4ZHRA

Structure of hiv-1 rt q151m mutant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the HIV-1 reverse transcriptase Q151M mutant: insights into the inhibitor resistance of HIV-1 reverse transcriptase and the structure of the nucleotide-binding pocket of Hepatitis B virus polymerase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords RT p66 subunit
total genus 143
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4zhrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4zhrA05
4KREA 4OLAA 4DS5A 2FJWA 3P83D 2HHVA 4DL7A 2E9ZA 1FK9A 1IM4A 4J9KA 4B9LA 4URSA 3AVNA 3PW2A 4TYAA 1YTUA 3MTKA 4HHTA 2G8UA 1UOCA 3KMQA 4K8XA 1KLMB 4RW9B 2HWHA 5KT4A 3DOKA 4K4YA 4C8OA 3V1QA 1RILA 4QCLA 1HQUA 1REVA 3IGNA 3KKRA 4ZTJA 4JV0A 2WRMA 5C25B 3V6JA 3CWJA 5KT5A 5J1EB 1JLFB 4DU4A 3CVKA 4IKAA 3L3VA 4O4RA 4QPXA 1RA6A 3K5LA 3AO5A 4NLGA 4M3WA 4ECSA 1RT6A 2GUIA 4CGIA 3CQ8A 1JLFA 1L3TA 2GV9A 4RW8B 3DRSB 1S6PA 1WAJA 3NAEA 2FJXA 5J2PB 5K14A 4B8AB 4RUAA 2B6AB 1J53A 4DFPA 2HMIA 3T1AA 3DRSA 1C0UA 3PW7A 3K5NA 2B6AA 3AO1A 2WK4A 4ELTA 3QEIA 3O3FA 2OPQA 1N48A 5KFMA 4MQ3A 4N47A 4GC7A 2I1RA 4R5PB 3G10A 3OL9A 4CCHA 1KCFA 2HWIA 4EYIB 3DRRB 1UWBB 2R2RA 1JXEA 3C6TA 4R8UB 4K4ZA 4DL4A 3KLIB 1TL3A 3P5JA 1X1PA 2YNIB 1NK5A 4DQPA 5C24A 1I39A 2ITGA 4QOZB 4C8MA 1C0UB 5KFGA 4URGA 4ED3A 3IRXB 4M3UA 4KO0B 5EWFA 4OVLA 3A2FA 4M3XA 3DYAA 1SKRA 3OYHA 1U04A 4B3OB 4CHQA 1L3SA 2JLEA 3H08A 1LWEB 2B43A 4Z4EA 1HPZA 4BDPA 3FSIA 1RT3B 4CGJA 2D0AA 2F8EX 3IG1A 1RT7A 3CDUA 4YP3A 4F4XA 4F4ZA 5KG6A 1JXBA 2AGPA 3QZ7A 2B4JA 3NHGA 4JV2A 3NH1A 2O4GA 4NLRA 4C8NA 3KLGA 4GC6A 2O4IA 2XC9A 1T8EA 5E41A 4ID5B 1SL2A 4O3NA 3FQKA 4WXWA 1WSGA 3AA4A 1S1TA 5KG1A 1JLCB 1BQNA 3BGRB 3RTVA 3ALYA 3FRZA 3UIQA 1LAWA 2FVCA 4X2BA 5HROB 1KSPA 3TAMA 5DQHA 3OLBA 2ATQA 3ZSZA 1GX5A 4YMEA 2LSNA 4NCAA 1JLGA 4NLPA 3JSMB 3LP3A 3F73A 3CG7A 1S0NA 5CZ2A 3K59A 4FCYA 1B9DA 2BDPA 3DRPA 4BE0A 4HUFA 4FK2A 4J9SA 3OS1A 2BQ3A 1XR6A 3V4IB 1BCOA 3QEVA 2UVUA 1RA7A 3MFHA 3I0SB 4FM1A 4DQIA 2F8SA 4CK2A 2R2UA 3IN5A 4M3RA 5HRNA 2QKBA 5DQGA 5FRMA 4TY8A 2RF2B 3V6KA 4FJJA 2FLPA 4CEFA 4ECXA 1TK5A 1D9DA 4FJ5A 3V4IA 1BI4B 4WFXA 4CEAA 1T05A 1TQLA 1LWFB 4NLYA 4ZMMA 1QS4A 3AA2A 4DL6A 1EP4B 3KHRA 3T3FA 5KFYA 3VQ6A 4IG3A 4FLZA 2Y1IA 4W5OA 1IKYB 3PVXA 1HMVA 2HMIB 1RAJA 1KRPA 1QE1A 3BSAA 3KJVB 4ZHRB 4MFBB 4O44B 3GV5B 5KFEA 1RT2A 4W5TA 2X78A 4DTMA 1DLOA 5DLGA 1BIZA 3HO1A 1Z25A 1FKOB 4FBTA 1NHVA 1RDDA 4FZYA 1EETB 2HW3A 3NBPA 3MXMA 2OZMA 3ZT2A 1S1UA 2VWKA 1DTQB 4OGCA 1RTHB 5KFKA 2HNDB 4KB0A 1IKXA 4DSKA 3V1RA 3KLFA 5EUHA 3OYMA 4TXSA 3MEGB 4FJXA 2ASDA 4ELUA 3OJSA 3DLGA 4DEZA 1RTDB 4ZHRA 4B9MA 2YNIA 1S97A 2XHBA 1LW0B 4ECRA 1VSEA 2RN2A 3UQSA 4FJGA 4CJ3A 3H98A 4AHTA 1K1QA 1D8YA 1EXQA 3ZSXA 3ZSOA 5KG4A 2YNHA 1TV6A 3IRXA 3DLKB 3D5MA 2D0CA 1D0EA 5F8GA 3DLRA 4F4WA 1ASUA 4MK9A 2HHUA 3LALA 5KFBA 4O0JA 3H5UA 3QGHA 3BSCA 3RB3A 2G8KA 2X6SA 2HHXA 4BACA 4BDYA 5HRSA 4EYHB 4ICLA 4AH9A 4RW4A 2J6SA 3SFGA 3PX6A 2HHSA 4Q8EA 4QWDA 2V4RA 1XHXA 3ZT4A 2XI3A 2FVSA 5KT7A 2DPJA 1Q8IA 1R0AA 5KFXA 5KFOA 4B3OA 2HHTA 1U4BA 4JRQA 4CJ5A 3DOLA 5C42A 3UR0A 4J9MA 3VN5A 4IR1A 3N6MA 3KK1A 2JEGA 3FFIB 4M41A 1X9MA 3QIOA 1ZBLA 4CEDA 3KD1E 1OS5A 4N5SA 4W5QA 1S4FA 3OL6A 4Z4CA 1NK9A 1QSSA 3RMCA 4KB7A 3PUFA 3EZ5A 2PY5A 3KHLA 1RBVA 2ZQBA 3VQ4A 1N5YB 4IBNA 4N56A 4ED0A 4TLRA 2GC8A 3O4NA 4NCBA 3TAPA 3V1OA 3L2VA 4FYDA 5DG8A 4FZZA 4O3SA 1JIHA 4KI6A 2RDJA 3AVMA 2AX0A 4NLWA 2RDIA 5KFTA 4DLGA 2JEJA 4G3IA 3TANA 3BSOA 4E7HA 1VSKA 2BE2A 4URQU 1JKHA 4HUGA 1NNDA 4KHRA 1TVRA 3NKYA 3HK2A 1XWLA 4KBIA 1WSHA 1N6QB 3MECB 2J6TA 2CKWA 3GIKA 3AVIA 1CXUA 2KW4A 5F8MA 4UQGA 3I5CA 4LH5A 2ASJA 4DQRA 3NGZA 3D28A 4DQSA 4RNOA 2IAJA 2E6LA 1S1WA 1ZETA 3OYIA 3OJUA 3QEWA 3H4BA 1LWFA 3DI6B 4DSFA 2GBZA 4RW7A 5C24B 3G6YA 5SWMA 3QNNA 3BREA 1IO2A 3AO4A 2XI2A 3OHBA 4RNNA 3S9HA 4CJVA 3L2QA 4NLQA 3KLVA 3TARA 4B9UA 4ZVEA 3C94A 2AX1A 2ALZA 1TGOA 2Y1JA 3RBDA 1LW0A 2PZSA 1I3AA 2BRKA 4EBDA 4ZVGA 4TN2A 1JX4A 4OKKA 4LQ3A 1I6JA 3K2PA 3LDSA 1SL1A 1RT1B 3E01B 2D41A 3MR5A 2W8KA 2UUTA 4HCBA 4MIBA 4DL5A 4E7IA 4F4KA 3QIPA 1VSHA 4DWIA 3HVRA 4CIFA 3M9MB 2IJFA 3SV4A 1RT4A 2FVPA 2C28A 4AILC 3SYZA 3RR8A 1JLQA 4MK8A 4RW4B 5KRSA 4ECQA 3BDPA 1WSIA 2V4QA 1ZBIA 2ZE2A 3QINA 4KV8A 2KFZA 4CHOA 2VG5B 4LD0A 4NCGB 4RUCA 4DU1A 4XO0A 3NF8A 3D0PA 4N76A 3TAEA 4AHRA 2AJQA 2G8FA 5I42A 4CHNA 4JV1A 1CXQA 1JL1A 3OYAA 1S1VA 4J9QA 4IFVA 1EX4A 4ZP8A 5KFAA 3ZSWA 4XPEA 2UVRA 4Z0UA 5KT3A 5L9XA 1SKWA 4Z4GA 1LW2A 2C22A 3B6PA 3OYGA 5DLFA 4CECA 3OS0A 4FW1A 4O4GA 4O0IA 4H54A 3HPOA 3I5BA 3V9ZA 2IC3A 4NRUA 3ITHB 1X9WA 4RNHA 3BQ1A 1VSLA 3CIZA 1YT3A 3DMJA 3PHEA 3DOLB 2OPPB 1ZTTA 2ZKUA 1RBTA 3UDLA 1N4LA 5EWGA 2IM2A 5JUMA 4KPYA 4F2RA 3JYTA 4B9VA 3LP1A 5DQIA 2WTFA 3KNAA 3LWLA 3MECA 4CGDA 3L8BA 4Y1DA 3C95A 4O4GB 4K4SA 3OVNA 3OYEA 2R8IA 1NK0A 2ZD1B 4NLSA 2R8KA 5HBMA 4G1QB 2E9TA 3PR5B 3NAIA 4FLXA 3ICLA 5FRNA 2WOMB 4ZPDA 3DLEB 3WNHA 2ETJA 4RNMA 4J2EA 4DQQA 2CJQA 4CF0A 4G1QA 3QO9A 3NF7A 2W7PA 2ILZA 1B92A 4CIEA 2F8TA 3HVAA 2OA8A 4GMJB 4Y2CA 3CM6A 1RTDA 5C5JA 1TAQA 3HHKA 3ASMA 4ELVA 3N6NA 2Z1HA 5KFPA 4J9NA 1WNSA 3KK2A 1TV6B 1U47A 4R0EA 4CJTA 5F8JA 5F8HA 2C2DA 1HYZA 4DTNA 4FJIA 2O5DA 1S49A 4WYLA 3CM5A 3PO5A 3V81A 4B08A 2FVRA 5KGXA 1UWBA 4Q5VA 1U48A 1QTMA 1VK0A 5SZTA 2VA3A 2YV0X 2G8HA 3NGYA 1TL3B 3QIPB 5T14A 4FW2A 4EO6A 3RAXA 5DG7A 3CFOA 3HPGA 5HP1B 3SQ4A 2HNYB 3QETA 5KG3A 5DK5A 3C6UA 4CF1A 1T03B 3HP9A 3CFPA 4Z4IA 2QE5A 5HROA 4KV8B 3T5LA 3QLHA 3GILA 3KK1B 4M95A 4PA1A 5KFSA 1KVAA 4FJMA 1LWEA 4OL8A 3ISNC 4FLYA 4F50A 2OYQA 4CHPA 1U45A 1NK4A 4DFJA 1RT4B 4I2PB 4K50A 4KAIA 3KHHA 4NRTA 4FK0A 3FDSA 3LP2A 1NKEA 2AWZA 2JEFA 3VQ5A 3WNFA 2XY6A 2BQRA 1T94A 2ZE2B 4CE9A 3M8PB 5KRTA 3O3HA 4QAGA 3NGDA 3LWMA 4DTOA 1RCHA 5DGBA 3M8PA 4E1MA 1UA0A 1IG9A 2BANA 1J54A 5JS1A 1S6QB 4F2SA 1IKWA 2DPIA 2OPRA 4Q45A 1TVRB 2A1RA 3KLEA 3AVHA 3OYFA 1ZTWA 2WHOA 2FBYA 1S9EA 1SH0A 3MXIA 2VWJA 3NE6A 2YNFA 1TKZA 1S9FA 4O3PA 1A5VA 3WNEA 2QKKA 3KD5E 2UVWA 1BCMA 3KLFB 4PWDB 2AQ4A 3HJFA 1S6PB 3Q8SB 3NL0A 4KHMA 4IKFA 1KVCA 1RT6B 2W9BA 3ZCMA 3DM2B 4J2AA 3C6TB 4XPCA 2Z1JA 2BGGA 5CZ1A 1YTAA 3AO3A 2XO7A 3QERA 3VQQA 1BIUA 2XCPA 2EC0A 1C1BB 4ZVHA 5KG0A 3KMSA 1HJRA 3QZ8A 3M8RA 5L1KA 5HLFB 1HRHA 3AVAA 4CJEA 3SPYA 4FBUA 1XI1A 2AGOA 3AV9A 3H5SA 3GV7B 2IAJB 1Z4UA 4E7LA 3LP0B 3P1GA 3PW0A 2HNZA 3AVCA 4AHSA 2IJNA 4K4WA 1GX6A 1BISA 2HHQA 1NJZA 1NJWA 5KFHA 2KZMA 4K8ZA 2VG7A 2VA2A 4AHVA 3T19A 1TKXB 3DLGB 2DFHA 3ZT0A 1FXXA 5KFNA 4DTSA 4QWEA 4DTUA 4CJFA 4F3TA 1BQMA 2D5RA 3KIOA 4ECZA 2R2TA 4ECTA 4CJWA 3SV3A 4OJRA 1S1XB 1XC9A 1FK9B 2XY5A 4EBCA 4Y2AA 2DFEA 2OZSA 4CJRA 4K4TA 3GV8B 5EDWA 1JLGB 1G15A 4QW9A 5J2MB 3RB4A 3HVTB 3M8QA 4FJ8A 5HP1A 5KFVA 4FM2A 4E1NA 2IGIA 3MR3A 1C2PA 2OH2A 3CO9A 4M3YA 3HVWA 3PJWA 4CGHA 5KFCA 4LQ9A 3QLHB 2R2SA 4FM0A 1LV5A 5J2NB 3SI8A 1S6QA 4KKOB 2AU0A 2BE2B 4B9NA 3G86A 4DG1B 3I5AA 4BE2A 1D1UA 1REVB 1HQUB 1HNVB 5J2QA 5KFFA 2XGPA 4RU9A 3RAQA 2KTQA 2FJVA 2X6NA 3V9UA 2WCXA 4FLTA 2UVVA 1JLBB 2X74A 1MU2B 1SKSA 1HQEB 5HBMB 3AVBA 2WONB 2WOMA 1RYRA 4HUEA 1S9EB 5D3GB 4DSJA 1MMLA 4CEZA 4KHUA 1RBRA 4CJSA 1MU2A 4DLEA 5J2NA 4IG0B 2OPPA 2HNDA 1QE1B 3TR8A 3TI0A 3KLIA 3D45A 3CJ5A 3V9WA 3MR6A 4W5NA 4K4XA 1SL0A 1YVFA 3OS2A 2OPQB 2W9CA 4CFBA 4M42A 4L8RB 3V6HA 1QSLA 4Z4FA 3Q8RB 2G8VA 1KTQA 1ZBUA 4DL3A 1WSEA 4TSXA 1DTQA 3OSNA 2F96A 1S48A 2P5OA 3ISND 2BRLA 3GIMA 4DMNA 2NUBA 2YKNA 3PY8A 1T3NA 5JS2A 1HPZB 4M45A 5F8NA 2I5JA 1FKPA 1RDAA 4IH5A 4F4YA 4FS2A 2G8IA 1RDBA 2KZZA 3QO9B 1BGXT 3L2RA 4CEEA 4WE1A 1WN7A 4EO8A 3Q8PB 3Q8QB 1TKXA 3RRHA 4DFKA 3C6UB 4JLHA 2VG7B 4CK3A 1K6YA 3IGVA 1B9FA 4IDKA 2YHAA 3NFAA 4KHSA 3DDKA 1KFDA 1HNIA 4ED8A 4KRFA 4I9QA 5KFDA 4K4VA 1UAXA 4YR2A 1U49A 4I7FB 1ZBFA 3HL8A 4FLVA 3HXMA 4JS4A 1VRUB 4Y1CA 3K58A 4NLVA 3GYNA 3DRPB 2RKIA 2FBTA 4IFYA 1N56A 2EHGA 1VRUA 4DTPA 1SUQA 4E7KA 4QWBA 1VSIA 1DTTA 3NGIA 5KFQA 2YHBA 2J6UA 3N6LA 2HVIA 3V6DB 3DLBA 2ILYA 3AVJA 3PZPA 4CF9A 4WYWA 4ZTFA 3LAKA 2BANB 4ID5A 4LH4A 1S1XA 4CHYA 1NOZA 1RYSA 3RMAA 3VQPA 1RT3A 4M3ZA 1IKVA 2W8LA 4NYNA 3TQ1A 1JLAB 2XGQA 1S9GB 4H4MA 1RDRA 2E9RX 4E89A 1JKHB 1NK7A 3OYDA 4KAZA 5KFIA 3VA0A 2IOCA 3K57A 1C6VA 4CGFA 1HQEA 1KLMA 4RW9A 3B6OA 5KG7A 1TL1B 2WONA 5DG9A 1QUVA 2QV6A 5HRRA 3OYLA 1KFSA 3RWUA 2IC3B 4OGEA 2BQUA 3S3MA 4KHNA 3IAYA 4RNFA 1GOAA 5F8IA 3OHAA 2P5GA 5CY4A 1LWCB 3H4DA 5C25A 2YKMA 4FJ9A 3KLHA 2IM0A 3MFIA 3DLHA 1QQCA 1VRTA 1HMVB 3EZUA 3SJJA 1TK0A 1C0TB 1VSFA 2DTUA 2FBXA 1WLJA 4B9SA 1TP7A 3OL8A 1C0TA 4HKQA 2W7OA 1JLEA 1KVBA 2XRIA 1FKOA 1RTIB 1SV5B 4E3SA 2QK9A 1N6QA 1F21A 2VG6B 3ZSVA 4J2DA 1S1WB 3RMDA 1GOBA 2GIRA 2YNHB 3VQCA 3PV8A 3U3GA 3AVKA 4RW6B 2GIQA 4LSNB 2HNZB 3VQAA 4N41A 4QWAA 4R5PA 3QGIA 1RBUA 4RW8A 3GIJA 1RT1A 4RW6A 1Z26A 5L1LA 4CFAA 4FLWA 2I5JB 3ZT1A 3H2LA 4U6PA 1W25A 4O5BA 4Z4HA 4KHWA 4R8UA 3T5HA 3SZ2A 2FLNA 3QNOA 1NKBA 4EBEA 4KO0A 1J5OA 3DLKA 3RRGA 2VG6A 3HP6A 3HYFA 3AVLA 1IH7A 3VQ9A 4CERA 2IMWP 2HB5A 3TAFA 4EZ6A 1QAJA 3SFUA 5DMRA 2IDOA 3VQ7A 4ECYA 2QXFA 4TQRA 2JC1A 4J2BA 3EYZA 5KTQA 3LP0A 3PW4A 3KOAA 1Y97A 3H5XA 3M8SA 4FXDA 5J2MA 2V9WA 4KTWA 3SI6A 3TAGA 1DTTB 4CJUA 2RPIA 4PQUA 1S0MA 4Q8FA 4CGGA 1RTJB 3BR9A 1CZ9A 1A5WA 4ZP9A 4CHZA 3S3OA 4H4OA 4KFBB 1W9HA 5L1IA 3LPTA 4IQXA 3KTQA 4EZ9A 5F9NA 1HYSA 4QW8A 4LY7A 3FFIA 4ED1A 1QAIA 3VQ8A 3U6FA 1KHWA 4DG1A 3HPHA 4C8LA 1YVUA 3BJYA 1JLAA 3MEEA 3L2UA 1J9AA 1JXLA 1RT7B 4E19A 4XIUA 1NK8A 1NKCA 3DOKB 4CEBA 1JLBA 3CJ2A 2Z1GA 3SUQA 4I2PA 3SQ0A 3OYJA 4CJKA 3ITHA 3OYBA 3LP2B 5KG5A 4IRKA 2YNFB 4OPKA 4WXOA 3V6DA 2FLLA 2IM3A 2ZD1A 2YNGB 3VA3A 2XWYA 1HYVA 5CYQB 4HCCA 4JUZA 3TABA 3MF5A 3HKWA 4MK7A 1L5UA 1BI4A 2D0BA 4DSIA 1ZYQA 2JC0A 4RW7B 4H4MB 3CJ3A 4KHQA 3H5YA 2OPRB 1IKWB 2IM1A 3QGGA 4ZPBA 3RBEA 1HNVA 3IS9A 3SUOA 1RT2B 4ZPCA 3E51A 1NJYA 4YR0A 3KKSA 3DLEA 1O1WA 4M3TA 1WAFA 2Z1IA 4BWMA 1S5JA 4TY8B 1CLQA 3QEPA 3NH2A 4KI4A 3O3GA 3NBPB 1Q9YA 4ZP6A 4YFUA 3AA5X 5KI6A 3OYNA 4OPJA 1EP4A 1ASWA 4LSNA 2DY4A 3VQSA 3HSTB 1IKXB 4DFMA 4CJPA 3KJVA 4YNQA 3LAMA 1KHVA 4IH7A 4FK4A 5CYMA 2EX3A 3IS9B 1SV5A 1J5OB 4AHUA 2W9CB 1DLOB 4NCGA 1NJXA 1WSJA 4Q0BA 1TK8A 1ASVA 3RB6A 2JEIA 1S0OA 5KFLA 4CF2A 1TAUA 1WSFA 3ZSQA 4CK1A 4FVMA 3HVTA 4J9RA 4BE1A 4TQSA 2VG5A 1NOYA 5DGAA 4DF4A 3KLGB 4CEQA 4BDZA 5I42B 1S1TB 1RT5A 2FC0A 3PW5A 3TWHA 1C1CB 4IFVB 3DMJB 5KG2A 4Q43A 4ECUA 3NDKA 4QWCA 3TAMB 2FBVA 3OY9A 1IKVB 3ZSYA 2R8JA 3SUPA 4O55A 3G6XA 4U7CA 4RG8A 3SCXA 3JSMA 4CJQA 4HTUA 4NYZA 4NYFA 4DS4A 2ASLA 1LAVA 3QYYA 2E4LA 4CFCA 1K1SA 3CJ4A 1RNHA 4FJNA 3I0SA 1N5YA 1A5XA 4H8KA 1QSYA 3H59A 4CEOA 1LWCA 3KLHB 2YKMB 4KFBA 5I3UB 3CYMA 1ZBHA 3CDWA 5C42B 3NAHA 3JYTB 4FLUA 4DL2A 2P51A 4KKOA 5K14B 4DTRA 1BHLA 4YR3A 4NLTA 3AO2A 4DSLA 1D9FA 4FZXC 3PJXA 1X9SA 2C2EA 4J9OA 4MKAA 2G8WA 4NLDA 4OKEA 2ATLA 4ZP7A 3PX4A 3BQ0A 4FS1A 2Q3SA 2JGUA 4IRDA 1TL1A 3MXJA 1XHZA 1S1UB 2W9BB 2OPSA 3NMAA 3DM2A 4I9LA 4ZVFA 1JL2A 5KFRA 2HHWA 4JRPA 4PWDA 1KLNA 3EPIA 4EP4A 4FJHA 2D3UA 4TY9A 5J2PA 1C1BA 3M9NB 5FROA 3SNNA 4J9LA 5EWEA 1XR7A 4IDKB 5HLFA 3OYKA 4O3OA 3O4QA 4WZMA 1JLEB 2HVHA 2R7YA 2BR0A 3NH0A 3V81B 2B5JA 3FQLA 3L3UA 3AVFA 5F9LA 2OPSB 3G6VA 3OL7A 4Y34A 3OLAA 4EEYA 4Q0BB 1EETA 2W42A 1FKPB 1C0MA 4BWJA 1RTHA 5KT6A 4KE5A 3THVA 1L3VA 4ICLB 2IBKA 3OSPA 3T5KA 1RTJA 2HAIA 4PQUB 5L1JA 2W9AA 4KSEB 4LSLB 1UA1A 3LPUA 5KFUA 5FDLB 1R0AB 4MIAA 2DFFA 4CJ4A 4DTXA 3GIIA 4I2QB 1C1CA 3ZSRA 2AGQA 4KTQA 2HNYA 3RB0A 2D3ZA 3NF9A 1HNIB 3VQEA 3MEEB 1VSDA 1D5AA 4PY5A 1T03A 1VSJA 3H40A 1GOCA 1S9GA 4MH8A 3MEDA 3CFRA 4I7FA 3SQ1A 2A1SA 5KT2A 5T7BA 4HYKA 3MEDB 1RDCA 3I8DA 1S10A 3VQBA 3CDEA 1LW2B 3QIDA 4IFYB 4E0DA 4DF8A 2RKIB 3LZJA 3M8QB 1SUQB 1QHTA 4NLOA 1TKZB 4OKJA 3G0ZA 2WB4A 3SQ2A 3AA3A 1VRTB 5KFJA 4DTJA 4HVJA 5F8LA 3SPZA 2PYLA 5HRPA 1JLCA 1S1VB 1BQNB 3BGRA 3KLEB 3AVGA 4DU3A 2R8HA 1IKYA 1W0HA 4J9PA 2R8GA 2FVQA 5KFZA 3EPGA 3NCIA 4IOBA 4W5RA 2V0NA 3NF6A 3RR7A 3S3NA 3PX0A 4ECVA 1RTIA 5J2QB 3KHGA 4C8KA 2PYJA 4AHCA 3K5MA 5J1EA 4IR9A 3SUNA 4E7JA 2KFNA 3MR2A 5KGWA 2D7SA 1VSMA 1Q9XA 4F3OA 4GW6A 4IG0A 5D3GA 4ZPAA 2C2RA 4WFZA 2YNGA 2YKNB 4YQWA 4TYBA 5CYQA 3BQ2A 3GQCA 4CFDA 5JXSA 4RZRA 1T05B 3T5JA 4IG3B 5CYMB 1EKEA 3LP1B 2E6MA 3EY1A 3I0RA 4ED7A 4O44A 1CSJA 1TKTB 3UPFA 4MFBA 2XY7A 1T7PA 4KHYA 3WNGA 4FJ7A 3KK3B 4MKBA 1BL3A 4ED2A 2B5JB 4ECWA 3ULDA 3PO4A 1HARA 2IA6A 3DRRA 3BSNA 3LANA 4WFYA 3VQDA 1BQMB 1U09A 3KK2B 4CESA 3KK3A 4EP5A 2XY8A 4Q44A 4GVMA 1SH2A 4WE1B 4K4UA 2UUWA 3DI6A 5KFWA 3RMBA 4KB1A 3V9XA 4FJKA 4Y3CA 1JLQB 4ID1A 2P1JA 3K5OA 4CF8A 4F8RA 3MEGA 1XR5A 2KQ2A 2XCAA 4PUOA 3ZT3A 5EU7A 3HM9A 4NZ0A 3I0RB 1WNEA 5FDLA 1RT5B 3DYAB 3OYCA 1TKTA 4DSEA 3M9OB 3CJ0A 1HYSB 3LZIA 1TKDA 4LSLA 4PUOB 4O3RA 1C1AA 3HT3A 3TVKA 4KTZA 4WZQA 1L3UA 1CZBA 1RBSA 1ITGA 2IS3A 4B8CA 3IG1B 4CJLA 1SH3A 3L2WA 4CIGA 4OLBA 3MAQA 4ED6A 4NLXA 4B9TA 3U3YA 3F9KA 3PR4A 3E01A 3V9SA 4IH6A 4O3QA 3QESA 4IRCA 3TAQA 4JS5A 1NHUA 4NLUA 4FJLA 4I2QA 5I3UA 4M94A 1NK6A 3QEXA 2RF2A 4H4OB
chains in the Genus database with same CATH superfamily
4OLAA 3THXB 4DS5A 3H0PA 3H7HB 1FJCA 1T6CA 3ENHA 1I5OB 1IBMJ 2PFDA 1MG7A 3KMQA 3F0NA 4RW9B 2HWHA 1J27A 1SJ4P 4K4YA 1IBKK 4CLUA 2QN6B 1HQUA 4O0NA 2RRBA 2WRMA 5C25B 3M6VA 5IXUA 5KT5A 3VTHA 3CVKA 4F0HA 5DDOC 1RK8A 2JSXA 3H3OB 3MD1A 1RT6A 3VF4A 3HFVA 3O1BA 2HVDA 3T1HF 3WT0A 2GV9A 4CDIA 3BGFA 3DRSB 4KGKA 5K14A 1ZOTA 4RUAA 4QYZJ 1J53A 4F26A 2AF6A 1YIJN 3O3LA 5D4LA 2IJRA 1NGEA 4WP8A 1PGZA 3PW7A 2VDIA 3A5OC 3ZTRA 4DQ8A 2WK4A 4HLBA 3QEIA 4RPFA 4MQ3A 1FXDA 4QU7A 5A0YA 3OL9A 2ZKTA 4DKWA 4XK8C 1KCFA 3KG1A 1HQ2A 4EYIB 1CQNA 1CEZA 3C6TA 2K7JA 5JVGL 3Q0AA 4KR0B 2YNIB 1R8PA 1FFWB 3DRXA 1RZMA 3KJQB 4QOZB 4LIWA 2LFVA 2OEMA 1UWAA 2P9KA 5JLFA 2P9IB 2BABA 1JXVA 4OVLA 3TQEA 2VODA 1U04A 5G0RB 1L3SA 2Y0SD 3O44A 4JI4F 3H08A 4IOCL 2B43A 5IT0A 4BDPA 3FSIA 1FFGB 4JK8A 2F8EX 4G6VB 2OANA 4YP3A 4F4ZA 2FXUA 1YVNA 2YHXA 3PHTA 2J7KA 3JXUA 5M1OA 4UOFA 3QZ7A 1EWQA 1EHWA 4GO7X 4A8YA 1NAQA 5FLXU 4DCHA 2J4RA 4FWPA 4GC6A 1SL2A 2Q66A 3I32A 1APSA 1WUAA 1WSGA 1JLCB 2MZRA 2VGNA 2GGPA 4LRBA 1U0HB 1V5IB 2FVCA 3A3NB 5HROB 2M4MA 2PFUA 3NCRA 2ATQA 4NCAA 1JLGA 4FPAA 3K59A 2LXUA 2KXHA 3AB4B 2GA7A 3DRPA 4J9SA 1RGVA 3C14A 3V4IB 2QLWA 4K59A 1RA7A 1U7LA 3FLCO 3I0SB 5LM7E 4CK2A 3IN5A 2H65B 5FRMA 2OHDA 1TUYA 4FJJA 2Z2YB 1TK5A 3TUPA 2HRTA 4WFXA 2E44A 3ZZ0A 5HSPA 4DX5A 1RAEB 2DGSA 1KNZA 4CZGA 3JSYA 5KFYA 4FLZA 3WQPA 1OKJA 4JI3K 1BG3A 3NCPA 3KJVB 3DDIA 3R2CJ 2K1RA 3GV5B 2VUGA 3D6HB 1RT2A 4HHJA 3A3OB 3C46A 1DLOA 3HO1A 2VJUA 1Z25A 1RDDA 2ABYA 4FZYA 1H6KX 2HW3A 2OZMA 3ZT2A 1S1UA 2KRRA 2VWKA 1F5CA 5D4PA 5ETOA 3BGOP 5EUHA 4TXSA 4F9OA 4FJXA 2GVDB 4K42A 1WKJA 2B4OA 1VHXA 2NNWA 2UUBF 3MM9A 1BQXA 3VGTA 2YNIA 1S97A 1D3WA 1LW0B 1EQMA 1WHYA 1VSEA 3UQSA 2GJIA 4FOEA 3H98A 2HZVA 1RLCL 3GE1A 3ILIA 1EXQA 3ZSOA 4B3SJ 1PG5B 3TA0A 1U1RA 3EKUA 4USUA 1YHQS 2PEHA 5F8GA 1WTFA 4M63C 5AQIA 1VS3A 3LALA 3BBCA 3CJSA 3VEXA 3H5UA 3RBXA 1XNQJ 4BDYA 4GNIA 5HRSA 4ICLA 5BYRA 2Y0BB 3PX6A 2V4RA 1XHXA 3ZT4A 1ZA1B 4MLEA 3TZZA 5LXRA 4LVNP 1WC6A 3DOLA 3ZEUB 2L48A 2PE8A 4J9MA 3VN5A 4LF5K 4FP9A 1D8ZA 3KK1A 3QB0A 2F9WA 4BR7A 1KQFB 2LCWA 3FEXB 2O8FB 3M05A 4ID8A 3KD1E 2J8SA 3UCGA 1KVIA 2HSTA 5LMNJ 2BUPA 2X1AA 4DV7J 3R5CA 3DWLA 4NCBA 3O4NA 1UFKA 3AD9C 2N3OA 5DG8A 3VVTA 3MUTP 2KFYA 1GLBG 1GEHA 2IMOA 1VMBA 2JEJA 1NGJA 3TANA 4HUGA 1NNDA 4KHRA 1TVRA 4PYDA 3NKYA 3HK2A 4J9VA 2B9YA 1XWLA 1FJGK 4KBIA 3ULEB 3CCUN 9ATCB 1WSHA 3MECB 2BMBA 3CMES 5HQLA 4LFAK 1J6ZA 3I55S 2Q79A 2R3VA 3AVIA 4AYBD 2J76E 1NWKA 2KW4A 3OTOF 2WFBA 4Z37A 2FGCA 3I5CA 4UQGA 5A8RA 2CWXA 4DQRA 3NGZA 6FD1A 2G9OA 3MOJB 3OJUA 2A6OA 3WQUA 1LWFA 3DI6B 5HANA 4KJIA 3ZZYA 2QFJA 5B0CA 3G6YA 5SWMA 1IO2A 3AO4A 1CJVA 1SQFA 3EKSA 1SC4B 4OYOA 1OSDA 1BA1A 4ZVEA 3C94A 4X64F 5HJXA 4WK3A 2AX1A 2ALZA 2RS8A 3RBDA 2PZSA 3CB4A 4ZVGA 4HHUA 1JX4A 1FRIA 2R7SA 1I6JA 1BHNA 3VAKA 1WC5A 4WJBA 4P2SA 3MR5A 2W8KA 4DL5A 4DWIA 3R7NB 1DRZA 4CIFA 2IJFA 3SV4A 2O8DA 2FVPA 2C28A 2HQ3A 3ZZUA 3H42A 3FGVA 1JLQA 3HHLC 4EMDA 2NZTA 2W40A 5KRSA 1CJUA 3VV2B 3M8ZA 3CCJS 4YEAA 4RUCA 2VGMA 4XO0A 1X4HA 1YXQA 1EQ0A 2J8AA 1IBCB 2NUHA 1RP5A 4JV1A 2CPEA 4K0KF 2J5AA 1JL1A 5B8HA 2FF6A 3FBFA 5KFAA 3ZSWA 4KH5A 4UY8O 2M70A 1N8RT 4Z4GA 1LW2A 3B6PA 1VQ4N 2FJDB 3CMAS 3MM5B 2O01C 5DLFA 3I5BA 3W66A 2H9ZA 4JKEA 3I56S 2DHSA 4RNHA 2ZITA 1JNZB 1T02A 3P3DA 4OX9J 1TL7A 4L73A 5CR4A 3CD5A 5EWGA 2A1BA 2XMVA 5ETMA 2E5GA 1FX4A 2W2QP 2IRXA 2E1AA 4CP5A 1AB8A 3R7BB 3SSSA 4ER8A 4OHWA 1LFPA 5IWAJ 3OYEA 4ETXA 1N34K 4AL7A 3AOAA 4YY3J 2B7BB 1XC3A 3DLEB 1TTHB 1PILA 1QTNB 3IR7B 5M1QA 2MDAA 4J2EA 3VGMA 4DQQA 2CVEA 4HH1A 2XSJA 2CPJA 2AT1B 5ETVA 1JJ4A 3PSFA 1NMDA 1B92A 1FFSB 2F40A 1VJQA 3SCJE 3CM6A 3MI7X 1RCXB 4OX6A 1TAQA 4N77A 1KOOA 1HHQA 2E20A 2EW9A 1Q82T 2Z1HA 3D2EB 3KK2A 5JJBA 1RTZA 4CJTA 3SDEB 4USMA 5F8HA 4DN9A 5GADU 2CG4A 1RBLA 4IOAQ 3M6WA 5D6GA 3V81A 4X65F 2FZGB 1K8AT 2AMCB 4JI3F 3SCKE 4DX7A 3NGYA 4Q2LA 1CG2A 4NXMF 4EO6A 3R1XA 4FW2A 3RAXA 2O66A 3SQ4A 3TZXA 3QETA 2E1ZA 4YOEA 1S72N 5LMNF 2GZOA 3CJRA 3QLHA 4IOCQ 3KK1B 4FVUA 4UUWA 4PG7A 5KFSA 4DR6F 3VAFA 1UVLA 3ISNC 1RAAB 4F50A 2OYQA 3FR0A 1SXLA 3J80O 2O8FA 4YHHF 2V7YA 1NK4A 4DFJA 2G2YA 2QLJB 4K50A 3CC4N 4USHA 1Q16B 3KHHA 3GZ7A 1N32J 5JVHL 1ULRA 3HX9A 1GLCG 2ZH7A 4DR1K 3VQ5A 2XY6A 2HIYA 1OVQA 1SQKA 1T3OA 2VB6A 2C42A 2R42A 4X4UA 5BRFA 1FDAA 4WCEL 2DNOA 3O3HA 3D6TB 3NGDA 2HBLA 3LWMA 4QIEA 3D67A 1VQOS 2BANA 5JS1A 2VQEF 3R5AA 2BJDA 3U02A 3S01A 1VQ7S 3OFHA 1IKWA 1MNEA 2RDDA 4Q45A 2FQQB 2MGZA 3AGRA 2A1RA 3IWXA 2P9UB 1S79A 2WB1D 4HACA 4L74A 3KLEA 3AVHA 3OYFA 4JV5F 4DV4J 1S72S 2X1FA 4MYTA 3MMBB 1NPKA 2YNFA 3WNEA 3T1YJ 3C19A 1PBAA 1V4SA 3GIRA 3KLFB 4PWDB 4KHMA 4IKFA 3M2VB 5EGYA 1KVCA 2NRTA 3MZIA 4J2AA 3X1LB 1X7VA 3G82B 3UR3C 3I31A 5AQMA 2JRSA 2CXEA 1YTAA 2RS2A 1U24A 2BUNA 1BIUA 2XCPA 3O9TA 4C3MA 1CLFA 1XMQF 2EC0A 2AP1A 2VBXA 3H6EA 4ZVHA 1DEJA 3ZETA 5L1KA 1VISA 4DV7F 3AVAA 3SPYA 3J7AN 3BN4A 1XI1A 4CT8A 4BR2A 3H5SA 3VZHA 2Q3PA 4YB7A 3ZO7A 3QAUA 2XBPA 3PW0A 2HNZA 3TSQA 3MEKA 1HNWK 5CHCB 3DXMB 2CNKB 5EXWA 4K8ZA 2KJWA 5KAKA 3K2YA 4UOGA 3GU0A 2UV8G 3QNWB 3Q83A 4FF2A 1Y3JA 3M8YA 2Q97A 3HULA 4DTSA 2B3TB 4JI0K 3MPUB 2XNRA 2D5RA 3J7ZT 3BEGB 1R8HA 5HVFA 1RE1B 2QT7A 5AQVA 1FK9B 2XY5A 3N5BA 3J7Z5 3U1LA 4UY8T 2DFEA 4Y2MA 4CJRA 3A3PB 3GV8B 3CNQP 3M32A 1JCEA 1G15A 4FOIA 4U8VA 3J80Y 3O5BA 5J2MB 1Q1KA 4KGXB 1H2VZ 3MUMP 4FM2A 2F63A 5DETA 2IGIA 1VQNN 1GTEA 1C2PA 4NEYA 1KP6A 1MA9B 2ZM6K 2OH2A 4OZ0A 3HVWA 3QLHB 4W98A 4FM0A 1PSDA 1LV5A 1VDHA 1S6QA 4ES2A 2VONA 1XMOK 3A1YG 4B9NA 2ZH1A 3GSDA 4DOZA 3OUYA 3FRYA 1HQUB 4ZCMA 5KFFA 2HFNA 4MLHA 2WCXA 4FLTA 2J9CA 2X1GA 4AF1A 2OMOA 1MU2B 3GJQB 1HQEB 1P9QC 3TZWA 2WOMA 1OYDA 1S9EB 5D3GB 1MMLA 1S77D 4Y2IA 1HX1A 3MURP 3LM9A 2ZH6A 4IG0B 2DNMA 1HBUB 5THWA 3TI0A 3CJ5A 1E4GT 2NZCA 3MR6A 3ET6B 4LMZA 1SL0A 1YVFA 1NPRA 2W9CA 4JKAA 3PYFA 1RXOB 1F9EB 2HHPA 2HQFA 5CD4H 1ZBUA 1DTQA 2C2KB 2VFVA 3ISND 2BRLA 4CBUA 2YKNA 1T3NA 2CWKA 4M45A 2IVPA 1FKPA 1G2EA 1H2UX 1HBMB 4FS2A 4OYPA 1RDBA 1OJ4A 5AFUH 3KDNA 1NB2A 4EO8A 1UCNA 4WBFA 3RRHA 3OA9A 3KJFB 4CQ1A 4JLHA 1MSWD 1ZC6A 4OFZA 1WKKA 3VGSA 1B9FA 1NUEA 4E1JA 2WSFC 1KFDA 3M30B 4ED8A 4KRFA 5KFDA 2MKSA 3CCZA 1UAXA 1KC8O 4YR2A 3QPIA 1SAZA 1U49A 1FX2A 1NHKL 1RWNB 2NQPA 3EE9A 1DARA 1V3SA 1ZBFA 3HL8A 4FLVA 4JS4A 3Q24A 1VRUB 4ZPTR 4Y1CA 2FIUA 3PTWA 3K58A 1X9JA 3GYNA 3DRPB 2RKIA 3BO4A 1I94J 4DTPA 1SUQA 4EK2A 1UAWA 1DTTA 1GXLA 3THTA 5KFQA 5IZHA 3N6LA 1ZM2A 2NUUG 4X66J 3ZC4A 1TU0B 4TU8A 3RSEA 3T1YK 1BUXA 4WYWA 2D69A 4LBHA 4LH4A 4C2MA 3PCOB 1S1XA 2LEAA 2YI1A 4ETZA 4OX8A 1RYSA 2OSQA 3MN7A 1RT3A 4LIRA 4NYNA 5BYQA 4BQZA 2DCLA 2PGCA 1S9GB 4H4MA 5HMWA 1FT8A 4BRLA 2YBVA 3OYDA 3MMBA 1VAZA 2ZM6F 1YRUA 4X66K 2HSEB 1TL1B 5DG9A 1QUVA 2QV6A 5HRRA 2BQUA 1HKAA 4JI0J 4RNFA 1LWCB 5FJ4A 1TUWA 3MFIA 3DLHA 3CTRA 3D7EO 2KKZA 3W2WB 2RU9A 1FNXH 5KOWA 1F6TA 2GO9A 3OXLA 4CZKA 2K3KA 3OL8A 1LWXA 1C0TA 5A8WA 4HKQA 2MSSA 3HHDA 2DXEA 5IC6B 1FKOA 1RTIB 1H72C 2MZ1A 4J2DA 4GVBA 1S1WB 2ZHAA 2EC2A 5I4MA 2GIQA 4M63A 1RWWB 4Y0FA 2HNZB 4N41A 5A0YB 4RW8A 1QQNA 3HT0A 2RRNA 4U7BA 3MWPA 1RT1A 4RW6A 5L1LA 4OHXA 4I1TA 3NVMA 5IWAF 3GFZA 5D0HA 2XM3A 3H2LA 4U6PA 4CO3A 1S76D 4JV5K 5BR8J 2YKPA 1KQGB 4ZN3A 1VCTA 3SZ2A 2FLNA 3QNOA 4DV7K 4FPIA 4EBEA 2HK2A 2XMWA 1J5OA 1N5QA 3RRGA 2VG6A 3JSRA 3D2EA 4U96A 4K43A 5U47A 3AVLA 1IH7A 2QWLA 2JH3A 4BC7A 3GCXP 3TAFA 4C11B 4CH1A 2EFVA 2F8HA 2CPZA 4CBWA 5CCMA 2IDOA 3NGRA 2JC1A 3KOAA 2VPWB 1Q95G 2XZTB 3H5XA 5J2MA 4KIAA 2ZJQQ 1K0TA 1F2GA 3F44A 2RPIA 3BB5A 3OFEA 4PQUA 5E5NA 1VQMN 2E1CA 1CZ9A 2DEJA 4ZP9A 4DV2J 2K8GA 1ATRA 1XUPO 3LPTA 3Q23A 5GAGU 1DBDA 1QAIA 3O8MA 1KHWA 3NMRA 1PYTA 2DIUA 2ZC4A 3AJ2A 3BJYA 1YKWA 3L2UA 3EUNA 1JXLA 4E19A 2AJ0A 2XQCA 2A3ZA 1FESA 3UKUB 3DOKB 4X4TA 1JLBA 2Z1GA 2E7VA 4JI8J 3BZQA 2RB7A 2HK3A 4CJKA 4LF8J 3IFRA 2HS4A 3V6DA 1WF0A 4O8UA 4DR3F 4OYXA 2MZJA 3D2WA 3TX8A 4C0OC 3DLJA 2PFFB 3NOCA 4CLWA 1N54B 2DNGA 3TABA 4NOHA 4OHYA 4YHHK 3GFXA 2GWJA 2WBMA 2BX6A 4DR1J 4OMFG 3L6QA 2DRDA 2MSTA 3H5YA 2IM1A 1I94K 3SMSA 4I69A 1HNVA 3SUOA 1ZXOA 1WTBA 1JNRB 1K47A 3E51A 1VK8A 1XQSC 3WXJA 2QA4N 1CLQA 5T41A 3NH2A 3QEPA 5GIPA 3NBPB 4FDFA 3D1HA 4ZP6A 3VCDA 4ZIWA 1GXTA 1HL6A 1VLOA 2FC9A 1NDLA 2POKA 5M1KA 2JWNA 3F5TA 5CE3A 1ASWA 1AROP 2E66A 3J81U 1HWKA 3CJ7A 2XEXA 3TP2A 3OV7A 2HAFA 3KJVA 3QFWA 2OIHA 5AQKA 4HTJA 2X7IA 1Q78A 1WDDA 4DJBA 4LFCF 2RU3A 2RNEA 1H73A 4CO2A 1DAXA 2V4JA 4EUVA 3JTNA 2DGXA 2RRAA 1S0OA 2MZSA 3IC1A 5E3AA 4XAKA 3HVTA 4J9RA 5J1PA 1NBWA 4NLBA 4B1VA 1F3VA 3U1MA 1BO5O 1NOYA 3OW2R 3NGKA 4DF4A 2LXIA 1AFIA 3V5RA 3POTB 2M3DA 4RBUA 5I42B 3TWHA 1C1CB 4WTYA 4KH4A 3B8AX 5KG2A 2A41A 3NDKA 1GNKA 2O8CA 2AV5A 2FBVA 2ASPA 2V6AA 3OY9A 2R8JA 1ATSA 3G9CA 4RG8A 3JSMA 4L72B 3QT7A 2KG0A 1URNA 4NPOA 1Y5IB 5D15A 3I87A 2WAQD 1X0PA 5D0GA 4BRHA 1A0OB 3ZNUA 4DV1F 1RNHA 3H1QA 1VQPS 4H8KA 1D9AA 4CEOA 2MQOA 3KLHB 1XJWB 3KWMA 2RHQB 3J7YI 3ZTQA 5AJ3F 3OVAA 4PXEA 3VVUA 4DTRA 4DV0F 1Z2ZA 3RJMB 3J7ZO 1LK5A 1QZ5A 2V63A 2C2EA 4J9OA 2F7TA 3CC7S 4OKEA 4BCAA 2UXCK 1FRKA 4FS1A 5ETTA 2Q6CA 1V4TA 1H74A 3PNIA 5LJVA 1XHZA 2W9BB 3NMAA 2P9NB 4I9LA 5A6PA 2DTJA 4GY2B 2HHWA 5DM7L 4JRPA 4PWDA 3R2DJ 3WX8A 3TWZA 3EPIA 2Q36A 4ZOSA 4NASA 4JHDA 3QGPA 2XTJP 2CQPA 4DPOA 4TY9A 3VEOA 2HEKA 2N7YA 4B3TK 3ULEA 4WQ5C 4HTIA 1UZDA 3O4QA 2BXJA 1HNZF 4WZMA 4JI1J 2R7YA 3WQTA 4FPRA 1N32F 1Y0HA 3W61A 3AVFA 2P9GA 2GS8A 4YHHJ 2UXCF 3OLAA 2L9WA 1FJGJ 3SLCA 1DHMA 3BKTA 1FKPB 2HQIA 4BWJA 2R9LA 2ZH3A 1NDCA 2KI2A 3G87A 4ZJLA 2ROEA 4WIIA 1L3VA 4ICLB 2P9PA 3T5KA 2HRUA 2HAIA 4PQUB 4I0WA 1GLJO 4F36A 5L1JA 4LF6F 1UVIA 3P49B 5KFUA 3FZHA 4CJ4A 2YX1A 2ALYB 2J0WA 4DTXA 3GIIA 3ZSRA 3SIPB 3S7RA 1MROA 1HNIB 2QG9B 1D5AA 5BYSA 3SXLA 2GMJA 4L75A 4M7XA 3WXMB 1I3OB 3BF4A 2A3JA 2A1SA 1FWKA 2C2ZB 3FBEA 3G25A 1HR0F 2NYIA 5IOLA 3HDSA 1LW2B 1NU0A 4IFYB 4F4AA 3MPWA 4OHVA 2HIQA 4BRQA 1FNMA 2WB4A 3SQ2A 1Y10A 3D4JA 3MN5A 5KFJA 2QW9A 4DTJA 2ZJPQ 4U7UD 3HRGA 2MZTA 4L3QA 1BQNB 1W0HA 3W64A 3TZYA 4F3QA 2V0NA 3RR7A 3NF6A 3S3NA 5J2QB 4C8KA 2PYJA 4WYBA 2P9CA 3SUNA 5I3QA 1X8DA 2D7SA 4W90B 5DDRC 1Q9XA 4LFCK 2DK2A 5D3GA 2C2RA 1TL7B 4OYMA 4WFZA 2YX4A 1S7IA 4A2AA 3LDQA 5IV3A 2WVCA 3F9MA 3BEXA 3LP1B 1KWMA 3PEJA 2E6MA 1R43A 4PPZA 3EY1A 3W1YC 1HBNA 1URRA 3R3LA 4OX9K 3X3UA 1WELA 1TUUA 2GVZB 1T7PA 4KHYA 4FJ7A 1T0TV 3H46O 3OR2A 1SIZA 4ED2A 2Y8YA 4OI0A 2IA0A 4NXMJ 3ULDA 1UVNA 3DRRA 3LANA 1BQMB 4G1PA 1U09A 3KK2B 3ONQA 2VPZB 2AZ1A 4WE1B 1O6XA 4K4UA 1NSQA 2C2MB 3HSJA 3B82A 3DI6A 5KFWA 4B1YB 4CI0B 3CCQN 3OQ2A 4PXCA 4Y3CA 4CF8A 3IAS9 2L9NA 1E6VA 2XCAA 5FDLA 3QMQA 3OYCA 5ETRA 2LECA 1PJ7A 3L09A 1TKDA 2D1KA 1NJIT 3CJ1A 3NMUA 5H1SV 3T9NA 4KTZA 1CZBA 4DR5K 1N0UA 1ITGA 4B8CA 3IG1B 2RJZA 1JK9B 5K9FA 3N79A 5LMUJ 2I7NA 4B9TA 3PM9A 4PKIA 2BKOA 3UDCA 3W8GA 3B4MA 4QIWD 1S6OA 5JVHQ 3PR4A 1YJNN 3NGUA 2BBEA 1XNRJ 4IRCA 4EI2A 1E6YB 1IN0A 2DHAA 2CA9A 5HK4A 3R1LA 2EWHA 1RKIA 1JJCB 1VC0A 1EZZB 3UVJA 3TU5A 3CCWA 2CZ4A 2LQ9A 4I6AA 4DR5J 4JI4K 2RF2A 4H4OB 5B08A 4KREA 1SQGA 2HURA 3N9UC 1RHRB 3BKFA 2PEBA 1HWIA 2AYGA 2HHVA 1IM4A 3HI0A 3CCRS 3MCMA 3AVNA 4TYAA 4HHTA 4G65A 4NWBA 4K8XA 2D3OR 4BC3A 2QTWA 1UL3A 3GOIA 4IJNA 3DOMB 1YSJA 4A8SA 4ZTJA 4JV0A 2YKAA 2VFRA 4CZMA 3W5ZA 4CNYA 4O4RA 1YF5L 3K5LA 3AO5A 4NLGA 2HLTA 5IM0A 3TJAA 2Y1RI 2YCHA 1UVKA 3VGUA 3OTCA 2MPUA 3UKRA 1QVGM 3UD4P 2WZ1A 7AT1B 1S6PA 5AE2A 4WFNQ 1N52B 4DFPA 3RGIA 4A57A 1RWVB 1OY9A 5A8WB 1X4GA 3K5NA 2CRLA 3AO1A 4DUTA 4ELTA 3O3FA 2HGLA 2OPQA 2VFUA 1U6BA 1OMSA 5KFMA 3P5BP 3CJTA 1P8ZA 4JI7F 1NNEA 2CJ9A 3NCQA 1WI6A 5C2GA 4JI6K 4JI2J 1AXQA 2KHCA 1JXEA 3GP9A 3TVZA 4R8UB 1G99A 2O8BA 2J7UA 4I64A 1W97L 1IBKF 1X1PA 3EO3A 5MAOA 2ITGA 3AY9A 3DC2A 2CDRB 2QWPA 4C6AA 2C1EB 2V7ZA 2ZH2A 1FXLA 3SK3A 4QOTA 4URGA 4OPAA 4ED3A 1Y9OA 4M3UA 4KO0B 5EWFA 2P2CB 2BJ7A 3DYAA 4WFBL 4X62F 4B3OB 5E7OB 4CHQA 4RUBA 2JLEA 3BF1A 1HPZA 2ZBQA 3PACA 3IG1A 2IFXA 5KPTA 3EZOA 3G71N 4F4XA 2RQMA 4PG8A 3KWGA 2B0GA 5KG6A 2CDQA 3UDEA 4FWKA 2B4JA 5AQNA 3NH1A 3R5GA 3T1YF 3MOZA 3ENAA 3GONA 3KLGA 2O4IA 2JVOA 2B56A 4AM6A 2GQ2A 4BVPA 4O3NA 3AA4A 1BD6A 1S1TA 3RTVA 3FEYB 2E5LF 4PG6A 2D74B 1NG9A 1WHXA 1RAHB 3TAMA 5DQHA 4FF4A 3ZSZA 3HHNB 1GX5A 4BHQA 3M32B 1S0NA 1AYEA 2HFZA 4NE9C 1W2IA 2OTLN 1E6YA 4LF4J 1FW6A 1KQKA 2OFGX 3KHYA 3W8PA 1N33F 3O9SA 2BQ3A 1XR6A 4ZLNA 2UVUA 3KG0A 4DQIA 2R2UA 1VBZA 5HRNA 1ZZNA 2LDIA 2UZAA 2FLPA 2DIVA 1RLDA 4CNZA 3V4IA 2CNNB 4KBOA 2FDNA 2EG1A 4DPYA 4NLYA 3OR1B 3AA2A 3AODA 4DL6A 3VQ6A 4W5OA 3CCSS 4WKRA 5E33A 4ZHRB 4H0PA 1QVGR 4O44B 1KVJA 3CI5A 3J7YP 3THYA 3PG9A 1BIZA 4QJVA 4RCHA 3ZFVA 4PKGA 4C3LA 1VQ9N 4DR7J 3NBPA 4NLCA 1RTHB 1EKRA 1IKXA 4DSKA 1HBUA 3SQGA 3KLFA 3MDQA 4JKFA 3MEGB 4FVCA 3THPA 4X62K 4LF8K 1WEXA 3G82A 4NEZA 2AKWB 4EHUA 2WVEA 4P6QA 4CLPA 4B9MA 3CCUS 4JI1F 3H8YA 4TNOA 4AHTA 1D8YA 2VJVA 2I8EA 4F67A 1IJEB 1R6YA 2YNHA 5G0RA 3IRXA 2R4FA 2XG8A 3DLKB 2KB2A 2DNYA 1NZ8A 1ROFA 4TU9A 1RWXB 1RWUA 4MK9A 2HHUA 3ATVA 3MM6B 4B3TJ 2O8BB 2O8DB 1P1TA 3PLAA 4AH9A 2XMTA 3EGWB 4H5RA 4XH1A 3VGVA 2HHSA 1UKUA 3E9PA 4ALZA 2QWQA 1IBLK 2FVSA 2DPJA 4OJ1A 2PSZA 3PYDA 1R0AA 5KFXA 2JOQA 1LOTB 4JYAJ 4IO9Q 3BKUA 1U4BA 2KT3A 4CJ5A 1NZAA 1JWWA 3CCEN 4EWTA 3MD3A 5IT9U 4M5MA 2UXBK 5IQQA 2LA6A 4M41A 3PYGA 2ACYA 3TUZC 3TPQA 3QIOA 3IWNC 3GDQA 2NCKL 1WACA 1OS5A 4N5SA 3FK4A 5AFUA 2P9EA 3L7OA 3KHLA 1RBVA 1N5YB 4H0TB 4JI6F 4IBNA 1T44A 4XEIA 4TLRA 4CH7A 2RUGA 3BV8A 4JI7K 1EIYB 2HHHJ 1K8KA 4O3SA 2RDJA 1AUDA 4AXIA 3AVMA 2QJ3A 4NLWA 5KFTA 2V8HA 2Z8QA 2GJ2A 2BE2A 4URQU 4OYZA 3ADAC 4IQMA 5DM6L 3ULHA 3EVMA 2NZ4A 1NSPA 1KR4A 2ZDPA 3BYRA 4DQSA 2NXUA 2E6LA 4BRAA 3TYTA 4GV9A 3OYIA 1O5JA 4JI5J 4RR5A 2GBZA 5F2RA 2B9EA 5C24B 1M5VC 4BR9A 2D1CA 2XI2A 2A5XA 2EXUA 1PO6A 4CJVA 4RO0A 3SQOP 3M8WA 1BXNA 2CG8A 3Q8UA 1LXJA 2VD3A 2VFTA 1TGOA 2P5VA 5HL7L 3OPKA 3H2UB 1ZAWA 4IEIA 4I68A 2BRKA 3I56N 4OKKA 4LQ3A 4PRFA 4DR6K 2F9TA 2ASYA 2EFPA 1SL1A 1FDBA 3UB5A 1RT1B 2D41A 4OLOA 1Y11A 1HNXK 3QIPA 1VSHA 3M9MB 2ZEJA 3M2RA 3RR8A 1H98A 4PXDA 1VR6A 3QFPA 1FD2A 4D3GA 3TSUA 3QINA 2LXFA 4CHOA 4UT4A 1YRXA 3TTDA 4RUHA 1YJVA 3NF8A 4DR5F 5K8PA 2DEIA 3LQVA 3TAEA 2AJQA 3MM8A 3N5FA 2QL7B 2G8FA 2F4VK 2DR8A 4DR1F 3OYAA 4XDDA 1S1VA 2Q31A 1EX4A 2JWLA 3NS7B 1FA0A 2PMHA 1UPMB 1O51A 3C66A 2NSBA 1SKWA 3OYGA 1UEKA 4AT1B 4LC9B 4CECA 4N8NA 2I9SA 3CSKA 1RHMB 1F5BA 2ZNZA 1VOMA 4FYWB 3ITHB 4UTGA 4FWRA 3L4IA 3MCSA 3CCTA 5HI7A 5GIOA 1VSLA 2F4VJ 1YT3A 3PHEA 2OPPB 4A5AA 3TEGA 1NM1A 4ITSA 1G1XA 1N4LA 1TUGB 5RUBA 1DJ0A 3T6JA 3JYTA 4B9VA 4K7QA 1Q5YA 2HBYB 2B4PA 5DQIA 4OYBA 4KH6A 3KNAA 3LWLA 3MECA 4HR2A 3E8OA 5F41A 2ITMA 1X4CA 4AL5A 1NGCA 1X4DA 3OHRA 4LRFA 2R8IA 3OVNA 3W0LA 1HR0K 4WWSA 3C14B 3PXGa 5HBMA 3EE3A 1CS4B 3ICLA 3THWB 1UJ6A 1MWZA 2MKIA 3WNHA 2V51B 2W4DA 2CGJA 3U4LA 4JI8K 2CJQA 4PG5A 1PJ5A 3J7A1 3NF7A 3DXSX 4P52A 2ILZA 3C65A 4CIEA 3O6WA 3SBTA 3HVAA 4GMJB 3TUIC 2GNKA 5C5JA 1R0CB 1QAYA 3MHYA 1U2VB 3ASMA 4LJMA 3N6NA 1M90T 1Q18A 2K1RB 4LF6K 1TV6B 1U26A 2HQGA 4JI7J 3VF0B 5F8JA 5JLHA 3M6XA 5C15A 2E5JA 2O5DA 4WK1A 1SJ3P 3A5MC 4WYLA 4GKJF 3CM5A 3PO5A 2OGUA 1GMWA 1U48A 4ED5A 1YBAA 5AQSA 3OTDA 2YV0X 2QA1A 4FWLA 2KN4A 2YWHA 2LA4A 3QIPB 3BY5A 5T14A 4NA3A 5GVQA 3CFOA 1F9HA 1M5PC 5HOOA 3PKYA 3TNVA 4LFBF 3SBGA 3C6UA 2E5LJ 3CC7N 2WW8A 2DR5A 1T03B 1NEEA 4Z4IA 5ETKA 4DCOB 5HROA 1AZSB 3T5LA 3K5PA 3GILA 4YDUA 4OYIA 4M95A 4FJMA 4OL8A 3C3LA 4FLYA 1OPZA 2YWKA 5ETNA 1BWVA 1RT4B 3MM5A 4X64K 2H4YB 4ZPWR 4OX7A 5CD4A 1J5EJ 3L3CA 2AWZA 2JEFA 3WNFA 4A59A 1T94A 4CE9A 2XLIA 2Z4PA 5KRTA 5K8MA 4QAGA 3OTEA 3O9RA 4DTOA 1LK7A 1RCHA 2AEJA 3A0IX 4JV5J 1VBYA 4DV0K 1IG9A 2DGOA 1HNZK 4QIGA 3A12A 5C2DA 2C2NA 4M5GA 4F2SA 1CULA 1W2BR 2DPIA 2OPRA 4B3TF 2K3IA 2D0OA 3BR8A 1T9YA 1Y5LB 2FJAB 4H5VA 1FJGF 2MJNA 3HSZA 3JQKA 5AZIA 4A8KA 3NE6A 4DX8H 1S9FA 2BH1A 4O3PA 4OI2A 5T7LA 3ILLA 4IOAL 5AQOA 2UVWA 1BCMA 3BZKA 1YJ7A 3HJFA 3HZEA 4TLQA 2W9BA 1OQ3A 3ZCMA 3DM2B 4Z7CA 3WX4A 3W9HA 3C6TB 1T95A 1PAUB 2RE1A 3UKRB 2Z1JA 4ILLA 2BGGA 3DU5A 1OH5A 5IV4A 2XO7A 3QERA 2Y1LB 5HN0A 3VQQA 3BH6B 5KG0A 3KMSA 2W4CA 3QZ8A 3M8RA 5HLFB 2YWFA 3OTOK 4FBUA 2I2YA 2IAJB 2QLFB 3N01A 4S0MA 1EJ7L 3M2VA 4AHSA 3AVCA 1KAXA 2IJNA 3W65A 3GG4A 3JQMA 5C10A 4JHDB 4BG8A 3FZBA 5KFHA 2FSNA 2KZMA 2FHOB 2Z2MA 2VG7A 3CMAN 2W01A 5M2UA 1VQLN 2YPYA 1YTYA 5EN1A 2U1AA 4MJKA 2DFHA 4WU2A 4NYOA 2BM1A 2GQQA 5HO4A 1VRQC 2IPOB 1WKLA 4CVNE 4CJFA 4GV3A 1SVDA 3KIOA 1CQMA 2UP1A 2QL5B 2G1HA 2PIIA 1JLGB 5IC4B 4ILRA 2LU2A 1WC1A 2IDEA 1YI2N 1VQNS 4F0KA 4QW9A 4BRFA 5MLCV 3M8QA 1M5KC 3NRBA 2QMWA 3ZZRA 1HI8A 3CO9A 2FSJA 5KFCA 2MKKA 2R2SA 2HVEA 1R31A 3MAAA 2F1FA 4KKOB 2AU0A 2ROPA 2BJ9A 3C7NB 4EGLA 4AE5A 3G86A 4DG1B 4UZCA 4C8YA 1HNVB 5FD1A 3U7JA 2XGPA 3RAQA 2DRAA 2BW7A 3V9UA 4ZVOB 4XH4A 2KXNB 2QYCA 5HBMB 3ENVA 2XMUA 3LH2S 1RYRA 3BGUA 3WEEA 5AR0A 4DCJB 3W3DA 4KHUA 4DLEA 2JHEA 2UUBK 1IWGA 2HNDA 4B3MK 3KLIA 3R5BA 1N88A 4PCQA 1IJFB 4W5NA 2NYHA 4X65J 4CFBA 2ZF5O 4M42A 4L8RB 5IT4A 1QSLA 3QT8A 4WP3A 4E98A 2OUGA 5K8NA 2F96A 1FWLA 2P5OA 4DMNA 3PY8A 2F4VF 2NUBA 2O8EB 2I5JA 3EL2A 4LF4F 1RDAA 4F4YA 4LF2A 3GJRB 3QO9B 1M1KO 2LU1A 3FBCA 4FNHA 1WN7A 4OV1A 3U8XA 2ZVSA 4AUKA 4DZ6A 4IDKA 1FD8A 5GMEA 3DDKA 2VOPA 3UFCX 4JI5K 1VQ8N 5EX0A 3R27A 3VWSA 4YDXA 3IR6B 3LGHA 1F60B 1Z05A 4NLVA 1N56A 2ZOFA 2BA9A 1B3TA 1VRUA 4E7KA 4P10A 1KN6A 2HVIA 1QD1A 4ILHA 2F9JA 5HVHA 4H5TA 2H1YA 3EZWA 2ILYA 5D0EA 4CF9A 4ZTFA 3LAKA 2J7WA 3P39A 1WOOA 3MAHA 1FRHA 3WXKA 3RMAA 3VQPA 1YRTA 4IOXA 3TQ1A 4HDGA 3LGNA 4DPTA 1RDRA 2E9RX 4QS7A 1JKHB 1NK7A 3UE5A 2OMLA 1HQEA 3B6OA 5KG7A 2VC1A 2WONA 3FMWA 3WZ0A 1KFSA 3THYB 4JD2A 3S3MA 4OGEA 3QSYB 3SMPA 1GMVA 3D3CJ 5A8RB 5F8IA 2V68A 3OHAA 5CY4A 2XWXA 2NRRA 4L3KA 2YKMA 2IM0A 3W9JA 1QQCA 1Y5NB 1C0TB 1O8BA 3GFYA 1WD6A 1G4CA 1WLJA 4C3KA 2JJ4D 4I6WA 4ISFA 5K8OA 2W7OA 1KVBA 4QPTA 3J81Y 1SV5B 3CC2S 3MMJA 1MMDA 5FPNA 2RQKA 2QWRA 2YNHB 4PG4A 3VQCA 4B9QA 3NY0A 3U3GA 2V2ZA 5AZJB 4RW6B 5IM0B 2ZDOA 3CCVS 1T9WA 3VQAA 1M1HA 2LLZA 4YORA 2IY5B 1Y64A 2HFOA 1VBXA 4CFAA 2DR9A 4LR9A 3A8EA 1C4AA 3PDNA 5M1NA 3T5HA 3QFHA 3T1HK 4YOVA 1NKBA 3IUCA 1HBNB 2H5JB 3CO0P 4C11A 3VERA 5DRKA 3I4PA 3DGPB 3P8BB 4M5DB 4H5NA 3QRQA 4EZ6A 2V52B 3R8EA 1PC5A 3U9DA 2QZ8A 4ECYA 4TQRA 3EYZA 3PW4A 3M8SA 4FXDA 1CZAN 4PR6A 4CJUA 4Q8FA 4CGGA 3BR9A 1WSRA 1ZM4A 2X51A 1QLNA 4KFBB 1W9HA 2C3OA 2MHNA 1HYSA 4LY7A 3VQ8A 4DG1A 3SEOA 4ANDA 3QJJA 4ZJQA 1VK3A 1JLAA 3MEEA 4XIUA 3ID8A 2LQBA 3O2IA 2F8MA 1SC6A 3I96A 4J5OA 3AGKA 2QO3A 3QBWA 3OYJA 2LEBA 3OYBA 2A2DA 2ACMA 1W7WA 2HG4A 2VL1A 1TELA 3HBTA 1U0SA 2ZD1A 1R0BG 4LF1A 3Q7BA 2IDLA 1YJRA 4LF7F 5BR8K 3LO3A 4AQYJ 3P45B 3MF5A 3HKWA 4UUXA 1BI4A 4DSIA 2JC0A 2JFDA 1EWRA 2KVQE 4KHQA 1OO0B 5AQYA 1IKWB 3DCAA 3QGGA 2XULA 1U1LA 1K73T 2YQ0A 3K9KA 2R7WA 2V2KA 2GX8A 4YR0A 3DLEA 1M0SA 1O1WA 3WXLA 4M3TA 1WAFA 4BWMA 1BWFO 1S5JA 1MWMA 3O3GA 4DX6A 1Q9YA 3JTOA 2CQHA 3HF5A 2OTJN 3BPSP 5KI6A 2WVBA 2YVSA 4PABA 1BMQB 1UTAA 3OXFA 4FO0A 1WF1A 2VICA 3HSTB 1MLAA 1IKXB 5ADZA 3CCES 1XERA 2L3MA 1OH7A 5GAEU 2JZ5A 2GEMA 3OT9A 5CYMA 2EX3A 3IS9B 5DO2A 2DPNA 1SV5A 1RAFB 2W9CB 4YOXA 1X4AA 4U7UK 2ROGA 1FI4A 1WSJA 5ITHA 2BJ8A 2E2PA 5BPLA 5ELZA 3MCPA 1ASVA 4B1UB 2E5IA 3IBCB 1ACMB 3SQGB 3KDOA 3ZSQA 1VI7A 3CD0A 3M1VA 2CZVC 1F0XA 4TQSA 2LVWA 4ED4A 4V1Ak 2XLJA 4F0MA 2VG5A 4IDHA 3LDOA 3I9V9 1GMUA 5DGAA 2CPIA 3EGNA 5F0WA 4A4JA 3MMAA 1RT5A 3ILOA 3TRGA 2FPHX 3C0BA 3PW5A 2GQCA 5C0YA 4DV6J 1U6FA 4IFVB 4JI0F 4Q43A 4OJGA 1WB9A 3TAMB 3FKBA 3CCJN 1MROB 5AE1A 1HWLA 3SUPA 4O55A 3C2PA 3G6XA 4U7CA 3MMCA 2Q43A 3BZCA 4CJQA 1WORA 4H0OA 2RE2A 3GSIA 1VQSA 4DS4A 2ASLA 3QYYA 2RMLA 3CJ4A 3VAIA 4FJNA 1WOSA 1U1OA 1A5XA 4ANCA 3GLJA 3H59A 2ZZMA 5E3CA 2YKMB 3F56A 1NO8A 1CVJA 2CZ9A 1M90O 1LFWA 2VKZG 3NAHA 1T6DA 4H0YB 4DL2A 3THXA 2RHKA 4TKTA 1XMQK 4KKOA 1H7XA 3D6RA 2GMHA 2DNHA 3KJNB 4IWVA 2QX0A 1D9FA 3K8WA 2FC8A 3MCNA 3SSQA 3JS9A 2G8WA 3ILJA 3SAGA 1RWPB 3NXZA 2Q3SA 4B02A 4BR5A 2DR7A 4U67L 2CPDA 2OPSA 2UXDK 4DU8A 4DV5J 2XMKA 2ERRA 5LY3A 3E9LA 5KFRA 4OYAA 1BDGA 2DR6A 3W2WA 4EP4A 3KWIA 3P31A 4FJHA 2MKHA 2D3UA 5JMVA 2A40A 4W92B 1YG0A 1QDUB 2DGQA 3M9NB 1NGIA 3G2XA 4AXJA 3L4QA 4P74A 4BC4A 3OYKA 2NPIA 5TKYA 2VQEK 4WFBQ 2HVHA 1Q7YO 1J5EF 2L9DA 2BR0A 1FO1A 5KPRA 3AD7C 3AA9A 3L3UA 4CZHA 2V4JB 4CZLA 1BY9A 4R79A 2XSJB 2BJ1A 5BRDA 5KT6A 3HMJG 4KE5A 2XO6A 1QUPA 2DGTA 4Z94A 2IBKA 3OSPA 3MR7A 1DY3A 1TFWA 4J7CA 3LPUA 2QEXN 5KQDA 3GBTA 4MIAA 2EFGA 2EK6A 4I2QB 2QXLA 3ZTOA 4KTQA 4DHYA 5LMNK 3NF9A 4L3NA 3H40A 1GOCA 4MH8A 2ZH8A 3CE8A 2HBJA 4DUYF 3BO3A 4GKJJ 2N7CA 3VENA 3E9OA 3CIPA 4NXMK 2ADCA 3I4HX 1RDCA 4OX9F 2EK1A 3I8DA 4E2FB 2IRUA 3BYPA 2KG1A 4DF8A 3LZJA 3M8QB 2HBKA 4R0JA 3BN7A 1SUQB 4NLOA 3B78A 1FRXA 2QA4S 5F1XA 3G0ZA 3AA3A 1VRTB 2PYLA 5HRPA 1CULB 1WG4A 4TVAB 2R7OA 1S1VB 3BGRA 1ZZFA 3O9QA 2R8HA 1IKYA 2QM1A 2E1MC 3EPGA 3NG8A 3NCIA 4K8RA 4W5RA 3PX0A 5B0FA 3L95X 1V6HA 3EM1A 3MX2A 3TO8A 1KDNA 3K5MA 2Z30B 5J1EA 3V4MA 2KFNA 2B7CB 5B0EA 2QTDA 3MR2A 3FCHA 2E7WA 3ZLJA 4IG0A 2DNZA 4ZPAA 2I6WA 3MCOA 1Q8KA 5CYQA 3GQCA 4RZRA 3KZBA 2BJEA 2MY7A 4JYAF 3I55N 4I6MA 1OWXA 5CYMB 3U1NA 3BF3A 5ETQA 4ZPVR 2YH1A 2XNQA 4H5WA 3I0RA 4Z2XA 1CSJA 4BGAA 3UPFA 4MFBA 2V8PA 1RUSA 3SDEA 3KK3B 3BDEA 1CS4A 3VQDA 3BSNA 4FWMA 4CLTA 1X0FA 4WFNL 1ZPVA 3AXKA 4EP5A 2XY8A 2KM8C 4GVMA 3O8WA 5AXLA 5B0DA 1UPPA 1KXPA 2HBMA 3RMBA 3V9XA 4FPBA 1JLQB 4F8RA 2DGVA 2MQ8A 2GW8A 1WOPA 3HM9A 3AOCA 1WNEA 2J9DE 3H2VE 4K0KK 3LZIA 1NGDA 4PUOB 3R6LB 4P2XA 3HT3A 1Q82O 5L46A 1RBSA 5L39A 3J8AA 4CJLA 1SH3A 3MN6A 2SXLA 3MAQA 2AIRB 2DNKA 3CHWA 1YJTA 1HKCA 2YH0A 3U3YA 3AB2B 3JAMO 3W5YA 5CZXA 1P9YA 3DXMA 4IH6A 1FTCA 4O3QA 3BPDA 4USWA 3QSIA 1HI1A 1GAOA 4LRAA 1NHUA 4NLUA 1RACB 3G8QA 3NGSA 1ZBSA 4LFAF 3JSBA 4YOTA 5I3UA 1NK6A 1KOHA 1V9OA 5LSLA 2ASMA 4KFBA 3RW6A 4QZVB 3M7VA 1BWEA 3P83D 3N0VA 1V3ZA 1PC4A 4DL7A 3MM8B 1FK9A 1V3RA 1XTZA 4URSA 4B9LA 3QWUA 2NPFA 3PW2A 1QHAA 2E1PA 4RJVA 1YBTA 1UOCA 3MWTA 4OQJA 1SJFA 3AQPA 1T9UA 2LKZA 3EJMA 4C8OA 4QCLA 3B54A 1REVA 1N33J 3IGNA 3KKRA 4ZKAA 1WJ9A 5LOQA 2H3EB 3CWJA 3H3NO 5J1EB 1JLFB 1RHUB 4DU4A 4IFEA 2ZWOA 3QWPA 3CMQA 5ETSA 4DMZA 4QPXA 3FE1A 3HD1A 4M3WA 2COLA 4ECSA 4C0BA 5AJ3K 4CGIA 1VQ9S 2VV5A 3CQ8A 4RW8B 2B4UA 4WFAL 1WAJA 3KVGA 3NAEA 2V50A 4B8AB 4BC2A 5HAOA 2BE7D 3T1AA 4DV1K 4X4QA 1C0UA 4UQTA 3OBWA 2B6AA 1O13A 4JKDA 3S8SA 3VPZA 1GMWD 2I1RA 1D09B 4R5PB 4DPXA 2XMMA 1UWBB 2R2RA 4CI6A 3QJPA 4QYZK 3ZZZA 4K25A 1TL3A 3P5JA 5L8RC 2Q0RA 1NK5A 4DQPA 5FIIA 5I3PA 4P7VA 3TJ8A 2IIRA 3QT6A 2VQFF 2I0XA 4LF5F 1BLUA 3CJKA 2V34A 4M3XA 3OYHA 5C7PA 1Q8LA 2UXCJ 3K7RA 1HLUA 4Z4EA 2MYFA 4J90A 5JICA 4CGJA 4PPDA 1U8SA 2D0AA 4XTTA 1U1QA 1AT1B 4FYXB 2VIHA 3BO2A 3CDUA 3FSYA 3G6EN 3B6BA 4EFHA 2MEWA 5DM7Q 3BBFA 2CAJA 1WC0A 1IBMF 2G13A 2O4GA 2P9SB 2YPZA 1YITS 4NLRA 2OD6A 1T8EA 4YB6A 5FPEA 4LBPA 5B7WA 4KH1B 2AJ1A 2CUYA 2JLFA 5KG1A 4WPAA 5EOYA 3BGRB 3FRZA 3UIQA 1NPPA 3OLBA 4JAXA 4YMEA 2LSNA 2K2PA 4NLPA 3LP3A 1AFJA 4FCYA 1B9DA 1WDTA 2BDPA 2HGNA 2M8HA 4IO9L 1YUWA 4BE0A 4FK2A 3ISZA 5DJBA 3RU0A 1OYEA 1BCOA 3MFHA 1VBKA 4RWWA 4WCEQ 2IVOA 4WF9Q 4EFAC 2HBZB 2W2NP 2QKBA 5DQGA 2VYPA 4CEFA 4ECXA 4ZLPA 1OH6A 5I9EB 3UD3P 1T05A 4Q7AA 5KPZA 1LWFB 1EAYC 1RWOB 1ZS6A 3T3FA 3K17A 1KAYA 5G4DA 2ADBA 4DR3K 4MT1A 2HMIB 4OZ5A 1KRPA 3LUYA 4MFBB 3SAHA 4WQ4A 5KFEA 1UFLA 3DLLQ 2X78A 4A8WA 5BPNA 1FKOB 1NDPA 3UD5A 3MXMA 3CF5L 2BVZA 4B3SK 4CZEA 2XSFA 2HNDB 1SJRA 2QSFA 2JLGA 1RHQB 2X3DA 2J0QD 1WG1A 2ZHBA 1F1BB 1FXRA 1OQ6A 2ASDA 2CJAA 4QS9A 4ZCIA 4DEZA 3VAHA 4ZHRA 5HMYA 4YOWA 4ECRA 2RN2A 2KVIA 2NXEA 4CJ3A 3H45C 1KKHA 3POTA 1K1QA 5GMDA 4A8MP 1IXKA 5KG4A 1NRKA 1ZM9A 4ILJA 1S5ZA 2ATCB 4C98A 2LQJA 3D5MA 3GTYX 4IO1A 1D0EA 5GADI 2DT9A 5F0XA 2QRRA 3I6PA 4LFCJ 4RL1A 3C6HA 1OY6A 2AYMA 4PHTX 4O0JA 3ENQA 3TEHB 1CPZA 1SBRA 4U95A 3W3SA 2G8KA 2X6SA 2HHXA 4F02A 4BACA 3IDHA 1RADB 1IBKJ 4EYHB 2XYGB 4CD3A 2N4DA 2Q6BA 5IWAK 4L76A 5KT7A 1N0VC 1Q8IA 5JMNA 3MAAB 5KFOA 4CZJA 4P72A 4JRQA 1HW8A 5C42A 3CQYA 3AAPA 3GG1A 2FZKB 2RAQA 4Q2MA 4IR1A 2W6KA 5M1PA 3N6MA 2GGPB 4RWXA 4JN4A 2KM8B 1TYQB 1R27B 3MPYA 4CLKA 2FJEB 4CEDA 3WIVA 2CQ3A 3O80A 4W5QA 2BZ2A 3EICA 3OL6A 4Z4CA 1NK9A 4KB7A 5LJ5Y 3EZ5A 1UZHA 4N56A 4M5IA 4FXVA 3PIPL 1NMNA 2GC8A 3TAPA 3NLCA 3V1OA 5BN8A 2Y8WA 4FYDA 3L2VA 4FZZA 1JIHA 4P7TA 2IRYA 4KI6A 4L6V3 4LSZB 2AX0A 3VAMA 5GAGP 2CH6A 4E7HA 1VSKA 3A8IA 3C16A 3ATUA 2F3JA 4YB1P 3CPWM 1JKHA 2MGZB 2HFUA 2P9UA 4DXLA 1PJ6A 4N8OA 2M2BA 1WSVA 3WC2A 1N6QB 3CUNA 1N5TA 2J6TA 5H9FK 3MXHP 2A10A 1CXUA 5F8MA 3JAMU 3UN3A 2ASJA 3D28A 3A4TA 2IAJA 4RNOA 1ZETA 1HA1A 1ILYA 5HMZA 3H4BA 4DSFA 3M6UA 3N28A 4RW7A 4NMLA 4B1XB 3BREA 4O23A 2ZFHA 1R3NA 3OHBA 4RNNA 4NLQA 5DS7A 4MDAA 4HEA9 3KLVA 4ZK7M 4B9UA 2C3PA 3HFZB 4FKXA 2VH7A 2MTLA 4MYUA 4IXCA 5D4OA 5K20B 3ZTSA 2UXBJ 2KT2A 3MMAB 4ZN1A 4LVOP 1LW0A 2VC0A 1I3AA 4EBDA 4IJAA 4TN2A 3K2PA 4AL6A 4O5FA 3NP5A 4OI6A 2UUTA 1RAIB 3HVRA 4KRWA 2CJYB 1RABB 4ERDA 2N3LA 2QWOA 4F7VA 4AILC 3RG6A 1YJNS 2OELA 4RW4B 1VQ5N 4ENOA 1V5VA 3DXKB 1SJQA 4ECQA 3WDOA 4DV4K 3VEVA 3CPEA 2DKOB 1ZBIA 5GAEP 4KV8A 2P8IA 4B3MJ 4NCGB 3D2FA 4DU1A 2YJFA 4CO1A 3D0PA 5E3QA 3VHQA 5I42A 1GTHA 3NS5A 1CXQA 2E7XA 4ZP8A 1YZ7A 3OTBA 1S12A 4XPEA 2UVRA 1P1LA 3A5NC 5LSOA 5L9XA 4B3RF 2RD5C 4HI1A 2C22A 3IWLA 4JI6J 4O0IA 3CCQS 4O8KA 2FY8A 1U2FA 5B0AA 4A47A 1WOQA 2DO4A 5DZ6A 2MKCA 3JQJA 3THWA 1R8CA 3CIZA 4PQAA 3DMJA 5A8KB 3DOLB 2R7RA 3ZEUA 2ZKUA 4JB8B 1R6VA 5LJ3Y 4OI1A 3PEHA 5JUMA 4KPYA 4F2RA 4DI6A 1EARA 2MKYA 5BN9A 1S4EA 4OI4A 3LP1A 3A8KA 2WTFA 1WEZA 4CGDA 4Y1DA 4O4GB 3T41A 2ZH5A 4BR0A 4K4SA 1FHTA 2ZD1B 4NLSA 3NOGA 2R8KA 4DR2J 2E9TA 4G1QB 1R59O 3NAIA 3PR5B 2WOMB 4ZPDA 5HQ8A 3KYLA 1XMOF 2HVZA 1YJ9S 2CYYA 1XMOJ 2KHDA 3QO9A 1ATNA 2KO1A 2GVDA 2MQQA 1FWPA 1RSCA 1QVFR 2F8TA 3B8HA 1A9NB 2OA8A 1LXNA 4Y2CA 3IMQJ 1UVJA 3S41A 1YQHA 3CC2N 3HHKA 5H1SQ 1Q86T 5KFPA 4YY3K 4KHPF 3ETMA 1WNSA 2LQ8A 3AARA 5CA5A 1HYZA 3NNAA 4DTNA 3HCXA 3HSCA 4NX9A 3QJLA 1YJ9N 1EQYA 1NM2A 1GLLO 2FVRA 3VTIA 1UWBA 4GV6A 4Q5VA 1ESVA 1QTMA 3C15B 4PWWA 1VK0A 3IM8A 2VA3A 3ELHA 2G8HA 5D77A 2B9XA 1TL3B 1UFWA 2CIMA 1S3XA 3HPGA 1S99A 2RQCA 5HP1B 5BPMA 2EKNA 5DK5A 4RBTA 3DXKA 3HP9A 3R5DA 1HNWF 2G2OA 1X5PA 1VQ4S 2DHHA 1VIOA 4KV8B 2MHEA 5H9EJ 4CHPA 4I2PB 1RFQA 4FK0A 3FDSA 3H25A 1UEUA 1NKEA 1BOTO 3LGMA 2UUCJ 3PIOQ 1VQLS 4BC5A 2CQBA 3M2UA 4QIFA 8RUCA 3CJBA 5DDPC 2V2VA 1MMNA 2KKHA 3ZNJ1 1KD1O 4YS2A 5ETPA 3EX7B 3O1LA 5DGBA 3M8PA 3NGTA 4E1MA 1UA0A 3OUYB 1J54A 4WU3A 2H5EA 4LF9F 5E2QA 4C9DA 3LPEA 1TVRB 1T9VA 2G0JA 3ID6A 1U02A 5AZIB 1U1KA 1D4XA 2UYTA 4PYAA 4DDFA 1ZTWA 1RHJB 2WHOA 3HHLD 4C1NK 4EIAA 1S9EA 5EY4A 3MXIA 5IQ6A 7FDRA 3Q2SC 1A5VA 3KD5E 2B51A 4P75A 2AQ4A 3FUYA 1S6PB 3Q8SB 3NL0A 3VMFB 3AJDA 3KUEA 1RT6B 3HZGA 1RBOB 4JKCA 3F2KA 4CO5A 2V8GA 1L3KA 2RQ4A 3AO3A 1HHTP 2DH8A 5EHHA 2A6AA 2O3DA 1HJRA 3M4XA 3FBBA 1J2VA 1HRHA 2AD9A 4IEEA 3AD8C 2KT5A 1NGBA 2M5YA 2ZJRQ 2AGOA 1K44A 2OEJA 2BV3A 2N82B 1OSCA 4ZS6A 4E7LA 4USKA 4CWBA 2HHQA 1BISA 2YJEA 3M1VB 1NJZA 1NJWA 3C15A 1FNOA 4OIXA 3DLGB 3SMZA 3ZT0A 1N34J 5KFNA 1Q7YT 3RUBL 4CZCA 2UU9K 4QWEA 4X65K 3AAWB 2VZ9A 1HUXA 4F3TA 2M52A 1BQMA 4ECZA 2C3MA 4NA1A 3SV3A 4ECTA 2FB0A 1HPMA 2WUSA 3CD6S 2DHGA 1S1XB 1TMJA 1XC9A 4EBCA 4Y2AA 2OZSA 3FEZA 4DV3F 2VU5A 1HKBA 4MO5A 3RB4A 5J1NA 4HTLA 3CC4S 5HP1A 2OAUA 4CTAA 4DV6F 1K8KB 4M3YA 3PJWA 1B0PA 3CJQA 5BR9A 2J9DA 3U27A 3W7BA 3SI8A 3CD6N 2BE2B 1XNQK 1N34F 2PI5A 4ZVRB 4BE2A 1WEYA 1D1UA 3IKMA 1REVB 1RQ0A 4DR7K 4FYYB 5J2QA 3QRRA 3IFEA 4RU9A 2KTQA 2UVVA 1JLBB 2DVIA 4F3MA 1KAZA 4NMXA 1SKSA 3MM7B 3D0HE 2IHR1 1K9MO 1RHKB 2WONB 5LT5A 1OPIA 1F2HA 1XEZA 2XMJA 4DSJA 2UV8A 4CEZA 2VQFJ 4M7YA 1RBRA 4CJSA 3B4DA 5J2NA 2OPPA 3TA2A 3ETOA 1B0VA 1QE1B 2OP5A 4A8QA 3V9WA 5A2QY 2L41A 4XDCA 4P73A 4K4XA 3EXYA 3TA1A 2WVDA 3R6MA 2GAGC 4CIOA 3Q8RB 2G8VA 4DL3A 5D8HB 4TSXA 3J81j 2AJ4A 1S48A 5EX3A 2HFSA 1XK8A 5F8NA 2PA8D 1GLAG 2GJFA 3EWGA 4X4OA 2AJFE 2R7QA 2ZOGA 3SBMA 1S6UA 4AD6A 3PRBA 4QYRA 4DR7F 1TKXA 1Q8BA 1VQYA 1PCAA 4DFKA 1Y4ZB 5GINA 1XNQF 4CK3A 1K6YA 3IGVA 1S57A 2OSRA 4LRDA 4KHSA 3JXOA 2LYVA 2E2OA 4I9QA 1QY7A 2XS7A 4Y6IA 3UCUP 1SC3B 2HFVA 3ZYYX 4JKBA