4ZI2D

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
125
structure length
125
Chain Sequence
EDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
total genus 54
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi2D00
4ZI3C 2K9AA 4ZI2D 4ZI3D 4ZI2C
chains in the Genus database with same CATH superfamily
2XHEB 3Q5WA 4KX6A 5L3DB 4GYSA 3ZC0A 1W9RA 3F31A 2XQ3A 5CA0E 4UF0A 1MMAA 3ZMVB 2N2NA 1IJ6A 3C64A 5J1GA 5AQFB 3B13A 3HKEE 2VQET 3D0TA 4G2AA 4PJLA 1ZOYA 2E8IA 5HCJA 5HEGA 5LYJE 5FL1A 2EHOC 3RRCA 2UUAT 2DHRA 5LA6E 2BS2A 3UUMA 3I9WA 4YTNA 3VR8A 3ZKRA 3TLVA 3ZEFB 4LMKA 1G8XA 1KK7A 3RC3A 4MLKA 3PJAA 3RI5A 1IJ5A 5L3GB 4H9SE 2XJ7A 5TAOA 2I59A 3RX6A 4CXWA 2I6HA 4QWNB 3LSVA 3TLUA 3H3MA 1VRBA 3CWZB 3HR0A 4EIWA 5CGMA 2XQYA 2CCQA 1MMGA 2NWBA 4B6XA 1N36T 4NUUA 2FJDA 2YOEA 3UU8A 2CLYB 5LGNB 2HHHT 2CWYA 4IGUA 2JQHA 4LF4T 4IREA 1E2AA 1UUSA 3ZJ1A 2UXBT 2W63A 4DR1T 4K0KT 4KUMB 2UXDT 2BZBA 4COFA 2XAJB 2JQQA 1YKEB 4IE5A 3C50A 4Q25A 1XNRT 3N9PA 5AQTB 2WMNA 3ZT7A 5AQRB 4DO0A 2VKDA 3OPCA 3MKDA 2V8SV 2EHOD 5DJQC 4CQIA 1VCSA 2A2FX 2YDRA 3KV4A 3ZN1B 4EB6E 1I94T 3FXEB 4DR5T 2G0UA 3J9X1 2JMHA 4DV4T 2WWVA 1KEYA 4TNWA 4I4TE 2V7JA 3PUGA 4ZS2A 4NIQA 4YSYA 4HFHA 3ETVA 3ONLC 4IL9A 1IBMT 2UUBT 4HGAA 2PG8A 5FXVA 4KHPT 2FBWA 3PE0A 1OWAA 2KT9A 3ABVA 3CQCB 4N78D 2FJAA 2X0LB 2XQ7A 3OKQA 4U2ZA 2NW9A 3Q5EA 3TKLB 4AXPA 5JREA 4B3ST 3VHLA 3AVSA 2H7OA 3X1DA 3QB5A 2JPFA 4B3RT 1N32T 2JRKA 3RYIE 5J0ZA 2WMOA 3JADA 2B76A 2KXPB 4ZS3A 4A5XA 3H37A 3AE3A 4AQFA 2NW7A 1KNZA 2BG9C 4WZXA 3N5LA 3ZPOA 4H63H 5JH7E 4NUVA 1M62A 3EDVA 3QK6A 3RIUC 4EEBA 2X67A 4IE0A 5A1LA 2DCFA 3S4UA 2X9XA 5JDGA 3RKOA 4IDPA 3SRZA 4LFCT 1MMDA 1WCRA 3TLSA 2KNDA 1UURA 2YN6A 3EVYA 2LHNA 3IF8B 4O4HE 4GK0E 2IW5B 3C51A 4EAHA 2BKPA 5DQWA 1B7TA 2KINB 3OBVE 3ZSTA 1YKHB 3AE7A 3CVRA 3AXJB 4U3CA 3PUAA 1OEDE 5DABA 3P4PA 2N1GA 3QC9A 3SFDA 2VL0A 4O2BE 1DU2A 1J5WA 2E9XA 4JLEA 5L4EA 4DR2T 4ZI3D 4H9PC 4F8HA 2IC6A 1U5PA 2XAGB 3PU3A 4IDOA 4UV8B 4HWHA 3NWIA 2MTQA 3FBZA 5ETWA 5ADXL 5LBMA 4P0AA 1ZHCA 4UR9A 4X1KE 3O9XA 3L8RA 4P09A 5AQJB 3RYFE 3LBXB 2L3LA 1SHZC 3ZMUB 3PU8A 5J2TE 3CQGB 4LF6T 1V9DA 2CBIA 3O4XE 2V7KA 2ZLYA 2HPJA 3DTOA 4HFIA 4O4JE 4LF8T 4QH5A 2HPLA 2IHR1 5AQIB 1IBLT 4YTPA 4Z91A 3NVOA 4TV9E 1NWMX 3LDQB 4IE6A 4Z90A 4YT0A 5L3FB 2XAFB 2XSAA 3CX6B 5HAXA 4ZZBA 3OJAA 3O1JA 4PFPA 1WYCA 4X66T 1HCIA 4C90A 3PUYF 3LK42 2JMKA 2D5UA 3FHNA 1T98A 3N9QA 4X64T 3VRBA 1X9BA 2XQAA 1Y01A 4OYJA 4TNVA 4UVAB 5JRCA 1ZP0A 3JCFA 2BS3A 2HH7A 4KI0F 3U78A 3GN5B 4CZZB 4DV5T 1FMWA 3P8CD 4HFEA 5AQVB 3AXJA 3PUVF 5FXZA 1O3XA 3RGLA 4G63A 5C2TA 1L0VA 2LSJA 2UXNB 3QOFA 4GYRA 2A3DA 3UT5E 1M7KA 1XDPA 5J2UE 5JDLA 2C5KT 2J62A 1D0ZA 2GK9A 4V1Av 3KVAA 5L4HA 4GIWA 3WAKA 3ONJA 1I6ZA 1X79A 4K0UA 3L09A 4UVBB 4M1PA 4CN4A 1MIVA 2QGSA 5FY0A 4PK5A 1LVFA 3IHRA 4IT4A 4PNIA 5HCMA 4DBQA 4ISSA 2EHOA 2NTYA 4EZHA 1UX5A 4QXBB 4DV6T 2X66A 3JAFA 2K9AA 3AVRA 2C5IT 2VKHA 2KZ7B 4X65T 2LRLA 2YK0A 1WR6A 5IHYA 2A9UA 3VRAA 2DWGA 3I9YA 4WYVA 3ZCIA 4LF7T 2CHNA 4ZI3C 2DWKA 3U3IA 4UIGA 3GWHA 4O8SA 4QHOA 2SPCA 2WS3A 4J2CA 4KMCA 4CXXA 4DVDA 2X51A 3AA1B 5L2LA 5LGTB 3AEFA 1T8BA 3IA3A 5HXSA 4UXNB 3ANWB 4AQYT 2UUCT 1WLXA 2WU5A 3DP7A 3N2GE 3O1IA 4AISA 2BG9E 2BG9A 1BR4A 5LMNT 4TV8E 1JNRA 2ODUA 4AQGA 1HF8A 4AI6A 3H3AA 2D2SA 4HTEA 3NKZA 2CM0A 5CB4E 5CFBA 2WB5A 3CK6A 4DMWA 1IAPA 2EHOB 2OA5A 3FB2A 1T72A 4X1IE 3KFWX 2F4VT 3VKHA 4EYUA 5LMUT 2V6XA 4U33A 4UEMA 4BA9A 2XTLA 4DV0T 2C5JA 1J5ET 3HKBE 3PUSA 3CPZA 3HI2A 3PUQA 3C4WA 4DBRA 3OTOT 2X0YA 1HTJF 5FY7A 1MNDA 3MA9A 1ZKEA 4IDNA 3MACA 3AE1A 4HWCA 2CA5A 4TZ4C 4YHHT 3V5UA 4ZOLE 2XSBA 5IYZE 3E08A 4UVCB 1G73A 3RYHE 1CHUA 3EUHA 2BBHA 3LG7A 4EOZB 4YJ2E 3ANWA 4OX9T 4BJNA 4NPPA 2WDVA 2XQ8A 3Q9DA 2LE8A 3N9OA 5AQOB 3K3QC 2W61A 4GKJT 3FZMB 3A7MA 5LP6E 3AEGA 3LK2B 2RP4A 3AE9A 5FNVE 2JQKA 3K1SA 4L5GA 2M67A 4DUYT 2LJLA 3UQ4A 3CQXC 3UFGA 5HXRA 4WNKA 4BAYB 3GMIA 4ZI7E 3Q5XA 3UUBA 1MIYA 1D1BA 2BS4A 2KSRA 1Y64B 4FJOA 3AEDA 3BQKA 4U7YA 5AQUB 3ESLA 4MALA 4EYYR 3PTRB 3SWHA 4H9OC 3KINB 3NZQA 4JI5T 2W0GA 4MBQA 4YSZA 2P9BA 2UXCT 5JDQA 4LMJA 4YSXA 1KFYA 4JEUB 2Q9QB 1W0AA 2CMRA 2VB6A 2NTXA 2XM1A 2K5BB 3AA0B 3NBXX 3ZMZB 4TX5A 2X9YA 1WYBA 2K24A 1VCTA 3E22E 2DLRA 2XQ6A 5HEUA 4ZHQE 2V5DA 2PTFA 2BVLA 2CHOA 2LSGA 2E5VA 2NW8A 1D1CA 2YKSA 2ZM8A 4GK5E 1D0XA 2LLYA 2CRBA 5F8PA 2AXDS 3R6NA 1FJGT 1UX4A 4B3TT 4OHFA 4A98A 2BG9B 2L8KA 3OYXA 4P1NA 2Q9QC 5LB7B 5AQLB 2DI4A 3GN5A 4AKGA 5FP3A 3FZHB 5C3JA 4I55E 3N9MA 1MIWA 2WU2A 3P4RA 1XMQT 3J7Yq 5JDHA 2IIUA 3C98B 4NXMT 4LFBT 4AKHA 3IBPA 4O4IE 5AQQB 4DV2T 1BR0A 2VKOA 4DR6T 2D0TA 5LCYA 2VWAA 2H3RA 5F3JA 4EZ4A 1UCUA 4X5TA 4XZCA 5FKYA 2XASB 5HYAA 2Y8DA 1U4QA 5C8YE 3ONXA 4PW8A 2BVMA 4ISTA 4YJ3E 4DUZT 5HXHA 1FMVA 2WWUA 5JTGA 4L0RA 4OYKA 4A56A 5AQPB 5LHGB 4DV3T 5GONE 3LJCA 1N33T 2YU1A 2IC9A 2ZM0A 4MFRA 2XY8B 4PFOA 4ERRA 4ZEYA 2XQ4A 3MJXA 4X1YE 3HKDE 1US7B 3NRXA 3ZJ2A 2WDQA 1KNPA 2ES0A 2HN1A 3AAEB 4U7IA 2DL1A 2IMLA 4WBOA 2Q9QA 2X68A 4ADZA 4EEDA 4EXTA 4F6RC 4JI6T 2AE9A 2V7IA 4LFAT 3KV9A 4JI1T 5JR9B 2E5LT 2LM2A 1WFDA 1XZYA 2Q9QD 2WAUA 2J4GA 5LBQB 4E7SA 3EI0A 2E9XB 5ABFA 3HKCE 5HXEA 2BBJA 2LOPA 3KDSE 4GKKT 4IE7A 3F57A 3ZC1A 2BDEA 2X9WA 1HG5A 1QLBA 4PK6A 5AQGB 5IUXA 4O2AE 4YY3T 4LF9T 3FZLB 5JVDE 4I0UA 5HWYA 2LM9A 3AB3B 2LSIA 4HFVA 3RIFA 2MBGA 3SS1A 5JQGE 5HWXA 3AE2A 2YDQA 3OYZA 4HWIB 5ABHA 3I0OA 4U31A 4E7ZA 5KMGP 2CEAA 2CLYC 3RHWA 1LVKA 4BJMA 3K8PC 3AEBA 3V5SA 1YW0A 2WCAA 2CWOA 3CKDA 1QSDA 1NENA 2VURA 1EZ3A 2CE7A 2M6BA 2YDSA 4HN9A 4IIJE 3RKGA 4LMLA 1HS7A 5EZYE 3LK3B 4TN7B 4JUYA 4AKIA 2VVSA 2QRXA 4QH1A 3N2KE 4IDZA 4DV1T 5EK3A 3T1HT 1YXRA 1GQEA 4IL4A 5FY1A 4QH4A 2W00A 2WZIA 4CN6A 2WY2A 2YEVC 3UULA 3LBXA 3ZLIA 4DR4T 3AAAB 3CIRA 2V6YA 4DMVA 5L3CB 3JAEA 4H63V 5LJNA 4JI0T 1ZV4X 2C0SA 2IDOB 2MYSA 4AKRB 5FXXA 3N2OA 1D1AA 1FIOA 3M3ZB 2HN2A 4OFZA 4JYAT 1WR0A 2OLTA 5AQHB 2WQYA 5AQKB 2NOXA 4UF0B 1W09A 4YXDA 1D0YA 2FJBA 4JV5T 2LRKA 4I50E 2Y48B 3K3OA 3P7IA 1MNEA 4HFDA 5E0OA 5LG3A 2LKHA 3KV5A 2V5CA 3KV6A 5JR9A 2B1EA 3FZKB 2XM2A 1CUNA 5DQVA 2WBLA 3I0QA 2E9XD 4PJNA 3TLWA 1KNRA 3EAMA 3P50A 1ZEEA 3PJAJ 5LG4A 3ZT5A 1BR2A 4YFSA 4ZXLA 2LHRA 3RLFF 4ASKA 4H9RC 3HA4A 4ZI2C 3C4ZA 2N9DA 4X20E 4HE8A 4OK0A 2K48A 2QVAA 4HKAA 3AA6B 3ZSSA 2VASA 1IZNB 2K3WA 3N9NA 1OEDA 4DV7T 2UU9T 2ZMAA 3RH3A 3AE4A 5HEHA 2ACXA 1T7SA 5F5WA 4ZI2D 2XQ9A 5HEJA 4EV6A 2H89A 4P0BA 4PJJA 5FXWA 1MMNA 5L47A 4JI7T 1YQ3A 3AECA 2V7MA 3AE6A 5LHIB 5H6QB 1BR1A 5LOVE 1SE7A 3VKGA 2CXLA 2CXDA 3A8YC 4XAXB 5JR9C 2V6YB 2W66A 3BQIA 3P4WA 3PDYA 3UFEA 5FVLA 3RQUA 2J47A 2IAKA 1HX1B 3EHZA 2VL8A 3CMLA 3KBUA 5JDFA 2RPAA 3OVUA 4ANJA 4JI3T 3E0ZA 4QX7B 2L9QA 1XWMA 2CPTA 2X9HA 3CX8B 4ILBA 4YHJA 1YQ4A 3AE5A 2W2UA 3BK9A 3WAJA 5L3EB 2V26A 2WSSV 3UU3A 4PJMA 2M6IA 2VVNA 4O4LE 4QX8B 2JJ9A 3KVBA 1UK5A 3T1YT 5FYMA 2ZM2A 3HL6A 4ILCA 1YD8G 4DIDB 4TWDA 1R8IA 3Q2MA 1H7CA 4I43B 3QUJA 1HFAA 5EK4A 2LSYA 3MXZA 3PV0F 5L3BB 4IE4A 1LRZA 3M65A 4LF5T 2D9DA 5HXCA 3A5XA 4B3MT 2W4XA 2WM9A 2W67A 3SOLA 5M4YA 3I1AA 2J1DG 3JC6C 3UU4A 4DR3T 4FI5A 3FZFB 5IWAT 2V7LA 4JI2T 3UTKA 2QA7A 2H7VC 4JEHB 3Q5DA 4HFBA 2LSKA 2OV9A 4QKNA 4C91A 2V1DB 2ACZA 3IEEA 4JBWF 4TWFA 3RRWA 5H6RB 2W62A 3B5MA 2NP9A 3JC6D 2UXXB 4GOUA 2CBJA 2XAQB 3QNUA 4TWHA 5ABGA 4QXCB 4AIUA 1HNZT 1XNQT 5JRCB 2MAWA 3T8OA 3NRYA 3NZPA 2I0MA 2Z6EA 3ZN0B 4CN1A 2WP9A 3EDUA 5ABEA 2FUPA 2D0UA 2RA1A 2PBIA 3UUXB 3VU7H 2LT3A 1HNXT 1SUMB 4A97A 5ABFB 1HX8A 4ZZCA 2MPKA 2ODVA 1Z8UA 4HEAA 3ZT6A 4DR7T 3ZYKA 3TLTA 4NXNT 2FJEA 1XDOA 4PAGA 1VOMA 4U74A 4HFCA 3ZCJA 3DJBA 2KWHA 5FVKA 4AQFC 2LOSA 2VKJA 3G06A 1E7PA 1W0BA 1WRDA 2E2AA 4WBNE 2XUEA 3PUWF 3O1HA 3QB5K 1NAFA 1FEWA 3RIUA 2A72A 4KHZF 4KBMB 4ILAA 4UELA 1AJ3A 2BKNA 2KMFA 2PFVA 1E1HB 2LEHA 4AKLA 4CI3B 2JIWA 3B57A 4KP3C 5LGUB 5FL0A 4Z8XA 3UUNA 3RF1A 4HWDA 4CI2B 5AQMB 3ZMSB 2Y6XA 3AA7B 5LJMA 5LNKA 3RYCE 2BKOA 3CX7B 1OEDB 2E9XC 3FBLA 3ZYMA 2WDRA 2IUBA 4YLHA 2XZEA 4EGWA 3UU5A 1HG2A 5HEOA 1HNWT 2KLQA 3RPUA 2VK9A 3C4XA 3F2EA 5KDMC 1KF6A 5AFUL 1HR0T 1S35A 2X0HA 3AE8A 5JDMA 5LXTE 4CXYA 1J1JA 2XPKA 3MK7C 3W15B 2XAHB 5CA1E 5KX5E 2KWIB 2PJQA 3RQWA 4IHJE 5AQNB 4U2YA 3VR9A 2H88A 2NR4A 2VQFT 5FMNA 5LHHB 3PURA 4TUYE 2ZM6T 2CXFA 4PK4A 3FXDB 3P4QA 4H9QC 4HWFA 3UQ7A 2XQ5A 3EABA 3R84B 3SFEA 3AEAA 3ZMTB 3UU6A 5CJ5A 3P4SA 5EK2A 3LFMA 4JI4T 4QXHB 1N34T 2YINA 3RC8A 3BQLA 2LKGA 2MOZA 1IBKT 3PUXF 3ZYLA 3PUZF 4L9IA 4ILUA 1Z0PA 2R6GF 1LKXA 1JNZA 4DNDA 1QUUA 1OEDC 5JDNA 3RIAA 3L3PA 4YTMA 5BMVE 1S94A 3KBTA 3AEEA 3N9LA 3AAIA 2JQ9A 4IDQA 4MHCA 1OXZA 5BR8T 4H9NC 3K3NA 4UV9B 5AQSB 2YU2A 3WI3A 1NEKA 1UGOA 2QYWA 2WZHA 3MZKB 1XMOT 4CI1B 4XBFB 3GA8A 4JI8T 3L39A 4U72A 1SA0E 5KXJA 3ETUA 4X62T 2DNXA 4WW0A
chains in the Genus database with same CATH topology
2XHEB 3Q5WA 5L3DB 4GYSA 3ZC0A 3F31A 5CA0E 4UF0A 1MMAA 3ZMVB 2N2NA 1IJ6A 3C64A 5J1GA 3B13A 3HKEE 3D0TA 4G2AA 4PJLA 2E8IA 5LYJE 2EHOC 3RRCA 2DHRA 5LA6E 3UUMA 3I9WA 3ZEFB 1G8XA 1KK7A 3RC3A 4MLKA 5L3GB 1IJ5A 4H9SE 4CXWA 5TAOA 2I59A 3RX6A 4QWNB 1VRBA 3CWZB 3HR0A 4EIWA 2XQYA 2CCQA 1MMGA 2NWBA 4B6XA 4NUUA 5LGNB 2CLYB 2CWYA 4IGUA 3ZJ1A 2W63A 4KUMB 2BZBA 2XAJB 2JQQA 1YKEB 4IE5A 3C50A 3N9PA 2WMNA 4DO0A 2VKDA 3MKDA 2EHOD 5DJQC 4CQIA 3KV4A 2A2FX 4EB6E 3FXEB 2G0UA 3J9X1 2JMHA 4I4TE 2V7JA 3PUGA 4ZS2A 3ETVA 4HGAA 2PG8A 5FXVA 3PE0A 1OWAA 2KT9A 3CQCB 4N78D 3TKLB 2X0LB 3OKQA 5JREA 4AXPA 2NW9A 3VHLA 3AVSA 2H7OA 2JPFA 2JRKA 3RYIE 2WMOA 2KXPB 4ZS3A 3H37A 1KNZA 4AQFA 2NW7A 3N5LA 3ZPOA 4H63H 5JH7E 4NUVA 3EDVA 3QK6A 2X67A 4IE0A 5A1LA 2DCFA 3S4UA 2X9XA 5JDGA 3RKOA 3SRZA 1MMDA 2KNDA 3EVYA 3IF8B 4O4HE 2LHNA 2IW5B 4EAHA 4GK0E 3C51A 5DQWA 1B7TA 2KINB 3OBVE 1YKHB 3CVRA 3PUAA 5DABA 2N1GA 3QC9A 4O2BE 2E9XA 4JLEA 4ZI3D 4H9PC 2IC6A 1U5PA 2XAGB 3PU3A 4UV8B 5ETWA 2MTQA 3FBZA 5ADXL 5LBMA 4P0AA 1ZHCA 4X1KE 3O9XA 3RYFE 4P09A 3LBXB 1SHZC 2L3LA 3ZMUB 3PU8A 5J2TE 3CQGB 1V9DA 3O4XE 2V7KA 2ZLYA 2HPJA 3DTOA 4O4JE 2HPLA 4TV9E 1NWMX 4IE6A 5L3FB 2XAFB 3CX6B 5HAXA 3OJAA 3O1JA 4PFPA 1WYCA 1HCIA 4C90A 3LK42 2JMKA 2D5UA 3FHNA 1T98A 3N9QA 4OYJA 4UVAB 5JRCA 2HH7A 4CZZB 3U78A 3GN5B 1FMWA 3P8CD 5FXZA 1O3XA 4G63A 2LSJA 2UXNB 4GYRA 3UT5E 2A3DA 5J2UE 5JDLA 2C5KT 1D0ZA 2GK9A 4V1Av 3KVAA 4GIWA 3WAKA 1X79A 4K0UA 3L09A 4UVBB 4M1PA 1MIVA 2QGSA 5FY0A 4PK5A 1LVFA 3IHRA 4PNIA 4ISSA 2EHOA 2NTYA 4EZHA 1UX5A 4QXBB 2X66A 2K9AA 3AVRA 2C5IT 2VKHA 2KZ7B 2YK0A 1WR6A 5IHYA 2DWGA 3I9YA 3ZCIA 4ZI3C 2DWKA 3U3IA 4UIGA 3GWHA 4O8SA 4QHOA 2SPCA 4J2CA 4KMCA 4CXXA 4DVDA 2X51A 3AA1B 5L2LA 5LGTB 5HXSA 4UXNB 3ANWB 1WLXA 3DP7A 3N2GE 3O1IA 1BR4A 4TV8E 4AQGA 2ODUA 1HF8A 4AI6A 3H3AA 2D2SA 4HTEA 2CM0A 5CB4E 4DMWA 1IAPA 2EHOB 2OA5A 3FB2A 4X1IE 3KFWX 3VKHA 4EYUA 4UEMA 4BA9A 2XTLA 2C5JA 3HKBE 3PUSA 3CPZA 3HI2A 3PUQA 3C4WA 4DBRA 1HTJF 5FY7A 1MNDA 3MA9A 1ZKEA 3MACA 2CA5A 4TZ4C 3V5UA 4ZOLE 5IYZE 3RYHE 3E08A 4UVCB 1G73A 4EOZB 3EUHA 4YJ2E 3LG7A 3ANWA 4BJNA 3Q9DA 2LE8A 3N9OA 3K3QC 2W61A 5LP6E 3LK2B 2RP4A 5FNVE 4L5GA 2M67A 2LJLA 3CQXC 5HXRA 4WNKA 4BAYB 3GMIA 4ZI7E 3Q5XA 1MIYA 1D1BA 4FJOA 1Y64B 4EYYR 3BQKA 5JRCB 3ESLA 4MALA 3PTRB 3SWHA 4H9OC 3KINB 3NZQA 2W0GA 4MBQA 2P9BA 5JDQA 4JEUB 2Q9QB 2VB6A 2CMRA 2NTXA 2K5BB 3AA0B 3NBXX 3ZMZB 4TX5A 2X9YA 1WYBA 3E22E 2K24A 4ZHQE 2DLRA 3RC8A 2BVLA 2NW8A 3ZN1B 2LSGA 3ZC1A 1D1CA 4GK5E 2ZM8A 5F8PA 1D0XA 3R6NA 1UX4A 4OHFA 2L8KA 3OYXA 4AKGA 2Q9QC 2DI4A 3GN5A 5FP3A 4I55E 3N9MA 1MIWA 3J7Yq 5JDHA 3C98B 4AKHA 3IBPA 4O4IE 1BR0A 2VKOA 2D0TA 5LCYA 2VWAA 2H3RA 5F3JA 4EZ4A 1UCUA 4XZCA 2XASB 5HYAA 2Y8DA 1U4QA 5C8YE 3ONXA 4PW8A 2BVMA 4ISTA 4YJ3E 5HXHA 1FMVA 2WWUA 4L0RA 4OYKA 4A56A 5LHGB 5GONE 3LJCA 2YU1A 2IC9A 2ZM0A 4MFRA 4PFOA 4ERRA 3MJXA 4X1YE 3ZJ2A 3HKDE 1US7B 3NRXA 4DBQA 2ES0A 3AAEB 4ADZA 4WBOA 4F6RC 4EXTA 2Q9QA 2X68A 2V7IA 3KV9A 5JR9B 5LBQB 2Q9QD 2WAUA 5HXEA 4E7SA 2E9XB 3HKCE 2LOPA 3KDSE 4IE7A 3F57A 2BDEA 2X9WA 1HG5A 4PK6A 4O2AE 5JVDE 5HWYA 2LM9A 3AB3B 2LSIA 4HFVA 3SS1A 2MBGA 5JQGE 5HWXA 3OYZA 3I0OA 4E7ZA 5KMGP 2CEAA 2CLYC 4BJMA 1LVKA 3K8PC 3V5SA 1YW0A 3CKDA 2CWOA 4HN9A 1QSDA 5JDNA 1EZ3A 2CE7A 4IIJE 1HS7A 5EZYE 3LK3B 4TN7B 4JUYA 4AKIA 3N2KE 4IDZA 5EK3A 5FY1A 2W00A 2YEVC 3UULA 3LBXA 3ZLIA 3AAAB 5L3CB 4DMVA 4H63V 5LJNA 1ZV4X 2C0SA 2MYSA 4AKRB 5FXXA 3N2OA 1D1AA 1FIOA 4OFZA 2NOXA 4UF0B 1D0YA 4I50E 5E0OA 2Y48B 3K3OA 3P7IA 1MNEA 3KV6A 3KV5A 5JR9A 2B1EA 1CUNA 5DQVA 2WBLA 3I0QA 2E9XD 4PJNA 1ZEEA 5LG4A 1BR2A 4YFSA 4ASKA 2LHRA 4ZI2C 4H9RC 3HA4A 3C4ZA 2N9DA 4X20E 4HE8A 4OK0A 2K48A 4HKAA 3AA6B 2VASA 1IZNB 3N9NA 2ZMAA 3RH3A 2ACXA 4ZI2D 4P0BA 4PJJA 5FXWA 1MMNA 2V7MA 5LHIB 5H6QB 1BR1A 5LOVE 3VKGA 2CXLA 2CXDA 4XAXB 5JR9C 3BQIA 3PDYA 3UFEA 3KBUA 2IAKA 2VL8A 3CMLA 5JDFA 4ANJA 3E0ZA 4QX7B 2L9QA 2X9HA 3CX8B 4YHJA 3BK9A 3WAJA 5L3EB 2V26A 2WSSV 4PJMA 4O4LE 4QX8B 2JJ9A 3KVBA 5FYMA 2ZM2A 3HL6A 1YD8G 3Q2MA 4I43B 1H7CA 5EK4A 3QUJA 1HFAA 2LSYA 3MXZA 5L3BB 4IE4A 1LRZA 3M65A 5HXCA 3A5XA 2WM9A 3SOLA 5M4YA 3I1AA 2J1DG 3JC6C 4FI5A 2V7LA 3UTKA 2QA7A 2H7VC 4JEHB 2LSKA 4QKNA 4C91A 2V1DB 3IEEA 3RRWA 5H6RB 2W62A 2NP9A 3JC6D 2UXXB 4GOUA 2XAQB 4QXCB 3T8OA 3NRYA 3NZPA 2Z6EA 3ZN0B 3EDUA 2D0UA 2RA1A 2PBIA 3UUXB 3VU7H 2LT3A 1HX8A 2ODVA 4HEAA 3ZYKA 4PAGA 1VOMA 4U74A 3ZCJA 3DJBA 2KWHA 4AQFC 2LOSA 2VKJA 1WRDA 4WBNE 2XUEA 3O1HA 1NAFA 1FEWA 2A72A 4KBMB 4UELA 1AJ3A 2KMFA 2PFVA 1E1HB 2LEHA 4AKLA 4CI3B 3B57A 4KP3C 5LGUB 4Z8XA 3UUNA 4CI2B 3ZMSB 2Y6XA 3AA7B 5LJMA 5LNKA 3RYCE 3CX7B 2E9XC 3FBLA 3ZYMA 4YLHA 1HG2A 2KLQA 3RPUA 2VK9A 3C4XA 3F2EA 5KDMC 5AFUL 1S35A 5JDMA 5LXTE 4CXYA 3MK7C 3W15B 2XAHB 5CA1E 5KX5E 2KWIB 2PJQA 4IHJE 5FMNA 5LHHB 3PURA 4TUYE 2CXFA 4PK4A 3FXDB 4H9QC 3R84B 5EK2A 3ZMTB 3LFMA 4QXHB 2YINA 3BQLA 2MOZA 3ZYLA 4L9IA 4ILUA 1Z0PA 1LKXA 4DNDA 1QUUA 3L3PA 5BMVE 1S94A 3KBTA 3N9LA 3AAIA 4MHCA 1OXZA 4H9NC 3K3NA 4UV9B 2YU2A 3WI3A 3MZKB 4CI1B 4XBFB 3GA8A 4U72A 1SA0E 3ETUA 2DNXA 4WW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI3 C;  2K9A A;  4ZI2 D;  4ZI3 D;  4ZI2 C; 
#chains in the Genus database with same CATH topology
 2XHE B;  3Q5W A;  4KX6 A;  5L3D B;  4GYS A;  3ZC0 A;  1W9R A;  3F31 A;  2XQ3 A;  5CA0 E;  4UF0 A;  1MMA A;  3ZMV B;  2N2N A;  1IJ6 A;  3C64 A;  5J1G A;  5AQF B;  3B13 A;  3HKE E;  2VQE T;  3D0T A;  4G2A A;  4PJL A;  1ZOY A;  2E8I A;  5HCJ A;  5HEG A;  5LYJ E;  5FL1 A;  2EHO C;  3RRC A;  2UUA T;  2DHR A;  5LA6 E;  2BS2 A;  3UUM A;  3I9W A;  4YTN A;  3VR8 A;  3ZKR A;  3TLV A;  3ZEF B;  4LMK A;  1G8X A;  1KK7 A;  3RC3 A;  4MLK A;  3PJA A;  3RI5 A;  1IJ5 A;  5L3G B;  4H9S E;  2XJ7 A;  5TAO A;  2I59 A;  3RX6 A;  4CXW A;  2I6H A;  4QWN B;  3LSV A;  3TLU A;  3H3M A;  1VRB A;  3CWZ B;  3HR0 A;  4EIW A;  5CGM A;  2XQY A;  2CCQ A;  1MMG A;  2NWB A;  4B6X A;  1N36 T;  4NUU A;  2FJD A;  2YOE A;  3UU8 A;  2CLY B;  5LGN B;  2HHH T;  2CWY A;  4IGU A;  2JQH A;  4LF4 T;  4IRE A;  1E2A A;  1UUS A;  3ZJ1 A;  2UXB T;  2W63 A;  4DR1 T;  4K0K T;  4KUM B;  2UXD T;  2BZB A;  4COF A;  2XAJ B;  2JQQ A;  1YKE B;  4IE5 A;  3C50 A;  4Q25 A;  1XNR T;  3N9P A;  5AQT B;  2WMN A;  3ZT7 A;  5AQR B;  4DO0 A;  2VKD A;  3OPC A;  3MKD A;  2V8S V;  2EHO D;  5DJQ C;  4CQI A;  1VCS A;  2A2F X;  2YDR A;  3KV4 A;  3ZN1 B;  4EB6 E;  1I94 T;  3FXE B;  4DR5 T;  2G0U A;  3J9X 1;  2JMH A;  4DV4 T;  2WWV A;  1KEY A;  4TNW A;  4I4T E;  2V7J A;  3PUG A;  4ZS2 A;  4NIQ A;  4YSY A;  4HFH A;  3ETV A;  3ONL C;  4IL9 A;  1IBM T;  2UUB T;  4HGA A;  2PG8 A;  5FXV A;  4KHP T;  2FBW A;  3PE0 A;  1OWA A;  2KT9 A;  3ABV A;  3CQC B;  4N78 D;  2FJA A;  2X0L B;  2XQ7 A;  3OKQ A;  4U2Z A;  2NW9 A;  3Q5E A;  3TKL B;  4AXP A;  5JRE A;  4B3S T;  3VHL A;  3AVS A;  2H7O A;  3X1D A;  3QB5 A;  2JPF A;  4B3R T;  1N32 T;  2JRK A;  3RYI E;  5J0Z A;  2WMO A;  3JAD A;  2B76 A;  2KXP B;  4ZS3 A;  4A5X A;  3H37 A;  3AE3 A;  4AQF A;  2NW7 A;  1KNZ A;  2BG9 C;  4WZX A;  3N5L A;  3ZPO A;  4H63 H;  5JH7 E;  4NUV A;  1M62 A;  3EDV A;  3QK6 A;  3RIU C;  4EEB A;  2X67 A;  4IE0 A;  5A1L A;  2DCF A;  3S4U A;  2X9X A;  5JDG A;  3RKO A;  4IDP A;  3SRZ A;  4LFC T;  1MMD A;  1WCR A;  3TLS A;  2KND A;  1UUR A;  2YN6 A;  3EVY A;  2LHN A;  3IF8 B;  4O4H E;  4GK0 E;  2IW5 B;  3C51 A;  4EAH A;  2BKP A;  5DQW A;  1B7T A;  2KIN B;  3OBV E;  3ZST A;  1YKH B;  3AE7 A;  3CVR A;  3AXJ B;  4U3C A;  3PUA A;  1OED E;  5DAB A;  3P4P A;  2N1G A;  3QC9 A;  3SFD A;  2VL0 A;  4O2B E;  1DU2 A;  1J5W A;  2E9X A;  4JLE A;  5L4E A;  4DR2 T;  4ZI3 D;  4H9P C;  4F8H A;  2IC6 A;  1U5P A;  2XAG B;  3PU3 A;  4IDO A;  4UV8 B;  4HWH A;  3NWI A;  2MTQ A;  3FBZ A;  5ETW A;  5ADX L;  5LBM A;  4P0A A;  1ZHC A;  4UR9 A;  4X1K E;  3O9X A;  3L8R A;  4P09 A;  5AQJ B;  3RYF E;  3LBX B;  2L3L A;  1SHZ C;  3ZMU B;  3PU8 A;  5J2T E;  3CQG B;  4LF6 T;  1V9D A;  2CBI A;  3O4X E;  2V7K A;  2ZLY A;  2HPJ A;  3DTO A;  4HFI A;  4O4J E;  4LF8 T;  4QH5 A;  2HPL A;  2IHR 1;  5AQI B;  1IBL T;  4YTP A;  4Z91 A;  3NVO A;  4TV9 E;  1NWM X;  3LDQ B;  4IE6 A;  4Z90 A;  4YT0 A;  5L3F B;  2XAF B;  2XSA A;  3CX6 B;  5HAX A;  4ZZB A;  3OJA A;  3O1J A;  4PFP A;  1WYC A;  4X66 T;  1HCI A;  4C90 A;  3PUY F;  3LK4 2;  2JMK A;  2D5U A;  3FHN A;  1T98 A;  3N9Q A;  4X64 T;  3VRB A;  1X9B A;  2XQA A;  1Y01 A;  4OYJ A;  4TNV A;  4UVA B;  5JRC A;  1ZP0 A;  3JCF A;  2BS3 A;  2HH7 A;  4KI0 F;  3U78 A;  3GN5 B;  4CZZ B;  4DV5 T;  1FMW A;  3P8C D;  4HFE A;  5AQV B;  3AXJ A;  3PUV F;  5FXZ A;  1O3X A;  3RGL A;  4G63 A;  5C2T A;  1L0V A;  2LSJ A;  2UXN B;  3QOF A;  4GYR A;  2A3D A;  3UT5 E;  1M7K A;  1XDP A;  5J2U E;  5JDL A;  2C5K T;  2J62 A;  1D0Z A;  2GK9 A;  4V1A v;  3KVA A;  5L4H A;  4GIW A;  3WAK A;  3ONJ A;  1I6Z A;  1X79 A;  4K0U A;  3L09 A;  4UVB B;  4M1P A;  4CN4 A;  1MIV A;  2QGS A;  5FY0 A;  4PK5 A;  1LVF A;  3IHR A;  4IT4 A;  4PNI A;  5HCM A;  4DBQ A;  4ISS A;  2EHO A;  2NTY A;  4EZH A;  1UX5 A;  4QXB B;  4DV6 T;  2X66 A;  3JAF A;  2K9A A;  3AVR A;  2C5I T;  2VKH A;  2KZ7 B;  4X65 T;  2LRL A;  2YK0 A;  1WR6 A;  5IHY A;  2A9U A;  3VRA A;  2DWG A;  3I9Y A;  4WYV A;  3ZCI A;  4LF7 T;  2CHN A;  4ZI3 C;  2DWK A;  3U3I A;  4UIG A;  3GWH A;  4O8S A;  4QHO A;  2SPC A;  2WS3 A;  4J2C A;  4KMC A;  4CXX A;  4DVD A;  2X51 A;  3AA1 B;  5L2L A;  5LGT B;  3AEF A;  1T8B A;  3IA3 A;  5HXS A;  4UXN B;  3ANW B;  4AQY T;  2UUC T;  1WLX A;  2WU5 A;  3DP7 A;  3N2G E;  3O1I A;  4AIS A;  2BG9 E;  2BG9 A;  1BR4 A;  5LMN T;  4TV8 E;  1JNR A;  2ODU A;  4AQG A;  1HF8 A;  4AI6 A;  3H3A A;  2D2S A;  4HTE A;  3NKZ A;  2CM0 A;  5CB4 E;  5CFB A;  2WB5 A;  3CK6 A;  4DMW A;  1IAP A;  2EHO B;  2OA5 A;  3FB2 A;  1T72 A;  4X1I E;  3KFW X;  2F4V T;  3VKH A;  4EYU A;  5LMU T;  2V6X A;  4U33 A;  4UEM A;  4BA9 A;  2XTL A;  4DV0 T;  2C5J A;  1J5E T;  3HKB E;  3PUS A;  3CPZ A;  3HI2 A;  3PUQ A;  3C4W A;  4DBR A;  3OTO T;  2X0Y A;  1HTJ F;  5FY7 A;  1MND A;  3MA9 A;  1ZKE A;  4IDN A;  3MAC A;  3AE1 A;  4HWC A;  2CA5 A;  4TZ4 C;  4YHH T;  3V5U A;  4ZOL E;  2XSB A;  5IYZ E;  3E08 A;  4UVC B;  1G73 A;  3RYH E;  1CHU A;  3EUH A;  2BBH A;  3LG7 A;  4EOZ B;  4YJ2 E;  3ANW A;  4OX9 T;  4BJN A;  4NPP A;  2WDV A;  2XQ8 A;  3Q9D A;  2LE8 A;  3N9O A;  5AQO B;  3K3Q C;  2W61 A;  4GKJ T;  3FZM B;  3A7M A;  5LP6 E;  3AEG A;  3LK2 B;  2RP4 A;  3AE9 A;  5FNV E;  2JQK A;  3K1S A;  4L5G A;  2M67 A;  4DUY T;  2LJL A;  3UQ4 A;  3CQX C;  3UFG A;  5HXR A;  4WNK A;  4BAY B;  3GMI A;  4ZI7 E;  3Q5X A;  3UUB A;  1MIY A;  1D1B A;  2BS4 A;  2KSR A;  1Y64 B;  4FJO A;  3AED A;  3BQK A;  4U7Y A;  5AQU B;  3ESL A;  4MAL A;  4EYY R;  3PTR B;  3SWH A;  4H9O C;  3KIN B;  3NZQ A;  4JI5 T;  2W0G A;  4MBQ A;  4YSZ A;  2P9B A;  2UXC T;  5JDQ A;  4LMJ A;  4YSX A;  1KFY A;  4JEU B;  2Q9Q B;  1W0A A;  2CMR A;  2VB6 A;  2NTX A;  2XM1 A;  2K5B B;  3AA0 B;  3NBX X;  3ZMZ B;  4TX5 A;  2X9Y A;  1WYB A;  2K24 A;  1VCT A;  3E22 E;  2DLR A;  2XQ6 A;  5HEU A;  4ZHQ E;  2V5D A;  2PTF A;  2BVL A;  2CHO A;  2LSG A;  2E5V A;  2NW8 A;  1D1C A;  2YKS A;  2ZM8 A;  4GK5 E;  1D0X A;  2LLY A;  2CRB A;  5F8P A;  2AXD S;  3R6N A;  1FJG T;  1UX4 A;  4B3T T;  4OHF A;  4A98 A;  2BG9 B;  2L8K A;  3OYX A;  4P1N A;  2Q9Q C;  5LB7 B;  5AQL B;  2DI4 A;  3GN5 A;  4AKG A;  5FP3 A;  3FZH B;  5C3J A;  4I55 E;  3N9M A;  1MIW A;  2WU2 A;  3P4R A;  1XMQ T;  3J7Y q;  5JDH A;  2IIU A;  3C98 B;  4NXM T;  4LFB T;  4AKH A;  3IBP A;  4O4I E;  5AQQ B;  4DV2 T;  1BR0 A;  2VKO A;  4DR6 T;  2D0T A;  5LCY A;  2VWA A;  2H3R A;  5F3J A;  4EZ4 A;  1UCU A;  4X5T A;  4XZC A;  5FKY A;  2XAS B;  5HYA A;  2Y8D A;  1U4Q A;  5C8Y E;  3ONX A;  4PW8 A;  2BVM A;  4IST A;  4YJ3 E;  4DUZ T;  5HXH A;  1FMV A;  2WWU A;  5JTG A;  4L0R A;  4OYK A;  4A56 A;  5AQP B;  5LHG B;  4DV3 T;  5GON E;  3LJC A;  1N33 T;  2YU1 A;  2IC9 A;  2ZM0 A;  4MFR A;  2XY8 B;  4PFO A;  4ERR A;  4ZEY A;  2XQ4 A;  3MJX A;  4X1Y E;  3HKD E;  1US7 B;  3NRX A;  3ZJ2 A;  2WDQ A;  1KNP A;  2ES0 A;  2HN1 A;  3AAE B;  4U7I A;  2DL1 A;  2IML A;  4WBO A;  2Q9Q A;  2X68 A;  4ADZ A;  4EED A;  4EXT A;  4F6R C;  4JI6 T;  2AE9 A;  2V7I A;  4LFA T;  3KV9 A;  4JI1 T;  5JR9 B;  2E5L T;  2LM2 A;  1WFD A;  1XZY A;  2Q9Q D;  2WAU A;  2J4G A;  5LBQ B;  4E7S A;  3EI0 A;  2E9X B;  5ABF A;  3HKC E;  5HXE A;  2BBJ A;  2LOP A;  3KDS E;  4GKK T;  4IE7 A;  3F57 A;  3ZC1 A;  2BDE A;  2X9W A;  1HG5 A;  1QLB A;  4PK6 A;  5AQG B;  5IUX A;  4O2A E;  4YY3 T;  4LF9 T;  3FZL B;  5JVD E;  4I0U A;  5HWY A;  2LM9 A;  3AB3 B;  2LSI A;  4HFV A;  3RIF A;  2MBG A;  3SS1 A;  5JQG E;  5HWX A;  3AE2 A;  2YDQ A;  3OYZ A;  4HWI B;  5ABH A;  3I0O A;  4U31 A;  4E7Z A;  5KMG P;  2CEA A;  2CLY C;  3RHW A;  1LVK A;  4BJM A;  3K8P C;  3AEB A;  3V5S A;  1YW0 A;  2WCA A;  2CWO A;  3CKD A;  1QSD A;  1NEN A;  2VUR A;  1EZ3 A;  2CE7 A;  2M6B A;  2YDS A;  4HN9 A;  4IIJ E;  3RKG A;  4LML A;  1HS7 A;  5EZY E;  3LK3 B;  4TN7 B;  4JUY A;  4AKI A;  2VVS A;  2QRX A;  4QH1 A;  3N2K E;  4IDZ A;  4DV1 T;  5EK3 A;  3T1H T;  1YXR A;  1GQE A;  4IL4 A;  5FY1 A;  4QH4 A;  2W00 A;  2WZI A;  4CN6 A;  2WY2 A;  2YEV C;  3UUL A;  3LBX A;  3ZLI A;  4DR4 T;  3AAA B;  3CIR A;  2V6Y A;  4DMV A;  5L3C B;  3JAE A;  4H63 V;  5LJN A;  4JI0 T;  1ZV4 X;  2C0S A;  2IDO B;  2MYS A;  4AKR B;  5FXX A;  3N2O A;  1D1A A;  1FIO A;  3M3Z B;  2HN2 A;  4OFZ A;  4JYA T;  1WR0 A;  2OLT A;  5AQH B;  2WQY A;  5AQK B;  2NOX A;  4UF0 B;  1W09 A;  4YXD A;  1D0Y A;  2FJB A;  4JV5 T;  2LRK A;  4I50 E;  2Y48 B;  3K3O A;  3P7I A;  1MNE A;  4HFD A;  5E0O A;  5LG3 A;  2LKH A;  3KV5 A;  2V5C A;  3KV6 A;  5JR9 A;  2B1E A;  3FZK B;  2XM2 A;  1CUN A;  5DQV A;  2WBL A;  3I0Q A;  2E9X D;  4PJN A;  3TLW A;  1KNR A;  3EAM A;  3P50 A;  1ZEE A;  3PJA J;  5LG4 A;  3ZT5 A;  1BR2 A;  4YFS A;  4ZXL A;  2LHR A;  3RLF F;  4ASK A;  4H9R C;  3HA4 A;  4ZI2 C;  3C4Z A;  2N9D A;  4X20 E;  4HE8 A;  4OK0 A;  2K48 A;  2QVA A;  4HKA A;  3AA6 B;  3ZSS A;  2VAS A;  1IZN B;  2K3W A;  3N9N A;  1OED A;  4DV7 T;  2UU9 T;  2ZMA A;  3RH3 A;  3AE4 A;  5HEH A;  2ACX A;  1T7S A;  5F5W A;  4ZI2 D;  2XQ9 A;  5HEJ A;  4EV6 A;  2H89 A;  4P0B A;  4PJJ A;  5FXW A;  1MMN A;  5L47 A;  4JI7 T;  1YQ3 A;  3AEC A;  2V7M A;  3AE6 A;  5LHI B;  5H6Q B;  1BR1 A;  5LOV E;  1SE7 A;  3VKG A;  2CXL A;  2CXD A;  3A8Y C;  4XAX B;  5JR9 C;  2V6Y B;  2W66 A;  3BQI A;  3P4W A;  3PDY A;  3UFE A;  5FVL A;  3RQU A;  2J47 A;  2IAK A;  1HX1 B;  3EHZ A;  2VL8 A;  3CML A;  3KBU A;  5JDF A;  2RPA A;  3OVU A;  4ANJ A;  4JI3 T;  3E0Z A;  4QX7 B;  2L9Q A;  1XWM A;  2CPT A;  2X9H A;  3CX8 B;  4ILB A;  4YHJ A;  1YQ4 A;  3AE5 A;  2W2U A;  3BK9 A;  3WAJ A;  5L3E B;  2V26 A;  2WSS V;  3UU3 A;  4PJM A;  2M6I A;  2VVN A;  4O4L E;  4QX8 B;  2JJ9 A;  3KVB A;  1UK5 A;  3T1Y T;  5FYM A;  2ZM2 A;  3HL6 A;  4ILC A;  1YD8 G;  4DID B;  4TWD A;  1R8I A;  3Q2M A;  1H7C A;  4I43 B;  3QUJ A;  1HFA A;  5EK4 A;  2LSY A;  3MXZ A;  3PV0 F;  5L3B B;  4IE4 A;  1LRZ A;  3M65 A;  4LF5 T;  2D9D A;  5HXC A;  3A5X A;  4B3M T;  2W4X A;  2WM9 A;  2W67 A;  3SOL A;  5M4Y A;  3I1A A;  2J1D G;  3JC6 C;  3UU4 A;  4DR3 T;  4FI5 A;  3FZF B;  5IWA T;  2V7L A;  4JI2 T;  3UTK A;  2QA7 A;  2H7V C;  4JEH B;  3Q5D A;  4HFB A;  2LSK A;  2OV9 A;  4QKN A;  4C91 A;  2V1D B;  2ACZ A;  3IEE A;  4JBW F;  4TWF A;  3RRW A;  5H6R B;  2W62 A;  3B5M A;  2NP9 A;  3JC6 D;  2UXX B;  4GOU A;  2CBJ A;  2XAQ B;  3QNU A;  4TWH A;  5ABG A;  4QXC B;  4AIU A;  1HNZ T;  1XNQ T;  5JRC B;  2MAW A;  3T8O A;  3NRY A;  3NZP A;  2I0M A;  2Z6E A;  3ZN0 B;  4CN1 A;  2WP9 A;  3EDU A;  5ABE A;  2FUP A;  2D0U A;  2RA1 A;  2PBI A;  3UUX B;  3VU7 H;  2LT3 A;  1HNX T;  1SUM B;  4A97 A;  5ABF B;  1HX8 A;  4ZZC A;  2MPK A;  2ODV A;  1Z8U A;  4HEA A;  3ZT6 A;  4DR7 T;  3ZYK A;  3TLT A;  4NXN T;  2FJE A;  1XDO A;  4PAG A;  1VOM A;  4U74 A;  4HFC A;  3ZCJ A;  3DJB A;  2KWH A;  5FVK A;  4AQF C;  2LOS A;  2VKJ A;  3G06 A;  1E7P A;  1W0B A;  1WRD A;  2E2A A;  4WBN E;  2XUE A;  3PUW F;  3O1H A;  3QB5 K;  1NAF A;  1FEW A;  3RIU A;  2A72 A;  4KHZ F;  4KBM B;  4ILA A;  4UEL A;  1AJ3 A;  2BKN A;  2KMF A;  2PFV A;  1E1H B;  2LEH A;  4AKL A;  4CI3 B;  2JIW A;  3B57 A;  4KP3 C;  5LGU B;  5FL0 A;  4Z8X A;  3UUN A;  3RF1 A;  4HWD A;  4CI2 B;  5AQM B;  3ZMS B;  2Y6X A;  3AA7 B;  5LJM A;  5LNK A;  3RYC E;  2BKO A;  3CX7 B;  1OED B;  2E9X C;  3FBL A;  3ZYM A;  2WDR A;  2IUB A;  4YLH A;  2XZE A;  4EGW A;  3UU5 A;  1HG2 A;  5HEO A;  1HNW T;  2KLQ A;  3RPU A;  2VK9 A;  3C4X A;  3F2E A;  5KDM C;  1KF6 A;  5AFU L;  1HR0 T;  1S35 A;  2X0H A;  3AE8 A;  5JDM A;  5LXT E;  4CXY A;  1J1J A;  2XPK A;  3MK7 C;  3W15 B;  2XAH B;  5CA1 E;  5KX5 E;  2KWI B;  2PJQ A;  3RQW A;  4IHJ E;  5AQN B;  4U2Y A;  3VR9 A;  2H88 A;  2NR4 A;  2VQF T;  5FMN A;  5LHH B;  3PUR A;  4TUY E;  2ZM6 T;  2CXF A;  4PK4 A;  3FXD B;  3P4Q A;  4H9Q C;  4HWF A;  3UQ7 A;  2XQ5 A;  3EAB A;  3R84 B;  3SFE A;  3AEA A;  3ZMT B;  3UU6 A;  5CJ5 A;  3P4S A;  5EK2 A;  3LFM A;  4JI4 T;  4QXH B;  1N34 T;  2YIN A;  3RC8 A;  3BQL A;  2LKG A;  2MOZ A;  1IBK T;  3PUX F;  3ZYL A;  3PUZ F;  4L9I A;  4ILU A;  1Z0P A;  2R6G F;  1LKX A;  1JNZ A;  4DND A;  1QUU A;  1OED C;  5JDN A;  3RIA A;  3L3P A;  4YTM A;  5BMV E;  1S94 A;  3KBT A;  3AEE A;  3N9L A;  3AAI A;  2JQ9 A;  4IDQ A;  4MHC A;  1OXZ A;  5BR8 T;  4H9N C;  3K3N A;  4UV9 B;  5AQS B;  2YU2 A;  3WI3 A;  1NEK A;  1UGO A;  2QYW A;  2WZH A;  3MZK B;  1XMO T;  4CI1 B;  4XBF B;  3GA8 A;  4JI8 T;  3L39 A;  4U72 A;  1SA0 E;  5KXJ A;  3ETU A;  4X62 T;  2DNX A;  4WW0 A; 
#chains in the Genus database with same CATH homology
 2XHE B;  3Q5W A;  5L3D B;  4GYS A;  3ZC0 A;  3F31 A;  5CA0 E;  4UF0 A;  1MMA A;  3ZMV B;  2N2N A;  1IJ6 A;  3C64 A;  5J1G A;  3B13 A;  3HKE E;  3D0T A;  4G2A A;  4PJL A;  2E8I A;  5LYJ E;  2EHO C;  3RRC A;  2DHR A;  5LA6 E;  3UUM A;  3I9W A;  3ZEF B;  1G8X A;  1KK7 A;  3RC3 A;  4MLK A;  5L3G B;  1IJ5 A;  4H9S E;  4CXW A;  5TAO A;  2I59 A;  3RX6 A;  4QWN B;  1VRB A;  3CWZ B;  3HR0 A;  4EIW A;  2XQY A;  2CCQ A;  1MMG A;  2NWB A;  4B6X A;  4NUU A;  5LGN B;  2CLY B;  2CWY A;  4IGU A;  3ZJ1 A;  2W63 A;  4KUM B;  2BZB A;  2XAJ B;  2JQQ A;  1YKE B;  4IE5 A;  3C50 A;  3N9P A;  2WMN A;  4DO0 A;  2VKD A;  3MKD A;  2EHO D;  5DJQ C;  4CQI A;  3KV4 A;  2A2F X;  4EB6 E;  3FXE B;  2G0U A;  3J9X 1;  2JMH A;  4I4T E;  2V7J A;  3PUG A;  4ZS2 A;  3ETV A;  4HGA A;  2PG8 A;  5FXV A;  3PE0 A;  1OWA A;  2KT9 A;  3CQC B;  4N78 D;  3TKL B;  2X0L B;  3OKQ A;  5JRE A;  4AXP A;  2NW9 A;  3VHL A;  3AVS A;  2H7O A;  2JPF A;  2JRK A;  3RYI E;  2WMO A;  2KXP B;  4ZS3 A;  3H37 A;  1KNZ A;  4AQF A;  2NW7 A;  3N5L A;  3ZPO A;  4H63 H;  5JH7 E;  4NUV A;  3EDV A;  3QK6 A;  2X67 A;  4IE0 A;  5A1L A;  2DCF A;  3S4U A;  2X9X A;  5JDG A;  3RKO A;  3SRZ A;  1MMD A;  2KND A;  3EVY A;  3IF8 B;  4O4H E;  2LHN A;  2IW5 B;  4EAH A;  4GK0 E;  3C51 A;  5DQW A;  1B7T A;  2KIN B;  3OBV E;  1YKH B;  3CVR A;  3PUA A;  5DAB A;  2N1G A;  3QC9 A;  4O2B E;  2E9X A;  4JLE A;  4ZI3 D;  4H9P C;  2IC6 A;  1U5P A;  2XAG B;  3PU3 A;  4UV8 B;  5ETW A;  2MTQ A;  3FBZ A;  5ADX L;  5LBM A;  4P0A A;  1ZHC A;  4X1K E;  3O9X A;  3RYF E;  4P09 A;  3LBX B;  1SHZ C;  2L3L A;  3ZMU B;  3PU8 A;  5J2T E;  3CQG B;  1V9D A;  3O4X E;  2V7K A;  2ZLY A;  2HPJ A;  3DTO A;  4O4J E;  2HPL A;  4TV9 E;  1NWM X;  4IE6 A;  5L3F B;  2XAF B;  3CX6 B;  5HAX A;  3OJA A;  3O1J A;  4PFP A;  1WYC A;  1HCI A;  4C90 A;  3LK4 2;  2JMK A;  2D5U A;  3FHN A;  1T98 A;  3N9Q A;  4OYJ A;  4UVA B;  5JRC A;  2HH7 A;  4CZZ B;  3U78 A;  3GN5 B;  1FMW A;  3P8C D;  5FXZ A;  1O3X A;  4G63 A;  2LSJ A;  2UXN B;  4GYR A;  3UT5 E;  2A3D A;  5J2U E;  5JDL A;  2C5K T;  1D0Z A;  2GK9 A;  4V1A v;  3KVA A;  4GIW A;  3WAK A;  1X79 A;  4K0U A;  3L09 A;  4UVB B;  4M1P A;  1MIV A;  2QGS A;  5FY0 A;  4PK5 A;  1LVF A;  3IHR A;  4PNI A;  4ISS A;  2EHO A;  2NTY A;  4EZH A;  1UX5 A;  4QXB B;  2X66 A;  2K9A A;  3AVR A;  2C5I T;  2VKH A;  2KZ7 B;  2YK0 A;  1WR6 A;  5IHY A;  2DWG A;  3I9Y A;  3ZCI A;  4ZI3 C;  2DWK A;  3U3I A;  4UIG A;  3GWH A;  4O8S A;  4QHO A;  2SPC A;  4J2C A;  4KMC A;  4CXX A;  4DVD A;  2X51 A;  3AA1 B;  5L2L A;  5LGT B;  5HXS A;  4UXN B;  3ANW B;  1WLX A;  3DP7 A;  3N2G E;  3O1I A;  1BR4 A;  4TV8 E;  4AQG A;  2ODU A;  1HF8 A;  4AI6 A;  3H3A A;  2D2S A;  4HTE A;  2CM0 A;  5CB4 E;  4DMW A;  1IAP A;  2EHO B;  2OA5 A;  3FB2 A;  4X1I E;  3KFW X;  3VKH A;  4EYU A;  4UEM A;  4BA9 A;  2XTL A;  2C5J A;  3HKB E;  3PUS A;  3CPZ A;  3HI2 A;  3PUQ A;  3C4W A;  4DBR A;  1HTJ F;  5FY7 A;  1MND A;  3MA9 A;  1ZKE A;  3MAC A;  2CA5 A;  4TZ4 C;  3V5U A;  4ZOL E;  5IYZ E;  3RYH E;  3E08 A;  4UVC B;  1G73 A;  4EOZ B;  3EUH A;  4YJ2 E;  3LG7 A;  3ANW A;  4BJN A;  3Q9D A;  2LE8 A;  3N9O A;  3K3Q C;  2W61 A;  5LP6 E;  3LK2 B;  2RP4 A;  5FNV E;  4L5G A;  2M67 A;  2LJL A;  3CQX C;  5HXR A;  4WNK A;  4BAY B;  3GMI A;  4ZI7 E;  3Q5X A;  1MIY A;  1D1B A;  4FJO A;  1Y64 B;  4EYY R;  3BQK A;  5JRC B;  3ESL A;  4MAL A;  3PTR B;  3SWH A;  4H9O C;  3KIN B;  3NZQ A;  2W0G A;  4MBQ A;  2P9B A;  5JDQ A;  4JEU B;  2Q9Q B;  2VB6 A;  2CMR A;  2NTX A;  2K5B B;  3AA0 B;  3NBX X;  3ZMZ B;  4TX5 A;  2X9Y A;  1WYB A;  3E22 E;  2K24 A;  4ZHQ E;  2DLR A;  3RC8 A;  2BVL A;  2NW8 A;  3ZN1 B;  2LSG A;  3ZC1 A;  1D1C A;  4GK5 E;  2ZM8 A;  5F8P A;  1D0X A;  3R6N A;  1UX4 A;  4OHF A;  2L8K A;  3OYX A;  4AKG A;  2Q9Q C;  2DI4 A;  3GN5 A;  5FP3 A;  4I55 E;  3N9M A;  1MIW A;  3J7Y q;  5JDH A;  3C98 B;  4AKH A;  3IBP A;  4O4I E;  1BR0 A;  2VKO A;  2D0T A;  5LCY A;  2VWA A;  2H3R A;  5F3J A;  4EZ4 A;  1UCU A;  4XZC A;  2XAS B;  5HYA A;  2Y8D A;  1U4Q A;  5C8Y E;  3ONX A;  4PW8 A;  2BVM A;  4IST A;  4YJ3 E;  5HXH A;  1FMV A;  2WWU A;  4L0R A;  4OYK A;  4A56 A;  5LHG B;  5GON E;  3LJC A;  2YU1 A;  2IC9 A;  2ZM0 A;  4MFR A;  4PFO A;  4ERR A;  3MJX A;  4X1Y E;  3ZJ2 A;  3HKD E;  1US7 B;  3NRX A;  4DBQ A;  2ES0 A;  3AAE B;  4ADZ A;  4WBO A;  4F6R C;  4EXT A;  2Q9Q A;  2X68 A;  2V7I A;  3KV9 A;  5JR9 B;  5LBQ B;  2Q9Q D;  2WAU A;  5HXE A;  4E7S A;  2E9X B;  3HKC E;  2LOP A;  3KDS E;  4IE7 A;  3F57 A;  2BDE A;  2X9W A;  1HG5 A;  4PK6 A;  4O2A E;  5JVD E;  5HWY A;  2LM9 A;  3AB3 B;  2LSI A;  4HFV A;  3SS1 A;  2MBG A;  5JQG E;  5HWX A;  3OYZ A;  3I0O A;  4E7Z A;  5KMG P;  2CEA A;  2CLY C;  4BJM A;  1LVK A;  3K8P C;  3V5S A;  1YW0 A;  3CKD A;  2CWO A;  4HN9 A;  1QSD A;  5JDN A;  1EZ3 A;  2CE7 A;  4IIJ E;  1HS7 A;  5EZY E;  3LK3 B;  4TN7 B;  4JUY A;  4AKI A;  3N2K E;  4IDZ A;  5EK3 A;  5FY1 A;  2W00 A;  2YEV C;  3UUL A;  3LBX A;  3ZLI A;  3AAA B;  5L3C B;  4DMV A;  4H63 V;  5LJN A;  1ZV4 X;  2C0S A;  2MYS A;  4AKR B;  5FXX A;  3N2O A;  1D1A A;  1FIO A;  4OFZ A;  2NOX A;  4UF0 B;  1D0Y A;  4I50 E;  5E0O A;  2Y48 B;  3K3O A;  3P7I A;  1MNE A;  3KV6 A;  3KV5 A;  5JR9 A;  2B1E A;  1CUN A;  5DQV A;  2WBL A;  3I0Q A;  2E9X D;  4PJN A;  1ZEE A;  5LG4 A;  1BR2 A;  4YFS A;  4ASK A;  2LHR A;  4ZI2 C;  4H9R C;  3HA4 A;  3C4Z A;  2N9D A;  4X20 E;  4HE8 A;  4OK0 A;  2K48 A;  4HKA A;  3AA6 B;  2VAS A;  1IZN B;  3N9N A;  2ZMA A;  3RH3 A;  2ACX A;  4ZI2 D;  4P0B A;  4PJJ A;  5FXW A;  1MMN A;  2V7M A;  5LHI B;  5H6Q B;  1BR1 A;  5LOV E;  3VKG A;  2CXL A;  2CXD A;  4XAX B;  5JR9 C;  3BQI A;  3PDY A;  3UFE A;  3KBU A;  2IAK A;  2VL8 A;  3CML A;  5JDF A;  4ANJ A;  3E0Z A;  4QX7 B;  2L9Q A;  2X9H A;  3CX8 B;  4YHJ A;  3BK9 A;  3WAJ A;  5L3E B;  2V26 A;  2WSS V;  4PJM A;  4O4L E;  4QX8 B;  2JJ9 A;  3KVB A;  5FYM A;  2ZM2 A;  3HL6 A;  1YD8 G;  3Q2M A;  4I43 B;  1H7C A;  5EK4 A;  3QUJ A;  1HFA A;  2LSY A;  3MXZ A;  5L3B B;  4IE4 A;  1LRZ A;  3M65 A;  5HXC A;  3A5X A;  2WM9 A;  3SOL A;  5M4Y A;  3I1A A;  2J1D G;  3JC6 C;  4FI5 A;  2V7L A;  3UTK A;  2QA7 A;  2H7V C;  4JEH B;  2LSK A;  4QKN A;  4C91 A;  2V1D B;  3IEE A;  3RRW A;  5H6R B;  2W62 A;  2NP9 A;  3JC6 D;  2UXX B;  4GOU A;  2XAQ B;  4QXC B;  3T8O A;  3NRY A;  3NZP A;  2Z6E A;  3ZN0 B;  3EDU A;  2D0U A;  2RA1 A;  2PBI A;  3UUX B;  3VU7 H;  2LT3 A;  1HX8 A;  2ODV A;  4HEA A;  3ZYK A;  4PAG A;  1VOM A;  4U74 A;  3ZCJ A;  3DJB A;  2KWH A;  4AQF C;  2LOS A;  2VKJ A;  1WRD A;  4WBN E;  2XUE A;  3O1H A;  1NAF A;  1FEW A;  2A72 A;  4KBM B;  4UEL A;  1AJ3 A;  2KMF A;  2PFV A;  1E1H B;  2LEH A;  4AKL A;  4CI3 B;  3B57 A;  4KP3 C;  5LGU B;  4Z8X A;  3UUN A;  4CI2 B;  3ZMS B;  2Y6X A;  3AA7 B;  5LJM A;  5LNK A;  3RYC E;  3CX7 B;  2E9X C;  3FBL A;  3ZYM A;  4YLH A;  1HG2 A;  2KLQ A;  3RPU A;  2VK9 A;  3C4X A;  3F2E A;  5KDM C;  5AFU L;  1S35 A;  5JDM A;  5LXT E;  4CXY A;  3MK7 C;  3W15 B;  2XAH B;  5CA1 E;  5KX5 E;  2KWI B;  2PJQ A;  4IHJ E;  5FMN A;  5LHH B;  3PUR A;  4TUY E;  2CXF A;  4PK4 A;  3FXD B;  4H9Q C;  3R84 B;  5EK2 A;  3ZMT B;  3LFM A;  4QXH B;  2YIN A;  3BQL A;  2MOZ A;  3ZYL A;  4L9I A;  4ILU A;  1Z0P A;  1LKX A;  4DND A;  1QUU A;  3L3P A;  5BMV E;  1S94 A;  3KBT A;  3N9L A;  3AAI A;  4MHC A;  1OXZ A;  4H9N C;  3K3N A;  4UV9 B;  2YU2 A;  3WI3 A;  3MZK B;  4CI1 B;  4XBF B;  3GA8 A;  4U72 A;  1SA0 E;  3ETU A;  2DNX A;  4WW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...