4ZHRA

Structure of hiv-1 rt q151m mutant
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
553
structure length
553
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RT p66 subunit
publication title Structure of the HIV-1 reverse transcriptase Q151M mutant: insights into the inhibitor resistance of HIV-1 reverse transcriptase and the structure of the nucleotide-binding pocket of Hepatitis B virus polymerase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 143
structure length 553
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4zhrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zhrA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4zhrA05
5KFUA 4TYAA 4AHTA 5L9XA 4TY9A 4NYFA 4EO6A 4TQRA 2UVRA 1J53A 2F96A 2UVVA 1ZBIA 2R2UA 4C8KA 5KFMA 1S9EA 3I5BA 1RT5B 3HKWA 2G8WA 2VG5A 1TL1B 2YKMA 3RRHA 1S1UB 5HBMB 4CEEA 1WAJA 4ED0A 5J2PA 3HVWA 5HRNA 4WE1B 1D0EA 1C6VA 3QLHA 2C2EA 1QUVA 4BE2A 2WONA 2C28A 5CYMB 3OL6A 5L1KA 1S9EB 4KHMA 4RW6A 1KFDA 3VQ9A 3NF7A 4URGA 1SKSA 3BDPA 4FLWA 4Q43A 4CF8A 4E1NA 5J2PB 4FM1A 5DGAA 4FLUA 4E7JA 3QEXA 4DQPA 2XI2A 1RT1A 5KT5A 3K5OA 1RBVA 1GOBA 1FK9A 4TSXA 4YNQA 4ZVGA 3SI8A 1KLNA 4KI6A 2ASLA 3V4IB 1DTTA 5F8HA 1EX4A 3AVFA 4CJWA 4OKEA 3KTQA 2ZD1A 4KAZA 2AWZA 4KV8A 4WYWA 1N4LA 4Q0BA 1LWFA 3KHRA 2YNGA 1TKDA 4HUGA 4FLZA 1XR5A 4ZVFA 4J9QA 3BREA 4FZYA 2O4GA 4TY8B 2IDOA 1DTTB 2HWHA 5KG0A 3OYCA 3CDEA 1RT6A 1WAFA 2IM3A 3P83D 2EX3A 4RG8A 2YNHA 1EETB 3KK1B 3PO5A 2YNGB 4N5SA 3OYBA 3HM9A 2Q3SA 2HB5A 2R2TA 3I5CA 3DLEB 1RTJB 4ECUA 4IDKA 1RT6B 4F2SA 3FQKA 3PV8A 1HRHA 2OPSA 1RT4B 4J9NA 2YNHB 3U3GA 4FVMA 3O3GA 4WXOA 3CJ3A 2HVIA 4KHNA 4ZTJA 1CZ9A 4K4SA 1T7PA 4R8UB 5KG7A 4IFVA 1JLGA 1WSIA 1YVUA 3KLFA 1JLFA 4CIGA 3L2QA 2XWYA 2FBVA 5HLFA 5KFXA 3DLGA 1NHVA 3RB0A 3ZSQA 1U49A 3QGIA 4DFKA 5KG2A 3KMSA 5F9LA 2HHSA 2XHBA 3QIPB 3RAXA 4KREA 3CDUA 4RUAA 1JLFB 1RA7A 5KFOA 4BDPA 4I2QA 4B3OB 3DLGB 3OL9A 4RUCA 1HNIA 4O3OA 3V9UA 4CJ3A 3S3MA 1CSJA 2E6LA 3N6NA 1LW2A 1VK0A 4LSNA 5FROA 4XIUA 3QEVA 3P5JA 4M3YA 3SV3A 1S97A 4NLDA 2OPQA 3BSOA 3DYAA 2YV0X 3S9HA 3OSNA 4RU9A 3AVLA 2DTUA 1S0MA 2FBXA 2HNZA 1SL1A 5KFIA 3AVNA 2UVWA 3V6DB 2IJNA 3GV5B 1LWCA 1OS5A 4NLWA 1TGOA 3OL8A 2XO7A 4ICLA 2IM2A 5FRMA 3SYZA 5KFYA 4DL3A 4C8LA 3KJVA 1WN7A 3M9MB 1EKEA 3AVIA 2AX1A 5J1EA 2X74A 5HP1A 4ZP8A 1RDDA 4WFZA 1NK6A 1NNDA 3DLBA 3AV9A 2JEFA 3NF6A 3TAMA 3MFHA 4OLBA 2HHQA 4DL7A 3H2LA 1BGXT 3SQ2A 4NCGA 3RMAA 4JUZA 4JV2A 1IKVB 4ECTA 4FLYA 1Y97A 1BQNA 4ECSA 5J1EB 1JLEB 3MEDB 4O4GA 5KFCA 3VQBA 4OPJA 4B08A 3OLAA 3PHEA 4W5TA 3M9OB 3O4QA 4CGIA 3OYGA 4NCGB 1X1PA 2WOMA 2IOCA 4EP5A 3CJ0A 1BI4A 4QOZB 1C0MA 1U4BA 1TK5A 1SH0A 1RBRA 4OL8A 4O4GB 3LP1A 2O4IA 5F8LA 5HRSA 2E6MA 1ZBHA 1QSSA 2UVUA 4E89A 1S1TB 4NLTA 1JLQB 3LP2A 4PQUA 2JLEA 1CXQA 2KQ2A 4OVLA 2W9CA 2HMIB 5DLFA 2AGQA 3D45A 4TLRA 3AVCA 3LP1B 1ASUA 3OYIA 3AVHA 4RW4B 1A5XA 5T7BA 3NH2A 3LALA 3QYYA 2Z1JA 3DRRA 3ZT4A 3K5MA 4ZPBA 2KZZA 1R0AB 3H5YA 4K4VA 3H4BA 2AQ4A 2Z1GA 1T8EA 3PR5B 2X6NA 2W9CB 2RPIA 4O3NA 1KSPA 1BQMB 5F8MA 4KHRA 4B9SA 4CJ4A 3VA3A 1DTQB 5KT7A 4K50A 1VSLA 1YTUA 3MFIA 1JL1A 1S0NA 1Q9XA 4MQ3A 3SUPA 1X9WA 1ITGA 2HHWA 3JSMA 4ELTA 3NAHA 1HQUA 4CFDA 4KPYA 3BQ2A 1ZTWA 4ECRA 4RW9A 4RNMA 4IG3A 1RTIB 3AA2A 1SV5A 2IAJB 3M8PA 2VG6B 4LQ3A 4K4UA 3AO2A 4HHTA 3ULDA 4ED1A 3AO1A 2OH2A 4CFCA 4FJ5A 3V1OA 3GIMA 1JLCA 3THVA 4OJRA 4ZVEA 3T19A 1SV5B 3M8PB 1JKHA 5D3GB 3LP0A 4N76A 5L1JA 1I6JA 4PUOB 3QEWA 5KI6A 1TQLA 3KK2A 3RR8A 1RAJA 1T05B 4Y1DA 1HNVA 3MEEB 3K5NA 4DTOA 4CJTA 4CIEA 4FM0A 4F2RA 1JKHB 3LP0B 3CWJA 1X9MA 3FRZA 4JRQA 3KK2B 4M45A 1J5OB 2FBTA 3V1QA 4KO0B 1U45A 2DFHA 3ZCMA 1QAIA 4CERA 4Z4FA 4E3SA 3S3NA 4B9UA 2IGIA 1T03A 4B9TA 3OYKA 1SL2A 2HVHA 4TQSA 1NK8A 4RNNA 3OHBA 2JGUA 3ZT3A 1T3NA 4BACA 3G6VA 3GIJA 4QCLA 3FQLA 4FJHA 5KG3A 4AHCA 4EEYA 4DTSA 4YR0A 1LWEA 1TKTA 4FJ9A 5JUMA 2RKIA 3K58A 1BCOA 4AHUA 3I0SA 1RA6A 2I5JB 2R2SA 1IKYA 2BANA 1S10A 3GQCA 2IBKA 5JS1A 2J6TA 4WFYA 2HNDB 3O3HA 3F9KA 3QERA 3M8SA 4KHYA 1LWEB 1SH2A 4KTWA 3KHLA 3QO9B 3CG7A 4FJXA 3KD1E 3FSIA 1NK5A 3TVKA 3D5MA 1RT3A 3NAIA 3UPFA 4B9MA 2UUTA 2G8KA 3VQ7A 3GV8B 3B6OA 5KFJA 1RILA 4W5OA 4O4RA 1TVRB 2G8UA 3H4DA 4FLVA 4CHYA 5KT4A 4FK2A 3Q8RB 2C22A 5J2NA 4E0DA 3OYNA 3PUFA 2FC0A 3AVKA 3EPIA 3CVKA 2DY4A 4I9LA 2OPPA 4MKAA 4KHWA 4DSFA 4MFBA 4F3OA 2VG7A 1ZBFA 5DK5A 1SKRA 5FRNA 1MU2A 2Z1HA 3RMDA 3KLHB 4DLGA 2R8IA 3CDWA 1TAQA 1RYSA 1QHTA 4R5PA 3LAKA 2J6UA 3KHGA 3BR9A 4EBCA 4I7FB 4BE0A 4ZHRB 1C2PA 3QNOA 2OA8A 5I3UA 3SQ1A 4MFBB 3RB6A 2HWIA 4NLXA 1S9GA 2VG7B 1KVAA 2G8FA 1JLBB 1MU2B 5E41A 2GIRA 4IH5A 4J9RA 3LANA 4FK0A 2F8TA 1UWBB 4QAGA 1TL3A 4DTMA 4RW8B 4Y2AA 3PW5A 4WYLA 4O3RA 4LD0A 4KI4A 4EYHB 2A1RA 3SFGA 5EWGA 1N5YA 1BHLA 4XPCA 3SZ2A 3LZJA 3MR2A 1HYVA 4BDYA 5F8IA 1ZBUA 4B9VA 1HARA 1WSJA 1VSHA 3IGVA 4F4WA 4J2BA 4JRPA 4FJ8A 1GOCA 3ISND 1VSMA 1RDBA 5F8NA 5KT6A 1YVFA 3V6HA 4CJQA 3MF5A 1N5YB 1WLJA 1TL1A 4FYDA 1S1UA 5HBMA 2OPRA 1UA1A 3NF9A 4WE1A 4FJJA 1LV5A 4KB0A 4CJEA 4E7HA 5CYMA 1NK7A 2JEIA 4J9MA 5KTQA 4CHNA 5KT3A 3VQAA 1SUQB 3D28A 3KKSA 4DU4A 1SKWA 2HNYB 1G15A 4OKJA 3KK3A 4YQWA 3SFUA 2OPRB 3SUQA 3RB3A 4IRDA 1IKXB 1J54A 3L3UA 3DLRA 5KFTA 3V4IA 3AVAA 3OJUA 2BQUA 2FLLA 4QWDA 4WFXA 1RBTA 3KK3B 1IKWA 1RNHA 3ZSXA 5FDLB 4JV0A 1NKCA 1Z25A 4DL2A 4J2AA 2QE5A 3OYJA 5CZ1A 4NLVA 4MIBA 3GYNA 1QSYA 4ED3A 4MH8A 4TY8A 4J2EA 1NK9A 1SH3A 2YNIB 4CJUA 1IKWB 1RBSA 5KFSA 3SV4A 4IFYB 3MEGB 2WB4A 1EETA 3KK1A 3M8RA 1WNEA 4DTUA 4URSA 2YHBA 3RBEA 4CHZA 1QQCA 3HPOA 2GBZA 3DLEA 3GILA 1XR7A 1RTJA 2XCAA 2VA2A 3NDKA 2ZE2A 1KLMB 1KCFA 4M3UA 4ZPDA 4I2PB 1RT4A 3TANA 3V9ZA 4IQXA 3LZIA 1QE1B 3I0RB 4LSLB 5EWFA 3IN5A 3CJ5A 4O3PA 5SZTA 5I42B 3OYMA 3TAEA 1REVA 1VSEA 3KNAA 3DOLB 2FVSA 4ZMMA 1FKPB 4YR3A 1MMLA 5F8JA 1WSFA 5KG6A 2ZE2B 2B5JA 1RT7B 4JLHA 5KFPA 2FLPA 4R8UA 5KFDA 2XGPA 3V81B 1LAWA 4RW7B 4LH4A 1REVB 4ECVA 3OS1A 1NOYA 5KFVA 4M41A 3QZ7A 2B5JB 3NFAA 4E7IA 4DSJA 3KMQA 5KFHA 1N6QB 4IR1A 4TYBA 3QIPA 4DSLA 3RTVA 1W25A 4DTXA 3PW4A 4B3OA 3VQ6A 5C5JA 3KLVA 4M3ZA 3NMAA 3OHAA 4QW9A 3NGZA 3Q8SB 4NLQA 3CYMA 2I1RA 3RB4A 3C6UB 2R8KA 2XY5A 3NBPB 4OKKA 4KBIA 2R8HA 3VQDA 5T14A 4CJLA 2DFFA 3ZSRA 1TAUA 3ICLA 3IGNA 4NRTA 1A5WA 1IG9A 3DRPB 3V6DA 1BIUA 4CEOA 3H40A 2QK9A 2KZMA 2ZKUA 5KG4A 3OYEA 4ECWA 3ZT0A 3RWUA 4FJKA 1S4FA 1S6PA 3ZSOA 4DL6A 4RNFA 3T5LA 1TK0A 4PWDB 3MR5A 4TXSA 2DFEA 2EC0A 4CK2A 1IKVA 4ED2A 2G8VA 3DI6B 3NGYA 3ZSWA 3PJXA 4O3SA 3AVJA 1S6PB 1JLEA 4O0IA 5L1LA 2XY8A 1U48A 1RTHB 3SQ0A 3AO3A 3V6JA 1S1VB 3MEDA 1RCHA 3EPGA 4CFBA 1N56A 5J2MB 3H98A 4QWCA 1XC9A 2X78A 3DRSB 3HK2A 4N47A 4AILC 3KD5E 1HYSA 5C24B 3V1RA 2ZQBA 4B9NA 2FJVA 1KFSA 4RNOA 3CM5A 4IRKA 2W8LA 2FVQA 4DS4A 1L3VA 1S1TA 4LQ9A 4KE5A 2W8KA 1JLQA 4C8OA 2OYQA 1HYSB 3FFIB 2HMIA 4EP4A 1S1WB 2QV6A 4ID5B 4DF8A 4RW4A 2PZSA 1C1CA 2D5RA 1D1UA 4KHSA 3PJWA 3CJ4A 5JXSA 5KT2A 4CGDA 3CQ8A 4I9QA 4OGEA 4BWJA 1R0AA 3IG1B 4IRCA 2ATLA 4NLGA 4HUFA 1BQMA 1HMVB 4FJIA 1C0UB 1NJYA 3VQEA 1DTQA 1C1CB 3AO5A 4IH7A 4GC7A 3E01B 1ZBLA 1KHVA 1NJZA 3C95A 3N6MA 2A1SA 2Z1IA 1JXBA 1D9DA 3K59A 3AA5X 1IO2A 4ED6A 1HJRA 3HO1A 3UQSA 3OYDA 2Y1JA 2R2RA 4CJKA 2P5GA 3MXJA 2WRMA 4CCHA 3KHHA 2R8GA 4ECQA 1EXQA 3MTKA 4Y3CA 2GC8A 3GIKA 4CF1A 1RTIA 3C6TB 3V9SA 1FKOB 2IAJA 3HPHA 2O5DA 2VG6A 1JX4A 4CGGA 3QINA 3IS9A 5C42B 4C8MA 1C1BA 1U04A 3ZT2A 1Z4UA 4DU3A 3UIQA 4ZP7A 5KGXA 5DGBA 5D3GA 4CESA 2WTFA 3NAEA 5EDWA 1L3SA 5KG1A 4PUOA 4DL4A 3I8DA 1JXLA 3KKRA 3IS9B 1T05A 3TAGA 4EBDA 1C1BB 3NE6A 1S5JA 4L8RB 4CJSA 4BDZA 4FJNA 3MEEA 1XWLA 4IKAA 2R8JA 4F4ZA 3A2FA 5KFEA 1RT2A 1J9AA 4LH5A 4Y1CA 3K5LA 3L2UA 2BGGA 1N48A 4Q8FA 3DMJB 1TK8A 4CGFA 1J5OA 4Q45A 4KO0A 1YTAA 1S1XB 5J2QA 4HKQA 4IG0B 3LWLA 4DEZA 4QWBA 3OJSA 1RT2B 3PY8A 1NK0A 5CYQA 3SQ4A 1VRUB 3BSNA 3DM2B 4AHVA 1TKZB 2AX0A 2C2RA 3NKYA 3T3FA 5J2QB 4RZRA 4AH9A 3P1GA 4OPKA 3BQ1A 2I5JA 2D41A 2D0CA 4K4WA 3NF8A 3DDKA 4DQSA 4CJ5A 4QPXA 5CYQB 2AGOA 1D9FA 4NZ0A 5DG9A 4DSIA 5KFRA 4CF2A 2HNDA 3V9WA 2CJQA 4J9PA 1I3AA 3ZSZA 1TV6A 3QESA 4HVJA 4KB7A 4FCYA 3M8QB 5KFFA 3QO9A 3BQ0A 4FM2A 3WNEA 4FS2A 4K4ZA 5F9NA 1IH7A 4DTPA 2BE2B 3NL0A 3D0PA 1K1QA 5KGWA 4FXDA 1TV6B 4NYNA 2NUBA 4DG1B 3FDSA 2HHTA 5KRTA 1ASVA 1TVRA 4ED7A 1S48A 4W5QA 2OZMA 1D5AA 4DQRA 4ZP9A 4M3TA 1TKXB 4URQU 4CJRA 2YNFA 1ZYQA 3VQSA 3OS0A 3EY1A 5HROB 4DF4A 2GIQA 3BGRB 4Y2CA 1VRTB 4KKOB 3VQCA 3ZSVA 3KLHA 2BRLA 4CGHA 2YNFB 4EZ6A 4ZP6A 2E9RX 4NLSA 4H4MB 4Y34A 3O3FA 4I7FA 4NRUA 3LP3A 4ZHRA 3LDSA 3OY9A 3Q8PB 2B6AB 4B8AB 3ITHB 4CF9A 5EWEA 1C0TB 1JLBA 1L3UA 5CZ2A 2W7PA 5KFZA 1UWBA 4KHUA 1WSGA 1BISA 1NJXA 1DLOA 3HP6A 4RW8A 3CO9A 2QKBA 2B43A 4O55A 3HP9A 1GX5A 2W9BB 2B4JA 4CFAA 1KTQA 4Z4IA 4Z4GA 4N41A 2ATQA 1ZTTA 1A5VA 3RAQA 2JEGA 4N56A 2ALZA 1DLOB 3SUOA 2RF2B 3DLKB 1JL2A 2R7YA 4NLRA 4EO8A 4LY7A 1VSFA 1BCMA 2IC3B 4Z4CA 1S6QB 3G86A 4WZMA 4M94A 3QIOA 2BRKA 4AHRA 4GW6A 4ECYA 5KFKA 2XY6A 1LAVA 3PVXA 4CJFA 4K8ZA 4W5NA 5DG8A 4J9OA 4C8NA 1SL0A 1SUQA 4ZPAA 2GV9A 3CFOA 2HNYA 3KIOA 1CXUA 1S0OA 1Q8IA 4QWEA 4EZ9A 4Z4EA 3DOKA 1IKXA 3TABA 4U6PA 3TAQA 3HT3A 3TI0A 4NLUA 3IAYA 1HPZA 1WNSA 1QTMA 3TAPA 2F8SA 4O44A 5FDLA 4FW2A 4ELUA 3M9NB 4FW1A 2HHUA 4OLAA 3DOKB 3RMBA 5DQHA 2V4QA 3PW7A 3SJJA 1UOCA 4H4OB 1Q9YA 2FVCA 2YNIA 1HPZB 3OYAA 3G6YA 4ELVA 4O44B 3V9XA 1UA0A 4IFYA 3MEGA 5CY4A 4BE1A 1X9SA 4CHOA 2KFZA 4DFPA 3ZSYA 4H8KA 4CEBA 4JS4A 3QEPA 2D0BA 1KLMA 2VG5B 4M42A 2BDPA 4F50A 3SI6A 2YKMB 4CEAA 4I2PA 4YP3A 3LAMA 3VQPA 1LW0A 1QE1A 3I0RA 4LSLA 2X6SA 3QLHB 5I42A 2WONB 3DOLA 1FKPA 5DQIA 2WK4A 3UDLA 4RW6B 3ALYA 3OYHA 4E7LA 3DLHA 1RT7A 1B92A 4KB1A 3AA3A 4YFUA 1LW0B 1B9DA 1O1WA 4CEZA 3V81A 4RW7A 1RT1B 3OVNA 2AGPA 1FK9B 4CK3A 4CK1A 2JC1A 4DTNA 4MK7A 3GIIA 4FK4A 3CJ2A 2ZD1B 4U7CA 3AO4A 1N6QA 4DSEA 4K8XA 4KV8B 2E9TA 4Q0BB 3C94A 1LWFB 4ZVHA 4MIAA 4PA1A 3KOAA 3QIDA 2ASJA 1RDCA 3IRXA 4E19A 3NGDA 3AVGA 4CHQA 1QSLA 1XR6A 3E51A 2XCPA 4F4KA 2BR0A 3T5KA 4CGJA 2RN2A 3C6UA 2F8EX 4W5RA 4OGCA 3NBPA 4G1QA 4DFMA 4IKFA 3I5AA 3VQQA 1UAXA 5SWMA 4IDKB 3JYTA 3IRXB 4IR9A 4HUEA 2OPSB 3ASMA 3EZ5A 3DRPA 3NCIA 5K14A 3RRGA 1RYRA 5KRSA 4F8RA 4G1QB 1K6YA 4ZTFA 3JYTB 3NH0A 4UQGA 3H5UA 2W9AA 1XHZA 4DMNA 4CJPA 3HYFA 5K14B 3QZ8A 4FJ7A 2V0NA 4CHPA 4DFJA 3L2RA 4IFVB 1JLGB 2ILZA 2KFNA 1CLQA 3KLFB 4PWDA 3QGHA 4IBNA 3MXMA 5HLFB 4YR2A 1W0HA 4Q5VA 4DQIA 4FBTA 3DI6A 5KFLA 4KFBA 4MK8A 3S3OA 4J9SA 1JIHA 1TP7A 1RTHA 3OL7A 3HVTA 3HL8A 3L3VA 1S1VA 4O0JA 3QETA 4B9LA 2Y1IA 3MECA 5J2MA 1C1AA 4I2QB 3OLBA 2ILYA 4F4XA 4M3RA 3T1AA 1YT3A 1NKBA 3DRSA 3LWMA 1HNIB 3PW2A 1ASWA 4XO0A 4KFBB 5C24A 4DLEA 1LW2B 3OYLA 3MXIA 3HVTB 4JV1A 4LSNB 4GVMA 1KVBA 2OPQB 3MECB 1D8YA 3DYAB 3N6LA 3VQ8A 4BWMA 3NH1A 4CE9A 1NHUA 2HNZB 1KRPA 2ITGA 3FFIA 4B8CA 3CFPA 3QNNA 4DQQA 1S1WA 3KLGA 4ID5A 4ZPCA 3H5SA 1LWCB 1RDRA 2RDIA 4ICLB 4FJMA 2G8IA 3IG1A 4NLPA 1FXXA 3KJVB 2PY5A 3H59A 4DSKA 3NGIA 5HP1B 1HMVA 3KLGB 2XC9A 1NK4A 1C0UA 3QEIA 4HCBA 3TAMB 3K2PA 3SPYA 3E01A 2XGQA 4QW8A 2RDJA 4KTQA 4F3TA 3PZPA 2FBYA 1F21A 1BQNB 4CEFA 1NKEA 4DTRA 3B6PA 3SNNA 1VSJA 3AVMA 3PX6A 4M95A 2WOMB 1BI4B 5HRRA 4Z4HA 1GX6A 3PW0A 3C6TA 3TQ1A 1FKOA 4M3XA 2ETJA 1KHWA 3CIZA 5DLGA 1GOAA 3VQ5A 4CECA 3OSPA 4DS5A 2D7SA 4ED8A 3F73A 3U6FA 5C42A 1S9FA 4M3WA 3LP2B 2AU0A 4J9LA 3L2VA 4PQUB 4HYKA 3TWHA 4FZZA 5DG7A 4CIFA 3V6KA 3RR7A 4GMJB 3AA4A 2E4LA 3U3YA 2DPJA 2VWKA 1QAJA 3DRRB 4GC6A 1NJWA 4AHSA 4FJGA 3G10A 4NLOA 3TARA 1IM4A 1NOZA 1WSEA 2PYJA 4DWIA 2IM0A 4H54A 4MKBA 3OS2A 1HQEA 3PX4A 4E1MA 3DMJA 4R0EA 3K57A 1XI1A 3WNHA 5DQGA 3ISNC 1S1XA 4IG0A 4ID1A 2UUWA 2XI3A 3G6XA 2EHGA 3JSMB 4DL5A 1HQEB 4FLXA 4O3QA 4FZXC 4J2DA 3VA0A 2G8HA 1HQUB 1VRUA 3DM2A 2YHAA 1TKZA 2QXFA 4IH6A 1VSIA 3H5XA 4HTUA 3LPTA 1VSDA 5JS2A 2WHOA 4RW9B 2C2DA 2VWJA 4IG3B 3KLIA 1HYZA 5KFNA 3QGGA 4NCBA 1W9HA 3HHKA 2JC0A 2ASDA 4FJLA 3RBDA 2P5OA 1JLCB 4KSEB 4WXWA 3M8QA 3VQ4A 1RTDA 3KLIB 2P1JA 1KVCA 2AJQA 1XHXA 4FBUA 2BE2A 2E9ZA 1K1SA 2KTQA 2BQ3A 1HNVB 3TAFA 4DG1A 1U09A 3HPGA 3WNGA 2W42A 2IM1A 5EUHA 4O5BA 1RTDB 3RMCA 2V9WA 3BSAA 3HXMA 4PY5A 3NHGA 4EYIB 1BIZA 1JLAA 4CF0A 2IS3A 4JS5A 2VA3A 1TKXA 3SPZA 2J6SA 4ECXA 5HROA 1T03B 3BGRA 4NLYA 2IA6A 3Q8QB 2V4RA 2KW4A 1VRTA 4K4YA 2OZSA 4KKOA 3PX0A 1JLAB 3TR8A 3BSCA 3SCXA 2XRIA 1TKTB 3KLEA 2FLNA 3SUNA 2RKIB 2QKKA 5C25A 1I39A 4DU1A 3I0SB 2D3ZA 4WZQA 5KG5A 4NCAA 1IKYB 2BANB 3HJFA 3LPUA 2IJFA 3L2WA 4H4MA 2D3UA 2B6AA 3ITHA 2JEJA 2FVRA 3CFRA 1C0TA 3MR3A 1Z26A 1L5UA 3KLEB 1U47A 2CKWA 5C25B 4FLTA 1VSKA 1ZETA 4KAIA 5DMRA 3HVAA 2DPIA 4X2BA 5KFQA 2W9BA 3MAQA 1RT3B 2P51A 1S49A 4Q44A 2YKNA 5KFAA 3HVRA 1L3TA 1CZBA 1BL3A 3VN5A 1QS4A 2LSNA 2RF2A 3DLKA 4NYZA 4FS1A 4CEDA 2D0AA 5KFWA 4DTJA 2BQRA 3HSTB 3L8BA 5HRPA 4CJVA 1WSHA 2IC3A 2YKNB 2HHXA 5J2NB 1S6QA 3T5HA 3EYZA 2FJWA 1B9FA 3G0ZA 4XPEA 1JXEA 3GV7B 1EP4A 4Q8EA 4KHQA 4F4YA 2OPPB 2HW3A 2HAIA 3PR4A 3EZUA 3OYFA 3AVBA 2FJXA 1RBUA 4Z0UA 4K4TA 1RDAA 3CM6A 3WNFA 3PO4A 4R5PB 1EP4B 3O4NA 2IMWP 3ZT1A 5L1IA 4MK9A 4KRFA 4K4XA 4TN2A 4CEQA 5I3UB 4KTZA 3UR0A 1S9GB 4ECZA 4QWAA 4EBEA 4G3IA 5EU7A 2GUIA 2PYLA 4HCCA 4E7KA 1TL3B 5KFGA 3H08A 3BJYA 3MR6A 4J9KA 4YMEA 4RNHA 2W7OA 4IOBA 2HHVA 3T5JA 4H4OA 1T94A 1RT5A 2XY7A 5KFBA 5F8GA 2WCXA 2FVPA
chains in the Genus database with same CATH superfamily
4TYAA 1RCXB 1U26A 1UP1A 5L9XA 4Q7AA 1NLVA 3W61A 3CJAA 1J53A 2QI2A 2DT9A 2KDOA 3VPZA 1CJVA 4PAAA 2VDHA 4A2BA 5KFMA 5ADZA 4N8NA 2OAUA 1Q7YT 2MZTA 5DM7Q 2YKMA 3NVMA 1RISA 3RBXA 5ETOA 2QWLA 4FKYA 4FXVA 2H5EA 5G0RA 1C6VA 4BE2A 2MSTA 2C28A 5CYMB 1CJVB 3OL6A 4IJAA 2V94A 2NXCA 4KHMA 1ATSA 3PJ9A 3VF4A 1FDAA 2UUCK 4E1NA 1YKWA 5C2DA 4E7JA 3QEXA 2UXDK 1NBEB 2XI2A 4B3TJ 2HHHJ 5KT5A 4L75A 2ZH9A 1RAIB 1B99A 4ZVGA 4KI6A 1BA1A 3FMWA 3VQTA 3V4IB 2ASLA 1EX4A 2E29A 4OKEA 2ZD1A 1VQPS 2YBVA 4FWQA 3M8YA 2B4VA 2YNGA 1NSQA 3W2WA 3QBXA 1Q5VA 4R25A 5ETLA 1CVJA 2HWHA 3CI5A 2JVRA 3OYCA 4ES2A 2OSRA 1MW7A 3D7SB 2YNHA 3PO5A 3VTHA 2YNGB 2FPHX 3OYBA 1WELA 4GV6A 1YRUA 2HB5A 2R2TA 3I5CA 4C4WA 2RU9A 4OHZA 4ECUA 1DAXA 4F2SA 3FQKA 3PV8A 3VEZA 4IOCL 2YNHB 4NX9A 1WC6A 1HX1A 1ZBSA 1KAYA 2RU3A 2QLXA 2HQ3A 2EBEA 4CLZA 4KHNA 1BA0A 3W8GA 4R8UB 3DAWA 1JLGA 1MDUB 1JLFA 1FXRA 1ZA2B 4QYRA 3GCXP 3H25A 3L2QA 2XWYA 2FY1A 5HLFA 4OI0A 1U8WA 3W1YC 1KN6A 2A3ZA 2H3GX 1GNKA 4DPTA 2XHBA 4DCPB 1SQEA 2LEPA 4GV9A 3CDUA 3CC7N 1JLFB 1GLEG 4IEEA 2K8GA 1S72S 4RUCA 1FWPA 5LSLA 3M5RA 1UZDA 2YX7A 4JI3F 1SI9A 1PG5B 3HSZA 1LW2A 1WUUA 3QEVA 3P5JA 2HIQA 1S97A 2OPQA 3TYTA 3CCTA 3BSOA 2YV0X 3S9HA 2IIHA 2M2BA 4RU9A 4LFCK 3AVLA 5DZ6A 3SCKE 4CLKA 4XH4A 3MPYA 1VOMA 3F5TA 2NRHA 4FWOA 4NWBA 2IJNA 1LWCA 2OFHX 3CCUS 2UZAA 1TGOA 2GWJA 2HRYA 2XO7A 4ICLA 1Z2LA 2GHPA 5FRMA 2W4PA 3KJVA 1EKEA 4EUVA 1OYEA 5J1EA 2X74A 1RDDA 2XS5A 4KGXB 5EHHA 1VQLS 1NK6A 2XHCA 1RCOB 1IBLK 3RZAA 3MFHA 4JEPA 1NJIT 1BGXT 4M1KA 4HL9A 3PYFA 4NCGA 5H9EJ 5LM7E 4OYZA 5IXUA 4J90A 4OHXA 4JUZA 1QTNB 1SC6A 2F9DA 4FLYA 5J1EB 5LMUF 1BD6A 1X5TA 3K9JA 1RHQB 3K89A 5KFCA 4OX6A 3VQBA 2K3KA 1Q18A 2BJEA 5GAGI 4PKIA 2AEJA 3OYGA 4NCGB 1FO1A 2EVZA 5AXNA 4EP5A 3CJ0A 2HK2A 4P9SA 2DNLA 2QA4N 4CLPA 3CPWM 1BXNA 3UCZP 2BKNA 2UXCK 1SH0A 1Z6RA 3IP0A 2VL1A 2E6MA 3BDEA 4UTGA 1R8PA 3T1HF 2R3VA 3VF6A 1JLQB 4PQUA 2JLEA 2ZWPA 4OVLA 2QL7B 2HMIB 2OIHA 2AGQA 4DV2J 4TLRA 5T7BA 3P45B 4FPAA 1IBCB 3FSYA 2Z1JA 3IBFB 4BRCA 4JI0K 3UD5A 1R0AB 3BPDA 3QBCA 3ENBA 2Z1GA 3H4BA 2DBBA 3OXGA 4RO0A 5L8RC 5L9NA 1RE1B 4O3NA 3VA3A 1BC6A 3G71S 1DTQB 3BKTA 2G0CA 3U8XA 4GY2B 4KH1B 4K5SA 3GB0A 4JV5F 4PXEA 4M5DA 1O8BA 2CAJA 2K7JA 2HHWA 1DURA 3ZEUA 1H2TZ 4OX7A 1NMNA 3R5AA 3LOUA 4HHUA 4ECRA 3TA1A 4IG3A 2KU7A 1VIXA 3ZEUB 3A5MC 2FTRA 2OTLN 2VG6B 4JI5K 4K4UA 2DNGA 3FZLA 2EI5A 3AO2A 3PG9A 3ULDA 4AQYF 3AO1A 3JSBA 2OH2A 5E0OA 2JSXA 3R5DA 3CCQN 1JLCA 3THVA 2KG0A 4ZVEA 4GO5X 2XEXA 4NI2B 4JP8A 4N76A 4PUOB 2H4YB 3QEWA 5KI6A 3SCJE 1RAJA 2R7SA 1YDLA 2MSSA 1HNVA 1IQZA 2Z56B 4RBTA 4DTOA 2YHXA 1LXNA 1ESVA 2ASPA 3WXJA 2YY3A 1Y3JA 5DZ7A 1HD1A 2GX8A 3V1QA 1M90T 4Z4FA 3CCRN 3S3NA 5CABA 4NXNF 2IGIA 2HVHA 4OZNA 3OHBA 1URRA 4ILLA 2JGUA 5GAEP 4NE9C 3AAQA 5KG3A 1M1KT 2W2OP 4EEYA 4YR0A 1LWEA 3I6PA 3HHLB 3K58A 2O8BA 4IO1A 5LOQA 3I0SA 2DR8A 1RA6A 1PIEA 4AM7A 2BANA 2P9KA 3GQCA 2IBKA 3D67A 2J6TA 2I9SA 4ZVUB 1N32F 4NO7A 4W4MA 4DKWA 1LWEB 2C2NA 1YRTA 1NDPA 1LEOA 3KD1E 2P9KB 1G3OA 2HBZB 3TVKA 2PA8D 1RLDA 2DR6A 4FSVA 4DR5K 4A8YA 2CQPA 2UUTA 5TKWA 5AE3A 3GV8B 3B6OA 5KFJA 1RILA 4W5OA 4I4BA 2KFYA 1XN9A 3CULA 4CIOA 2VFVA 3QRQA 4CHYA 5AQGA 3MM5A 2ZH2A 4BC7A 4NOHA 5KT4A 2OTJS 5J2NA 4LF8F 4GKKJ 2R42A 4C3KA 1WI6A 2MKKA 2BA9A 2CXEA 4LVNP 5HSPA 4P52A 4MKAA 3MM5B 3EE8A 3TP2A 1MN7A 2O8CA 2W4DA 3KLHB 4DLGA 2DH9A 3OTDA 4YY3J 5BRHA 3IA0A 2QWQA 1TAQA 2J6UA 3KHGA 4AM6A 2VV5A 4EBCA 1IM6A 1WC4A 1KD1T 4BE0A 1YWXA 2FSJA 2CG4A 2DXEA 5B0FA 2O8FA 3MN5A 4NLXA 2Z2LA 2UUAF 2G8FA 5E41A 4X4PA 1I94J 3Q8VA 4FK0A 4BS2A 2QWOA 1JWWA 4MIWA 4Y2AA 3PW5A 4E2FB 4LD0A 2VFUA 1HKCA 4BRDA 4EYHB 2O8FB 4ZOSA 1VK8A 1N36K 4YDUA 1HKAA 3HLUA 3SZ2A 2EFOA 2MY7A 4NMLA 1ZBUA 4B9VA 3IGVA 4GVBA 4YUDA 3RVCA 1P6TA 3ISND 1VSMA 4BGAA 5L46A 5HQ8A 1WLJA 3Q86A 5IT9O 3DNCA 3N01A 3FUYA 1SQGA 2Z57B 1F9EB 3SDEA 4WE1A 1ELOA 4KB0A 1S57A 4PKDB 1NK7A 1SIZA 4J9MA 3D3BJ 5LY3A 3VQAA 3D28A 4OKJA 1QLNA 4YQWA 3SFUA 3ATVA 2VONA 3CMEN 1IKXB 2KJWA 2KKZA 4HACB 1J54A 3L3UA 2V52B 4LF5J 3FC9A 3WX4A 2UU9K 4WYBA 3W66A 2BQUA 1IKWA 2HWTA 5FDLB 4JV0A 1NKCA 1TYQA 3BEXA 5I9EB 3BB5A 2YWEA 5CZ1A 2ZZMA 4NLVA 2J9EA 1GTHA 4MIBA 5IM0A 5HN0A 4MH8A 2YNIB 1IKWB 1XNQK 5A76A 3DN9A 3GL1A 1EETA 3M8RA 1WG1A 2FF3B 1QQCA 1TELA 1E6VA 4ZVOB 2GBZA 3DLEA 1RTJA 3NDKA 2ZE2A 4WFNL 1U6ZA 4A8WA 3MCPA 4DN0A 3QAEA 3NNHA 4O3PA 2DTJA 1WEYA 4ZCIA 1REVA 1VQ4S 1E6VB 2FVSA 1FKPB 1MMLA 5F8JA 5AR0A 2ADCA 2ZE2B 1WKJA 3ATUA 4JLHA 3IMXA 3AT1B 3V81B 1LAWA 4JOUA 4OJ1A 4C3MA 1REVB 2DHAA 4ECVA 2CQGA 1QQMA 5D4NA 4E7IA 2MLYA 4ANEA 3I56N 4Y2KA 4DSLA 5A0YA 3FFKB 4Q2MA 1W25A 3SK3A 3P6YC 5LT5A 4B3OA 1NH7A 4RWWA 1FD8A 4QW9A 3NGZA 4NLQA 2F3JA 3CYMA 2I1RA 2F4VF 4CZGA 3C6UB 1XERA 4WQ5C 4C11A 5DM6Q 3TTDA 2K06A 1NGHA 4CJLA 5JLHA 4LBHA 1TAUA 4IEIA 4JK7A 5H1SV 1IG9A 2I2YA 3AAPA 3L09A 1BIUA 4CEOA 1ZM9A 1RXOB 4B3SF 4P73A 2KZMA 4HEA9 3OYEA 3CIMA 2GFFA 2YX6A 3CCES 4PABA 2RS2A 1S6PA 2K2PA 2HG4A 5F3TA 3M2UA 2DY1A 3E9LA 2CGJA 2DXFA 2EC0A 3D9BA 2NYIA 4LR8A 2MGZA 3T69A 2VUGA 1OYDA 4ED2A 2OTLS 2G8VA 4O3SA 2GJIA 1S6PB 1RBOB 4O0IA 5L1LA 4P2MA 2I38A 1B64A 4DMZA 3EPGA 3J7YU 3CCQS 1AA1B 5ETPA 2XYHB 5J2MB 2X78A 3HK2A 3G9CA 2Q0UA 1HYSA 4L3NA 3RW6A 4BC2A 2BX6A 2FJVA 3CM5A 1FNOA 2QWRA 5GADU 4MYTA 2ZOMA 1AXQA 3T9ZA 2W8KA 1WF2A 3D1QA 1S6OA 4UOCA 1HYSB 1Y5IB 4V19S 3HRGA 2LU1A 1S1WB 2BXJA 4ID5B 3RJMB 2LVWA 1HI1A 4CLTA 4Y2MA 3MX2A 3EGZA 3VGVA 1X8DA 4CZEA 2Q0RA 3J7A1 1RU2A 3MMJA 2COLA 3VQEA 1R89A 4V1Ak 3TUJC 4MYUA 3G8TA 1W2IA 4E98A 4H4KA 1WEZA 1IO2A 4EWTA 2X1BA 5K8NA 5M2PA 3OYDA 4X4TA 5B0EA 2P5GA 1WG4A 2W41A 2A40A 3JS6A 4C0BA 2R8GA 4CBXA 5AQPA 2HZCA 3MTKA 2CADA 1D3WA 4Y3CA 3M6XA 1HNZK 4WCEQ 3M2VA 3HPHA 4JKGB 2VQEF 2RHSB 4CGGA 2DRAA 4OYPA 2N3OA 4C8MA 1FVQA 3S6EA 4JI4J 3ZT2A 1PJ7A 4X4NA 2QA1A 2MQPA 1NGDA 2WSEC 3UIQA 4ZP7A 2DPNA 4DPUA 5DGBA 3R8EA 2WTFA 1HUXA 4DOZA 1VRQC 4P10A 3KKRA 1T05A 4DCOB 4OJGA 3NE6A 2VFRA 3R1LA 1RTZA 3ENAA 4BR7A 3A2FA 1N48A 2B8PA 1FFSB 4CGFA 3FZKA 4ALZA 4CLLA 3T1YF 4KO0A 1YTAA 2DNYA 1SXLA 1S1XB 4HKQA 2CNNB 4IG0B 2H65B 2A41A 4DV4K 4NEZA 1LOTB 3PY8A 4QU6A 2MHNA 1TKZB 3A5NC 3KWGA 1VQYA 2C2RA 4UZBA 3T3FA 3BPSP 6AT1B 2JNJA 1IBKK 4LIRA 4K4WA 3NF8A 3DDKA 5A8KA 4QPXA 1VR6A 4NZ0A 1WEXA 1BO5O 3PCOB 4DSIA 2ADBA 3CJKA 4FWMA 3O4WA 3ZSZA 1TV6A 3J80O 5KFFA 4B3RJ 3KG4A 4GMKA 4FS2A 1SBRA 4AL5A 3L4IA 4K4ZA 2WSFC 1Q81O 5JVGQ 4JI3J 4OI3A 2UUCF 5KGWA 1TV6B 1UVIA 4DR2K 3CJTA 3FDSA 3H0PA 1SIWB 1ASVA 2FF6A 2UXDF 2MKCA 2MZQA 1TVRA 1EB0A 5IC6B 1D5AA 1SJRA 1FT8A 4ZP9A 3KJQB 2P9IA 3CMES 3MWTA 3DHXA 4URQU 1F5AA 3AOCA 4A8XA 4GVLA 4LRAA 3OS0A 3MK6A 1HHQA 2XMTA 1PCAA 3CF5Q 4IOXA 3MEKA 1F3FA 3CJBA 4OFZA 1RFQA 2J0SD 4ZITA 2E5LK 5LMNK 3VQCA 1TU0B 3QAUA 2BRLA 1SJQA 4GRSA 2E9RX 3LDSA 2CWXA 3Q8PB 2B6AB 3MMAA 4CF9A 5EWEA 1RHRB 4IJNA 1JLBA 1RWVB 5FD1A 2VICA 5LMUJ 3W3DA 3ZTOA 4KHUA 3ZFVA 1BISA 2E2NA 3CO9A 3D2FA 4DBQA 4O55A 4OZ3A 3ISZA 3P49B 5L38A 3MMAB 4X4RA 4Z4GA 2ATQA 2GTDA 3N5FA 5AXMA 2GV1A 3GMGA 1QDUB 2WW4A 1JL2A 2KRRA 2QGFB 2XYGB 2ZM6K 2DGSA 3JXOA 4LY7A 2IC3B 2QYCA 3L95X 2FDNA 2HBJA 4WZMA 4QS7A 1OY6A 3UR3C 4M94A 3QIOA 4FWRA 4GW6A 2XY6A 1TFYA 4ZN3A 2H3EB 4W5NA 2QW9A 1LFPA 2G13A 2CQIA 1SUQA 3GONA 2NQPA 1S0OA 3H2UB 4OYAA 3FGUA 3DLJA 4OYOA 2V2ZA 5THWA 4PYAA 4LREA 3VESA 3HT3A 1NG9A 4JV5J 3WQUA 2VJVA 4LFCF 2PSZA 4FL9A 1T44A 3SMZA 4OLAA 3RMBA 1RP5A 3O44A 5C10A 1UJ5A 1SPBP 1Q9YA 2YH1A 4J7CA 4ELVA 5CH7B 2JLFA 4BE1A 1X9SA 4J8FA 3UKRB 2KFZA 4GKJK 1DJ0A 3AGRA 4JS4A 2LMIA 2HBRB 1KLMA 3THWB 3W5ZA 4M42A 2ZJRQ 4F50A 4CEAA 2P9LA 1Q8BA 2EEYA 1SC1B 1QE1A 4ZJLA 3QLHB 3OW2M 2KLAA 2WONB 4DR4J 1FRXA 2P9UB 1NRKA 1SCJB 3UDLA 1IN0A 2KXNB 3JXUA 4HWIA 2MKIA 4ILHA 2CQ1A 2UXCF 2ZJQL 6FDRA 5U47A 2AGPA 3AA8A 2IA0A 2C2ZB 4MK7A 4HH0A 4W98A 4FK4A 2GZOA 4LRBA 3G8SA 3TZZA 2CQ2A 1GLDG 4Q0BB 4OX9J 3TZYA 4ZVHA 1JJHA 4MIAA 2MY8A 5J1PA 3QIDA 4JI0F 4E19A 4ANDA 5C2GA 4HDHA 2RN2A 1N32J 3M6GA 2E5JA 3OUYA 4ZVPB 4KGKA 1YGYA 1XMOJ 3I5AA 4X65F 1UAXA 1IJJA 5SWMA 4IDKB 3JYTA 5GMKa 2MDAA 4PL7A 4HUEA 5FPDA 1TMJA 1RYRA 5KRSA 1H98A 4CBWA 2U1AA 4FDFA 5A8RB 2CQHA 3S7RA 1Q53A 4ZTFA 1FE0A 3M1FA 2HGNA 1D09B 3JYTB 1JCGA 2BUPA 4RL1A 1XNRJ 4PCQA 3P39A 2PI5A 2DO0A 1R3NA 5BR8K 3QZ8A 4FJ7A 4KH5A 2BOPA 2ILZA 4JI5F 2RUGA 2YKQA 4PWDA 3FBEA 2B9EA 2O3DA 2YCHA 3MXMA 4Q5VA 4CZJA 5C7PA 4KFBA 3G4SN 4MK8A 3S3OA 5KOWA 3C14B 3OL7A 3HL8A 3QICA 1AB8A 2FD2A 3PIOQ 3QETA 1S6UA 1R31A 3OLBA 3VERA 4M3RA 1YT3A 1NKBA 1H72C 3ELHA 1S3XA 4G1IA 2NSCA 3OBYA 4KFBB 2PFDA 5C24A 3ZTSA 3OHRA 1QM9A 3OYLA 4GVMA 1T9TA 1KVBA 3P5BP 5E3QA 5GAHI 3DYAB 2VF3A 4F02A 3N6LA 2O67A 1NZ8A 3NH1A 4JKEA 2XMWA 4JI8J 3NOCA 1KRPA 3CFPA 3QNNA 2F7TA 3OT9A 2HZAA 5KPTA 1JK9B 1GLBG 1QVFM 1SZ2A 1T9UA 2KM8C 2CUYA 1JQGA 3NGIA 4O23A 2XC9A 1NK4A 3C66A 4KGZB 4KH4A 3QEIA 5BJRA 4NZ7A 1S99A 2HQIA 5BRDA 2LFVA 2ZDOA 2QFJA 2FBYA 5GINA 1X9JA 1F21A 4LF6K 1XMQJ 3BO3A 4C1NI 1IQTA 3C16A 2E1RA 1JCFA 4H0VB 1VSJA 4BG8A 3ZETB 3CUNA 1YJNN 2VOOA 4DR5F 3EJMA 2WOMB 2V2VA 3C6TA 3MGJA 2BM1A 1FKOA 1RZMA 1KHWA 4MTPA 2RE1A 4DV6K 3OSPA 4B3MK 1VQNS 5C42A 2YX4A 2RRAA 2P9PB 3R1HA 3GJRB 2GHVC 2IPOB 1XJWB 4CI6A 3QSIA 3WXIA 4WKYA 3NXZA 2ZJPL 2E4LA 1F60B 4LIWA 3IWXA 2OKQA 6FD1A 3NMUA 3CT9A 5HMXA 1QAJA 3W8PA 4L3KA 4N77A 3K0JA 4FJGA 4U67L 4PG7A 3VMFB 1OPZA 1NOZA 1WSEA 4LR9A 4TNOA 4DWIA 2IM0A 4ED4A 4YB6A 2OFGX 4OI1A 3U1NA 1KC8O 1HQEA 2RHQB 5E3RA 4R0EA 3K57A 4IDHA 4BROA 3WNHA 4R79A 5TKYA 1CJKA 3LPEA 3DXKA 5BPMA 4LBIA 3EKSA 3M05A 2UUWA 4ANCA 3JSMB 1HQEB 4FLXA 1VQ9N 4O3QA 4FZXC 3C15B 2G8HA 1HQUB 1VRUA 2FGCA 5MAOA 3M30B 2QXFA 2RMLA 1GEHA 3GR1A 4HTUA 2VB6A 1N36F 3PRBA 9RUBA 3UNYA 4QQBA 1T95A 3KLIA 3PTWA 3QGGA 4NCBA 2V34A 3GE9A 2V2KA 1U02A 2JC0A 2ASDA 2ZHOA 3FZ2A 4CWBA 4BHQA 3AARA 4NB4A 2W2PP 1XQIA 3EVMA 1MLAA 4M7XA 3KLIB 5AQUA 4DR7J 1UAWA 5IWAJ 4FBUA 2BE2A 4PRFA 3M2RA 1ATRA 2FXUA 5E5NA 1K1SA 2F4VJ 5B0CA 5EUHA 3U27A 1KQSM 3D1OA 4PY5A 3W9IA 1KDNA 3PNIA 3MM9B 2WVFA 3OR2B 1JLAA 4JS5A 4S0MA 1FXDA 2J6SA 2Z8QA 5HROA 4B3SJ 2F63A 3BGRA 4RX6A 2A2CA 3Q8QB 1NGBA 4IQMA 1Q16B 2AZ3A 3V5RA 1JLAB 3MDFA 3H42A 2BKOA 1ZH5A 1XNQF 2QKKA 3JQMA 4WQ5A 1AZSB 3VCDA 1IKYB 2D3UA 1CQNA 4TVAB 3ITHA 2JEJA 2HFZA 3GJSB 1FW6A 3ET6B 5ETTA 1WOOA 5AZJB 2IJRA 3THYA 4ER8A 2GIFA 3PFOA 3JAMY 2NUUG 2LP4A 5B0BA 4KAIA 5DMRA 4NA3A 3QFHA 5AFUH 4I64A 1PGZA 2W9BA 3QDKA 4WBFA 1RT3B 2AHOB 1NUEA 2P51A 4TU9A 1S49A 4X4QA 1B70B 1U1OA 3THYB 1RBLA 3W5YA 2PBDA 3VN5A 1DHMA 4FS1A 4NA2A 4JB8B 3A12A 2AKWB 2P9SA 3MAAA 3D2EA 4A8QA 1WSHA 2HHXA 3P5TL 2RNEA 3IDHA 3DKDA 3EYZA 2Y9HA 2E2PA 3LGNA 1FJGK 4AF1A 3D0IE 3FBBA 5L39A 4CVNE 4PPDA 3EZUA 2J4RA 5AJ3K 2FJXA 1RBUA 3QJPA 1F2GA 1RDAA 2AYMA 1EKRA 3PO4A 4R5PB 2AJ2A 3SJHA 3DLLL 2BH1A 4KH6A 1I5OB 1WORA 4MK9A 5I3UB 5AQXA 4Z7YA 1SJ1A 4EBEA 4PXCA 3QT7A 1A9NB 2YVSA 2LQBA 4E7KA 1YLXA 4KGMA 3BBFA 4CM2A 3I96A 5CYJA 7FD1A 2HFSA 2W7OA 4IOBA 2XMAA 3SMPA 1RT5A 4FWNA 2XSJA 3FR0A 3OVBA 2FVPA 3J81O 1T9WA 5KFUA 4AHTA 2RQ4A 2DHHA 1O51A 2SXLA 4WWSA 4TY9A 4NYFA 4EO6A 2VQEJ 3NRBA 2ZH1A 5FPMA 5GIPA 2UVVA 2M3DA 3DRXA 5F0WA 2DR5A 1BLUA 2R2UA 2XNQA 1RT5B 4LF4K 2G8WA 2VG5A 3AQOA 4IOCQ 1SJ3P 5HBMB 1WAJA 4ED0A 1YG0A 2F40A 1RAOA 3TSUA 5GAGU 1APSA 3GIRA 3G4SS 5L1KA 5J1NA 3MCSA 3MI7X 1F5CA 2LQ5A 4WFBQ 5DGAA 4FLUA 1V5IB 1K73T 2OEMA 3J7YP 2HBKA 3SI8A 1HWKA 3K17A 1DTTA 3MM7A 3AVFA 1V9OA 3BO4A 2QTWA 3KTQA 1RQ0A 2ZBCA 4KV8A 4WYWA 1LWFA 1Q7YO 2G1HA 3NCRA 3KHRA 4CO4A 5GADP 4HUGA 3AXKA 4J9QA 1MWZA 4FZYA 1JMTA 2O4GA 1DTTB 5KG0A 1BWFO 1R59O 2E44A 5EX3A 4P7TA 4A8KA 3P83D 5HANA 4OYMA 4N5SA 3HM9A 2F9TA 3R8YA 4FYYB 1QUPA 5JMNA 2KKHA 4CLUA 5D0GA 1Q0NA 2VZ9A 5ITHA 3VAHA 3C0BA 2WFBA 3R1XA 4PL8A 2UUCJ 3B4DA 4FVMA 3J81j 4WXOA 3TX8A 3PACA 4KIAA 2HVIA 2UXDJ 2ZH5A 4K4SA 4QIEA 1YJNS 1W2BR 4BR9A 1R27B 4K5RA 1WSIA 4F0MA 2GW8A 2V9KA 2FBVA 5KFXA 1NHVA 3ZSQA 1X5SA 3CETA 1U49A 4DFKA 1XC3A 4ZPWR 3QIPB 3RAXA 4KREA 4RUAA 2ZBPA 2E8AA 4ZJQA 1U8SA 4I2QA 3GG0A 3FNNA 2OJ3A 3PIPQ 3QBWA 3OL9A 1HNIA 2C3OA 2E6LA 3N6NA 1P1LA 1Q4RA 4AE5A 4XIUA 5FROA 1RLCL 5HL7Q 1NB7A 4M3YA 3GJTB 4GNIA 2OUGA 2GVZB 2DTUA 1S0MA 4A5BA 2HNZA 1SL1A 5KFIA 3VAIA 4DV4F 4JKHA 3V6DB 3BS9A 3GV5B 4DV0K 3LGHA 2XB2D 1RWNB 4USVA 2ZEJA 3CC4N 3SMSA 2IM2A 5GAEI 3SYZA 5KFYA 4DL3A 1GMUA 1VQ9S 5JMVA 3A5LC 3M9MB 2AX1A 5HP1A 4ZP8A 1NH8A 1IBKF 4WFZA 1NNDA 3DLBA 2L3MA 4L6V3 4CP5A 3O80A 3SQ2A 2NRRA 5HK4A 2QC3A 4BR0A 3W65A 1IKVB 1TTHB 4NLCA 1P8ZA 1Y97A 1BQNA 3N4WA 5D4PA 4WKRA 1JLEB 3POTB 4ILRA 1KR4A 5A6WA 3MEDB 4O4GA 3C3LA 3FZMA 1JCEA 4OPJA 4W5TA 3K9KA 3M6WA 3O4QA 3MMCA 2HS0A 2CIMA 1X1PA 1UETA 4QOZB 4M5IA 4USWA 2CH5A 4DR2F 1U4BA 1TK5A 4JI4K 1RBRA 3O8WA 2DGXA 4O4GB 3LP1A 4LFCJ 5MLCV 2FZGB 1S1TB 4JI2F 3MMCB 1R8HA 1M1HA 2K1RA 2W9CA 5DLFA 1LNQA 2OLWA 4OLOA 3P31A 3AVCA 3LP1B 1ASUA 3TJAA 3UDCA 3NH2A 2WBNA 4BC9A 3DRRA 1N34K 3ZT4A 2IVFB 2E5LF 4DV7J 3THXB 2K1RB 3PR5B 2W9CB 4BBYA 1IBLJ 1P9YA 5LJ3Y 1BQMB 4KHRA 1V4SA 1FHTA 4X62K 1CJUB 2XMVA 5KT7A 1VSLA 2MHEA 2D69A 4YHHF 3JSYA 1KQFB 4DB3A 3R6LB 2DGVA 4AYBD 1HWIA 5IT4A 1X9WA 2MKJA 1ITGA 3TTCA 2LYVA 3OVSA 3I82A 5A8WB 2HAFA 2VFSA 2HSEB 3BQ2A 5I3PA 2P9GA 2UXCJ 2PE8A 4H5RA 4RW9A 4RNMA 4A8OA 2IAJB 3PEJA 2ZM6F 4H5WA 2BUNA 4DUTA 1ZM4A 3TVZA 3O1LA 3SBTA 5KOXA 3S01A 1WHXA 2B9YA 1RHMB 4OHVA 2ZBQA 5B09A 3IAM9 1LK7A 5L1JA 2B51A 4JI0J 3HOTA 1G6BA 5AQLA 3KK2A 4L73A 1FX2A 4Y1DA 2NZTA 3KDOA 2J9CA 3MEEB 3K5NA 1T0TV 4CJTA 3CC2N 4CIEA 4G65A 1C4CA 4MMOA 4FM0A 1Q1KA 4F2RA 1GK8A 4CT8A 3VAFA 1DFDA 3CWJA 1TFWA 1WUAA 1FF2A 2MZJA 3KK2B 1J5OB 1WC1A 4W92B 3SSQA 1Z05A 1CS4B 1QAIA 3A4TA 2M8DB 2NRZA 4P7VA 2B4PA 4B9TA 1SL2A 3OYKA 3OR1A 1NK8A 1T3NA 4BACA 1X0PA 4JYAK 4HDGA 4FJHA 2P9NB 1BMQB 2AEMA 1RHUB 3EVWA 1TKTA 5JUMA 2RKIA 2GAGC 4JI5J 3VEYA 3O9RA 2I5JB 2W01A 4BRAA 1S10A 4FYXB 4GKJF 1DT9A 4XDDA 2OMOA 4WFYA 2NCKL 1WD6A 5CQGA 4CZIA 1X7VA 2VODA 2HNDB 2J5AA 1SH2A 4G6VB 3KHLA 4DX6A 3CG7A 2VASA 1NK5A 3BYRA 1M90O 4J9UE 5ETQA 2O8DA 2ZKTA 2VPYB 3CCJN 1T6DA 4B9MA 4OHYA 1VHIA 2HIYA 4FWSA 3EM1A 3HHDA 2HYIB 4O4RA 5B08A 1M1KO 1SC4B 1IJEB 1X4AA 2B56A 2BJ1A 3A8JA 4ERDA 2DNOA 9ATCB 2V5HG 4E0DA 3OYNA 3PUFA 3AVKA 3CVKA 3QNWB 2YKPA 3MUVP 5CAAA 5JVHQ 4NASA 2DNMA 1G1XA 4QS9A 1NXIA 2VG7A 5DK5A 2Z1HA 2HZVA 3RMDA 2A0FB 4A8FA 3DGVA 1RYSA 4BGBA 2FZCB 2MKYA 3QNOA 3TEGA 3GG4A 1S9GA 2VG7B 1N8RT 4J9RA 2F8TA 3GE1A 2F5GA 1UWBB 1IBMK 1G99A 2HS4A 3W64A 2XMMA 3FJ2A 5ETVA 3FZBA 4WYLA 4DR5J 3CIPA 3JTOA 3SFGA 4I6WA 1BHLA 3AAWB 1NGJA 3ILLA 5BREA 3LZJA 3MR2A 4BDYA 2P5VA 1HARA 5BR8F 3ENVA 4F4WA 5BRFA 3IM8A 4JRPA 3JB9k 1Q82T 5IC4B 2KM8B 5F8NA 4DR4K 3H90A 5AQFA 1TL1A 3BKFA 1S1UA 5K9FA 5E84A 1YBUA 3NF9A 1PILA 2MYFA 4P72A 1HKBA 4E7HA 4WU2A 2JEIA 3IR7B 4BR5A 4IO9Q 1W97L 2CWKA 3KKSA 4DU4A 3U9ZA 5A2QO 1TL7A 2UV8A 2OP5A 4JHDA 3RB3A 1VQKN 2ZOGA 1FNXH 4OX9K 4BC3A 1UPMB 5KFTA 2CRLA 2QSWA 3AVAA 2FLLA 4WFXA 1RBTA 4IUFA 5BN8A 5DRKA 2Y0SD 4JHDB 2YKOA 4O0NA 3WXMB 1N5VA 4BRIA 1N36J 4ED3A 3TA0A 4TY8A 2QA2A 2FHJA 1NK9A 4I67A 2H5JB 3N4PA 4CJUA 3HM8A 5KFSA 2FIUA 3SV4A 4DUYK 2RQKA 2CNLB 2WB4A 3CC4S 3KK1A 3N5BA 4CHZA 3BKUA 1LOUA 1UWAA 1UVKA 2VA2A 2C2KB 5RUBA 2JJ4D 1KCFA 4LF6F 4JAXA 5LJVA 1RT4A 3V9ZA 2DCLA 4IQXA 4M5LA 4LSLB 5EX0A 4X84A 1XNRK 3SQOP 2AYGA 5I42B 3PYGA 3VEOA 3KNAA 4ZMMA 2OSQA 4ZCMA 2MKHA 2ZH4A 1RT7B 2MJUA 3DWLA 5BN9A 3BN7A 5DM7L 1Q5YA 1N0VC 5KFPA 5KFDA 2XGPA 1H2UX 1U2FA 2UU9J 3AXMA 4B3MF 1ULRA 1NOYA 3MXHP 8RUCA 5FLXY 3NFAA 1LCUA 4ZLJA 2XSFA 2N7CA 2MKSA 1OY9A 5KFHA 1N6QB 3FZFA 1OVQA 4TYBA 4CO3A 2LQJA 2A2DA 4CZMA 5D15A 2UYTA 4K59A 5AQHA 3RTVA 3TR5A 1XNQJ 3VQ6A 3KLVA 5GMEA 3OHAA 3GSDA 3Q8SB 3JAMU 5GIOA 1RAFB 3RB4A 1NHKL 2XY5A 4JI8K 3I8BA 3NBPB 3BYPA 4H0PA 2R8HA 3VQDA 1G4CA 2J76E 3MD1A 2BV3A 5M1FA 1FESA 2HSTA 4NRTA 1A5WA 1VC5A 4KT0C 3E2EA 3BGFA 4CO1A 3M7VA 1GAOA 3H40A 1GMWA 1VQ6N 2QK9A 5M1NA 3MM8A 2MMYA 2MQNA 2V7ZA 1IR1A 1HBNA 4CH0S 3ZT0A 3RWUA 4FJKA 1UKUA 3ZSOA 4RNFA 3A5OC 4OYXA 4WPAA 3MR5A 4TXSA 3DI6B 3NGYA 4H0XB 3PJXA 3LH2S 5FJ4A 1U48A 1PYOB 4M5NA 3SQ0A 2AP1A 3V6JA 2BW7A 1FJ7A 1CC8A 3FCVA 4KHPK 3SQGB 3A8IA 3GZ7A 3LA0A 3CNQP 3FEZA 1YX2A 2AP6A 3V1RA 2ZQBA 3KUEA 1U0HA 4RNOA 1KFSA 4GKKF 3DXBA 3CC2S 1L3VA 1RWXB 3MD3A 4KE5A 1XIQA 3OTOJ 4C8OA 2LDIA 1HD0A 3FFIB 3L7PA 4X64K 4EFHA 2CPEA 4RW4A 3UD4P 3CJ4A 4CGDA 3CQ8A 1ZAXA 4OGEA 4BWJA 4NEYA 3IG1B 4G9ZA 3SIPB 4HUFA 3TRGA 4CO2A 1NJYA 4MJKA 1BQXA 4C7QA 1CLFA 3N6MA 2BVZA 2HS3A 3D2WA 3AHPA 2DJWA 1M5HA 4F4AA 2GS8A 3UQSA 3UKUB 3CTRA 5AQIA 4JK9A 1VQMN 1Y00A 1VQ8S 4ENOA 2R7XA 1RTIA 4ITSA 2HVZA 2Y0BB 1QY7A 3EVOA 3TUIC 3CCJS 2O5DA 1BG3A 5H1SQ 4JI7K 3HJVA 5SUHA 4J5OA 2ZITA 4HI2A 1H6KX 3QINA 3IS9A 2QLJB 1WWHA 1U04A 3FLCO 4DU3A 5B0GA 2BOAA 5KGXA 5D3GA 4CESA 1YTYA 1L3SA 4LRFA 3I8DA 1L3KA 3IS9B 3TAGA 2BJ8A 1S5JA 4C6AA 1W26A 1IVZA 1TMMA 4CJSA 4FJNA 3CCUN 2R8JA 2HEKA 4F4ZA 5D4LA 1U1NA 4LH5A 4RBUA 4DXLA 3K5LA 3IKMA 5M1QA 4Q8FA 2AYBA 2QLBB 1B0TA 3MPDA 1OSCA 4Q45A 1VQLN 3NGUA 5J2QA 3A13A 3IMQJ 2ASMA 4BVPA 2UXBK 2KT3A 3CQYA 4QWBA 2FJEB 3OJSA 3M6VA 2VBZA 4JD2B 3SQ4A 4WIQA 3UDVA 2AX0A 3NKYA 1HNZJ 5J2QB 3TNVA 3K2YA 2EK6A 4J9VA 4LF7K 2X1AA 4BQLA 4K0KK 2EW9A 4C0OC 4DN9A 1MNEA 2Q6CA 2A1BA 4DQSA 1WTBA 3JQKA 2NZ4A 5K8OA 5DG9A 4DZ6A 4LF4F 3V9WA 2VU5A 2NR0A 2V4JA 4CD1A 3Q22A 4DR1K 3QESA 4KB7A 1CEZA 3QO9A 4FM2A 3VV2B 5F9NA 3HSDA 4DTPA 4P6QA 4YOXA 3NL0A 3I55N 4OV6A 4NYNA 3A8YA 4DG1B 2V50A 5KRTA 1BHNA 3Q23A 3DU6A 2DGQA 1SC3B 5GAGP 3ETMA 4QU7A 1B4SA 2Z2ZA 2J9DA 3NGSA 2JRSA 1VQKS 4M3TA 4DV4J 4FNIA 3C46A 4FP9A 3EY1A 2QFIA 3R7NB 3M8WA 3MCOA 3MM6B 3R2CJ 3Q7BA 4CO0A 4I6MB 1IBKJ 1FE4A 1EKSA 2WTUA 4ZP6A 1U0SA 2VD3A 2VJUA 2K3IA 4NLSA 4H4MB 4QOTA 4Y34A 4I7FA 1CJTA 3LP3A 4ZHRA 4UW2A 3AJ1A 3OY9A 5C15A 1C0TB 1Y7PA 1OPIA 5CZ2A 2W7PA 1NPRA 4OZ2A 2NXNA 2GQCA 1DLOA 4P71A 2XZDB 4RW8A 1YJWN 2V8GA 2BJ9A 2B4JA 2ZH3A 1CJTB 3GP9A 2VPWB 4N41A 2KRBA 4Y6IA 5E26A 1VJQA 4PG4A 1A5VA 3RAQA 2ASYA 2MB0B 2DGTA 1DLOB 4BRFA 3W7BA 3VAKA 4WU3A 3CCMN 3TW0A 1SB6A 4PEOA 1VSFA 2FUG9 1RABB 4Z4CA 2Q36A 1J6ZA 1MWMA 1S6QB 3G86A 2B7BB 1RK8A 2HHPA 5LL6Z 5D0EA 1VGYA 3DJCA 3KWMA 2ZH6A 3ZZUA 3VAJA 1LAVA 1H7WA 1EQ0A 2E5LJ 5LMNJ 5DG8A 1YITS 1RBAA 1X5OA 4ZPAA 2GV9A 1WJ9A 1QAYA 3MPVA 2HNYA 3I33A 2YWHA 3ONQA 1CXUA 4XDCA 1HJOA 2C3UA 3BBCA 1Q8IA 2FB0A 4EZ9A 2V51B 3CW2C 5D8HB 4H4KC 3VZIA 2PO4A 1HW8A 3TAQA 3TU5A 2X3DA 3TI0A 3ILOA 2GWKA 3NGTA 3IAYA 4O44A 4ELUA 2V8PA 1UFKA 3M3ZA 1UZHA 3WUHA 2CPZA 4DV0F 3DGPA 3P4IA 1X5PA 1FRIA 4KYZA 3AODA 1RWMB 3WEEA 3OYAA 3G6YA 1VQ6S 4O44B 1R6YA 3V9XA 4IFYA 3MEGA 2ZM6J 4X4OA 5AQJA 3Q7CA 4J91A 2PMZD 3ZSYA 3VVUA 2YQ0A 4Z94A 2E66A 3QEPA 4NZ6A 1S12A 1NU4A 3SXLA 2JL9A 2CA9A 2YKMB 3SI6A 4I2PA 3P8BB 3I0RA 2OTJN 5G0RB 4IOAL 3KKFA 5M1OA 1N52B 1X4FA 3ZNJ1 2KJVA 3DOLA 3MCAB 4DX5A 1NO8A 1GH8A 4XK8C 3ALYA 1NAQA 3DLHA 1RWOB 1MG7A 2R7RA 2EXUA 4U7UK 4V19J 3ZX3A 1S0VA 2LA4A 4JI4F 4RW7A 4CK1A 3WQTA 1YJ7A 2QN6B 4AUKA 2ZD1B 2EWHA 3AO4A 1ACMB 4YOTA 2E9TA 4OZ5A 1UCNA 2RILA 3D6HB 1BWVA 5IV3A 1VQ7N 3W2WB 3DDIA 3KZBA 1NGCA 4DV1K 2Q1LA 2HRTA 3CD7A 4BRLA 2EC2A 1D9AA 3OQ2A 3E51A 4CZCA 3U4LA 4GKJJ 4F4KA 3IBCB 3CDBA 3LO3A 4W5RA 4OGCA 3UE5A 4G1QA 4X62F 4M7YA 1U7LA 2DXDA 4IR9A 2HLUA 3BM7A 1VHFA 1RKIA 1UW4A 1Y3KA 3DRPA 3RRGA 4KH0B 3ZC4A 5C0YA 4B02A 2DIUA 3H1VX 4G1QB 4C98A 2HBYB 4N8OA 1C4AA 4QR0A 4A4JA 3H5UA 3CXCR 2QZ8A 2ZWOA 2CYYA 3QSYB 4DMNA 4CJPA 3HYFA 2GHWA 1VQMS 4USIA 2IHR1 4A8SA 4CHPA 2Z4PA 4DFJA 4WFAQ 1JLGB 4B3RF 4RJVA 3UW1A 4IBNA 1WOSA 3QRRA 5HLFB 4YR2A 1W0HA 4YB1P 5DDPC 4DX7A 4FBTA 4CM0A 4J9SA 1JIHA 1TP7A 2ZZTA 1OWXA 1RTHA 3L3VA 1S1VA 1S7HA 2CPIA 2H5IB 2HQCA 4B9LA 2DHGA 3T1AA 1SS6A 2D3O1 3DRSA 3PW2A 2ERRA 3X1LB 2B4UA 4LFAK 1LW2B 4ZLLA 1RWUA 2CDRB 2OPQB 2WBRA 2OCEA 3EKUA 3VQ8A 1FDBA 1XQSC 1QQOA 4BWMA 3HD2A 1HI8A 3Q24A 4B8CA 4DV7K 4ZDNA 3KLGA 2ZWHA 4ZPCA 2HMPA 1LWCB 1KOOA 1FRJA 2FLOA 4ICLB 3RBZA 4LSZB 5DM6L 8AT1B 5BR8J 4Y2IA 5HMZA 1VQ4N 3KJVB 2PY5A 3H59A 3FMBA 2AMCB 4OI4A 1HMVA 3KLGB 1Y5LB 1C0UA 4K42A 2RE2A 3RYLA 3SPYA 3IR5B 5GMDA 3E01A 2XGQA 4KRWA 2RDJA 2BZ2A 1NSAA 4F36A 3PZPA 4Z37A 1C0GA 2JDJA 2MQLA 2AJFE 3BEGB 1WSVA 2VDIA 4DTRA 3JTPA 3HCXA 3SCLE 4M95A 4DDFA 1M5SA 4Z4HA 1KOHA 3PW0A 5FIIA 4M3XA 1M5KC 3QFUA 2VYPA 3CIZA 5DLGA 3JQJA 3I55S 1GOAA 2E7VA 3L7UA 2RJZA 3F56A 4CECA 1RAAB 1S9FA 1VC0A 4M3WA 2AU0A 4J9LA 3L2VA 4PQUB 4HYKA 3QT5A 4FZZA 4CIFA 3V6KA 3RR7A 5HI7A 4QYZK 3RRKA 1MMNA 1GXTA 4DPXA 3PSFA 4CYUA 3U3YA 2DPJA 2VWKA 3VGLA 1NJWA 4F9OA 3CD5A 4F7VA 2LA6A 4NLOA 3E9OA 1VDHA 1U1MA 4H54A 4UQTA 3OS2A 4O8UA 3K8VA 2ZUGA 2JLGA 1NB2A 3I4HX 2P8IA 4E1MA 3CCEN 3DMJA 3F9MA 4CYUB 4LF6J 3KJFB 2WVCA 4R0JA 3OFHA 1Q95G 4GV3A 3ISNC 4CTAA 4M5DB 1B7FA 1IBMF 4FYVB 2CQDA 1Z2ZA 3L9ZA 1V5VA 2KYZA 2ZNYA 2RB7A 2FGOA 3AGKA 2MLXA 3DM2A 1WBBA 3K8WA 2KB2A 3ILJA 4NYPA 2DGOA 4RWXA 5FLXU 1YJWS 3H5XA 4CQ1A 3LPTA 5JS2A 3P4UB 2C2DA 4IG3B 3NP5A 3VGSA 1T11A 4DV6J 2GMLA 4B3MJ 1VQ5S 1NMEB 2N7YA 3ULEA 1UFWA 4DR4F 5KQ8A 2YJEA 3WIVA 2P5OA 1JLCB 4CRJA 3CCMS 1JJ2R 3M8QA 2XQCA 4M5MA 3DU5A 4WCEL 2R7VA 2W25A 5EGYA 4WTYA 2AJQA 3HF5A 1OQ3A 2XZTB 1HNVB 3I31A 1YUWA 2ZUAA 2W42A 2IM1A 1HLUA 1TUWA 4LF2A 4OX9F 3J7YI 2IS3A 1NMDA 5E3PA 4A2AA 1TKXA 4A62A 4ECXA 2R7QA 4DJBA 3PFEA 5IOLA 3FSXA 1VRTA 3T1HK 4K4YA 4KKOA 1Q86T 5GADI 1SKUB 3TR8A 3BSCA 2DEIA 3SCXA 1YHQN 2XRIA 1XMOF 2IDLA 2AJ1A 3C6AA 1RDUA 2O8BB 4F0HA 2XLJA 3A8KA 3I0SB 2BANB 3W9JA 5ADXH 1K9MT 3L2WA 5EX5A 2GVDA 4P75A 2H48B 3CFRA 4UUXA 1QJHA 2M70A 3MR3A 2EKYA 5E3CA 1L5UA 3M1VA 2E5HA 3V4MA 3HVAA 1YVNA 1XNRF 1RAHB 3OV7A 5AQWA 3ZTRA 4ETXA 2AJ4A 2FYXA 4A8MP 2YKNA 2OI2A 5KFAA 3HVRA 3ZZZA 1QS4A 2LSNA 2RF2A 3DLKA 4NYZA 2ZH7A 4OI2A 4FYWB 2LXUA 3HSTB 4ZA1A 4ES1A 2YKNB 4IXCA 2CJKA 5J2NB 5JVGL 1U2RA 3OXFA 2OANA 1FTRA 3CERA 1JXEA 2H1YA 3R9LA 1REGX 1GXLA 4Q8EA 4KHQA 5HQMA 4F4YA 3R7SB 3PR4A 4AQYK 2GAHC 2DNRA 4EFAC 2O8CB 3MZIA 1VQ7S 4OYBA 2BJ7A 3CM6A 2IFXA 2G4BA 4JI8F 2XZWA 2IMWP 2R7WA 3CGIA 3LDOA 3CF5L 4KTZA 4ECZA 4QWAA 3I9ZA 5EU7A 3E1YA 5KFGA 2HHVA 1VMBA 3T5JA 4H4OA 3JSRA 5F8GA 3UO0A 3HULA 3CMAS 1HI0P 2QRRA 2D1KA 4NXNK 1XMQF 5EY4A 5DETA 2UVRA 2F96A 4GVBB 5AE1A 2Y1RI 3FCWA 3CJ8A 4QR2A 1FX4A 4U7BA 1WHWA 3HKWA 1F2HA 2DNPA 5F1XA 1IR2A 1N5TA 2HLTA 5J2PA 2DB1A 1FJGJ 3HVWA 2W4CA 3SDEB 3SSRA 4WE1B 3L0QA 5AJ3J 3UN2A 2XYPB 2HBMA 2ZZNA 4KHPF 4RW6A 1KFDA 3DRYA 3VQ9A 4BCAA 3NF7A 1KS2A 2J7KA 2E5GA 3MMBA 4URGA 1SKSA 4Q43A 2UV8G 5J2PB 5M1PA 3C7NA 1DQ9A 2OELA 3TJ8A 4NL5A 1RT1A 2G2YA 2I8EA 1RBVA 4DQ8A 1GOBA 1FK9A 1WHYA 4TSXA 2V68A 4YNQA 1KLNA 1EWQA 3O3LA 2R7OA 5F8HA 2ZNZA 3M8ZA 1TYQB 4KAZA 2AWZA 4EGLA 5AQKA 4Y28C 3OFEA 5IM0B 4ZVFA 2NRVA 2KHDA 3BREA 1RADB 2FC8A 2HFOA 3CDEA 1AUDA 4LF8K 1WAFA 3UWTA 3KVGA 2IVNA 4RG8A 1EETB 3Q89A 3KXDA 4LF4J 3DLEB 1RTJB 4JKCA 4I6AA 3EDRB 1FVSA 1HRHA 1FJCA 2OPSA 3OBIA 3IC1A 2P9CA 4J9NA 4NXMK 4OIXA 5HJXA 1K0VA 3U3GA 4K41A 4H5VA 2UUAK 2GEMA 3DOMA 3C6HA 3HTVA 1OH7A 2ZJRL 3GR0A 3CCSN 1MROA 1T7PA 5LXYA 2C1EB 4IFVA 3KYLA 3KLFA 4JI7F 3EN9A 4CIGA 4DR7F 1AFJA 3DLGA 3RB0A 4ZPTR 5IWAF 4JBCA 1MROB 5F9LA 3THPA 3GLJA 3TUPA 5A0YB 4DHVA 1N5SA 4BDPA 1UPPA 4B3OB 3LF0A 3DLGB 3D54A 4O3OA 2FY8A 3V9UA 4CJ3A 3OTOK 2KXHA 1VK0A 4LSNA 2N82B 2DVIA 5HQLA 1RDWX 1ZOTA 4C11B 3BF3A 3OSNA 1WOQA 4FWLA 1HNWK 1RWKB 1CBKA 2ZBRA 2FBXA 2ZFHA 2UXBF 4ILJA 1OS5A 2VBYA 3VALA 2FHOB 1MWQA 4TLQA 3CSKA 4LF7F 3ZZPA 3AVIA 4UOGA 4K0KF 3D68A 3VENA 3ID8A 2H51B 3M2UB 3NF6A 3TAMA 4M5JA 2HHQA 2FSNA 3H2LA 2PC6A 2L9DA 1DKGD 3RMAA 3RAMA 3WXKA 3PEHA 2MGZB 4PWWA 1ZZFA 2V8HA 4ECTA 2ZBIA 4DR1F 4ECSA 2QMUB 3CCVS 1GLAG 2W2NP 3G82A 4CGIA 1UJ4A 1S59A 3ZTQA 5K20B 4OJHA 1BI4A 5K8MA 4QIVA 1BUXA 2B8QA 3F41A 4AL7A 1F1BB 3HZEA 2QYGA 1Q78A 5F8LA 3PIOL 2VIHA 2UVUA 2J0XA 4NLTA 1NPPA 3LP2A 3GCWP 3A3OB 1CXQA 2D9PA 4WIIA 4DV0J 1ZAVA 3VAGA 3OYIA 3AVHA 3J8AA 3LALA 4FNHA 4B1VA 1UEVA 3K5MA 4BRNA 3L6QA 2YWKA 4AT1B 4K4VA 2AQ4A 2X6NA 2RPIA 2NUHA 4DL0C 1YHQS 3W2VA 1H3DA 2EFVA 1JL1A 1S0NA 4MQ3A 1RU1A 3MWBA 3HHLD 1NGFA 2E5IA 1R0CB 2R7UA 1V4TA 1W2BM 4DCHA 4WF9L 4KPYA 4PKGA 4PXDA 3LUYA 2CH6A 3O9QA 1ZTWA 1VFJA 3R3LA 3VTIA 1NDCA 5A2QU 1WDTA 4JK8A 2W6LA 1WDDA 5IV4A 3M2VB 2CJAA 4H5TA 1MMDA 4LQ3A 3LGMA 3W3SA 4CFCA 3V1OA 3IUCA 3GIMA 4OJRA 2BJDA 3CJ9A 3FEYB 1JKHA 2CPHA 1N34J 4FOIA 3LP0A 3AFGA 4TU7A 5T41A 1T05B 3W5XA 4X4SA 5KQDA 2CVIA 2O66A 1JKHB 3D0HE 4X62J 3EO3A 1GQEA 1X4HA 3LP0B 2FJBB 1X9MA 4OYIA 4JRQA 4YEAA 4EMDA 4KO0B 1WSRA 2F9JA 4HH1A 3ZCMA 2BW2A 3ZO7A 1H7XA 1T03A 2GUPA 5GAHP 4RNNA 3VVTA 2KL8A 3G6VA 4TKTA 3GIJA 3FQLA 4AHCA 2O8EA 4NLBA 4DTSA 4A47A 5MLCQ 4FJ9A 3JTNA 3TSQA 3A3PB 1BCOA 3HI0A 4AHUA 1PO6A 2R2SA 5A8KB 4QJVA 4IFEA 5ETRA 4ISEA 1WKLA 2O8EB 3CJKB 2LEBA 3ZX2A 3O3HA 3F9KA 3QERA 3B78A 4KHYA 2AIRB 2E88A 2EG1A 5HOOA 1VQNN 4FJXA 3EE3A 1UJ6A 3HI9A 2PD1A 2QJ3A 2NNWA 3D5MA 4ISFA 2JH3A 3VQ7A 2MXYA 2D74B 4FVCA 1HKGA 4FZVA 1TVRB 5ETKA 2G8UA 3H4DA 4FLVA 1ZZNA 2CJXB 2XM3A 4FK2A 1U6BA 1FERA 2P9IB 3BZKA 3HDSA 3VF0B 3PRVA 4UY8T 4JI1K 4JYAJ 2OPPA 2QL5B 3D66A 4UF4A 3DCAA 4DSFA 4MFBA 2DHXA 2DCUB 4DV1F 4JI6J 2ZGYA 3R5BA 1ZBFA 5FRNA 4IYQA 5BYSA 1MU2A 2R8IA 4LR7A 2WUSA 3LAKA 3BR9A 1C2PA 2N3LA 2OA8A 2VOPA 4MFBB 2HWIA 3AB4B 1KVAA 3CJRA 1JLBB 2K7KA 1MU2B 2BJ3A 2GIRA 3QQCD 4QAGA 1TL3A 3ENQA 2RH3A 4XTTA 3D2FB 2XLIA 2NRWA 4O3RA 1VQSA 4KI4A 3KUGA 2A1RA 4LFBK 3TWZA 4L74A 1N5YA 3LTOA 4H03B 4XPCA 4OO1J 3MUTP 4M8LA 4ZIWA 1HYVA 1P9QC 4MLHA 5IQ6A 4J2BA 1HWUA 1RSCA 1H73A 1GOCA 3CB4A 3B54A 3CCSS 1RDBA 2YQ1A 8ATCB 5KT6A 3I32A 1YVFA 4YDDB 4C48A 3MF5A 3V6HA 1N5YB 2MQ8A 4LRDA 4FYDA 2QX0A 2JVOA 2OPRA 1AUSL 2CG8A 1X0FA 3UVJA 4FJJA 1LV5A 2Z2MA 5CYMA 1N8RO 1WTFA 1YJRA 3HFKA 4CHNA 1SUQB 4UOHA 4DV5J 1SKWA 2OPRB 4LFAF 3UVJB 5E3AA 3H2VE 3AD8C 3HT0A 3MTJA 4DI6A 3V4IA 4Y0WA 1IBMJ 2DRBA 1HQ2A 2W7AA 4CLYA 3ZSXA 2FSKA 1S79A 1AW0A 1Q82O 4DV7F 2QE5A 3OYJA 4K25A 3EX7B 1SAZA 2OMLA 4TU8A 1RGVA 1TR0A 4HR2A 4OJ3A 1IBLF 4CT9A 4J2EA 1SH3A 2O01C 1RBSA 5DO2A 2ZHBA 1K47A 2YHBA 2I0XA 3GYGA 2BABA 3GFYA 2R9LA 2ALYB 1XR7A 2XCAA 1KLMB 5AQTA 3EXCX 3HD1A 5IT9Y 4M3UA 4ZPDA 2A18A 2P9LB 1JB0C 3TANA 1VISA 3NEKA 1VBZA 1QE1B 3IN5A 3CJ5A 4WP3A 3OYMA 1FWLA 3TAEA 3LDLA 1VSEA 3K5PA 3QMQA 2E7XA 1T02A 1HIYA 5E2QA 3BF1A 4R8UA 5M1KA 2QWNA 1T9XA 4LH4A 1GLLO 1KAXA 3H45C 4EAHD 1B3TA 5KFVA 2LXIA 4DSJA 3R5JB 4RUBA 3FBFA 2D0OA 4WFBL 1OSDA 4ETZA 4IR1A 4F3MA 1YZ7A 2OD4A 5C5JA 4M3ZA 2DRDA 3NMAA 1NGAA 1RUSA 4DUYJ 4HT7A 4P2SA 1MWKA 3X3UA 3OUYB 1KQKA 4B1YB 2GX9A 5T14A 2QT7A 3ZSRA 4UT4A 1HR0K 3IGNA 1W7WA 4FF2A 1KXPA 1QQNA 4FN5A 5D0RA 5KG4A 4LUBA 3WQPA 4EU0A 4I69A 3I4PA 3O9SA 3GFHA 2MZSA 4DL6A 3L4QA 3D0GE 3T5LA 4OZJA 1TK0A 4USJC 4PWDB 5AQSA 5M2UA 4DR6K 2DFEA 4CK2A 4RCHA 4PKHA 4DCJB 3AVJA 3VETA 1RCHA 4DU7A 5CCLA 2W40A 2IBOA 3AB2B 1YJ9S 2JFKA 4N47A 4AILC 1VYAA 5C24B 4B9NA 3BGOP 2CNOB 5D0HA 4IRKA 4YORA 3H1QA 4NPOA 4LQ9A 3F44A 4GVEA 1JLQA 4MO4A 3ZZOA 3PIPL 1S7IA 2OYQA 2EK1A 2GA7A 2HMIA 4EP4A 2HQFA 4DF8A 2PZSA 3NNAA 5HL7L 2D5RA 2VQFK 1D1UA 4ZCKA 3R97A 4KHSA 5JXSA 5KT2A 3UDEA 3HZGA 2VKRA 3BP8A 1R0AA 2ROEA 4JN4A 4LMZA 3WXLA 4FJIA 3LQVA 1DTQA 3AO5A 4IH7A 1M5PC 4GC7A 2D4WA 4M63A 2W6KA 1FNMA 3C95A 4X66J 2D1CA 4U8YA 2A1SA 2EWSA 2Z1IA 2WB1D 1E3MA 2J7UA 1NSPA 1ZA1B 4C3LA 4ED6A 1HJRA 1IR0A 4L3QA 3HO1A 4IWVA 4BRGA 5HVFA 3C16B 3EGNA 4KHPJ 3HSCA 3SAFA 2Y1JA 2R2RA 4CJKA 2WRMA 3ZZ0A 4FPBA 2H4WB 4X65K 4CCHA 4F25A 3G6EN 2CQCA 1EXQA 3IO1A 4CF1A 2GC8A 3GIKA 3ZLJA 3C6TB 3V9SA 1FKOB 2KH9A 5EN1A 1NGEA 2N4DA 2VG6A 4PYDA 4A61A 1HHTP 4PHTX 4WQ4A 4C0HA 5C42B 3A3NB 3GFXA 3N0VA 5CHCB 5K5MA 2D9OA 1NU0A 4X64J 1Q8LA 1Z4UA 1WG5A 1YRXA 1OY8A 1NDLA 4C23A 2DKOB 4U8VA 4NI2A 5EDWA 2VPZB 5LJWA 5KG1A 1BWEA 4PUOA 3RW7A 3BO2A 2FJAB 4DL4A 1JXLA 3GYXB 5I3QA 2CQBA 4L8RB 1WC0A 1XWLA 4IKAA 3C2PA 2PGCA 1X3NA 2PFUA 5KFEA 3OBWA 5EVZA 1RT2A 4PG8A 4ZVTB 3L2UA 2BGGA 4LJMA 3U1MA 1TK8A 1JXVA 5CR4A 3MMVA 4HHHA 2CJBA 1CJKB 3DXKB 2DY9A 4DV3K 2QG9B 4DEZA 2GGPA 3O08A 1NEEA 4FF3A 1RT2B 2PI4A 5F41A 1VRUB 3HKZD 2Q79A 4AHVA 2JWLA 3D7EO 3GWCA 5LSOA 1Y4ZB 4RZRA 1I51B 3LDPA 4AH9A 3FVYA 3HHLA 4OPKA 3SLCA 2JWKA 2GGPB 3BQ1A 4JI7J 2D41A 2D0CA 2ZH8A 4CJ5A 3GSIA 1D9FA 3BUZB 2VWBA 1Y0HA 4FF1A 2CJQA 2KHOA 5B8HA 3IBWA 4HVJA