4ZHRA

Structure of hiv-1 rt q151m mutant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the HIV-1 reverse transcriptase Q151M mutant: insights into the inhibitor resistance of HIV-1 reverse transcriptase and the structure of the nucleotide-binding pocket of Hepatitis B virus polymerase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords RT p66 subunit
total genus 143
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4zhrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4zhrA05
3CDWA 2XC9A 3MEDB 1L3VA 3SV4A 4FJHA 3RB0A 3QZ7A 4W5RA 3S3OA 1FKOA 1ASWA 4IOBA 4NYNA 1Y97A 4W5OA 5HRPA 3CJ2A 2ZKUA 3D45A 2VA2A 4ZP9A 5SZTA 1T05B 4LSNA 3SUNA 5FRMA 3LAMA 4FJMA 5J2MA 4Q8EA 4ZVGA 3H98A 4URSA 3OJUA 4O55A 5KFLA 2GUIA 3K2PA 4FLWA 5FDLA 1J9AA 1SH3A 3K5OA 4CHOA 4OGEA 3VQ5A 2IS3A 2AWZA 4DTOA 4M3ZA 4KHNA 2FBXA 5E41A 2UUTA 4FM0A 5KFEA 1QE1B 4DL4A 4BWMA 4PUOA 4LSNB 1T05A 3KD5E 3K5MA 1I39A 4W5NA 5CZ1A 4RUCA 1JLQA 4FS2A 4E7HA 4DSEA 3PVXA 1BIZA 1RA6A 5KFAA 3SPZA 4EBDA 4ELVA 2E9RX 1LV5A 4KTWA 3AO1A 1X9MA 4F4ZA 3HVWA 4I2QB 3KHRA 3AVKA 4B3OA 2BDPA 4DQQA 4IFYB 4NLOA 3QEWA 3MXJA 4M3YA 3ALYA 3KD1E 1SV5A 1LWFB 1W25A 2FBTA 3NF9A 1QQCA 4ID5B 4HCBA 4ECWA 4DQPA 3PHEA 3NMAA 1JKHA 3ZSOA 2HHXA 2OH2A 4KB7A 3PY8A 1UA0A 3MXIA 2XY7A 3DLRA 4IKFA 1RT6A 4DLEA 5DG7A 3G6VA 4CEQA 1TK5A 1EXQA 4CECA 4RNMA 1RBUA 3OYNA 4ED2A 2W9AA 3KKRA 4ECZA 5FDLB 2W42A 3FFIB 3DI6B 1R0AB 2Y1JA 5J2MB 1SKWA 4CK1A 3FDSA 3MFHA 3ZT2A 5KFTA 5KG2A 4ZTFA 2Z1IA 3PW2A 4ED0A 2WHOA 1JL1A 4DL2A 4U7CA 4KAZA 2FVRA 3OL9A 4J9NA 3T19A 2R2SA 3VQBA 3AVLA 1U47A 4CE9A 3FQLA 2YNGB 3HSTB 2HNYA 2BGGA 2RKIB 4I9LA 3DM2B 3CJ4A 4ECRA 4H4MA 5F8MA 3MF5A 4ZVEA 5KT3A 4GC6A 3BQ1A 4HUFA 2E4LA 5F8HA 3RB3A 4RNFA 1LAWA 2Q3SA 1QAIA 4RNHA 4N56A 2ZD1A 2D5RA 2KZZA 2KW4A 4I9QA 4KTQA 5KFXA 4JUZA 1YTAA 3MEGB 3V9ZA 5JXSA 4NCBA 5F9LA 1WSIA 4AHVA 4Z4CA 3QLHA 1RT3A 2OPPB 3K5LA 1TK8A 3A2FA 1ZETA 2G8VA 3QGIA 1RDRA 4CEZA 1K1SA 4DS5A 3M9OB 3ZSWA 4FJXA 4N47A 1YTUA 3OYEA 4KFBA 2ZE2B 1IKWA 1S1WB 1BQMA 2I5JA 5D3GB 1ZBUA 3K59A 3KLGA 4WFZA 1LW0B 4HKQA 4DU4A 5KFSA 1XHXA 4O3SA 2BQ3A 4KE5A 4QAGA 3RMBA 1J53A 2GIQA 1SL0A 4FZYA 3M8SA 4DWIA 1UAXA 2P1JA 4BDYA 5KFJA 5EWGA 3V81A 3PUFA 1IO2A 3U6FA 3L2VA 4E1NA 4MFBB 4HUEA 4KPYA 4ZTJA 1N6QB 4KKOA 1JLFB 4W5TA 4IG0B 1VSEA 5KG1A 4AHRA 1JX4A 2IAJB 2W7PA 3KK1B 2AGQA 4FK0A 1KHVA 5KFVA 3AVBA 4B9UA 1BL3A 4IRCA 2X78A 2YNFB 4J9LA 4JS5A 4RU9A 2I5JB 3MFIA 1R0AA 2HHUA 4KFBB 1TV6B 1SL2A 4NYFA 2IMWP 1VRTA 1RBTA 4OKKA 3NGYA 1NJXA 4B9SA 3K57A 1J5OB 1KRPA 2HVIA 3ZSZA 4E0DA 4ZP6A 1F21A 3UQSA 5KFNA 4IH7A 3KLIB 2OPSA 3MR3A 3VQEA 4Q0BB 4RNOA 4NLPA 3QIDA 4Z0UA 2WB4A 5KFHA 4X2BA 3G10A 5DMRA 3ZT4A 2OZMA 4ID5A 1RT7A 1HYVA 4DQSA 4DQRA 3PW7A 4E89A 3SJJA 4KHQA 4FJKA 2D0AA 2R2TA 4QWCA 4DU3A 2F96A 2OZSA 3DM2A 3DLKA 4K4ZA 2AGOA 1NOYA 4KHMA 3H2LA 2UVVA 3SQ2A 3WNGA 1BQNA 4M3XA 3PW0A 4CK3A 3DRSB 2W9BB 4KO0A 1RDBA 3LP2A 3V9XA 3ZT0A 2IC3B 5L1LA 4CF2A 2V4QA 5J2NA 3P83D 3IGVA 3OYMA 3MEEB 4I2PB 4CEAA 3OJSA 4H4OA 3SQ1A 1B92A 3FQKA 3LPTA 1U49A 2DPJA 4ID1A 3KLFB 5HP1B 1RT6B 4JRQA 2IA6A 3ZSXA 1TAQA 2XY8A 3CVKA 5DG8A 4FLXA 1VSDA 1FKOB 5EUHA 4FYDA 1IKVB 1RA7A 5KT2A 5F8NA 2IM2A 3MEDA 4JV1A 2F8SA 3HT3A 1L5UA 4IR1A 1HYSA 2DPIA 3IRXB 3BREA 1NKEA 2G8KA 4J9OA 4IG3B 3NGDA 4BE1A 2ZQBA 4J2BA 1S1VB 2YKNA 4O3RA 2W9CB 4W5QA 3HP6A 3TANA 3C6UB 2IDOA 3KHLA 1RTIB 2R8KA 4O5BA 1TKZB 3HO1A 3F73A 2D3ZA 1JLAA 3UDLA 3CFRA 2YHBA 2W8KA 2KFZA 1DTQA 3VA0A 2E9ZA 1NHUA 4GW6A 4CJRA 3AO4A 1O1WA 3ZCMA 2O4IA 4M3TA 2VWJA 4QWAA 2YV0X 2C2DA 3CFPA 4M41A 3KMSA 4M42A 4QCLA 3DRRA 3RBEA 2QKBA 1NJYA 1TKXB 3AO2A 4EZ9A 2R8HA 3NAHA 4ECXA 4DTJA 1LW2A 2J6SA 4CEDA 4DEZA 4E1MA 1S9FA 1S9EB 2VA3A 5J1EA 4DFMA 4KBIA 5KFBA 1MU2B 3ITHA 3GQCA 3RR8A 4IRDA 3GIJA 3CFOA 4DLGA 4NCGA 5DGBA 4K50A 4DU1A 2XI2A 4FJGA 3DYAA 3SV3A 3RAXA 4QWEA 3AVHA 3MXMA 4CGIA 3M9MB 4FM2A 1S9GA 3KLEB 3U3GA 2FLLA 3UIQA 5HRRA 4NLYA 2C2RA 4K4VA 5KFIA 4DSJA 4CIGA 1D5AA 3KJVB 1QSSA 4CEEA 2FVPA 4RW8A 1N48A 2A1RA 2R8IA 3CIZA 2C28A 4KHRA 4ECSA 1JXBA 1UOCA 3QGHA 3DOKB 3NH1A 1YVFA 5EDWA 4HTUA 2W9CA 1A5VA 4HUGA 1T8EA 5KT5A 3BDPA 5CYMA 3NF7A 4ZPAA 5KG4A 3SNNA 1D0EA 3IRXA 1TL1A 1ZTWA 5KGXA 1ITGA 3SUOA 4Z4GA 3WNFA 4H54A 1S1XA 2KZMA 3EY1A 2R2UA 1MU2A 3OVNA 3ZT3A 3HVAA 3PJXA 2DFHA 5J1EB 4AHTA 1LAVA 1KVAA 2F8EX 4DFJA 3HVTA 3Q8QB 3G0ZA 1IKXA 3LWLA 1D8YA 2WK4A 3Q8RB 2HHSA 5HP1A 4Y1DA 1HQEB 4DTMA 3SFGA 4ZPCA 1NK8A 3V1QA 3L3UA 1C1CA 4H4OB 1OS5A 4Q8FA 4LQ9A 4O0JA 3NHGA 4I2PA 4FZXC 5DQIA 5KG3A 4C8OA 2KTQA 1KFDA 2JEJA 3T3FA 4XPCA 2DFFA 1HPZB 3KNAA 2ITGA 4BE2A 2WCXA 5T7BA 4FS1A 1KVBA 5JS1A 3OYLA 1C0UB 1S0NA 4E7JA 1JLGA 3VQCA 3OHBA 3KK2A 4JV0A 3OLBA 4ZVFA 3IS9A 1DLOB 4KB1A 1EKEA 4Q43A 3DLBA 3V9SA 1MMLA 4CFAA 3E51A 2G8FA 3BGRA 2BQRA 2NUBA 5C25A 1RT7B 3CG7A 3CO9A 3OY9A 4Z4EA 4PQUB 2XGQA 3RMDA 5KT6A 3KKSA 3I5CA 1QS4A 1X1PA 3H4DA 2XRIA 3KLIA 3KLFA 4ZP8A 1QSLA 4CJTA 5KFOA 2BR0A 3OYDA 4YR2A 1W0HA 4CFCA 1T03B 3M8RA 3DLGB 5KFFA 5KFMA 3TI0A 4N5SA 1RTHB 3QO9B 1N5YB 4CJSA 4DSIA 1SH2A 4FM1A 5FROA 2C22A 1JLGB 5C5JA 4CF0A 4TN2A 3DLEB 2IOCA 2J6UA 5J2NB 2YNFA 3N6NA 1SH0A 4KI4A 3PX6A 3HVRA 3GIMA 2KQ2A 2IAJA 3PZPA 4MK9A 3RAQA 4O0IA 1TKTA 4CHQA 5F8JA 2VG7A 1JLCA 2E9TA 4BACA 4ED8A 4FW1A 1N5YA 1ZYQA 4EP5A 1JXLA 5HLFB 4CHYA 4CJFA 4KV8B 4C8NA 4HHTA 4URGA 1T03A 1TKDA 5KG6A 4MFBA 3U3YA 1TGOA 4B9TA 1C2PA 4WYLA 4KHUA 4EP4A 3DRPB 3B6PA 4ELUA 5KFCA 3BSCA 3TVKA 2P5OA 2HW3A 3OLAA 4XIUA 1RNHA 1LWEB 5C42B 4OLAA 2UUWA 3RR7A 4F3TA 2F8TA 3LWMA 3GV7B 3AV9A 5KI6A 3IAYA 1EX4A 3BJYA 4Q5VA 3KOAA 3AVAA 1YVUA 4OVLA 2X6NA 5CYMB 3HM9A 4WZQA 3TAPA 2FBYA 1L3SA 2B6AA 4E7IA 2ILZA 5F8IA 3AVNA 4FJLA 2HHTA 3I5AA 4B9VA 4J9PA 2OPRB 3DOKA 2OPPA 1CLQA 4K4SA 3I0SA 5KG5A 4EZ6A 3MECB 4FLUA 3MEGA 1A5WA 1S1TA 5L9XA 1S0OA 4CJVA 4ICLB 4CCHA 3ASMA 4FLZA 3ZSRA 3RB4A 2HWIA 4Q45A 1S5JA 2HB5A 1QUVA 3C95A 1BISA 4NLDA 2JGUA 3TAGA 1BCMA 1RT5A 1Z4UA 1NK4A 2FLNA 1S9GB 2B5JA 3VQ6A 3OYBA 3AVGA 3IG1B 4RW7B 5KFRA 1BI4B 3H40A 1CSJA 4J9MA 3I0RB 1EETA 4CEBA 1FK9B 4H4MB 1RYRA 1S10A 3ITHB 2YHAA 2QK9A 1RT4B 3C6TA 3AVCA 4Z4FA 3ISND 3HVTB 3V81B 1S9EA 1CZBA 2IJFA 2FVQA 2D3UA 4OPJA 3MR2A 3AA5X 1TAUA 1TKXA 3PR5B 3EZUA 3KK3B 3QERA 3SQ4A 4CF8A 4TY8B 3OYAA 1NOZA 1TL1B 4ZVHA 4FK4A 1KSPA 3LP0A 2XWYA 3Q8SB 3SYZA 3V4IB 3PJWA 3FFIA 4NYZA 3QZ8A 4DL3A 4CF9A 1I3AA 3Q8PB 1L3TA 3NE6A 4HCCA 1FXXA 3NFAA 3HKWA 4NLTA 2GBZA 2BE2A 4MK7A 4RG8A 1HQUB 5HRNA 1UA1A 2OA8A 4M45A 4DS4A 3F9KA 4IDKB 1JLAB 4N41A 4RW8B 1WN7A 1KLNA 5JUMA 1U04A 1TKZA 3RRHA 1HRHA 1TP7A 1RTJA 3C6UA 3LP1B 4RW9A 2IM3A 3M9NB 1QSYA 2Y1IA 5F8GA 1S6QB 4O3NA 3EPGA 3NAEA 4IFVA 4PA1A 4EYIB 4F8RA 2HHWA 5L1KA 3SI6A 2UVUA 4IG3A 3RMAA 1C0TA 2EC0A 4NCGB 4Y2AA 1G15A 4FJNA 4DF4A 2WONB 3NL0A 1WSFA 4B08A 3MR5A 4F2RA 2QV6A 3L2UA 3OS2A 4B8AB 2WRMA 5EU7A 3D28A 3NKYA 4CJ5A 3NGZA 3DRRB 2FJXA 1D9FA 3VQ8A 2AQ4A 1UWBA 1HMVA 4QWDA 4AILC 1U45A 4MH8A 3RWUA 4WFXA 3SPYA 3MEEA 5EWFA 5I42B 5KFGA 1L3UA 2OPQA 5J2PA 3WNHA 1RTIA 1RDAA 2AX0A 1JKHB 3V6JA 4CIFA 4YQWA 2W9BA 4TSXA 3DRSA 4J9RA 1X9SA 4FK2A 3PO5A 4RW6B 4O4RA 1LWFA 4B8CA 1JLEB 4RW4B 4IFYA 2DTUA 4EEYA 4CJEA 1IKVA 4TYBA 4CHZA 3WNEA 5DLFA 3SZ2A 5SWMA 3ZSVA 3O3FA 1JLEA 3OYIA 5KGWA 3B6OA 3QIOA 3AVMA 3LPUA 1S6QA 1JLQB 3GV8B 5KFKA 5KT4A 4CGGA 1SKSA 1RTJB 4FW2A 4ECYA 4TYAA 4OL8A 3VN5A 4O3PA 2P51A 1TVRA 4NCAA 3KIOA 2R8JA 4G1QB 1KVCA 2PZSA 1RCHA 2BE2B 4FVMA 3T5HA 1KCFA 4CJWA 5KTQA 1RBVA 5K14B 4JS4A 4EO6A 1B9FA 4QW8A 4LH5A 4CERA 1RBSA 3FSIA 4LH4A 1S0MA 4K8XA 4OKEA 2V9WA 5JS2A 2RF2A 3ULDA 3HHKA 4NRTA 3V1OA 3PW4A 4CFDA 1VSFA 4WE1A 3NDKA 3QNNA 3RBDA 2IC3A 1VSKA 2W8LA 1SL1A 3LP2B 3KHGA 3TAEA 2GC8A 4DL7A 5DGAA 5CY4A 3RMCA 4DTNA 5J2QB 4ZMMA 1ZBHA 1N6QA 4KHSA 1DTTA 4NLSA 2IJNA 1RT2A 2B4JA 3NBPA 3BSAA 5KFZA 3H4BA 3QEIA 2Z1JA 1IKYA 3ZSQA 4NLUA 2VG5A 3L2QA 2YKMB 3QESA 1GOCA 3GV5B 4ZHRA 4CEOA 4TQSA 3VQ4A 5KFPA 4ECQA 3CJ5A 1Z26A 1U09A 1A5XA 1JL2A 2OPSB 3HXMA 1S1TB 1S6PB 3V6DB 1HQUA 1BQMB 3I5BA 1ASVA 2AJQA 4MQ3A 1J5OA 1GOBA 3ISNC 4CFBA 1S1UB 3UPFA 4Q44A 4CGFA 3THVA 1VRTB 3DOLB 4C8KA 4YR0A 1RILA 4TXSA 1RT3B 3JYTB 4PWDB 4R8UA 1CXQA 3O4NA 2HNZB 4KHYA 3NH2A 3KK3A 4LSLA 4CGHA 1D1UA 4KREA 4ZHRB 3QYYA 3T5LA 4DTSA 3QEVA 3KK1A 1REVB 2C2EA 4L8RB 1FKPB 3PR4A 4AHCA 2VG5B 4MKBA 4CIEA 4O3QA 3CJ0A 3C6TB 4FJ9A 1K6YA 1S4FA 3LAKA 3SFUA 4C8LA 1NKCA 3AVIA 3L8BA 2GV9A 4OKJA 1RT2B 3P1GA 4IH6A 1DTTB 1FK9A 2E6LA 2RKIA 3RB6A 2YNGA 4RW7A 5J2QA 3V1RA 3HL8A 1C6VA 3T1AA 4BDPA 1QTMA 4FZZA 1GX6A 2VG7B 1RT5B 4Z4IA 4FBUA 5F8LA 2XGPA 5I3UB 4ZPBA 4LQ3A 1WNEA 2DY4A 1C1AA 3SCXA 4WE1B 4LSLB 4FJIA 1XR7A 3OL8A 1LW0A 3KLGB 4J9SA 4QOZB 4GC7A 3QNOA 2ZE2A 3JYTA 2BQUA 1N56A 4R5PA 5CYQB 3H59A 4DSKA 3T5KA 2WOMB 5K14A 4YNQA 4DTUA 1TQLA 4DTXA 4ED1A 4RUAA 4ECTA 3OYJA 2HAIA 3NAIA 3GILA 1JLBA 2R7YA 4M3WA 1HARA 1S6PA 4ZPDA 2RDJA 2UVRA 2FC0A 1BIUA 5FRNA 2BANA 3CM6A 3LP3A 2XI3A 3E01A 5KFDA 4RNNA 5DQGA 3GYNA 5C42A 4PQUA 1ZBIA 3DLHA 3QEXA 2XY5A 4E7KA 2XHBA 4FBTA 4LD0A 3NBPB 5DG9A 4B3OB 4TLRA 4B9MA 2YNIB 4FXDA 2FVSA 2HWHA 4RW4A 4KV8A 1T94A 2RDIA 5HLFA 3IGNA 4CJPA 4DL6A 1XWLA 3KTQA 3BR9A 4YP3A 3KLHA 2IM1A 2Z1HA 4J2EA 1X9WA 4O3OA 2VG6B 4F3OA 4KI6A 1QE1A 2OPQB 1NK6A 3OYHA 1HPZA 1C0MA 1NJZA 3DI6A 3DLEA 4QW9A 3JSMB 2AGPA 3VQ9A 1Z25A 2QE5A 4J9QA 4M95A 1JXEA 3HK2A 3CYMA 1Q8IA 1RTHA 3QO9A 2D0BA 3TQ1A 1UWBB 2LSNA 3CDEA 5KT7A 1TVRB 3VQSA 4GVMA 4XPEA 2HHVA 3TABA 3AVJA 2RN2A 1RTDA 1VSIA 3NF8A 4H8KA 2ASDA 1S48A 4J9KA 2XCAA 5DLGA 1NK0A 4I2QA 4FLTA 4R0EA 2A1SA 4URQU 4FJ5A 5DK5A 4CJKA 4RW6A 1TL3B 4NLVA 1KLMB 4ELTA 2FBVA 4OGCA 3ZSYA 1ZTTA 1HYZA 1IH7A 3LP1A 4E3SA 3NCIA 2Z1GA 4PUOB 3UR0A 5J2PB 3SQ0A 4IDKA 5I42A 4K4XA 4O44A 1RT1B 4EYHB 2CKWA 4YFUA 2V4RA 4I7FB 4MKAA 1SUQA 4F4WA 2WTFA 3QIPB 5KRSA 1IG9A 4M3RA 1HMVB 4FJ7A 3V4IA 4K4WA 2IM0A 4PY5A 3NF6A 2ETJA 2B43A 3OYCA 3HPGA 3FRZA 2AU0A 1WNSA 1XI1A 4TY8A 1N4LA 5T14A 2IGIA 2HMIB 2ALZA 1RDCA 1JIHA 3BSOA 1RDDA 2D0CA 4G3IA 3QINA 1NKBA 1HJRA 3SUPA 3ZT1A 5KG7A 2HMIA 1RT4A 1VSJA 3PW5A 1NHVA 3CWJA 2WONA 1S1XB 3I8DA 4E19A 2XCPA 2BRLA 2I1RA 1C0TB 1EETB 4CK2A 4CJ4A 4TQRA 2B5JB 3CDUA 4OPKA 3D0PA 2PY5A 4IFVB 2DFEA 1CZ9A 4NLGA 3QIPA 3TWHA 3HJFA 1QHTA 5C24B 4RW9B 2PYJA 3S3NA 3VQ7A 4O44B 2ATLA 4F4XA 2JC1A 1IM4A 5KFYA 1T3NA 3PO4A 3MECA 2UVWA 1XHZA 4WYWA 4DFPA 2ILYA 4HVJA 4QPXA 3AO5A 2R2RA 2FVCA 4CF1A 3L3VA 3M8PA 4TY9A 4AH9A 2JEFA 3KLEA 2YKNB 3OHAA 2G8HA 5F9NA 2R8GA 3LP0B 4CJLA 3VQAA 3OYKA 4K8ZA 4HYKA 3OS0A 4DQIA 3DYAB 4ZP7A 3MAQA 4DG1A 2P5GA 1WSHA 4KSEB 4DL5A 3VQPA 5HBMA 1WSEA 5DQHA 3SI8A 4MIBA 4AHUA 4CHNA 3RRGA 4DF8A 3TAMB 5CZ2A 3H5YA 4M3UA 1EP4B 3CJ3A 3OSPA 2X74A 2OYQA 3AO3A 1LW2B 4B9LA 1VRUB 1NK7A 4BWJA 1VSHA 3D5MA 4IH5A 1KFSA 2D41A 3DRPA 4IBNA 2QXFA 1GOAA 4JV2A 3I0RA 2VWKA 3IG1A 1BI4A 1ASUA 2JEGA 3EZ5A 4NLWA 3LDSA 3O4QA 4CGDA 2FLPA 4KB0A 1RAJA 1JLCB 4J2AA 1C1BA 1SUQB 2E6MA 4N76A 3EPIA 4EO8A 3AA3A 3V6KA 1T7PA 1RT1A 4ICLA 3TR8A 1HNIB 3I0SB 4BE0A 2VG6A 3OYGA 1LWCB 3LALA 2OPRA 4DMNA 3KLHB 3CM5A 1KLMA 2YNHB 2B6AB 4Y3CA 3IN5A 1K1QA 2ASLA 5KFWA 3DMJA 4CJ3A 1Q9YA 4OJRA 2QKKA 4NLXA 4CGJA 2EHGA 4WFYA 4XO0A 2HNDB 4O4GB 4WXOA 3AA4A 2J6TA 4CESA 4CJUA 5KFQA 1SKRA 4UQGA 1HNVA 4AHSA 1RTDB 2G8IA 1LWEA 3L2WA 4RZRA 3G6YA 3E01B 3K5NA 3P5JA 4DTPA 4FJ8A 5KFUA 1I6JA 2EX3A 2BANB 4CJQA 3M8QB 4QWBA 3PX4A 4FJJA 2O5DA 3HYFA 2PYLA 3GIKA 1ZBLA 1NJWA 4BDZA 3GIIA 2HNDA 1JLBB 3N6MA 4DSFA 3BQ0A 4IQXA 1BCOA 2WOMA 2YNHA 3VQQA 3O3GA 4FLYA 2GIRA 1TKTB 5CYQA 1WAJA 2XY6A 3JSMA 1C0UA 3T5JA 2O4GA 4NRUA 4J2DA 5HROB 3SUQA 2KFNA 4KTZA 4K4YA 2JEIA 3V9WA 4YR3A 4KAIA 3RTVA 3TAFA 1WAFA 1RBRA 4LY7A 5HROA 4DTRA 1W9HA 1RYSA 5I3UA 2X6SA 4KO0B 3V9UA 1B9DA 1BHLA 1C1CB 4IG0A 1BQNB 5L1JA 1XC9A 1CXUA 3CQ8A 2BRKA 4Z4HA 4Y1CA 3NGIA 4KKOB 3DLKB 3DLGA 3K58A 3KLVA 3OSNA 1HQEA 3H5UA 4ECUA 2YNIA 3H08A 4Y34A 3C94A 3M8QA 1XR5A 3H5SA 3TARA 1EP4A 3AVFA 4NZ0A 1NNDA 2XO7A 1HNVB 5C25B 4F50A 4K4UA 4Q0BA 3QGGA 4DSLA 3BGRB 4EBCA 5HBMB 4O4GA 3EYZA 4YMEA 4B9NA 4ECVA 3LZJA 3L2RA 2HNZA 4CEFA 3KMQA 1S1WA 1IKWB 1NK5A 1DLOA 3IS9B 3DMJB 1ZBFA 1S97A 3KK2B 1TK0A 3DOLA 2G8WA 1VSMA 3OYFA 4ED3A 3M8PB 2V0NA 4R5PB 3BSNA 4IRKA 1LWCA 4C8MA 1TV6A 2FJWA 3HP9A 4KRFA 3MTKA 3ICLA 3BQ2A 1QAJA 1HNIA 4FCYA 3V6DA 5HRSA 3NH0A 3KJVA 1S49A 5L1IA 4E7LA 4F4KA 5C24A 3VQDA 1C1BB 4U6PA 2G8UA 2YKMA 5KRTA 2JLEA 1J54A 1YT3A 3G86A 4GMJB 3HPOA 2D7SA 3H5XA 2HVHA 3PV8A 1JLFA 3DDKA 3OL6A 4Y2CA 5EWEA 4ED7A 4JRPA 4EBEA 1XR6A 1NK9A 1WSJA 4OLBA 4JLHA 2HNYB 3V6HA 1IKXB 2CJQA 3S3MA 1VK0A 3TAQA 1VRUA 3QETA 4MIAA 3TAMA 1D9DA 1KHWA 3N6LA 4M94A 1FKPA 2AX1A 2IBKA 1REVA 2ASJA 2RPIA 3O3HA 4KHWA 3PX0A 4FLVA 4NLRA 3AA2A 4DG1B 4CHPA 4MK8A 5D3GA 3MR6A 3OL7A 2W7OA 1BGXT 4PWDA 4R8UB 4K4TA 2RF2B 2ATQA 4NLQA 2JC0A 3VA3A 1S1UA 4I7FA 4F4YA 3G6XA 1GX5A 4F2SA 3KHHA 3QLHB 1DTQB 1KTQA 2HHQA 4G1QA 1WLJA 4IR9A 4IKAA 3LZIA 1VSLA 3S9HA 1U48A 2ZD1B 4WZMA 4DFKA 2FJVA 5KG0A 3HPHA 3QEPA 1S1VA 4ED6A 3OS1A 1U4BA 3LANA 1TL3A 4WXWA 1IKYB 1SV5B 1Q9XA 1WSGA 1HYSB
chains in the Genus database with same CATH superfamily
3KG1A 1VHFA 4BRMA 2BTFA 4JD2B 3RB0A 2ATCB 1KOHA 4PKIA 4WJBA 4IOBA 2V8PA 4C6AA 5FPDA 3BV8A 3AODA 1FFSB 3CMAN 1NB2A 3D45A 4ZP9A 1T05B 1YZ7A 1HD1A 4JHDA 2BX6A 3A8IA 3WQUA 3SUNA 3P5BP 1NGDA 1TYQB 4FJMA 3J7YP 1HBNA 4O55A 3D1HA 5KFLA 4H5NA 3K2PA 2Z57B 1X5PA 1UVNA 4FWQA 1CULA 1LQ9A 2E29A 5D4OA 1FD2A 1FDDA 3K5OA 5KQDA 4DTOA 5K9FA 1SJFA 4HLBA 2FBXA 1QE1B 4UOCA 2M2BA 2GV1A 5AQXA 4B3RJ 3FRYA 4RCHA 3JSYA 5GVQA 4W5NA 1JLQA 4HVZA 4DR4K 1RA6A 4I6MA 4ELVA 5EX0A 3E9OA 2E9RX 2MKKA 1S22A 4I2QB 4NLOA 3QEWA 2I6WA 1W25A 5CE3A 3BKFA 3J81j 5AZJA 4ECWA 2XMVA 4BRPA 2OH2A 1WSVA 2QN6B 2XY7A 3W2VB 1XNQK 1AROP 1WBBA 1RT6A 3WBZA 1WHWA 2KHCA 1N32J 3GE1A 2OLWA 4H0TB 1N34J 4RNMA 4BRIA 3CCES 1UP1A 2HRUA 5FDLB 2W42A 2CVEA 3FFIB 4CZMA 4OMFG 1H7WA 3S8SA 3ENWA 3KG4A 2C3UA 3THWB 4ZDNA 1SKWA 3KUEA 4DOZA 2ACYA 3ZT2A 5KFTA 3KDOA 4ZTFA 1MSWD 2LFVA 4ED0A 1QHAA 2WHOA 1JL1A 1WB9A 4U7CA 3N4QA 1S6OA 3GJQB 3OL9A 3T19A 2R2SA 2DHGA 3AVLA 2QT7A 2Y0SD 2YNGB 1UL3A 3KUGA 3SK3A 1DRZA 5F8MA 3SAFA 2CPJA 2NRVA 4KYZA 4DU8A 5KT3A 2CWXA 3RB3A 4RNFA 2E1PA 3CCVS 3VAKA 1QAIA 2ZD1A 1ZPVA 2F9WA 5AQNA 1WG5A 2Q6CA 4B3MJ 2VOOA 4DV3F 3DLJA 2GJFA 4OX6A 1YRTA 5JXSA 3MUMP 4Z4CA 1WSIA 3CO0P 3QLHA 3MD1A 1RT3A 2OPPB 1CS4B 3K5LA 1V4SA 2D74B 3A2FA 1K1SA 1HNZF 3M5RA 3I33A 5DZ7A 2J0QD 2HFZA 2ZE2B 1S1WB 2O1PA 2I5JA 3EMTA 3K59A 5DZ6A 4JI5J 4DU4A 4BRQA 2FHJA 3OTBA 3JAMO 3R7SB 4CO5A 4QAGA 2RU3A 2DGSA 4FZYA 3QAUA 4KH5A 4JI0J 4BS2A 2FGOA 5ELZA 3ILLA 3U6FA 3GR1A 1FRMA 2LEBA 4A62A 4ZTJA 3BZKA 4KKOA 1JLFB 4WTYA 2RE1A 1TUYA 4WCEL 2UXCF 3MAAB 2XLKA 4AHRA 1JX4A 4JI3J 1FNOA 2IAJB 3UVJB 3M6VA 5DDOC 2W7PA 3UD3P 2VFUA 1WWHA 4A57A 1HLWA 2UUAK 4PG4A 5KFVA 4DCHA 3ZTQA 2X78A 3UDVA 2V2QA 2DXEA 2F4VJ 2FHJD 2I5JB 1OYEA 3PKYA 2VH7A 1R0AA 2M8DB 3UKRB 1TV6B 3EGVA 2EEYA 2M88A 2QTDA 2XEXA 3MPUB 3L95X 3K57A 1J5OB 2HVIA 2F4VF 4JNEA 3ZSZA 1WC0A 2PDAA 3HI0A 4ZP6A 3IDHA 5AQWA 5KFNA 5EX5A 2Z2ZA 2VBZA 4NLPA 1BWEA 4BRFA 5LJWA 3FJ2A 5L8RC 1E6VB 3D2EB 4IJNA 3PACA 4FOEA 3ZT4A 4P2SA 4UZCA 2PFFB 1WF2A 5CYJA 2ZOGA 4E89A 4FJKA 5TKWA 2D0AA 4R0JA 4K4ZA 1RI7A 2AGOA 2POKA 2CZ9A 4KHMA 2UVVA 3SQ2A 3WNGA 4OX8A 1IJFB 1EZZB 2MTLA 1KBRA 1RDBA 1PKUA 4OZLA 3V9XA 3ZT0A 3QFPA 2HGLA 2EWHA 1IWAA 5HJYA 3RG6A 3THWA 3P83D 3IGVA 3MEEB 4F3MA 2E8AA 4E2FB 3BF4A 1M5KC 3LPTA 4HTLA 3A3NB 4B3MF 1VHIA 2DPJA 5H1SQ 1E6YB 3W2VA 5IV3A 3ZSXA 2CQ4A 1X8DA 2UYTA 1QVFR 2CPZA 2FLOA 4NI2A 3MCPA 2XYHB 3PDNA 4CWBA 2HZAA 4M1KA 3LDLA 1NKEA 3Q7CA 1ATSA 1QVGM 4J9OA 4IG3B 1Q16B 1TR0A 4BE1A 3WQTA 4OX9F 1FDBA 3C6UB 1NPKA 2IDOA 3MDFA 3NMUA 3HO1A 3F73A 4E8UA 4HH1A 1GLDG 1JLAA 2BV3A 4L6V3 3UDLA 3CFRA 2YHBA 3G6ES 2Q0UA 3VA0A 2E9ZA 1NHUA 4GW6A 3AB2B 1XNQF 3AO4A 1O1WA 2P9KA 4OZNA 4QWAA 3CJCA 4YUDA 1TUVA 5IT9O 2C2DA 3CFPA 3BKUA 4M41A 4QCLA 2AV5A 1N5TA 1FRKA 2QLWA 4DR1F 2R7QA 1XBWA 1DGKN 3AO2A 2O01C 1EO1A 5GAGI 1ESVA 2N4DA 4CEDA 1BWVA 1R8CA 3X1LB 4E1MA 1S9FA 1REGX 4N8NA 1PILA 3B82A 5KOWA 4DR4F 3SMPA 1T0TV 4IRDA 4NCGA 1WDDA 4K50A 4DU1A 2XI2A 1Q82O 3LDOA 3SV3A 3RAXA 2NPIA 3MXMA 4CGIA 2W01A 2XS5A 3M6GA 3CPWM 2KN4A 4DMZA 1AT1B 3PCOB 2KHOA 3I82A 4ZPWR 5E84A 4B1XB 1A9NB 4K4VA 2QWQA 2FVPA 1N48A 5C7PA 3QB0A 2R8IA 4FWMA 4KHRA 3ZETA 3MEKA 2ZJPQ 2JOQA 3DOKB 3TVZA 5AJ3K 1YVFA 3LGHA 2PT0A 2LU2A 4HTUA 1A5VA 3U02A 1T8EA 3AXKA 5KT5A 3BDPA 3WXKA 1MWZA 3NF7A 3C16B 4ZPAA 2ZH3A 3HLUA 3VEWA 1TL1A 5KGXA 1ITGA 3E1YA 1HKAA 2VOPA 4H54A 3O3LA 1S1XA 5LMNJ 2KZMA 2BOAA 2MKSA 4NASA 3EY1A 1GXTA 2AYMA 4CH7A 2DNKA 3TU5A 1LAVA 3AY9A 1KVAA 3UD4P 5JLHA 3HVTA 3C19A 3DXMA 4ILGB 3KHYA 1PJ6A 1SXLA 1YHQS 5HP1A 3EVWA 4FVCA 3L3CA 2VQFK 4DTMA 4TU9A 2RRBA 3SFGA 1GAOA 3MCOA 1NK8A 2UXBF 2AD9A 3L3UA 1BE4A 4CLZA 2P9KB 4FZXC 5DQIA 4PXDA 1Q81O 1Y64A 2JEJA 2DFFA 4D3HA 1YSJA 2ITGA 2NUHA 2C3MA 5JS1A 2Q43A 1NZ8A 2M3DA 1XIQA 1CJUB 3MM9B 2NPFA 5LL6Z 3TUIC 2NSBA 3CC4N 4KB1A 3FNNA 3V9SA 2ZVSA 2WSFC 2UXDJ 1YJNN 1Q82T 3E51A 2LDIA 1ZA1B 2BQRA 1SKUB 2NUBA 2CQ2A 1WJ9A 1XJWB 5DM7L 1S5ZA 3R27A 3CG7A 1J27A 2H48B 5BR8K 1MWKA 3JAMY 2HSTA 3KKSA 1X1PA 4FSVA 1P90A 2ZWHA 5IV4A 2F9JA 3ZNUA 4ZP8A 4JI7J 3KK7A 5KFOA 4YR2A 1W0HA 3M8RA 1KC8O 4WBFA 2XSJA 1NZAA 3OTCA 3RZAA 4CT9A 5KFFA 3TI0A 1RTHB 3QO9B 1N5YB 4OHYA 1U1KA 4C0BA 5LJ5Y 5FROA 1WKLA 4BLGA 2C22A 2RJZA 1JLGB 4QIFA 1WD6A 3IWLA 3DLEB 1Y3KA 2VGNA 4DN0A 3HHNB 1WELA 3B8AX 2B4VA 4MJKA 5LJVA 1U25A 4CM2A 3BP8A 3HVRA 3PZPA 1D09B 4O0IA 4CZGA 2VG7A 3JAMU 2JH3A 4CLPA 3A5NC 4EP5A 3C15A 4CHYA 2XLJA 4DU7A 4KV8B 4BGBA 4URGA 2E5LJ 4H0OA 1T03A 5KG6A 3U3YA 4B9TA 1TGOA 1P9QC 1CJKA 1AFIA 3EE3A 1NPRA 4A4JA 2GHWA 5KFCA 2QTWA 2P5OA 4O8KA 4EIAA 3OLAA 5AJ3J 2HRYA 1LWEB 5C42B 2UUWA 4DCPB 1E6VA 3LWMA 1JCFA 1RWUA 3K8WA 4H5TA 3C7NB 2VPWB 3AV9A 1V3ZA 1O6XA 3NNCA 3D6MB 4ZLNA 1N32K 2O8FA 5KPRA 3PIPL 3HI9A 5LMUF 2YBVA 3Q8YA 3BJYA 3TQEA 4Q5VA 3KOAA 1YVUA 1CC8A 3HM9A 4WZQA 3RU0A 4MO5A 2B6AA 3CC2S 2ILZA 2L9WA 4BRAA 2OPRB 4BRHA 3MMBB 2HS4A 2A3JA 3HX9A 2C3YA 4P7VA 3SQGB 3M32B 3GE9A 4FLUA 1WI8A 1F0XA 4CJVA 3ASMA 4FLZA 2HWIA 4W90B 2NRZA 2HB5A 2UXDK 1H73A 1BISA 2DHSA 3CD5A 4H5VA 3TAGA 5HAOA 2FLNA 5A8RB 2MGZB 1S9GB 2UUBK 1WC3A 3NXZA 1YBAA 3AVGA 3IG1B 3I0RB 4DR6K 5A76A 1IBMK 1DFDA 3ZEUA 2DCUB 1NG9A 3FSXA 3T1HJ 1S10A 3THTA 1RUSA 2YHAA 2FSNA 2J8SA 2QK9A 3RAMA 1KS2A 4FXWA 3K7RA 1S9EA 3NGTA 2CQPA 3W5ZA 2IJFA 4F4AA 1RBAA 3CSKA 2D3UA 1DAXA 5AXKA 3EZUA 3CCRN 3OA9A 3VAJA 3OYAA 4ZVHA 1KQSR 5ADZA 3V4IB 4TVAB 1NO8A 2BJEA 3FEXB 4DL3A 4GMKA 1I3AA 2ZZMA 3C65A 1L3TA 3ZTSA 3VEXA 3NE6A 2MY8A 4NLTA 2GBZA 2BE2A 4FYXB 3L4QA 4MK7A 4RG8A 1HQUB 1UA1A 3VAFA 1N0UA 4M45A 4IDKB 3F9KA 4RW8B 1WN7A 3OVSA 4JI4J 4P52A 1TKZA 3RRHA 3O9QA 1RTJA 2IM3A 1QSYA 4DR3K 5HL7Q 1VQNS 3GWCA 3NAEA 2ZOFA 4F8RA 1X4GA 2E66A 4QU6A 1C0TA 3QSYB 4EI2A 2IDLA 1GXLA 2QGFB 4FJNA 3NNAA 1WSFA 3MR5A 1ZPWX 4ZIVA 5DDQC 4NB4A 2J5AA 3CCSS 2QA4N 4IFEA 2HBKA 4ZLPA 4LMZA 4FZVA 4ANEA 1N36F 4NO7A 2GAGC 3NGZA 3R8EA 3TA2A 3VQ8A 1AUSL 2AQ4A 3IAS9 2GQQA 3R5CA 1RSCA 2OTLN 2IVNA 3AQOA 3D2WA 4KGKA 4PYAA 1GMVA 4A8QA 2KRBA 5GMKa 3RWUA 4WFXA 5EWFA 5K8OA 2G1DA 1AA1B 5KFGA 1L3UA 3GSDA 2X1BA 3WNHA 1RKIA 1RTIA 2AX0A 2KG0A 1NSAA 2CRLA 2HZVA 3DRSA 3A3PB 4J9RA 4FK2A 4O4RA 3O6WA 4RW4B 2WBMA 4Y2KA 4FWPA 4LFAJ 1FA0A 1YHQN 1XEZA 3WNEA 3SZ2A 2JSXA 4BR9A 2DCLA 5KGWA 3AVMA 2LEPA 5D8HB 5KFKA 3IR5B 4FW2A 5JVHL 4ECYA 4YOXA 1BMQB 4ZS6A 4WWSA 2N3LA 5BR8F 4NCAA 1M5PC 3KIOA 1JJ2M 2XO6A 3KG0A 1RCHA 3L7UA 3WX8A 2MHEA 3I56N 1YJ7A 4EO6A 1B9FA 4I6AA 2H4WB 4LH5A 4CERA 3FSIA 3LF0A 3O80A 2NCKL 3BBBA 4OKEA 3ULDA 2DH7A 3HHKA 3PW4A 3VF0B 5AQSA 1SL1A 1H74A 2DR6A 2KB2A 2EG1A 1IJEB 1NH8A 2Q6BA 5J2QB 4X64K 6FD1A 1ZBHA 4KHSA 4GKJJ 2OD4A 4I68A 2RUSA 4J9UE 3NBPA 2E5JA 1IBLK 3BSAA 1U6BA 4JI4K 2Z1JA 3MURP 3VVTA 3N9UC 2DRAA 2FC9A 2VG5A 2O8DA 2VV5A 2OHDA 3QESA 2C3PA 3G87A 4TQSA 3VQ4A 4PEOA 3D3BJ 2EG2A 2NRRA 1S1TB 2FJDB 2EK1A 1RCXB 3I5BA 2QC3A 1M90T 3TZYA 3GB0A 3THVA 5ETVA 4BR2A 4YR0A 2O8CA 3KDNA 4OYIA 2ZWOA 3O4NA 1GLJO 3ENBA 8AT1B 3KUHA 4BRLA 4U67Q 1KEKA 1D1UA 3QEVA 3UNGC 3PR4A 4AHCA 5AQZA 2VG5B 2AZ3A 3DC2A 2YWFA 1CJVB 2GGPA 4O0NA 2Y8YA 3C6TB 1S4FA 3LL3A 4KGXB 3PG9A 2GV9A 4OKJA 2FB0A 4AL6A 1DTTB 2WSCC 2IPOB 5J2QA 1U0HB 4LRBA 1S79A 2JJ4D 3V1RA 3BN4A 3GZ7A 1RT5B 3MM8A 5F8LA 3DXKA 5I3UB 2YKOA 3ZC4A 2GFFA 3W5XA 4N77A 4FJIA 4DR5J 3FMBA 2CPXA 4QOZB 2YHYA 2VFTA 2ZNZA 3JYTA 4X65F 5AQKA 2ZM6J 3TZXA 1RBOB 1TZ0A 2AJ0A 4FNHA 3WXLA 1TQLA 4RUAA 4CM0A 1X5SA 3OYJA 3GILA 3ZZPA 2R7YA 4XAKA 5A8KB 3ZZOA 3BPSP 3QWPA 4RPFA 3H20A 2P9SA 1YGYA 5KFDA 2RSQA 4RNNA 1YITN 1C4CA 4RR5A 1BUPA 2IYIA 4F7VA 3W3DA 1UZHA 4B3OB 5FLXY 3J80Y 3W0LA 4X62J 2HWHA 4RW4A 4O5FA 2JHEA 2V8GA 2D1CA 5HLFA 3IGNA 4OQJA 4UOFA 3ET6A 1KNZA 1XWLA 4BROA 1IR2A 4J2EA 5BPLA 4MO4A 4O3OA 3VGKA 3RBZA 3VEVA 3BM7A 4F3OA 5C0YA 2OPQB 3MOJB 4PL7A 3OYHA 1RWPB 5HQ8A 1Q81T 4QW9A 2AGPA 3VQ9A 4J9QA 5ETOA 3CCMN 4CP5A 3K8VA 3HK2A 2A18A 4GVEA 1UWBB 1OWXA 3TWZA 5A8WA 1FXLA 3CDEA 4UY8O 1MW7A 3TP2A 4DPYA 3LDNA 1NH7A 3M2UA 2XMKA 3ENHA 5D0HA 5BPNA 2W6KA 1NBWA 3F5TA 4OYAA 3ULEB 3MN7A 1W2IA 2IIHA 2VONA 2XQCA 1NGFA 4QPTA 5DJBA 4URQU 3V2UC 4ZCMA 1LK5A 1TL3B 2WBNA 3MMJA 4NLVA 4V19X 2ZJQL 3W5YA 4D3GA 1X31C 3THYB 3J81U 2Z1GA 5GAEU 4PUOB 2D69A 3UR0A 5J2PB 2DIUA 4IDKA 4P7TA 5ADXA 3AQPA 5I42A 5BRFA 4EYHB 4BRDA 1NMEB 4AD6A 2DR8A 3D6FB 3D6RA 5KRSA 4M3RA 1G6BA 3HFZB 2V8DA 1TU0B 3V4IA 2IRYA 1NGIA 3NF6A 3HPGA 1R0CB 3ZZRA 5B7WA 1UJ6A 1FX4A 1N4LA 3AFGA 3Q22A 1BOTO 3F0NA 3R6LB 2HMIB 1IQTA 4LUBA 3LDPA 3BSOA 1RDDA 1UEKA 3H2VE 3QINA 1NKBA 3ZZUA 3HSJA 3W66A 2L08A 1RHMB 1VLYA 4KR0B 3B4DA 1I94F 3TSUA 2I1RA 3CCTA 1C0TB 5HOOA 1EETB 3BKTA 1FNXH 5GAHI 1SJRA 4YB1P 4KY3A 5H9EK 2DO4A 4IFVB 2DFEA 4NLGA 3QIPA 3QAEA 1RGIA 4B1WB 2P9GA 3TRGA 5C2GA 2HEKA 2ZBCA 1YXQA 1QQOA 3CERA 2JLFA 1YJWS 4BVOA 3LQVA 2XSFA 4TY9A 3OFFA 1A0OB 3B54A 3CCUS 3K17A 2YKNB 1YI2S 4YDUA 2QLFB 2G8HA 2JL9A 3ZZ0A 5F9NA 4CJLA 3LP0B 4K8ZA 3VQAA 1QTNB 3OS0A 5IC6B 3DYAB 4ZP7A 3MAQA 4DG1A 1WBDA 1WSHA 4KSEB 4DL5A 2UZAA 3VQPA 4M63C 1GEHA 5DQHA 7FDRA 1WOQA 3D3CJ 2CWKA 2OFGX 4CHNA 4J8FA 4CZCA 4YB5A 2ZH4A 5CZ2A 2XNQA 3D6HB 5GIPA 2X74A 3OSPA 1NJIO 1LW2B 4DV7F 2HKEA 4JB8B 1VSHA 2ROEA 4IH5A 2MLZA 1KFSA 2D41A 4GO7X 4IBNA 2QXFA 2CJ9A 5A8WB 1G99A 3I0RA 3RW6A 2VWKA 1M0SA 1BI4A 2VCPA 2JEGA 3EZ5A 4X4NA 1HBUA 4XDCA 3KWGA 1C1BA 3EPIA 4C0HA 3AA3A 1YTYA 1T7PA 3T9NA 1UW9A 2K06A 2E1ZA 5KQ8A 4A8KA 3LM9A 3MMBA 2OPRA 2XS2A 2E2OA 4FWNA 1Q86O 2BA9A 4Q2MA 3IN5A 4WQ5C 1K1QA 3CULA 4FOIA 2IFXA 1G1XA 4H0VB 4ZVUB 3M6XA 4XO0A 2HNDB 4O4GB 3A8YA 4AM6A 2J6TA 4CJUA 3QBWA 3GP9A 1SKRA 4TLQA 3R3TA 1T3OA 2MLYA 1LWEA 3E01B 3P5JA 4FJ8A 2RIJA 2EX3A 4LJMA 2BANB 4CJQA 2DNHA 3M8QB 2PD1A 2VODA 2P9SB 1U2FA 2O5DA 3HYFA 5E26A 2BM0A 4C1NK 4KH0B 3DLLL 2DNQA 4PZVA 6AT1B 4KRWA 3W3SA 4CRJA 5G0RA 1D4XA 4FLYA 4NOHA 3PJ9A 5IWAF 2XY6A 2O4GA 4J2DA 5HROB 1WEZA 5H9FJ 3SAGA 1QM9A 1VHXA 3TAFA 1RADB 3TJ8A 5D0GA 4H03B 4FXVA 1W9HA 1P1TA 1MROA 2ZDPA 1WDTA 1BQNB 3AGRA 3S6EA 4PKDB 3DLKB 3KLVA 5BYRA 3VESA 2YNIA 1YRXA 2OSRA 4Z2XA 5AXMA 3TTDA 3TUZC 2AJ4A 1NDLA 1BQXA 4NXNF 3VEYA 4K4UA 2K1RA 1NBEB 2EK6A 1K73O 4CZIA 5HBMB 4EGLA 1TMMA 4PG7A 5DM7Q 4LF7F 4YMEA 4B9NA 4ECVA 2CQCA 1WEXA 3KMQA 4GO5X 1NK5A 1EKRA 3IS9B 3O2IA 3C16A 3DMJB 2PO4A 4PKHA 2PFUA 5C2DA 3ENQA 1ATNA 3M8PB 1U02A 1XTZA 4KRFA 2Z56B 3CDBA 4DV1J 4YEAA 5HRSA 1ICEB 1VQKS 2HLTA 2QI2A 1NGBA 2V6AA 3G71S 3VQDA 1QY7A 1BXNA 2JLEA 1J54A 3G86A 2VDHA 3ZZTA 2NREA 2EI5A 2D7SA 3PV8A 3DDKA 4Y2CA 4ED7A 2HBQB 4LF8K 4FPAA 4EBEA 3W1YC 1BG3A 2CJQA 3S3MA 4G65A 3RBXA 1VRUA 2X1FA 3QETA 3EX7B 4MIAA 2VFRA 3CCVN 3E3XA 2PMZD 1CBKA 2RPIA 5LMUK 5I3PA 4RUBA 3PX0A 2F5GA 4JI5K 1CEZA 3I96A 3CT9A 1UWAA 2VL1A 2Y1RI 1V5VA 3HHLA 4F36A 2KXHA 2W7OA 4PWDA 4R8UB 4K4TA 1XMOJ 3MWPA 3SCIE 1EQ0A 3U9DA 4X66J 4I7FA 2G0CA 4F4YA 3UKUB 3GU0A 1KVJA 2NQPA 2CGJA 4CH0S 2X51A 3CF5L 1DTQB 4G1QA 4IKAA 5HMWA 4ZVRB 1YDLA 3LPYA 3QT8A 1H38A 5EGYA 1VSLA 4YHHJ 1VRQC 2K3KA 1SQGA 5HI7A 4WZMA 2FJVA 4XDDA 3D54A 3EWGA 1S1VA 3LANA 4F3QA 1IKYB 3CCZA 3CCQN 1NRKA 4DV6K 3CDWA 1RACB 2VGMA 2AP1A 3QZ7A 1SZ2A 3MMAA 1ASWA 4NYNA 3CJ9A 3TZWA 2CZVC 4DUZJ 1KVKA 3QMLA 2RS8A 3LOUA 5A0YB 4ZVSB 5FRMA 2YQ1A 4URSA 1VQ4N 4K0KJ 2ZH7A 4BQLA 1B0VA 5D6GA 3MN9A 1DZ5A 2G2ZA 2HFUA 3VALA 1SH3A 3L4IA 1CJTA 2YX6A 4C4WA 4QU7A 4CTAB 3VQ5A 2IS3A 4M3ZA 1VQNN 5E41A 1Q4RA 2UUTA 1FNMA 2PA8D 5KFEA 3T1HK 4F67A 1MG7A 4KT0C 2IA0A 1AFJA 4DCOB 1D8ZA 2RDDA 2HS0A 4LSNB 3KD5E 3J7YU 1I39A 4KBOA 3NGKA 4RUCA 5CZ1A 4E7HA 2W2NP 4DSEA 4JP8A 4G6VB 2A2CA 2FZKB 1BIZA 4C8ZA 4EBDA 3KXDA 4AL7A 1NGEA 4KTWA 2ZM6K 1X9MA 4F4ZA 4A59A 1YRUA 3KHRA 4DQQA 4IFYB 1VQLS 3TR5A 4LF6F 2XS7A 3ALYA 2VASA 3CJ7A 1LWFB 2DITA 2QWLA 2XM3A 2KYXA 1QQCA 3GYGA 2DIVA 3PHEA 3PYEA 3D2EA 3FK4A 1JKHA 3VGUA 5HO4A 3ZSOA 2HHXA 4KB7A 3VGVA 3MXIA 2HRTA 3DLRA 3IMXA 3DJCA 3G6VA 2O67A 4CEQA 3G9CA 1EXQA 3ID8A 4CECA 3QRRA 2CH6A 1T6DA 2XHWA 3EE9A 4ED2A 4ECZA 2VD3A 1HNWF 3D0GE 4U7UD 3DI6B 1R0AB 3WUHA 4USTA 4MLEA 2U2FA 2YKAA 4CK1A 3CB4A 3FDSA 1UFKA 2DGQA 1IUJA 1X4CA 4KAZA 2FVRA 3CC2N 4CE9A 3FQLA 2OJ3A 3UN2A 5BR8J 2BGGA 2HFVA 5AFUH 4IOCL 1W26A 4H4MA 1QVFM 1OY6A 4JK9A 3AOAA 1SC1B 4GC6A 3T1HF 4OZ3A 3U8XA 4JBCA 4UUWA 5F8HA 4H4KC 1LAWA 2PIIA 1OVQA 2XULA 4C3LA 1XNRK 2M8HA 2KZZA 2KW4A 1AZSA 5IOLA 4FF2A 3VENA 3BF1A 5IQ6A 1YTAA 3O9RA 4NXMF 3NS5A 5E2QA 1TK8A 3UKUA 4X4QA 4GVBA 2BUPA 1NLVA 2CJAA 3UKRA 2OEMA 1BQMA 1NGHA 1NLKL 4C3KA 1ZBUA 4HKQA 4OYMA 4X4SA 4HT5A 5KFSA 5E3QA 1XHXA 1PCAA 3C7NA 3JXUA 5M2RA 2RB7A 4M63A 4DWIA 1UAXA 2P1JA 4UOHA 4CO4A 4X4RA 3PUFA 3NOCA 1IO2A 2SXLA 3HFVA 1JXVA 3PIPQ 2CQ3A 4HTIA 4BVPA 1HNWK 1ZM2A 1WUAA 2EKYA 4KPYA 4YS2A 4ZA1A 2YX1A 5FIIA 4Y00A 2J9CA 5CZVA 2WSEC 3PHTA 2M52A 3GLJA 2AGQA 4UF4A 2VJVA 2MQQA 3CCRS 3GL1A 3EN9A 4LF4F 2HHUA 2LQ5A 1SL2A 4F0MA 4OZ2A 2J8AA 1PC4A 2L9DA 2IMWP 4BC5A 3CDAA 1RBTA 3NGYA 4ISGA 4B9QA 3OW2R 4WP3A 2KVIA 4E0DA 5DRKA 1V4TA 1F21A 1RAHB 4OI4A 1FI4A 3CIPA 2OPSA 4JV5J 1H6KX 4JKGB 4OO1J 3VQEA 4RNOA 1NDPA 4X84A 3K0JA 1HR0K 4Z0UA 3FEZA 2WB4A 5KFHA 2DNMA 2OZMA 4DQSA 2JDJA 3W62A 3VCDA 1N33F 4GKJF 4QWCA 2BXJA 1HWUA 1SBRA 4HEA9 2VC1A 2AYBA 1BA1A 2F96A 2OZSA 1OH8A 2XG8A 1NOYA 4RUHA 2L9NA 1BQNA 3Q24A 4M3XA 4CO0A 2W9BB 1QQMA 4KO0A 3RSEA 5DM6L 3W2WB 2RHSB 2BW2A 5U47A 4CF2A 2R9LA 1YJUA 1YJTA 1H1VA 1F3FA 1GMUA 4BR5A 1G2EA 2JNJA 2V68A 1N32F 1HBUB 1CPZA 4ATNA 8RUCA 1U49A 4DX6A 3HTVA 4ID1A 3KFWX 5HP1B 1RT6B 2C2ZB 1DQAA 4JRQA 4CH1A 3BN7A 2XY8A 3CCJN 2EBGA 4LR9A 3IWNC 5EUHA 1XMQJ 1WACA 1UVKA 1RB0A 4ANCA 4U96A 5KT2A 5F8NA 2IM2A 3NG8A 3HT3A 1JJCB 2G8KA 2IDEA 3NGDA 2ZQBA 2YKNA 2MXYA 4B3RF 2CDQA 3HP6A 2CQIA 4ZVTB 3CCWA 2AHOB 5GAEP 1GMWD 3MMCA 1X3NA 1QAXA 3HBTA 2F8MA 2D3ZA 1VQ7N 1HKGA 2W8KA 1G7CB 2KFZA 2QO3A 3A12A 4IO8A 4JI3F 1L3KA 2ACMA 5D0RA 1S72N 2H5EA 4WFAQ 2FIUA 2IY5B 2AP6A 1N34K 2WVEA 1B99A 5E3RA 2YV0X 2JFDA 4FWKA 1KOOA 3ILIA 2CAJA 4OV1A 1HBNB 1HI8A 4JAXA 5DO2A 2EFOA 1U1RA 2QKBA 1S77D 2RNEA 1NJYA 1HNZK 4LFAK 4QS8A 4CLUA 1PAEX 1LW2A 1VAZA 3G96A 4HHUA 4DEZA 1HBMA 3MN5A 1C0GA 4NA3A 1MU2B 4LRDA 3ITHA 2PC6A 2CQDA 3CFOA 5DGBA 2Q0RA 4FJGA 3DYAA 1CQMA 2F7TA 2HYIB 3AVHA 2AYGA 3UIQA 3WDOA 2ZH2A 2Q1LA 2C2RA 5AR0A 4DPWA 3FSYA 2QRRA 1D5AA 2NR0A 3TOQA 1UJ4A 1VQ9N 4RW8A 4NEZA 4DV0F 2VZ9A 3CD7A 3QGHA 2O8BA 3NH1A 5EDWA 1ZAWA 4I69A 4DXLA 2EXUA 2VUGA 3CETA 5C10A 5CYMA 5ETSA 2D9PA 5KG4A 2FJAB 4HI2A 3IRXA 4A8SA 1ZZNA 3SUOA 1PJ5A 4NI2B 2I9SA 1Y11A 2BJ9A 3PJXA 4CD1A 5J1EB 5F0WA 2BJ8A 4YOEA 3HOSA 3GOIA 1HA1A 1UZDA 3CC7N 1S7HA 3S01A 3G0ZA 1IG8A 3D4JA 2HHSA 4Y1DA 2XTJP 5J1NA 4JKHA 2WVFA 3HSDA 4BBYA 2ZDOA 1AW0A 1HIYA 3V1QA 4Q8FA 1YJVA 4OHZA 4IZ9A 4I2PA 5BPMA 2B3TB 2RRAA 5KG3A 3VEZA 1VK8A 4MLHA 2QZ8A 3T3FA 4LR8A 1HPZB 2HURA 3OYLA 5AQJA 2FSJA 1C0UB 4U9RA 3JS6A 3BGUA 1GTEA 3VZHA 1DLOB 3VMFB 4JI6K 4NX9A 1MMLA 4CFAA 3NRBA 2HBJA 1RQ0A 1VQYA 3ULEA 3SSSA 5C25A 4DV3J 3JQMA 3A0IX 1RT7B 4RBTA 4X4TA 2XGQA 5AQIA 3I5CA 1QS4A 3M2UB 1OVYA 2KT5A 4P71A 1V3SA 5K8PA 3KLIA 3DFEA 1QSLA 4CJTA 2BR0A 4C97A 3OYDA 4CFCA 4DR4J 4DCJB 4B3TK 5IS2A 2VJUA 4N5SA 4DSIA 4FM1A 3U7JA 1GLFO 2C1EB 5C5JA 2P6TA 4OI6A 4TN2A 2RQ4A 2IOCA 5J2NB 3UD5A 2YNFA 3N6NA 1SH0A 3FZKA 4KI4A 4F0KA 3PX6A 1Q7LB 2J76E 1ZOTA 2IAJA 3UVJA 4MK9A 2COLA 2ZBQA 1XNQJ 1JLCA 3CQYA 4BACA 4RBUA 3ET6B 4ED8A 1N5YA 1ZYQA 3GG4A 5HLFB 1FDNA 4CJFA 4C8NA 1TKDA 2CPDA 1ZH5A 2PA3A 5BJRA 3DRPB 4CD3A 1WI6A 2GWJA 2OD6A 4OYBA 3QJJA 2HW3A 5C15A 4XIUA 4L74A 4WQ4C 4EHUA 4OLAA 1UJ5A 2F8TA 3QATA 4KH4A 4X64F 3KWMA 1B70B 4DZDA 1E3MA 5ETNA 5A8KA 3AVAA 1P6TA 5CYMB 4LF4K 2VC0A 2WAQD 5M1FA 3TAPA 2FBYA 3AVNA 4EWTA 3MM7B 4BC2A 2HQIA 2OPPA 4PWWA 1U2CA 5HJXA 3FBBA 4A8MP 4EZ6A 4A5AA 4WF9L 4WQ5A 1S1TA 1S0OA 4ICLB 2KYZA 2KRRA 3ZSRA 1S5JA 4Y65A 1RT5A 1UVMA 1R6YA 2B5JA 3VQ6A 2FF3B 4KPCA 5B8HA 2KJVA 3QBXA 1CSJA 4J9MA 3R5DA 3M6WA 2I7NA 3ITHB 1RT4B 4UY85 3AVCA 2WVDA 2YTCA 1M90O 1VFJA 4WKRA 1CZBA 3M2VA 1QD1A 4OPJA 3LGNA 1TAUA 2AW0A 1TKXA 2G9OA 3PR5B 3MM5A 4ZKAA 2X1GA 5CXTA 4TY8B 1NOZA 2ZC4A 1KSPA 3PJWA 3FFIA 3HHLD 5AQYA 5MAOA 4CF9A 2HQ3A 4PKGA 1MN7A 2I0XA 3UN3A 3GG0A 3ONQA 1VQKN 4OIXA 1T3VA 4NMXA 3M7VA 3TVYA 1V6HA 2RU9A 2OA8A 2X3GA 2G13A 4N41A 5CA5A 4NLBA 1RHRB 3HM8A 4HACA 9ATCB 3LP1B 4RW9A 5AFUA 1RWMB 4XTTA 4O3NA 1PO6A 3BGOP 3KKFA 4EYIB 4QIEA 5AZIA 4PXCA 1HWIA 4JI2F 2CNLB 4Y2AA 1G15A 4DF4A 2QA2A 3BBFA 3NVMA 2WW4A 3IBWA 3NCRA 4WU2A 3O9TA 1N8RT 3OS2A 3VV2B 1HBMB 1S59A 2I8EA 5A6PA 5F41A 4NXMK 3D0HE 2WRMA 3VOVA 4ID8A 2PEHA 1FX2A 5GMEA 5EU7A 4ZCKA 2A0FB 4CJ5A 2AJ2A 4DUZK 1RGVA 2P6SA 2FJXA 2YXLA 4RWWA 2CG4A 1D9FA 4DI6A 5J1PA 4WU3A 1HMVA 3D66A 1HHTP 3QNWB 2W41A 3LW5C 1U45A 3GR0A 3FCHA 2MMYA 4Y0WA 1VBZA 2WFBA 4ETXA 4C2MA 4M7XA 4K0KF 2NXJA 4ILHA 3MMCB 3E66A 3V6JA 4CIFA 2R42A 4YQWA 5M2UA 1BA0A 1KDNA 1VMBA 3B8HA 3LH2S 3PO5A 1T9UA 3NY0A 4XH5A 2DTUA 4EEYA 4K8RA 3MTJA 4TYBA 4CHZA 4ISEA 3O3FA 2IIRA 4K25A 5F3ZA 5D4LA 2FY1A 4CGGA 2DEJA 2KXNB 1XC3A 4TYAA 3VN5A 3G6EN 3D1QA 4O3PA 3NCQA 1TVRA 2OEJA 4IOXA 4CIOA 3NOGA 3GONA 2CQGA 2Q97A 4FVMA 3T1YK 3VWSA 2A5XA 1X4DA 3QT5A 5KTQA 4J9VA 4CJWA 4OI3A 3NWRA 4QW8A 3GYXB 1RBSA 4ALZA 2RF2A 4AFFA 4NRTA 5DDPC 3R1XA 5AQGA 3HZGA 1PBAA 2UV8G 1VSFA 3H7HB 4WE1A 3NDKA 1WTBA 3THXB 3FBFA 3WIUA 2QLJB 2W8LA 2P9EA 3KHGA 3F56A 1T95A 4DL7A 5DGAA 1WOOA 3ZZYA 3RMCA 4IDHA 1DEJA 4ZMMA 2B51A 1O0PA 3PEHA 2V7ZA 3J81O 2IJNA 1ITPA 3G8TA 4USWA 4HTJA 3QEIA 1YBTA 3ZSQA 4U95A 2H3GX 2F9TA 2CQBA 1RWOB 4NLUA 5A8RA 4JI2J 1N8RO 2P5VA 3ID6A 1AYEA 3L2QA 5ITHA 3DKDA 3L09A 1VBYA 1VQMN 4CEOA 1Z26A 5KFPA 4Y0FA 1U09A 1HNXK 2OPSB 5B0BA 3R5BA 2DNGA 3HXMA 1S6PB 3V6DB 5B0GA 1U6FA 3F9MA 1P9YA 4OYWA 3M32A 1BQMB 3M30B 4FYVB 1J5OA 1GOBA 3ISNC 1LKZA 2W7AA 4CFBA 3MM7A 4LF5K 3UPFA 2NUUG 3RW7A 4CO2A 4AXIA 1DBDA 3A4TA 3NH2A 1TFYA 2DISA 4KGZB 4OI0A 2F63A 3UW1A 2VQEF 2ZGYA 4KREA 3T5LA 4CNYA 4L8RB 1NPPA 3VZIA 4LSZB 1VS3A 4PG8A 3OTOF 4MKBA 1S0VA 4O3QA 1JJ4A 1ZM4A 4J37A 4FJ9A 2N7CA 3LAKA 2YH1A 1BO5O 3AVIA 3L8BA 4IH6A 2HFSA 1ATRA 1RAFB 3SDEB 2RKIA 3T1AA 4FZZA 1QTMA 1HR0F 1GX6A 2VG7B 3CNQP 4Z4IA 3H8YA 3PSIA 2XGPA 4ZPBA 5DS7A 4LQ3A 3GFHA 4P2FA 4DV2K 2HG4A 4LSLB 4ZN1A 2XBPA 2HMPA 3CCJS 1DQ8A 1XR7A 4JI8J 1Q53A 1GLBG 2ZE2A 4AM7A 2BQUA 2GVDA 2MY7A 1Q7YT 1RWKB 4LFCJ 3JSRA 4DSKA 1TFWA 4ZJLA 2GS8A 2VQFJ 2RHQB 2HAIA 3NAIA 1K9MT 1JLBA 2V8HA 1QVGR 4ZPDA 1GK8A 2RDJA 4Y2MA 1BIUA 1LEOA 4L3KA 4NZ7A 5D15A 2VFSA 3CM6A 3LP3A 4R25A 5DQGA 3GYNA 4CYUA 3WT0A 5FPEA 3AY0A 2XHBA 5IFMA 4LD0A 1YBUA 1FTRA 4B9MA 3O8MA 5ETTA 4ZCIA 2L3MA 2FVSA 5LY3A 3SJHA 4BC9A 2GAHC 5JVHQ 3N01A 3C15B 1Y5NB 4KQZA 5KOXA 3KZBA 3WXJA 3FLCO 1XERA 3BR9A 4YP3A 3KLHA 2NXUA 3MM9A 3LUYA 1X7VA 1HHQA 4OLOA 1NK6A 4WCEQ 1HPZA 1C0MA 4FF1A 3CMES 3DI6A 2GTDA 3OBYA 4IOAQ 3DU6A 3JSMB 4AQYK 2IVOA 4NXNJ 2MLXA 5ETMA 4YOVA 2ZJRL 1TELA 2VU5A 4LF1A 3WX4A 4A47A 1K8KA 2DYAA 1R8PA 2LSNA 4FO0A 3UFCX 2DD8S 3VQSA 1VGYA 4ANDA 1W97L 4XPEA 2ASMA 5C12A 3I55N 4HL9A 1ZZFA 1RTDA 1VSIA 4WP9A 4ZOSA 1EAYC 3FMWA 1S48A 5H9FK 3SCJE 4CW7B 2HIQA 4B1VA 4X64J 1N36K 2OGUA 3AT1B 4NL5A 3U1NA 4I6MB 2VKRA 4FJ5A 4CJKA 4CZJA 3UDEA 3OBIA 1KLMB 3EKUA 9RUBA 3ZSYA 1ZTTA 1IH7A 2E88A 3HD1A 4BHQA 4MIWA 2B7CB 2DR5A 2AEFA 4DKWA 3OUYB 3H25A 1F2GA 1SVDA 3G8QA 3UNYA 1QUPA 3MUVP 3SQ0A 1FWLA 3PSFA 4K4XA 4O44A 1RT1B 4PYDA 2E1MC 2CKWA 1CJTB 4JKAA 2F7VA 2P2CB 4I7FB 1FJGK 1SUQA 3DHXA 4F4WA 3K0SA 4JI3K 4I64A 4PY5A 3OYCA 3FRZA 2ZM6F 3GJRB 1FHTA 2UU9F 3R5AA 1YITS 7AT1B 2RE2A 1FKAF 2ALZA 1RHJB 2NRTA 4J90A 5M1KA 1F9FA 2B8QA 5CCMA 3UO0A 1HLUA 3PW5A 2WONA 1S1XB 1MWMA 5HL7L 3OVBA 4E19A 2XCPA 4A8FA 5HSPA 3FKBA 4CJ4A 3GSIA 3A3OB 4ZK7M 4MYUA 2FDNA 5IQQA 3CXCR 1XNRF 3MWTA 2HS3A 2FJBB 3VQ7A 4OYOA 1T9XA 3R5JB 2M0GB 4F4XA 1IM4A 5KFYA 1T3NA 4CBXA 3MECA 3TJAA 2UVWA 4WYWA 2ILYA 3THPA 4XH1A 2DNRA 2R2RA 2CPYA 1OYDA 3L3VA 4AH9A 3RRKA 4JEPA 4KGVB 2NLWA 1RDWX 4HYKA 4I6WA 4DQIA 1GT8A 2DY1A 2ZH9A 3HHLB 1CZAN 5HBMA 1WSEA 2M5YA 5IWAJ 3SI8A 1FF2A 1BY9A 4MIBA 3FFKB 1TUWA 1Q5YA 4DF8A 3TAMB 4M3UA 4OYZA 1EP4B 2JWKA 2ABYA 1FXDA 1F5CA 1FW6A 1VRUB 3CW2C 3D5MA 3EO3A 3SMZA 2LXUA 3MX5A 2B8PA 4LC9B 5AQQA 5H9EJ 1ASUA 4NLWA 1NAQA 2NRHA 3LDSA 4CGDA 4KB0A 4WIIA 3PIOQ 1Q86T 2WUSA 4BRKA 1X0FA 2E6MA 1Y00A 2B9EA 3H3OB 1HW9A 2BBEA 2CJKA 3TR8A 3OUYA 4PQAA 3W63A 1RAAB 4DMNA 2ZBIA 1KONA 3CM5A 1KLMA 5G0RB 3PTWA 2HQGA 5KFWA 3DMJA 4TU7A 3AJ2A 4CZFA 4WFYA 3O8WA 4CZLA 2PE8A 1N34F 3AA4A 1TL7B 5ETKA 2CQ1A 1BHNA 3U27A 5AQRA 1RTDB 5L39A 4CO1A 2G8IA 4CO3A 3L2WA 4CZHA 1DHMA 2UUBF 4C98A 1T02A 5KFUA 1DARA 2HAFA 1LFPA 4FJJA 1MLAA 4BY9C 1ZBLA 4JKGA 3DXBA 1NJWA 3GIIA 2HNDA 3N6MA 3BQ0A 1VI7A 5I4MA 4BR7A 2BW7A 1DJ0A 2WOMA 4NWBA 2RAQA 3D6TB 1TKTB 5CYQA 1MDUB 2RQMA 3JSMA 2F3JA 3VAMA 5LSOA 2NXEA 4KTZA 2CGLA 1HWJA 4K4YA 2HVZA 5IZHA 1R7IA 1Y0HA 1VR6A 2BUNA 3RTVA 2XB2D 4DUYF 5HROA 3ENVA 4KO0B 1M1KO 4PCQA 1BHLA 2E7XA 4Z7YA 1EB0A 1C1CB 4JYAK 2NZ4A 1CXUA 1G3OA 3DWLA 2IVMA 4CJ7A 3DLGA 4B3SJ 1M5HA 2HLUA 3IBFB 1HQEA 3H5UA 1QQNA 5H1SV 2CIMA 3QJLA 3H08A 2ZHOA 1U8SA 3C94A 3M8QA 1EP4A 4NZ0A 2M9KA 2D0PA 2MZSA 1YJ9N 1YJRA 4U67L 3GG1A 2XO7A 1RTZA 1TMJA 3G82B 1X3MA 2I2YA 4M5DA 4DSLA 1V5IB 1LK7A 3AAWB 4O4GA 2AF6A 1EHWA 3BBCA 1CLFA 3NS6A 2ZWPA 2HNZA 4CEFA 5T7LA 1IN0A 1S1WA 2BKNA 4JI5F 4CNZA 4FPIA 1S97A 1ZBFA 3DOLA 1VSMA 2PMHA 2V0NA 3BSNA 2OANA 4C8MA 1MMNA 2FJWA 3SXLA 3MTKA 1QAJA 1SCJB 2J7WA 5M1OA 1R8HA 2BOPA 3NH0A 2V69A 2DT9A 2EFNA 1F2HA 1RP5A 2GQ2A 1C1BB 4U6PA 2G8UA 2YKMA 5KRTA 3J80U 4NPOA 1IBMF 1F3VA 2Q2RA 3EKSA 4GMJB 1R8AA 3H5XA 2HVHA 4P75A 1DQ9A 1FFGB 4JLHA 3G8SA 2DNLA 3V6HA 4B3RK 1F9EB 3W61A 2CYYA 1FDAA 3PNIA 1X4AA 3JS9A 3MPWA 3CJBA 1KHWA 1FKPA 1DT9A 4ZLJA 4KHWA 3B4MA 4DR5K 4NLRA 3FCWA 2DGVA 1FJEB 5AQVA 2LKZA 4YDDB 3UI3A 2V94A 4DG1B 1CQNA 4U7UK 3B78A 4MK8A 5G4DA 3OL7A 2MKYA 1NMDA 1WC4A 3DAWA 4OZ1A 1OIAA 2IVPA 1PJ7A 1X60A 3ULHA 2JC0A 4OPHA 3VA3A 1KKHA 3O9SA 3KHHA 1GLCG 2HHQA 1IBKF 1WLJA 2MJNA 3CMAS 2VPZB 4HDHA 4YN3B 3S9HA 3DDNA 2G0IA 3CEDA 5D0EA 4DFKA 5KG0A 3TJ9A 3HPHA 3QWUA 4K43A 4WF9Q 3POTA 3OS1A 2N82B 3L6QA 2ADBA 1Q9XA 1HYSB 2XC9A 3MEDB 1L3VA 2VKZG 2YWKA 4AUKA 4JKBA 4U7BA 2ASYA 1VYAA 1FKOA 1VOMA 4W5OA 1OH5A 5HRPA 3CJ2A 1YVNA 3PRBA 3WIVA 3MK6A 4LSNA 3THXA 5E7OB 4KH6A 1D3WA 1Q18A 1SI9A 1K44A 4JV5K 3NNHA 3LAMA 4ZVGA 3H98A 4WK1A 5BREA 3OJUA 1MWYA 4M5KA 1R6VA 2CNOB 4FLWA 5FDLA 1R8BA 2GUPA 1FFWB 2F1FA 2GMHA 4A8WA 2OP5A 1N54B 2D3O1 4OGEA 2G2YA 1K73T 2AWZA 4KHNA 2ZJQQ 4B3MK 4FM0A 2DHXA 3VR1A 4PUOA 3C66A 3K5MA 2BKOA 1RHQB 4FS2A 2GWKA 2VDIA 1NWKA 3GFZA 3PVXA 4NXMJ 3SPZA 4ZVOB 4DHYA 2P9LA 4B1YB 3AO1A 1UETA 3HVWA 2R7VA 1P1LA 3AVKA 4UT4A 3IBCB 3MXJA 4M3YA 1SV5A 2A42A 4V19S 3T9ZA 4ID5B 3M3ZA 4HCBA 1YJ9S 4DQPA 1GXUA 3NMAA 1VC0A 2HQDA 1UA0A 2E5HA 2ITMA 5DG7A 3CGIA 3AJ1A 2D4WA 3DGVA 1TK5A 3OYNA 3NWGA 2YHWA 2NSCA 1ELOA 1VJQA 4F26A 2W4PA 4K5SA 2QA4S 1J5EJ 1U1MA 3CCSN 3NP5A 1M1KT 4ISFA 4WFNL 4USIA 2F4VK 4JI6J 2DGTA 4X65K 2Z1IA 1BDGA 2BKPA 4GKKF 3MM8B 2H1YA 5HATA 4J9NA 3MMAB 2RKIB 3DM2B 3CJ4A 4WFBL 4ECRA 2DNZA 3M1FA 3MF5A 3H42A 1KQFB 2CG8A 2DK2A 2CA9A 1IM6A 4HUFA 1JNZB 4L75A 2Q3SA 2BYCA 4DV0J 3C46A 4N56A 5GADP 3WQPA 4BC4A 1PBUA 3RUBL 1TL4A 2UUBJ 2JX2A 3JQJA 4BC3A 4I9QA 2GA7A 4JUZA 3HFKA 4JYAF 3MEGB 3F41A 3V9ZA 1HNZJ 5F9LA 5A2QU 5LMNF 5BR9A 2MKCA 4QBUA 1VQSA 2O8CB 1ZETA 2Y9HA 3QGIA 4X65J 3FBCA 1YTUA 3MHYA 4ENOA 3OYEA 3KJFB 1FERA 5D3GB 2RQCA 3CQXA 3CCLS 4IO9Q 5LMUJ 4O3SA 4DV1K 2K1RB 2BM1A 2CUYA 3RMBA 2GIQA 1SL0A 2GHPA 3M8SA 4BDYA 2X3DA 2GCFA 2H5JB 3OXGA 1M5VC 4Z94A 3V81A 3NGRA 4BRNA 1HI0P 2VYPA 2KLAA 3R9PA 3BS9A 3TPQA 5HVFA 3MD3A 4E1NA 1U1NA 4HUEA 5A2QY 3D7EO 3NS7B 3OTOJ 1PC5A 2IHR1 4W5TA 4IG0B 1MWQA 4A2BA 4JI6F 5KG1A 3IR6B 2Y1LB 2FSKA 3KK1B 4M5IA 4FK0A 5IT0A 4JN4A 1FVQA 1KHVA 2CQHA 3KVGA 4J9LA 4WYBA 4KFBB 1U2VB 2OEKA 1SJ4P 4C23A 2UU9J 2CH5A 1SQKA 2QWMA 2KO1A 3UCUP 2AEMA 1UCNA 1IR0A 4B9SA 1KRPA 2ZC3A 4P10A 4U8YA 1UW4A 2ZZNA 3EGNA 3UQSA 4IH7A 3UWTA 3MR3A 1CVJA 5AE1A 1HHSA 3MOZA 4CVNE 4X2BA 1EKSA 4ID5A 3N79A 3PW7A 3KYLA 2ZH6A 1K9MO 1SQEA 2XHCA 4DU3A 2XMMA 3CJTA 3IR7B 3DLKA 2KKHA 3PFOA 2B56A 2R4FA 1OY8A 3MAHA 3K89A 3K5PA 3DRSB 3J7YI 5DETA 3O9UA 4KHPK 2MQLA 4RO0A 2V4QA 1RLDA 3Q8VA 5I3QA 1IBLJ 5BN8A 5K8MA 3OYMA 1T9VA 2F9DA 5A2QO 2QL9B 3PYFA 1YWXA 4H4OA 3SQ1A 1B92A 3FQKA 1HL6A 5L38A 5GAHU 5AJ3F 4WFAL 2YCHA 1T9TA 3O1LA 3I9V9 3KLFB 3J7ZO 2DH9A 2BABA 1ZAVA 3T6JA 4BQZA 1WG4A 3D68A 2J0XA 2V4JB 1I1GA 4PAAA 3GFXA 3QFUA 1FKOB 2Q66A 3C8YA 2CPHA 4G1IA 2DY9A 1IKVB 4JV1A 2F8SA 1L5UA 1HYSA 4O3RA 1OSCA 5SUHA 2W9CB 4W5QA 3TANA 4PRFA 2ZEJA 5I9EB 5GIOA 2R8KA 1RTIB 1YJNS 4DR5F 1G4CA 2B4UA 4YY3J 4DJBA 2MZ1A 1P27B 4CQ1A 3OW2M 1XN9A 1YIJN 4TU8A 3Q2TC 4CJRA 1GLAG 3R2CJ 2QFIA 4M3TA 2VWJA 2K7JA 4MMOA 1RHKB 4CLSA 3D9BA 2ERRA 4DPTA 3KMSA 4YOUA 4M42A 3Q2SC 3U9ZA 3VVUA 3RBEA 3L4BC 3C14A 1TKXB 3SMSA 2E2QA 2R8HA 4ECXA 2LA6A 4DTJA 4LF6K 1ILYA 1Q0NA 2DGXA 1ZS6A 3QRQA 4IO1A 2V34A 3US5A 1T9WA 1B3TA 3P6YC 2WC9A 4GV3A 2VA3A 5J1EA 2C2MB 4KBIA 5KFBA 1E4GT 1K8AO 1W7WA 3WC2A 3GIJA 1WSRA 5IM0B 1H0HB 4FM2A 4X66K 1S9GA 3POTB 3HOTA 1RWVB 1Z2ZA 5HRRA 2ZUAA 3ZXWA 2HHHJ 3SIPB 3EEQA 2EC2A 4DSJA 2PI4A 4JI0F 4CIGA 2Z58B 3ATUA 3KJVB 3RYLA 5THWA 1S4EA 4WIQA 2A1RA 2IVFB 2C28A 1YQHA 5C2CA 4ECSA 1PGZA 2YX7A 1KAXA 3HRGA 4G1PA 3FZFA 4JKEA 4ILRA 1J5EK 1SPBP 4NA2A 3R6MA 2W9CA 4HUGA 5BRDA 1UEVA 3SCLE 2HBLA 1QDUB 5T7LB 1D0EA 1N36J 4Z4GA 2H3EB 3WNFA 4LFBK 2R2UA 2R7UA 1MU2A 3OVNA 4FKYA 3OPKA 2DFHA 1FXRA 1VBXA 3CE8A 3D67A 2NYIA 3VAIA 4ZPVR 1S6UA 2PSZA 5E3AA 1IKXA 2FY8A 3C14B 2WK4A 1A7GE 1D8YA 4B1ZA 2MKHA 1HNWJ 1M5SA 3AD9C 1WEYA 3O1BA 4YY3K 1F9HA 1WC6A 4A61A 4ZPCA 1C1CA 4H4OB 4DV6J 2DNOA 1OS5A 2A1BA 4LQ9A 1U0SA 4O0JA 1WHVA 1MA9B 5AQOA 4OYPA 4C8OA 2KTQA 1KFDA 1RK8A 5K20B 4AXJA 1IBKJ 5T7BA 4FS1A 1KVBA 1OSDA 3MXHP 2ADCA 4AF1A 3ENOA 2ALYB 4E7JA 3CCEN 4K59A 2V5HG 1S7IA 3KK2A 4JV0A 4LF6J 2AMCB 2MQOA 2P9NA 1N88A 2MSSA 1KAYA 3BGRA 2EFQA 3ILJA 3OBWA 2Y8WA 2MSTA 1VCTA 3OY9A 4PQUB 1WUUA 3CC4S 1HW8A 5KT6A 1NCLA 1FTCA 3H4DA 2XRIA 4A48A 3KLFA 1CJKB 2AT1B 2Y0BB 1T03B 2UUAJ 1U8WA 5KFMA 4OPAA 4OX9K 3PYDA 2VQEK 2GEMA 3CUNA 3GPAA 3C0BA 3FBEA 4CF0A 1ROFA 3F44A 2Z0GA 2J6UA 5CR4A 4S0MA 1RDUA 2HF3A 3LGMA 5LMNK 3ZNJ1 1SJ1A 3K9JA 2KQ2A 5B0DA 4EHTA 3EM1A 3RAQA 4P6QA 1TKTA 4CHQA 5F8JA 2HVEA 4FW1A 1EQYA 1JXLA 1U0HA 2UXCJ 4DX5A 2DGWA 2APOA 4MFBA 4WYLA 3VGTA 1EARA 4EP4A 1XK8A 3B6PA 4ELUA 1EQMA 3BSCA 1EIYB 4DX7A 3UCZP 2KL8A 2IYGA 4RL1A 3GV7B 2W24A 3W9JA 3QT6A 4H5WA 5AQHA 4L76A 4USKA 3IAYA 1EX4A 3PRVA 1VQ8S 4OVLA 2HGMA 2ZJRQ 2QWNA 4H0PA 3T7ZA 4XEIA 1SB6A 1L3SA 4QJVA 4E7IA 4CLTA 5F8IA 5EHHA 4I4BA 2HHTA 5EOYA 4B9VA 2CPEA 2HK3A 2RS2A 1CLQA 2XMWA 2V50A 3DLLQ 4K4SA 2W4CA 3I0SA 4IWVA 3ZYYX 5KG5A 2UXCK 2E2NA 2P9PA 4B02A 4Q45A 4JI2K 2H65B 5D77A 3C95A 4NLDA 1BCMA 1NK4A 1IR1A 2O8DB 1LNQA 3OYBA 4Y6IA 5KFRA 4DB3A 2HZCA 1FK9B 4W92B 4YDXA 1VLOA 1RISA 1IBKK 4L3NA 3ZTPA 1FEEA 4DL0C 2F65A 1U2RA 1RYRA 4HDGA 2R3VA 3C6TA 4YB6A 3BR8A 3ISND 3HVTB 3V81B 4OX7A 1CJVA 2GGPB 5B0AA 2FVQA 4EFAC 4O23A 4MTPA 2GJIA 4P2XA 1YZ6A 1VQLN 4CF8A 1TL1B 2VBXA 4WQ4A 5JICA 2XWYA 3SYZA 4NYZA 3HHLC 2AYEA 2OIHA 2YWGA 2V7YA 3MGJA 2YVSA 3TW0A 3NFAA 3HKWA 1WF0A 2DGOA 3C3LA 1IVZA 2PI5A 1Y10A 5HRNA 4DS4A 4AYBD 1KLNA 2YWHA 1RAIB 2HBYB 3CC7S 2BMBA 2V2VA 1TP7A 2QX0A 3EICA 1KN6A 2DEIA 5EN1A 3C6HA 5F8GA 3EPGA 2BACA 1MN9A 2DVIA 2HHWA 5L1KA 4K41A 5ADXH 3SI6A 2UVUA 3OTDA 2HBRB 2CQ0A 2MJUA 3RMAA 3H90A 1PIEA 2MKJA 3TA1A 4NCGB 3BO3A 2WONB 3NL0A 2R7TA 4B08A 3CPEA 3LO3A 4F2RA 4L72B 4A2AA 3N28A 2NRXA 1WOPA 4B8AB 3VERA 3TUJC 3D28A 2CZ4A 3NKYA 5LSRA 3DRRB 4C11A 5AE2A 1GQEA 3TUPA 3DXSX 1HD0A 1K8AT 1RHUB 4B3TJ 4AILC 3ZX2A 2E5GA 2IJRA 3T6BA 1HPMA 1HI1A 1WC1A 4QZVB 3TNVA 3QFHA 4DR2K 1P8GA 3ETMA 2HHHF 1WOSA 2MQ8A 1RDAA 4OJ1A 1JKHB 3OXFA 4ED4A 3CD6N 2W9BA 2Q1NA 2V8VA 4TSXA 1WG1A 3J8AA 4FWLA 5AQUA 2FPHX 4RW6B 2ZBPA 3DOMB 1LWFA 4B8CA 5B0FA 4IFYA 4DPOA 3JTNA 3TZZA 2DRBA 5SWMA 1JLEA 3OYIA 4MKVA 2LQBA 3B6OA 3QIOA 1S6QA 3GV8B 2OI2A 5KT4A 1SKSA 1RTJB 1C4AA 1X4FA 1UPPA 1U24A 2P51A 2QJ3A 2VQFF 5C2FA 4DV7K 2QWPA 2PZSA 1SC6A 2BE2B 3CHWA 1KCFA 5K14B 1CG2A 4JS4A 3VAHA 4LF4J 2VBWA 4LH4A 1KC8T 2NXNA 2V9WA 2BH1A 5JS2A 3G71N 2QWOA 4IXCA