4ZI2D

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
125
structure length
125
Chain Sequence
EDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 54
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi2D00
4ZI2D 4ZI3C 2K9AA 4ZI3D 4ZI2C
chains in the Genus database with same CATH superfamily
5CA0E 1I94T 5BR8T 4AQYT 2K24A 2Y8DA 2X9XA 1SHZC 2WDVA 2WB5A 1D1BA 3N9OA 4F6RC 3PJAJ 1KEYA 4LMKA 2XQ8A 3AE6A 2C5JA 3OPCA 2KNDA 4DV2T 2LJLA 3PUVF 4ZZBA 1SE7A 3H3MA 4UEMA 3RHWA 2LEHA 1UGOA 4J2CA 3GWHA 5LOVE 4PJNA 5ABGA 3ZJ1A 3C51A 2L9QA 5AQSB 5JDHA 1D1AA 3Q5WA 2V5DA 3AB3B 5JDGA 1B7TA 4DV5T 5IWAT 3I9WA 2DHRA 3VRBA 5IUXA 5AQRB 2LM9A 5DJQC 2YK0A 2D5UA 5AQUB 4IE6A 2CXDA 4DMVA 3BQIA 2GK9A 2W00A 4PW8A 2DNXA 3VKGA 4JI3T 3RLFF 2BKNA 3PUWF 2LHNA 4IE5A 2JMKA 3HKEE 2CBIA 3A5XA 2PTFA 2XZEA 3VHLA 2YN6A 4PJMA 2WSSV 2HPJA 3LSVA 4HWFA 2A72A 3CIRA 3RIUC 4IDZA 4AKGA 3FZKB 1WYCA 1VCTA 2V7MA 1IBKT 2E9XD 4QWNB 1OEDC 4CXXA 2XSBA 2WM9A 1BR2A 2XSAA 5LCYA 1HS7A 4ZOLE 3KV9A 3UT5E 2IC9A 4IL4A 2LT3A 3CX6B 3NWIA 2JQHA 4ZI2D 4JI5T 4ZI2C 3TLSA 1HNWT 1IJ6A 4XBFB 3UU4A 1ZV4X 3KV6A 3ONLC 2Z6EA 3AE3A 2J47A 3N9PA 2OV9A 3L8RA 2VKHA 3EDUA 2YDQA 3C4WA 4BJMA 3Q5EA 4NUVA 2K3WA 4DV4T 3TLUA 4H63V 3TLWA 3RYIE 5J0ZA 2WS3A 4JI2T 2V7KA 5FVKA 4HWIB 4LF7T 5HXCA 4TNWA 4CQIA 1CHUA 4U3CA 5HXHA 3JADA 2IUBA 4ILBA 3QUJA 5HEGA 5IYZE 4KI0F 1LRZA 2VASA 3PUAA 4ZXLA 4TX5A 2VL0A 4MBQA 4B3ST 4JEHB 3UQ7A 4CI1B 1HNZT 4HN9A 2K5BB 3SFEA 4WNKA 5H6RB 4IE7A 5FYMA 3AAIA 1JNRA 2XQ4A 3RPUA 1W0BA 1IBMT 4YSZA 3PUZF 3K8PC 2J62A 1NENA 3R6NA 3QB5K 5JVDE 4IREA 4EYYR 4OHFA 1KNRA 5L3BB 3AE2A 4C91A 5L2LA 3VR9A 3QK6A 2XM1A 2BKOA 3LK2B 3KBTA 3UTKA 4NIQA 2NW9A 4YHHT 3OKQA 2Y6XA 1V9DA 2ZLYA 3CK6A 4HFHA 4P0BA 3AEEA 2MBGA 2XPKA 5KX5E 2V7IA 3E0ZA 5JDNA 2E5LT 4I55E 2R6GF 3AEBA 3DJBA 3T1HT 2NOXA 2K48A 5JDQA 2CLYC 4U2YA 4TV8E 1HFAA 2DI4A 4EV6A 2JQKA 2QGSA 3FZLB 1WYBA 2X66A 4CI2B 1MMNA 3PTRB 4DBRA 5AQVB 3AA6B 3JAFA 3PUQA 4MHCA 1M7KA 2W0GA 5HCJA 5FP3A 4NXMT 3M65A 5DQVA 2VQFT 3M3ZB 4PJLA 2E8IA 4JI1T 2ZM2A 2I6HA 4YTNA 3FBLA 4DBQA 4HKAA 3E08A 4UVCB 3AE8A 2RPAA 3IBPA 5AQIB 3FBZA 3U3IA 2AE9A 2LSJA 4H9PC 3PV0F 1FMWA 3U78A 3D0TA 3NZQA 2WWUA 3X1DA 3ABVA 4QHOA 3MJXA 3PUYF 4DIDB 2HH7A 1I6ZA 5LBQB 5HXRA 1HG5A 5ABHA 5LA6E 5LMNT 3RH3A 2HN2A 5ETWA 4E7SA 2ZM8A 3NZPA 2Q9QD 3ZT6A 2BG9E 2C5KT 5AQKB 5J1GA 2JQQA 2Q9QC 4KBMB 2I59A 4X1YE 1S94A 2XAHB 3CMLA 1FJGT 4H63H 3UU3A 3BK9A 3P4PA 2VK9A 4QKNA 4U2ZA 1CUNA 4TWDA 4WZXA 3RYCE 3JC6C 3UUNA 3EAMA 4EOZB 4QX7B 5AQLB 3JCFA 2BBHA 3AE5A 4X66T 2X9YA 3O1IA 2VB6A 3Q5DA 2WU5A 3O1HA 4UELA 5DQWA 1G73A 4GOUA 3F2EA 4O2BE 3HKCE 2KT9A 2CEAA 2RP4A 3NRYA 3EI0A 5JH7E 3P8CD 4QH4A 4DR5T 3CQGB 2EHOC 3WI3A 2X68A 5AQNB 3N9NA 2WDRA 3AEFA 4E7ZA 3AVRA 5AQTB 1IAPA 4O2AE 2FJAA 2XJ7A 3N9QA 4OYKA 4DNDA 3VR8A 1ZHCA 2FUPA 4LFCT 4O8SA 3FB2A 3SS1A 4P0AA 4AXPA 1XNRT 2C5IT 1T72A 3VKHA 4IT4A 2CWOA 3ONXA 5C3JA 3I1AA 3SRZA 1N33T 3EDVA 4IDNA 2LM2A 3B13A 2NTYA 2LSIA 2UXXB 2JRKA 2VKOA 3RYFE 4TZ4C 4PK5A 2VURA 3FZFB 2A3DA 3F57A 3ZCIA 5HYAA 1T98A 2G0UA 4CN4A 2XQ5A 3MK7C 5FXXA 3PJAA 4BJNA 3UUMA 4H9SE 4B3RT 4DMWA 3LK3B 4XZCA 3HR0A 5C8YE 4QXBB 2CM0A 1LVFA 2D9DA 2HHHT 1XWMA 4G63A 3OYXA 3OJAA 4X1KE 4YLHA 3DP7A 3SOLA 4CN6A 1KF6A 2W4XA 1NWMX 1KFYA 3MA9A 3RKGA 3RC3A 2DLRA 5LYJE 1KNPA 3ZMSB 3AE7A 2KMFA 3C64A 1E1HB 3SFDA 3RX6A 4HFEA 3G06A 2XM2A 3O1JA 4EZHA 3L09A 4ILUA 4UIGA 5AQPB 4AKRB 2NW7A 2CA5A 1HX8A 3F31A 3P4RA 2N2NA 5DABA 1HX1B 1VCSA 1MMGA 3LBXB 4IDQA 2L3LA 2WAUA 3N2KE 5FY1A 2YKSA 2IC6A 3HL6A 2MAWA 4HWDA 5JR9B 2CPTA 1N34T 3RIAA 4MALA 3AEAA 1UX5A 5FKYA 4HFCA 5LGNB 5FNVE 2EHOB 2CHOA 2V5CA 3AAAB 3HKBE 4EYUA 3ZC0A 4IL9A 2PBIA 2UUAT 4O4LE 4JI0T 4QH5A 5L3EB 2BS4A 3JAEA 2E9XC 5AQHB 4U72A 2PG8A 2KSRA 1LVKA 5LXTE 3LBXA 4ANJA 2UXCT 3W15B 4EAHA 4I0UA 2QYWA 1QSDA 4JI7T 5JR9A 3CX8B 1FMVA 3TKLB 2UU9T 1DU2A 3RF1A 3UU6A 1ZKEA 5L3GB 3RIFA 2EHOA 3I0OA 3CWZB 2WZHA 4GIWA 3ZN0B 5TAOA 2W67A 4Z91A 3H3AA 3UFGA 3N9LA 4LF4T 4Z90A 5A1LA 1W0AA 4H9OC 4KP3C 1S35A 1HNXT 4JUYA 5HEUA 4DUZT 2V26A 4CN1A 2YU1A 4NXNT 3ZSTA 3N9MA 3KV5A 3KBUA 1VOMA 4Z8XA 3S4UA 4ZS3A 2BG9C 3K3QC 1IZNB 1MNDA 3ZC1A 4EEBA 4A97A 1YKHB 5AQGB 2DCFA 3AEDA 3GA8A 5LHHB 4YTMA 5EZYE 3QOFA 5JDMA 4K0KT 1YXRA 3A8YC 4AKLA 2MTQA 4LFAT 1YQ3A 4YSYA 2IW5B 2QRXA 1UURA 1MIVA 3ETUA 4U74A 1MIYA 3CPZA 2XHEB 3AAEB 4GKJT 4IE4A 4HGAA 4O4IE 4G2AA 3NVOA 5L3DB 2W63A 4X5TA 3TLVA 3KVBA 3C4XA 1US7B 1FIOA 4FI5A 5H6QB 3WAKA 4WBNE 2ACXA 2WZIA 4YJ2E 4ZI3D 2YDSA 3RKOA 1UX4A 3AXJB 2ES0A 4TWHA 2VL8A 3RRWA 4P09A 5CFBA 4COFA 2ZMAA 4HEAA 2V1DB 2UXNB 1OEDB 2A2FX 1J5WA 2E9XB 4UV9B 2ODUA 4BA9A 2E5VA 3RRCA 3UFEA 4ZZCA 2V6XA 2OA5A 2W66A 1Z0PA 2BZBA 3ZPOA 5AQOB 4DV6T 3ZSSA 5FXVA 2B1EA 4TWFA 3PU3A 4ASKA 4DR4T 3CVRA 3ONJA 3ZMUB 2VKJA 3AXJA 2XAFB 4DUYT 1HTJF 4ILCA 4ZI7E 3UU8A 2M67A 2CE7A 3RIUA 5HAXA 3ZT5A 5KDMC 2VVNA 5LP6E 2V7LA 2W61A 3FXDB 1OEDA 2E9XA 3IEEA 2LLYA 4YSXA 4DR2T 2X51A 1FEWA 2X0YA 1W9RA 4P1NA 4NUUA 4JI4T 3KDSE 4QH1A 5LGTB 2DL1A 4MFRA 1X79A 4JBWF 3J9X1 2BS2A 3UQ4A 4U7IA 3OTOT 4DO0A 4YHJA 4UV8B 5E0OA 1H7CA 3P4WA 1WR0A 2MPKA 1SA0E 2VVSA 3CKDA 1XMQT 3ZMTB 2XQ3A 4YXDA 3SWHA 3KV4A 1XZYA 3EABA 3LFMA 2BKPA 3Q9DA 2WDQA 3ZMVB 4AISA 3B5MA 1SUMB 4K0UA 3RC8A 1BR0A 4V1Av 5LJMA 3OYZA 2DWKA 3EVYA 1WFDA 2WWVA 3ZMZB 2LKGA 4LF9T 4PK6A 2W62A 4HWHA 2D0TA 2BVMA 4JYAT 4HWCA 3KINB 3QB5A 2OLTA 1IJ5A 3L39A 5AFUL 2PJQA 2BBJA 1T7SA 2IMLA 4HFDA 2VKDA 3MACA 3FXEB 4PNIA 4ZEYA 4U33A 5FY7A 2UXDT 2NW8A 3EHZA 3T8OA 4IDPA 4EB6E 2BS3A 4GK0E 3QC9A 2A9UA 2CLYB 2LRKA 1MMAA 2NR4A 2BDEA 3AE9A 5KMGP 5L47A 2H88A 4JEUB 4IDOA 2ODVA 4ZHQE 2FJBA 5CGMA 3HA4A 4LF8T 3DTOA 4DR6T 4C90A 3A7MA 4X62T 4X64T 4EZ4A 2LHRA 2MOZA 2NP9A 3NRXA 3UU5A 4KHZF 2UUBT 3MXZA 2X67A 1D0ZA 2VWAA 4TV9E 5AQJB 4OYJA 2V6YB 4WW0A 4DV1T 3PE0A 3CQCB 2XASB 1M62A 2D2SA 1OWAA 1YD8G 2ACZA 3P4SA 5HXEA 4KX6A 2MYSA 4UXNB 5AQQB 1J1JA 3IA3A 4UF0B 3VRAA 3VU7H 3LJCA 2LKHA 4AQFC 4O4JE 3I9YA 4LMLA 4MLKA 2K9AA 4HFIA 1YKEB 4OK0A 3PURA 5J2TE 4JV5T 4U7YA 4A56A 4F8HA 5LHIB 3ZYKA 3RQWA 4ADZA 2CXFA 2CXLA 5F5WA 3AE4A 4HFBA 4WYVA 5L4EA 4UVBB 3PDYA 4EXTA 2XAGB 2V6YA 1AJ3A 4CXWA 1U4QA 4IHJE 1UK5A 2Y48B 3C50A 2Q9QB 5ABEA 3CQXC 4DR3T 4UF0A 5LBMA 2JQ9A 2P9BA 2WP9A 5CA1E 4I4TE 5HEHA 3ZCJA 4ISSA 2H7OA 3FZHB 1KNZA 2F4VT 1WCRA 4H9RC 4X1IE 3AA7B 5LMUT 3AECA 2YEVC 1UUSA 2HPLA 3QNUA 3OVUA 1W09A 4YY3T 3E22E 1NEKA 4QXHB 3AE1A 4AQGA 3P4QA 5GONE 3L3PA 5CJ5A 2WQYA 5LG3A 3IF8B 3PUGA 2Q9QA 4X20E 2PFVA 3LG7A 1D0XA 5F8PA 1BR1A 1IBLT 4BAYB 2H7VC 2H3RA 4B3TT 4QX8B 4LFBT 2FBWA 2YDRA 1WRDA 5LG4A 4DV7T 4PJJA 2XY8B 1ZOYA 1D0YA 5J2UE 4LF6T 2X9HA 1MIWA 3MKDA 2KWHA 3P7IA 4UR9A 5JRCB 3GMIA 2HN1A 2XQAA 2NTXA 2M6BA 4GKKT 2WMNA 3ZEFB 2CWYA 5ADXL 3ZKRA 3HKDE 4DV0T 3Q2MA 5FY0A 2LE8A 3OBVE 5JDLA 4ERRA 3ZJ2A 4AIUA 5HWXA 2ZM0A 4TNVA 1QUUA 2JIWA 5JQGE 1UCUA 5M4YA 3N5LA 1MMDA 3V5UA 3H37A 1GQEA 2YU2A 2ZM6T 4UVAB 2KLQA 3LDQB 3ETVA 5FXZA 1E7PA 1T8BA 5JRCA 3FHNA 4EIWA 4PFPA 4B3MT 3RYHE 4IE0A 5AQFB 4A5XA 3ZLIA 1HF8A 2YOEA 1EZ3A 2KZ7B 1N36T 5HXSA 3C98B 4JI8T 3MZKB 4GYSA 3AEGA 3I0QA 3K3NA 1X9BA 4AQFA 2L8KA 1LKXA 2XQ9A 2XQ6A 2E2AA 2CHNA 5HEOA 4XAXB 4EEDA 4TN7B 1L0VA 3C4ZA 5KXJA 3J7Yq 3PUSA 2QVAA 3IHRA 1Y64B 4HTEA 5FXWA 4PFOA 2IAKA 2WBLA 1JNZA 1BR4A 1D1CA 5HWYA 4YFSA 4CXYA 2FJDA 4U31A 5CB4E 1XDOA 4KMCA 4QXCB 2J4GA 2WMOA 3HI2A 1ZEEA 4ZI3C 3CX7B 5LHGB 4H9NC 4DV3T 2LSKA 4WBOA 3BQKA 4YJ3E 2V8SV 4DVDA 2XTLA 5AQMB 4YT0A 3KFWX 3AA1B 5FMNA 2JMHA 4M1PA 2CMRA 2XQ7A 4L9IA 3ZN1B 1QLBA 5FL1A 2M6IA 3UULA 3P50A 1WR6A 2H89A 4GYRA 1YW0A 4A98A 2XUEA 2J1DG 3O9XA 4CZZB 2RA1A 1J5ET 5HCMA 2JPFA 1HCIA 5EK3A 1KK7A 3O4XE 1N32T 4L0RA 1XNQT 4IIJE 4YTPA 1OXZA 5F3JA 3PUXF 3NBXX 2LRLA 2X0HA 3ZT7A 2CRBA 5EK2A 2IHR1 1MNEA 3RQUA 3KVAA 4DR7T 3AA0B 2LOPA 2BG9B 2CBJA 3Q5XA 4ILAA 2JJ9A 2N1GA 1OEDE 4KUMB 1O3XA 3PU8A 4TUYE 5L4HA 2NWBA 3FZMB 2IDOB 1Y01A 2FJEA 2I0MA 3T1YT 2WY2A 3B57A 2KWIB 3ANWB 2CCQA 2KINB 2XAJB 5JREA 1VRBA 1XMOT 4HE8A 2WU2A 4L5GA 4Q25A 2W2UA 2KXPB 3ESLA 2D0UA 5FVLA 2LOSA 1WLXA 2X0LB 2WCAA 5BMVE 3WAJA 1HG2A 3NKZA 4JI6T 5HEJA 2BG9A 1G8XA 2V7JA 2C0SA 4PAGA 4ZS2A 4EGWA 5FL0A 2BVLA 4ISTA 2QA7A 1ZP0A 1U5PA 3ANWA 4I50E 2LSGA 4CI3B 3UUXB 5LB7B 3BQLA 5L3CB 2XAQB 3K1SA 2XQYA 2DWGA 1R8IA 4PK4A 4AKIA 3RGLA 4KHPT 2X9WA 4N78D 2SPCA 1NAFA 4NPPA 4JLEA 1XDPA 2VQET 3JC6D 2B76A 1YQ4A 4FJOA 3EUHA 5EK4A 4AI6A 5JTGA 4OX9T 3V5SA 4I43B 4B6XA 5C2TA 5JDFA 5ABFB 3GN5B 2N9DA 2LSYA 3ZYLA 4LF5T 5LNKA 5JR9C 4HFVA 2EHOD 1E2AA 3TLTA 5LGUB 5LJNA 2IIUA 1Z8UA 3AVSA 3K3OA 4AKHA 4O4HE 4IGUA 4X65T 1HR0T 3ZYMA 3UUBA 5L3FB 4OFZA 5ABFA 4LMJA 2YINA 2AXDS 3GN5A 4DR1T 4GK5E 4H9QC 3N2GE 3R84B 5IHYA 2UXBT 3N2OA 3RI5A 3LK42 2UUCT
chains in the Genus database with same CATH topology
2ES0A 2NTXA 2WWUA 5CA0E 4QHOA 2VL8A 3RRWA 3MJXA 2K24A 2Y8DA 2WMNA 2HH7A 2X9XA 4P09A 1SHZC 5LBQB 5HXRA 1HG5A 5LA6E 3ZEFB 2CWYA 3RH3A 1D1BA 2ZMAA 4HEAA 5ADXL 3N9OA 5ETWA 3HKDE 4E7SA 3Q2MA 5FY0A 4F6RC 2V1DB 2UXNB 2LE8A 2ZM8A 3NZPA 2Q9QD 2A2FX 2C5KT 2E9XB 4UV9B 5J1GA 2ODUA 3OBVE 5JDLA 2JQQA 2Q9QC 4BA9A 4ERRA 2C5JA 3ZJ2A 2KNDA 2LJLA 5HWXA 3RRCA 2ZM0A 3UFEA 4UEMA 4KBMB 1QUUA 2I59A 4X1YE 1S94A 2LEHA 5JQGE 1UCUA 2OA5A 2XAHB 5M4YA 3N5LA 4J2CA 1Z0PA 1MMDA 2BZBA 3CMLA 3GWHA 3ZPOA 5LOVE 3V5UA 4H63H 3H37A 4PJNA 3BK9A 3ZJ1A 2YU2A 2VK9A 4QKNA 5FXVA 4UVAB 2KLQA 3C51A 1CUNA 2L9QA 3RYCE 2B1EA 3ETVA 3JC6C 5FXZA 3UUNA 4EOZB 4QX7B 5JDHA 3PU3A 4ASKA 5JRCA 3CVRA 1D1AA 3FHNA 3Q5WA 3ZMUB 2VKJA 2X9YA 3O1IA 2XAFB 4EIWA 4PFPA 1HTJF 2VB6A 3RYHE 3O1HA 4IE0A 4ZI7E 4UELA 3AB3B 2M67A 2CE7A 5DQWA 5HAXA 5JDGA 1G73A 3ZLIA 1HF8A 1EZ3A 2KZ7B 1B7TA 5HXSA 3C98B 4GOUA 5KDMC 2V7LA 5LP6E 3MZKB 4GYSA 2W61A 3F2EA 4O2BE 3FXDB 3I9WA 2DHRA 3HKCE 2E9XA 2KT9A 3I0QA 3IEEA 3K3NA 4AQFA 2L8KA 2CEAA 1LKXA 2RP4A 3NRYA 2X51A 1FEWA 5JH7E 2LM9A 5DJQC 2YK0A 3P8CD 2D5UA 4IE6A 2CXDA 4NUUA 3CQGB 3BQIA 2EHOC 4DMVA 4XAXB 3WI3A 3KDSE 2X68A 2GK9A 5LGTB 3N9NA 2W00A 4TN7B 4E7ZA 4PW8A 3C4ZA 3AVRA 4MFRA 1IAPA 1X79A 4O2AE 3J9X1 3J7Yq 2DNXA 3N9QA 3VKGA 4OYKA 4DNDA 3PUSA 1ZHCA 2LHNA 4DO0A 3IHRA 1Y64B 4HTEA 4IE5A 4O8SA 4YHJA 4UV8B 2JMKA 3HKEE 5E0OA 3FB2A 5FXWA 1H7CA 4PFOA 3SS1A 2IAKA 3NZQA 4AXPA 4P0AA 2WBLA 1BR4A 1SA0E 2C5IT 3A5XA 3VKHA 3CKDA 2CWOA 3ONXA 1D1CA 5HWYA 3I1AA 3SRZA 3VHLA 4YFSA 3EDVA 4CXYA 4PJMA 2WSSV 2HPJA 3ZMTB 2A72A 4AKGA 4IDZA 5CB4E 4KMCA 3B13A 4QXCB 2NTYA 2LSIA 3SWHA 3HI2A 2WMOA 1ZEEA 1WYCA 3KV4A 4ZI3C 2UXXB 3CX7B 5LHGB 3LFMA 4H9NC 2V7MA 2JRKA 2VKOA 2E9XD 3RYFE 4QWNB 2LSKA 4TZ4C 3Q9DA 4PK5A 4CXXA 3ZMVB 4K0UA 2WM9A 3BQKA 4WBOA 1BR2A 2A3DA 3F57A 3RC8A 5LCYA 4YJ3E 3ZCIA 1BR0A 5HYAA 1HS7A 1T98A 4DVDA 2G0UA 2XTLA 4V1Av 3KFWX 3AA1B 5LJMA 3OYZA 4ZOLE 5FMNA 2JMHA 3MK7C 5FXXA 2DWKA 4M1PA 2CMRA 3EVYA 4BJNA 3UUMA 4H9SE 4DMWA 3KV9A 4L9IA 3LK3B 3ZN1B 3UT5E 3ZMZB 4XZCA 2IC9A 3HR0A 2LT3A 3CX6B 4PK6A 5C8YE 2W62A 4ZI2D 3UULA 4QXBB 2D0TA 2BVMA 4ZI2C 2CM0A 1LVFA 1WR6A 4G63A 4GYRA 1YW0A 1IJ6A 3OYXA 3OJAA 4XBFB 3KINB 2XUEA 2J1DG 1IJ5A 3O9XA 4X1KE 1ZV4X 3KV6A 3DP7A 4YLHA 2RA1A 3SOLA 4CZZB 2JPFA 5AFUL 2Z6EA 2PJQA 1NWMX 1HCIA 2VKDA 3MACA 5EK3A 3MA9A 3FXEB 4PNIA 3N9PA 1KK7A 3RC3A 3O4XE 5FY7A 4L0RA 2VKHA 2NW8A 4IIJE 3EDUA 3T8OA 2DLRA 3C4WA 4EB6E 5LYJE 4BJMA 1OXZA 5F3JA 4NUVA 3NBXX 3ZMSB 4GK0E 2KMFA 3QC9A 3C64A 2CLYB 5EK2A 1MMAA 4H63V 1E1HB 3RX6A 2BDEA 1MNEA 3RYIE 5KMGP 4JEUB 2ODVA 2V7KA 4ZHQE 3KVAA 3O1JA 4EZHA 3L09A 4ILUA 4UIGA 4AKRB 5HXCA 2NW7A 2CA5A 3HA4A 4CQIA 3AA0B 2LOPA 1HX8A 3F31A 5HXHA 2N2NA 3Q5XA 5DABA 3DTOA 1MMGA 2JJ9A 3LBXB 3QUJA 2N1GA 5IYZE 2L3LA 4C90A 2WAUA 4KUMB 3N2KE 1O3XA 3PU8A 5FY1A 1LRZA 4TUYE 2LHRA 4EZ4A 2IC6A 3HL6A 2NWBA 2VASA 3PUAA 4TX5A 2MOZA 4MBQA 4JEHB 2NP9A 3NRXA 3B57A 5JR9B 2KWIB 4MALA 4CI1B 1UX5A 4HN9A 3ANWB 2CCQA 2KINB 2XAJB 5JREA 2K5BB 1VRBA 4HE8A 3MXZA 2X67A 1D0ZA 2VWAA 4L5GA 4TV9E 5LGNB 5FNVE 2EHOB 3AAAB 3HKBE 4OYJA 2KXPB 4EYUA 4WNKA 5H6RB 3ZC0A 4IE7A 2PBIA 4WW0A 3ESLA 2D0UA 4O4LE 3AAIA 5FYMA 3PE0A 3CQCB 2XASB 2D2SA 3RPUA 5L3EB 1OWAA 1YD8G 5HXEA 2LOSA 2MYSA 4UXNB 3K8PC 1WLXA 2X0LB 4UF0B 5BMVE 3R6NA 3WAJA 5JVDE 3VU7H 2E9XC 1HG2A 3LJCA 4AQFC 4U72A 4O4JE 2PG8A 3I9YA 4EYYR 4OHFA 5L3BB 1LVKA 4C91A 5LXTE 5L2LA 1G8XA 4MLKA 3LBXA 4ANJA 2K9AA 1YKEB 4OK0A 3QK6A 2V7JA 2C0SA 4PAGA 3PURA 5J2TE 4ZS2A 4A56A 3W15B 4EAHA 2BVLA 4ISTA 5LHIB 2QA7A 1QSDA 3LK2B 3ZYKA 3KBTA 1U5PA 3UTKA 5JR9A 3CX8B 2NW9A 1FMVA 3TKLB 4ADZA 2CXFA 3OKQA 2Y6XA 3ANWA 4I50E 1V9DA 2ZLYA 2LSGA 2CXLA 4CI3B 1ZKEA 3UUXB 5L3GB 3BQLA 4P0BA 2MBGA 2EHOA 2XAQB 5L3CB 3I0OA 4UVBB 2V7IA 2XQYA 3CWZB 3PDYA 2DWGA 3E0ZA 5KX5E 4PK4A 4EXTA 2XAGB 5JDNA 4AKIA 1AJ3A 4GIWA 3ZN0B 1U4QA 4CXWA 4I55E 4IHJE 2X9WA 2Y48B 3DJBA 5TAOA 3C50A 2Q9QB 2NOXA 4N78D 3CQXC 2SPCA 2K48A 3H3AA 1NAFA 5JDQA 3N9LA 4UF0A 5LBMA 4JLEA 5A1LA 2P9BA 5CA1E 4H9OC 4I4TE 3ZCJA 2CLYC 4ISSA 3JC6D 4KP3C 1S35A 2H7OA 4JUYA 2V26A 4TV8E 1HFAA 2DI4A 2YU1A 4FJOA 1KNZA 3EUHA 5EK4A 3N9MA 2QGSA 3KV5A 3KBUA 4H9RC 4AI6A 4X1IE 1WYBA 1VOMA 3AA7B 4Z8XA 3S4UA 4ZS3A 2X66A 4CI2B 3V5SA 3K3QC 4I43B 1IZNB 1MNDA 1MMNA 4B6XA 5JDFA 3ZC1A 1YKHB 2YEVC 3GN5B 3PTRB 4DBRA 5LHHB 2DCFA 3GA8A 2N9DA 2HPLA 2LSYA 5EZYE 3AA6B 3ZYLA 3E22E 5JDMA 5LNKA 5JR9C 4QXHB 3PUQA 4MHCA 4AQGA 4AKLA 5GONE 2W0GA 4HFVA 2MTQA 3L3PA 2IW5B 2EHOD 5FP3A 3IF8B 3PUGA 5LGUB 2Q9QA 4X20E 2PFVA 3LG7A 1D0XA 1MIVA 5F8PA 3ETUA 4U74A 1BR1A 3M65A 1MIYA 3CPZA 5LJNA 4BAYB 5DQVA 2H7VC 2XHEB 2H3RA 3AAEB 3AVSA 3K3OA 4PJLA 4IE4A 2E8IA 4HGAA 4O4IE 4QX8B 4G2AA 2ZM2A 1WRDA 5LG4A 5L3DB 4AKHA 4O4HE 4IGUA 2W63A 4PJJA 3FBLA 4DBQA 3ZYMA 4HKAA 3KVBA 1D0YA 3C4XA 1US7B 5L3FB 3E08A 4OFZA 1FIOA 4UVCB 2YINA 3GN5A 5J2UE 3IBPA 2X9HA 4FI5A 3FBZA 5H6QB 3U3IA 4GK5E 4H9QC 3N2GE 2LSJA 4H9PC 5IHYA 1MIWA 3MKDA 3R84B 3WAKA 2KWHA 3P7IA 4WBNE 2ACXA 1FMWA 4ZI3D 4YJ2E 5JRCB 3RKOA 3GMIA 3N2OA 3D0TA 1UX4A 3U78A 3LK42
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI2 D;  4ZI3 C;  2K9A A;  4ZI3 D;  4ZI2 C; 
#chains in the Genus database with same CATH topology
 5CA0 E;  1I94 T;  5BR8 T;  4AQY T;  2K24 A;  2Y8D A;  2X9X A;  1SHZ C;  2WDV A;  2WB5 A;  1D1B A;  3N9O A;  4F6R C;  3PJA J;  1KEY A;  4LMK A;  2XQ8 A;  3AE6 A;  2C5J A;  3OPC A;  2KND A;  4DV2 T;  2LJL A;  3PUV F;  4ZZB A;  1SE7 A;  3H3M A;  4UEM A;  3RHW A;  2LEH A;  1UGO A;  4J2C A;  3GWH A;  5LOV E;  4PJN A;  5ABG A;  3ZJ1 A;  3C51 A;  2L9Q A;  5AQS B;  5JDH A;  1D1A A;  3Q5W A;  2V5D A;  3AB3 B;  5JDG A;  1B7T A;  4DV5 T;  5IWA T;  3I9W A;  2DHR A;  3VRB A;  5IUX A;  5AQR B;  2LM9 A;  5DJQ C;  2YK0 A;  2D5U A;  5AQU B;  4IE6 A;  2CXD A;  4DMV A;  3BQI A;  2GK9 A;  2W00 A;  4PW8 A;  2DNX A;  3VKG A;  4JI3 T;  3RLF F;  2BKN A;  3PUW F;  2LHN A;  4IE5 A;  2JMK A;  3HKE E;  2CBI A;  3A5X A;  2PTF A;  2XZE A;  3VHL A;  2YN6 A;  4PJM A;  2WSS V;  2HPJ A;  3LSV A;  4HWF A;  2A72 A;  3CIR A;  3RIU C;  4IDZ A;  4AKG A;  3FZK B;  1WYC A;  1VCT A;  2V7M A;  1IBK T;  2E9X D;  4QWN B;  1OED C;  4CXX A;  2XSB A;  2WM9 A;  1BR2 A;  2XSA A;  5LCY A;  1HS7 A;  4ZOL E;  3KV9 A;  3UT5 E;  2IC9 A;  4IL4 A;  2LT3 A;  3CX6 B;  3NWI A;  2JQH A;  4ZI2 D;  4JI5 T;  4ZI2 C;  3TLS A;  1HNW T;  1IJ6 A;  4XBF B;  3UU4 A;  1ZV4 X;  3KV6 A;  3ONL C;  2Z6E A;  3AE3 A;  2J47 A;  3N9P A;  2OV9 A;  3L8R A;  2VKH A;  3EDU A;  2YDQ A;  3C4W A;  4BJM A;  3Q5E A;  4NUV A;  2K3W A;  4DV4 T;  3TLU A;  4H63 V;  3TLW A;  3RYI E;  5J0Z A;  2WS3 A;  4JI2 T;  2V7K A;  5FVK A;  4HWI B;  4LF7 T;  5HXC A;  4TNW A;  4CQI A;  1CHU A;  4U3C A;  5HXH A;  3JAD A;  2IUB A;  4ILB A;  3QUJ A;  5HEG A;  5IYZ E;  4KI0 F;  1LRZ A;  2VAS A;  3PUA A;  4ZXL A;  4TX5 A;  2VL0 A;  4MBQ A;  4B3S T;  4JEH B;  3UQ7 A;  4CI1 B;  1HNZ T;  4HN9 A;  2K5B B;  3SFE A;  4WNK A;  5H6R B;  4IE7 A;  5FYM A;  3AAI A;  1JNR A;  2XQ4 A;  3RPU A;  1W0B A;  1IBM T;  4YSZ A;  3PUZ F;  3K8P C;  2J62 A;  1NEN A;  3R6N A;  3QB5 K;  5JVD E;  4IRE A;  4EYY R;  4OHF A;  1KNR A;  5L3B B;  3AE2 A;  4C91 A;  5L2L A;  3VR9 A;  3QK6 A;  2XM1 A;  2BKO A;  3LK2 B;  3KBT A;  3UTK A;  4NIQ A;  2NW9 A;  4YHH T;  3OKQ A;  2Y6X A;  1V9D A;  2ZLY A;  3CK6 A;  4HFH A;  4P0B A;  3AEE A;  2MBG A;  2XPK A;  5KX5 E;  2V7I A;  3E0Z A;  5JDN A;  2E5L T;  4I55 E;  2R6G F;  3AEB A;  3DJB A;  3T1H T;  2NOX A;  2K48 A;  5JDQ A;  2CLY C;  4U2Y A;  4TV8 E;  1HFA A;  2DI4 A;  4EV6 A;  2JQK A;  2QGS A;  3FZL B;  1WYB A;  2X66 A;  4CI2 B;  1MMN A;  3PTR B;  4DBR A;  5AQV B;  3AA6 B;  3JAF A;  3PUQ A;  4MHC A;  1M7K A;  2W0G A;  5HCJ A;  5FP3 A;  4NXM T;  3M65 A;  5DQV A;  2VQF T;  3M3Z B;  4PJL A;  2E8I A;  4JI1 T;  2ZM2 A;  2I6H A;  4YTN A;  3FBL A;  4DBQ A;  4HKA A;  3E08 A;  4UVC B;  3AE8 A;  2RPA A;  3IBP A;  5AQI B;  3FBZ A;  3U3I A;  2AE9 A;  2LSJ A;  4H9P C;  3PV0 F;  1FMW A;  3U78 A;  3D0T A;  3NZQ A;  2WWU A;  3X1D A;  3ABV A;  4QHO A;  3MJX A;  3PUY F;  4DID B;  2HH7 A;  1I6Z A;  5LBQ B;  5HXR A;  1HG5 A;  5ABH A;  5LA6 E;  5LMN T;  3RH3 A;  2HN2 A;  5ETW A;  4E7S A;  2ZM8 A;  3NZP A;  2Q9Q D;  3ZT6 A;  2BG9 E;  2C5K T;  5AQK B;  5J1G A;  2JQQ A;  2Q9Q C;  4KBM B;  2I59 A;  4X1Y E;  1S94 A;  2XAH B;  3CML A;  1FJG T;  4H63 H;  3UU3 A;  3BK9 A;  3P4P A;  2VK9 A;  4QKN A;  4U2Z A;  1CUN A;  4TWD A;  4WZX A;  3RYC E;  3JC6 C;  3UUN A;  3EAM A;  4EOZ B;  4QX7 B;  5AQL B;  3JCF A;  2BBH A;  3AE5 A;  4X66 T;  2X9Y A;  3O1I A;  2VB6 A;  3Q5D A;  2WU5 A;  3O1H A;  4UEL A;  5DQW A;  1G73 A;  4GOU A;  3F2E A;  4O2B E;  3HKC E;  2KT9 A;  2CEA A;  2RP4 A;  3NRY A;  3EI0 A;  5JH7 E;  3P8C D;  4QH4 A;  4DR5 T;  3CQG B;  2EHO C;  3WI3 A;  2X68 A;  5AQN B;  3N9N A;  2WDR A;  3AEF A;  4E7Z A;  3AVR A;  5AQT B;  1IAP A;  4O2A E;  2FJA A;  2XJ7 A;  3N9Q A;  4OYK A;  4DND A;  3VR8 A;  1ZHC A;  2FUP A;  4LFC T;  4O8S A;  3FB2 A;  3SS1 A;  4P0A A;  4AXP A;  1XNR T;  2C5I T;  1T72 A;  3VKH A;  4IT4 A;  2CWO A;  3ONX A;  5C3J A;  3I1A A;  3SRZ A;  1N33 T;  3EDV A;  4IDN A;  2LM2 A;  3B13 A;  2NTY A;  2LSI A;  2UXX B;  2JRK A;  2VKO A;  3RYF E;  4TZ4 C;  4PK5 A;  2VUR A;  3FZF B;  2A3D A;  3F57 A;  3ZCI A;  5HYA A;  1T98 A;  2G0U A;  4CN4 A;  2XQ5 A;  3MK7 C;  5FXX A;  3PJA A;  4BJN A;  3UUM A;  4H9S E;  4B3R T;  4DMW A;  3LK3 B;  4XZC A;  3HR0 A;  5C8Y E;  4QXB B;  2CM0 A;  1LVF A;  2D9D A;  2HHH T;  1XWM A;  4G63 A;  3OYX A;  3OJA A;  4X1K E;  4YLH A;  3DP7 A;  3SOL A;  4CN6 A;  1KF6 A;  2W4X A;  1NWM X;  1KFY A;  3MA9 A;  3RKG A;  3RC3 A;  2DLR A;  5LYJ E;  1KNP A;  3ZMS B;  3AE7 A;  2KMF A;  3C64 A;  1E1H B;  3SFD A;  3RX6 A;  4HFE A;  3G06 A;  2XM2 A;  3O1J A;  4EZH A;  3L09 A;  4ILU A;  4UIG A;  5AQP B;  4AKR B;  2NW7 A;  2CA5 A;  1HX8 A;  3F31 A;  3P4R A;  2N2N A;  5DAB A;  1HX1 B;  1VCS A;  1MMG A;  3LBX B;  4IDQ A;  2L3L A;  2WAU A;  3N2K E;  5FY1 A;  2YKS A;  2IC6 A;  3HL6 A;  2MAW A;  4HWD A;  5JR9 B;  2CPT A;  1N34 T;  3RIA A;  4MAL A;  3AEA A;  1UX5 A;  5FKY A;  4HFC A;  5LGN B;  5FNV E;  2EHO B;  2CHO A;  2V5C A;  3AAA B;  3HKB E;  4EYU A;  3ZC0 A;  4IL9 A;  2PBI A;  2UUA T;  4O4L E;  4JI0 T;  4QH5 A;  5L3E B;  2BS4 A;  3JAE A;  2E9X C;  5AQH B;  4U72 A;  2PG8 A;  2KSR A;  1LVK A;  5LXT E;  3LBX A;  4ANJ A;  2UXC T;  3W15 B;  4EAH A;  4I0U A;  2QYW A;  1QSD A;  4JI7 T;  5JR9 A;  3CX8 B;  1FMV A;  3TKL B;  2UU9 T;  1DU2 A;  3RF1 A;  3UU6 A;  1ZKE A;  5L3G B;  3RIF A;  2EHO A;  3I0O A;  3CWZ B;  2WZH A;  4GIW A;  3ZN0 B;  5TAO A;  2W67 A;  4Z91 A;  3H3A A;  3UFG A;  3N9L A;  4LF4 T;  4Z90 A;  5A1L A;  1W0A A;  4H9O C;  4KP3 C;  1S35 A;  1HNX T;  4JUY A;  5HEU A;  4DUZ T;  2V26 A;  4CN1 A;  2YU1 A;  4NXN T;  3ZST A;  3N9M A;  3KV5 A;  3KBU A;  1VOM A;  4Z8X A;  3S4U A;  4ZS3 A;  2BG9 C;  3K3Q C;  1IZN B;  1MND A;  3ZC1 A;  4EEB A;  4A97 A;  1YKH B;  5AQG B;  2DCF A;  3AED A;  3GA8 A;  5LHH B;  4YTM A;  5EZY E;  3QOF A;  5JDM A;  4K0K T;  1YXR A;  3A8Y C;  4AKL A;  2MTQ A;  4LFA T;  1YQ3 A;  4YSY A;  2IW5 B;  2QRX A;  1UUR A;  1MIV A;  3ETU A;  4U74 A;  1MIY A;  3CPZ A;  2XHE B;  3AAE B;  4GKJ T;  4IE4 A;  4HGA A;  4O4I E;  4G2A A;  3NVO A;  5L3D B;  2W63 A;  4X5T A;  3TLV A;  3KVB A;  3C4X A;  1US7 B;  1FIO A;  4FI5 A;  5H6Q B;  3WAK A;  4WBN E;  2ACX A;  2WZI A;  4YJ2 E;  4ZI3 D;  2YDS A;  3RKO A;  1UX4 A;  3AXJ B;  2ES0 A;  4TWH A;  2VL8 A;  3RRW A;  4P09 A;  5CFB A;  4COF A;  2ZMA A;  4HEA A;  2V1D B;  2UXN B;  1OED B;  2A2F X;  1J5W A;  2E9X B;  4UV9 B;  2ODU A;  4BA9 A;  2E5V A;  3RRC A;  3UFE A;  4ZZC A;  2V6X A;  2OA5 A;  2W66 A;  1Z0P A;  2BZB A;  3ZPO A;  5AQO B;  4DV6 T;  3ZSS A;  5FXV A;  2B1E A;  4TWF A;  3PU3 A;  4ASK A;  4DR4 T;  3CVR A;  3ONJ A;  3ZMU B;  2VKJ A;  3AXJ A;  2XAF B;  4DUY T;  1HTJ F;  4ILC A;  4ZI7 E;  3UU8 A;  2M67 A;  2CE7 A;  3RIU A;  5HAX A;  3ZT5 A;  5KDM C;  2VVN A;  5LP6 E;  2V7L A;  2W61 A;  3FXD B;  1OED A;  2E9X A;  3IEE A;  2LLY A;  4YSX A;  4DR2 T;  2X51 A;  1FEW A;  2X0Y A;  1W9R A;  4P1N A;  4NUU A;  4JI4 T;  3KDS E;  4QH1 A;  5LGT B;  2DL1 A;  4MFR A;  1X79 A;  4JBW F;  3J9X 1;  2BS2 A;  3UQ4 A;  4U7I A;  3OTO T;  4DO0 A;  4YHJ A;  4UV8 B;  5E0O A;  1H7C A;  3P4W A;  1WR0 A;  2MPK A;  1SA0 E;  2VVS A;  3CKD A;  1XMQ T;  3ZMT B;  2XQ3 A;  4YXD A;  3SWH A;  3KV4 A;  1XZY A;  3EAB A;  3LFM A;  2BKP A;  3Q9D A;  2WDQ A;  3ZMV B;  4AIS A;  3B5M A;  1SUM B;  4K0U A;  3RC8 A;  1BR0 A;  4V1A v;  5LJM A;  3OYZ A;  2DWK A;  3EVY A;  1WFD A;  2WWV A;  3ZMZ B;  2LKG A;  4LF9 T;  4PK6 A;  2W62 A;  4HWH A;  2D0T A;  2BVM A;  4JYA T;  4HWC A;  3KIN B;  3QB5 A;  2OLT A;  1IJ5 A;  3L39 A;  5AFU L;  2PJQ A;  2BBJ A;  1T7S A;  2IML A;  4HFD A;  2VKD A;  3MAC A;  3FXE B;  4PNI A;  4ZEY A;  4U33 A;  5FY7 A;  2UXD T;  2NW8 A;  3EHZ A;  3T8O A;  4IDP A;  4EB6 E;  2BS3 A;  4GK0 E;  3QC9 A;  2A9U A;  2CLY B;  2LRK A;  1MMA A;  2NR4 A;  2BDE A;  3AE9 A;  5KMG P;  5L47 A;  2H88 A;  4JEU B;  4IDO A;  2ODV A;  4ZHQ E;  2FJB A;  5CGM A;  3HA4 A;  4LF8 T;  3DTO A;  4DR6 T;  4C90 A;  3A7M A;  4X62 T;  4X64 T;  4EZ4 A;  2LHR A;  2MOZ A;  2NP9 A;  3NRX A;  3UU5 A;  4KHZ F;  2UUB T;  3MXZ A;  2X67 A;  1D0Z A;  2VWA A;  4TV9 E;  5AQJ B;  4OYJ A;  2V6Y B;  4WW0 A;  4DV1 T;  3PE0 A;  3CQC B;  2XAS B;  1M62 A;  2D2S A;  1OWA A;  1YD8 G;  2ACZ A;  3P4S A;  5HXE A;  4KX6 A;  2MYS A;  4UXN B;  5AQQ B;  1J1J A;  3IA3 A;  4UF0 B;  3VRA A;  3VU7 H;  3LJC A;  2LKH A;  4AQF C;  4O4J E;  3I9Y A;  4LML A;  4MLK A;  2K9A A;  4HFI A;  1YKE B;  4OK0 A;  3PUR A;  5J2T E;  4JV5 T;  4U7Y A;  4A56 A;  4F8H A;  5LHI B;  3ZYK A;  3RQW A;  4ADZ A;  2CXF A;  2CXL A;  5F5W A;  3AE4 A;  4HFB A;  4WYV A;  5L4E A;  4UVB B;  3PDY A;  4EXT A;  2XAG B;  2V6Y A;  1AJ3 A;  4CXW A;  1U4Q A;  4IHJ E;  1UK5 A;  2Y48 B;  3C50 A;  2Q9Q B;  5ABE A;  3CQX C;  4DR3 T;  4UF0 A;  5LBM A;  2JQ9 A;  2P9B A;  2WP9 A;  5CA1 E;  4I4T E;  5HEH A;  3ZCJ A;  4ISS A;  2H7O A;  3FZH B;  1KNZ A;  2F4V T;  1WCR A;  4H9R C;  4X1I E;  3AA7 B;  5LMU T;  3AEC A;  2YEV C;  1UUS A;  2HPL A;  3QNU A;  3OVU A;  1W09 A;  4YY3 T;  3E22 E;  1NEK A;  4QXH B;  3AE1 A;  4AQG A;  3P4Q A;  5GON E;  3L3P A;  5CJ5 A;  2WQY A;  5LG3 A;  3IF8 B;  3PUG A;  2Q9Q A;  4X20 E;  2PFV A;  3LG7 A;  1D0X A;  5F8P A;  1BR1 A;  1IBL T;  4BAY B;  2H7V C;  2H3R A;  4B3T T;  4QX8 B;  4LFB T;  2FBW A;  2YDR A;  1WRD A;  5LG4 A;  4DV7 T;  4PJJ A;  2XY8 B;  1ZOY A;  1D0Y A;  5J2U E;  4LF6 T;  2X9H A;  1MIW A;  3MKD A;  2KWH A;  3P7I A;  4UR9 A;  5JRC B;  3GMI A;  2HN1 A;  2XQA A;  2NTX A;  2M6B A;  4GKK T;  2WMN A;  3ZEF B;  2CWY A;  5ADX L;  3ZKR A;  3HKD E;  4DV0 T;  3Q2M A;  5FY0 A;  2LE8 A;  3OBV E;  5JDL A;  4ERR A;  3ZJ2 A;  4AIU A;  5HWX A;  2ZM0 A;  4TNV A;  1QUU A;  2JIW A;  5JQG E;  1UCU A;  5M4Y A;  3N5L A;  1MMD A;  3V5U A;  3H37 A;  1GQE A;  2YU2 A;  2ZM6 T;  4UVA B;  2KLQ A;  3LDQ B;  3ETV A;  5FXZ A;  1E7P A;  1T8B A;  5JRC A;  3FHN A;  4EIW A;  4PFP A;  4B3M T;  3RYH E;  4IE0 A;  5AQF B;  4A5X A;  3ZLI A;  1HF8 A;  2YOE A;  1EZ3 A;  2KZ7 B;  1N36 T;  5HXS A;  3C98 B;  4JI8 T;  3MZK B;  4GYS A;  3AEG A;  3I0Q A;  3K3N A;  1X9B A;  4AQF A;  2L8K A;  1LKX A;  2XQ9 A;  2XQ6 A;  2E2A A;  2CHN A;  5HEO A;  4XAX B;  4EED A;  4TN7 B;  1L0V A;  3C4Z A;  5KXJ A;  3J7Y q;  3PUS A;  2QVA A;  3IHR A;  1Y64 B;  4HTE A;  5FXW A;  4PFO A;  2IAK A;  2WBL A;  1JNZ A;  1BR4 A;  1D1C A;  5HWY A;  4YFS A;  4CXY A;  2FJD A;  4U31 A;  5CB4 E;  1XDO A;  4KMC A;  4QXC B;  2J4G A;  2WMO A;  3HI2 A;  1ZEE A;  4ZI3 C;  3CX7 B;  5LHG B;  4H9N C;  4DV3 T;  2LSK A;  4WBO A;  3BQK A;  4YJ3 E;  2V8S V;  4DVD A;  2XTL A;  5AQM B;  4YT0 A;  3KFW X;  3AA1 B;  5FMN A;  2JMH A;  4M1P A;  2CMR A;  2XQ7 A;  4L9I A;  3ZN1 B;  1QLB A;  5FL1 A;  2M6I A;  3UUL A;  3P50 A;  1WR6 A;  2H89 A;  4GYR A;  1YW0 A;  4A98 A;  2XUE A;  2J1D G;  3O9X A;  4CZZ B;  2RA1 A;  1J5E T;  5HCM A;  2JPF A;  1HCI A;  5EK3 A;  1KK7 A;  3O4X E;  1N32 T;  4L0R A;  1XNQ T;  4IIJ E;  4YTP A;  1OXZ A;  5F3J A;  3PUX F;  3NBX X;  2LRL A;  2X0H A;  3ZT7 A;  2CRB A;  5EK2 A;  2IHR 1;  1MNE A;  3RQU A;  3KVA A;  4DR7 T;  3AA0 B;  2LOP A;  2BG9 B;  2CBJ A;  3Q5X A;  4ILA A;  2JJ9 A;  2N1G A;  1OED E;  4KUM B;  1O3X A;  3PU8 A;  4TUY E;  5L4H A;  2NWB A;  3FZM B;  2IDO B;  1Y01 A;  2FJE A;  2I0M A;  3T1Y T;  2WY2 A;  3B57 A;  2KWI B;  3ANW B;  2CCQ A;  2KIN B;  2XAJ B;  5JRE A;  1VRB A;  1XMO T;  4HE8 A;  2WU2 A;  4L5G A;  4Q25 A;  2W2U A;  2KXP B;  3ESL A;  2D0U A;  5FVL A;  2LOS A;  1WLX A;  2X0L B;  2WCA A;  5BMV E;  3WAJ A;  1HG2 A;  3NKZ A;  4JI6 T;  5HEJ A;  2BG9 A;  1G8X A;  2V7J A;  2C0S A;  4PAG A;  4ZS2 A;  4EGW A;  5FL0 A;  2BVL A;  4IST A;  2QA7 A;  1ZP0 A;  1U5P A;  3ANW A;  4I50 E;  2LSG A;  4CI3 B;  3UUX B;  5LB7 B;  3BQL A;  5L3C B;  2XAQ B;  3K1S A;  2XQY A;  2DWG A;  1R8I A;  4PK4 A;  4AKI A;  3RGL A;  4KHP T;  2X9W A;  4N78 D;  2SPC A;  1NAF A;  4NPP A;  4JLE A;  1XDP A;  2VQE T;  3JC6 D;  2B76 A;  1YQ4 A;  4FJO A;  3EUH A;  5EK4 A;  4AI6 A;  5JTG A;  4OX9 T;  3V5S A;  4I43 B;  4B6X A;  5C2T A;  5JDF A;  5ABF B;  3GN5 B;  2N9D A;  2LSY A;  3ZYL A;  4LF5 T;  5LNK A;  5JR9 C;  4HFV A;  2EHO D;  1E2A A;  3TLT A;  5LGU B;  5LJN A;  2IIU A;  1Z8U A;  3AVS A;  3K3O A;  4AKH A;  4O4H E;  4IGU A;  4X65 T;  1HR0 T;  3ZYM A;  3UUB A;  5L3F B;  4OFZ A;  5ABF A;  4LMJ A;  2YIN A;  2AXD S;  3GN5 A;  4DR1 T;  4GK5 E;  4H9Q C;  3N2G E;  3R84 B;  5IHY A;  2UXB T;  3N2O A;  3RI5 A;  3LK4 2;  2UUC T; 
#chains in the Genus database with same CATH homology
 2ES0 A;  2NTX A;  2WWU A;  5CA0 E;  4QHO A;  2VL8 A;  3RRW A;  3MJX A;  2K24 A;  2Y8D A;  2WMN A;  2HH7 A;  2X9X A;  4P09 A;  1SHZ C;  5LBQ B;  5HXR A;  1HG5 A;  5LA6 E;  3ZEF B;  2CWY A;  3RH3 A;  1D1B A;  2ZMA A;  4HEA A;  5ADX L;  3N9O A;  5ETW A;  3HKD E;  4E7S A;  3Q2M A;  5FY0 A;  4F6R C;  2V1D B;  2UXN B;  2LE8 A;  2ZM8 A;  3NZP A;  2Q9Q D;  2A2F X;  2C5K T;  2E9X B;  4UV9 B;  5J1G A;  2ODU A;  3OBV E;  5JDL A;  2JQQ A;  2Q9Q C;  4BA9 A;  4ERR A;  2C5J A;  3ZJ2 A;  2KND A;  2LJL A;  5HWX A;  3RRC A;  2ZM0 A;  3UFE A;  4UEM A;  4KBM B;  1QUU A;  2I59 A;  4X1Y E;  1S94 A;  2LEH A;  5JQG E;  1UCU A;  2OA5 A;  2XAH B;  5M4Y A;  3N5L A;  4J2C A;  1Z0P A;  1MMD A;  2BZB A;  3CML A;  3GWH A;  3ZPO A;  5LOV E;  3V5U A;  4H63 H;  3H37 A;  4PJN A;  3BK9 A;  3ZJ1 A;  2YU2 A;  2VK9 A;  4QKN A;  5FXV A;  4UVA B;  2KLQ A;  3C51 A;  1CUN A;  2L9Q A;  3RYC E;  2B1E A;  3ETV A;  3JC6 C;  5FXZ A;  3UUN A;  4EOZ B;  4QX7 B;  5JDH A;  3PU3 A;  4ASK A;  5JRC A;  3CVR A;  1D1A A;  3FHN A;  3Q5W A;  3ZMU B;  2VKJ A;  2X9Y A;  3O1I A;  2XAF B;  4EIW A;  4PFP A;  1HTJ F;  2VB6 A;  3RYH E;  3O1H A;  4IE0 A;  4ZI7 E;  4UEL A;  3AB3 B;  2M67 A;  2CE7 A;  5DQW A;  5HAX A;  5JDG A;  1G73 A;  3ZLI A;  1HF8 A;  1EZ3 A;  2KZ7 B;  1B7T A;  5HXS A;  3C98 B;  4GOU A;  5KDM C;  2V7L A;  5LP6 E;  3MZK B;  4GYS A;  2W61 A;  3F2E A;  4O2B E;  3FXD B;  3I9W A;  2DHR A;  3HKC E;  2E9X A;  2KT9 A;  3I0Q A;  3IEE A;  3K3N A;  4AQF A;  2L8K A;  2CEA A;  1LKX A;  2RP4 A;  3NRY A;  2X51 A;  1FEW A;  5JH7 E;  2LM9 A;  5DJQ C;  2YK0 A;  3P8C D;  2D5U A;  4IE6 A;  2CXD A;  4NUU A;  3CQG B;  3BQI A;  2EHO C;  4DMV A;  4XAX B;  3WI3 A;  3KDS E;  2X68 A;  2GK9 A;  5LGT B;  3N9N A;  2W00 A;  4TN7 B;  4E7Z A;  4PW8 A;  3C4Z A;  3AVR A;  4MFR A;  1IAP A;  1X79 A;  4O2A E;  3J9X 1;  3J7Y q;  2DNX A;  3N9Q A;  3VKG A;  4OYK A;  4DND A;  3PUS A;  1ZHC A;  2LHN A;  4DO0 A;  3IHR A;  1Y64 B;  4HTE A;  4IE5 A;  4O8S A;  4YHJ A;  4UV8 B;  2JMK A;  3HKE E;  5E0O A;  3FB2 A;  5FXW A;  1H7C A;  4PFO A;  3SS1 A;  2IAK A;  3NZQ A;  4AXP A;  4P0A A;  2WBL A;  1BR4 A;  1SA0 E;  2C5I T;  3A5X A;  3VKH A;  3CKD A;  2CWO A;  3ONX A;  1D1C A;  5HWY A;  3I1A A;  3SRZ A;  3VHL A;  4YFS A;  3EDV A;  4CXY A;  4PJM A;  2WSS V;  2HPJ A;  3ZMT B;  2A72 A;  4AKG A;  4IDZ A;  5CB4 E;  4KMC A;  3B13 A;  4QXC B;  2NTY A;  2LSI A;  3SWH A;  3HI2 A;  2WMO A;  1ZEE A;  1WYC A;  3KV4 A;  4ZI3 C;  2UXX B;  3CX7 B;  5LHG B;  3LFM A;  4H9N C;  2V7M A;  2JRK A;  2VKO A;  2E9X D;  3RYF E;  4QWN B;  2LSK A;  4TZ4 C;  3Q9D A;  4PK5 A;  4CXX A;  3ZMV B;  4K0U A;  2WM9 A;  3BQK A;  4WBO A;  1BR2 A;  2A3D A;  3F57 A;  3RC8 A;  5LCY A;  4YJ3 E;  3ZCI A;  1BR0 A;  5HYA A;  1HS7 A;  1T98 A;  4DVD A;  2G0U A;  2XTL A;  4V1A v;  3KFW X;  3AA1 B;  5LJM A;  3OYZ A;  4ZOL E;  5FMN A;  2JMH A;  3MK7 C;  5FXX A;  2DWK A;  4M1P A;  2CMR A;  3EVY A;  4BJN A;  3UUM A;  4H9S E;  4DMW A;  3KV9 A;  4L9I A;  3LK3 B;  3ZN1 B;  3UT5 E;  3ZMZ B;  4XZC A;  2IC9 A;  3HR0 A;  2LT3 A;  3CX6 B;  4PK6 A;  5C8Y E;  2W62 A;  4ZI2 D;  3UUL A;  4QXB B;  2D0T A;  2BVM A;  4ZI2 C;  2CM0 A;  1LVF A;  1WR6 A;  4G63 A;  4GYR A;  1YW0 A;  1IJ6 A;  3OYX A;  3OJA A;  4XBF B;  3KIN B;  2XUE A;  2J1D G;  1IJ5 A;  3O9X A;  4X1K E;  1ZV4 X;  3KV6 A;  3DP7 A;  4YLH A;  2RA1 A;  3SOL A;  4CZZ B;  2JPF A;  5AFU L;  2Z6E A;  2PJQ A;  1NWM X;  1HCI A;  2VKD A;  3MAC A;  5EK3 A;  3MA9 A;  3FXE B;  4PNI A;  3N9P A;  1KK7 A;  3RC3 A;  3O4X E;  5FY7 A;  4L0R A;  2VKH A;  2NW8 A;  4IIJ E;  3EDU A;  3T8O A;  2DLR A;  3C4W A;  4EB6 E;  5LYJ E;  4BJM A;  1OXZ A;  5F3J A;  4NUV A;  3NBX X;  3ZMS B;  4GK0 E;  2KMF A;  3QC9 A;  3C64 A;  2CLY B;  5EK2 A;  1MMA A;  4H63 V;  1E1H B;  3RX6 A;  2BDE A;  1MNE A;  3RYI E;  5KMG P;  4JEU B;  2ODV A;  2V7K A;  4ZHQ E;  3KVA A;  3O1J A;  4EZH A;  3L09 A;  4ILU A;  4UIG A;  4AKR B;  5HXC A;  2NW7 A;  2CA5 A;  3HA4 A;  4CQI A;  3AA0 B;  2LOP A;  1HX8 A;  3F31 A;  5HXH A;  2N2N A;  3Q5X A;  5DAB A;  3DTO A;  1MMG A;  2JJ9 A;  3LBX B;  3QUJ A;  2N1G A;  5IYZ E;  2L3L A;  4C90 A;  2WAU A;  4KUM B;  3N2K E;  1O3X A;  3PU8 A;  5FY1 A;  1LRZ A;  4TUY E;  2LHR A;  4EZ4 A;  2IC6 A;  3HL6 A;  2NWB A;  2VAS A;  3PUA A;  4TX5 A;  2MOZ A;  4MBQ A;  4JEH B;  2NP9 A;  3NRX A;  3B57 A;  5JR9 B;  2KWI B;  4MAL A;  4CI1 B;  1UX5 A;  4HN9 A;  3ANW B;  2CCQ A;  2KIN B;  2XAJ B;  5JRE A;  2K5B B;  1VRB A;  4HE8 A;  3MXZ A;  2X67 A;  1D0Z A;  2VWA A;  4L5G A;  4TV9 E;  5LGN B;  5FNV E;  2EHO B;  3AAA B;  3HKB E;  4OYJ A;  2KXP B;  4EYU A;  4WNK A;  5H6R B;  3ZC0 A;  4IE7 A;  2PBI A;  4WW0 A;  3ESL A;  2D0U A;  4O4L E;  3AAI A;  5FYM A;  3PE0 A;  3CQC B;  2XAS B;  2D2S A;  3RPU A;  5L3E B;  1OWA A;  1YD8 G;  5HXE A;  2LOS A;  2MYS A;  4UXN B;  3K8P C;  1WLX A;  2X0L B;  4UF0 B;  5BMV E;  3R6N A;  3WAJ A;  5JVD E;  3VU7 H;  2E9X C;  1HG2 A;  3LJC A;  4AQF C;  4U72 A;  4O4J E;  2PG8 A;  3I9Y A;  4EYY R;  4OHF A;  5L3B B;  1LVK A;  4C91 A;  5LXT E;  5L2L A;  1G8X A;  4MLK A;  3LBX A;  4ANJ A;  2K9A A;  1YKE B;  4OK0 A;  3QK6 A;  2V7J A;  2C0S A;  4PAG A;  3PUR A;  5J2T E;  4ZS2 A;  4A56 A;  3W15 B;  4EAH A;  2BVL A;  4IST A;  5LHI B;  2QA7 A;  1QSD A;  3LK2 B;  3ZYK A;  3KBT A;  1U5P A;  3UTK A;  5JR9 A;  3CX8 B;  2NW9 A;  1FMV A;  3TKL B;  4ADZ A;  2CXF A;  3OKQ A;  2Y6X A;  3ANW A;  4I50 E;  1V9D A;  2ZLY A;  2LSG A;  2CXL A;  4CI3 B;  1ZKE A;  3UUX B;  5L3G B;  3BQL A;  4P0B A;  2MBG A;  2EHO A;  2XAQ B;  5L3C B;  3I0O A;  4UVB B;  2V7I A;  2XQY A;  3CWZ B;  3PDY A;  2DWG A;  3E0Z A;  5KX5 E;  4PK4 A;  4EXT A;  2XAG B;  5JDN A;  4AKI A;  1AJ3 A;  4GIW A;  3ZN0 B;  1U4Q A;  4CXW A;  4I55 E;  4IHJ E;  2X9W A;  2Y48 B;  3DJB A;  5TAO A;  3C50 A;  2Q9Q B;  2NOX A;  4N78 D;  3CQX C;  2SPC A;  2K48 A;  3H3A A;  1NAF A;  5JDQ A;  3N9L A;  4UF0 A;  5LBM A;  4JLE A;  5A1L A;  2P9B A;  5CA1 E;  4H9O C;  4I4T E;  3ZCJ A;  2CLY C;  4ISS A;  3JC6 D;  4KP3 C;  1S35 A;  2H7O A;  4JUY A;  2V26 A;  4TV8 E;  1HFA A;  2DI4 A;  2YU1 A;  4FJO A;  1KNZ A;  3EUH A;  5EK4 A;  3N9M A;  2QGS A;  3KV5 A;  3KBU A;  4H9R C;  4AI6 A;  4X1I E;  1WYB A;  1VOM A;  3AA7 B;  4Z8X A;  3S4U A;  4ZS3 A;  2X66 A;  4CI2 B;  3V5S A;  3K3Q C;  4I43 B;  1IZN B;  1MND A;  1MMN A;  4B6X A;  5JDF A;  3ZC1 A;  1YKH B;  2YEV C;  3GN5 B;  3PTR B;  4DBR A;  5LHH B;  2DCF A;  3GA8 A;  2N9D A;  2HPL A;  2LSY A;  5EZY E;  3AA6 B;  3ZYL A;  3E22 E;  5JDM A;  5LNK A;  5JR9 C;  4QXH B;  3PUQ A;  4MHC A;  4AQG A;  4AKL A;  5GON E;  2W0G A;  4HFV A;  2MTQ A;  3L3P A;  2IW5 B;  2EHO D;  5FP3 A;  3IF8 B;  3PUG A;  5LGU B;  2Q9Q A;  4X20 E;  2PFV A;  3LG7 A;  1D0X A;  1MIV A;  5F8P A;  3ETU A;  4U74 A;  1BR1 A;  3M65 A;  1MIY A;  3CPZ A;  5LJN A;  4BAY B;  5DQV A;  2H7V C;  2XHE B;  2H3R A;  3AAE B;  3AVS A;  3K3O A;  4PJL A;  4IE4 A;  2E8I A;  4HGA A;  4O4I E;  4QX8 B;  4G2A A;  2ZM2 A;  1WRD A;  5LG4 A;  5L3D B;  4AKH A;  4O4H E;  4IGU A;  2W63 A;  4PJJ A;  3FBL A;  4DBQ A;  3ZYM A;  4HKA A;  3KVB A;  1D0Y A;  3C4X A;  1US7 B;  5L3F B;  3E08 A;  4OFZ A;  1FIO A;  4UVC B;  2YIN A;  3GN5 A;  5J2U E;  3IBP A;  2X9H A;  4FI5 A;  3FBZ A;  5H6Q B;  3U3I A;  4GK5 E;  4H9Q C;  3N2G E;  2LSJ A;  4H9P C;  5IHY A;  1MIW A;  3MKD A;  3R84 B;  3WAK A;  2KWH A;  3P7I A;  4WBN E;  2ACX A;  1FMW A;  4ZI3 D;  4YJ2 E;  5JRC B;  3RKO A;  3GMI A;  3N2O A;  3D0T A;  1UX4 A;  3U78 A;  3LK4 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...