4ZI2D

Bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
125
structure length
125
Chain Sequence
b'EDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 54
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi2D00
4ZI3C 2K9AA 4ZI3D 4ZI2C 4ZI2D
chains in the Genus database with same CATH superfamily
4JYAT 3EUHA 2VKOA 1D1BA 2NP9A 2W67A 2DI4A 3OYXA 1YXRA 2YN6A 3RKOA 2XQAA 1N34T 4JV5T 1MMDA 1WLXA 3A8YC 3UQ4A 1X9BA 2BBHA 5FVKA 1SUMB 2CPTA 5FY1A 4HFCA 3ESLA 2V7KA 4MFRA 2KINB 3I9WA 4U3CA 5HXCA 4EEBA 2KSRA 5LG4A 4HWFA 1VRBA 5FY7A 3F2EA 5EK4A 1I94T 4IDZA 4LFBT 1OXZA 3UUNA 2I6HA 3RI5A 2YU1A 4ZS3A 5LG3A 5J0ZA 1IBKT 5JREA 2X9WA 5KMGP 3LBXA 4IDNA 1S35A 3CX8B 1M62A 2V8SV 3IBPA 1FIOA 5TAOA 3AEFA 4IE4A 4HGAA 4QH4A 4YJ3E 4JBWF 5J2TE 2L9QA 4H9SE 2LHNA 3LFMA 1Z8UA 3ONJA 4EYUA 5M4YA 2HN2A 4EV6A 3PJAJ 4YLHA 4WYVA 2YKSA 2HH7A 3HKEE 3ZCIA 3S4UA 2CRBA 4DV3T 3RYIE 3BQKA 4JI3T 2V7IA 3AECA 4ASKA 2UUBT 1S94A 1XNQT 3JAFA 1HNXT 3W15B 2I0MA 1N36T 5AQTB 3RYFE 2YDRA 4ISTA 1UUSA 2XQ4A 2PJQA 4YTNA 4NXMT 1WYCA 1HG2A 3K3QC 5E0OA 2ACZA 3K3OA 2PBIA 4IT4A 1VCSA 3EDVA 1D1CA 2NOXA 3AVRA 4O4LE 5L4HA 1CHUA 4TNVA 5DABA 5LB7B 2WY2A 1E1HB 2HN1A 5JRCA 4PJNA 2LLYA 1IZNB 2XTLA 5LHHB 4K0KT 4YT0A 3LBXB 3P4PA 2AXDS 2XPKA 3SS1A 2LRLA 4NIQA 2KWHA 1QLBA 5JR9C 3G06A 2LSGA 5JR9B 1NWMX 2FJAA 3PJAA 5FXVA 1NEKA 5HEGA 3HKBE 3UTKA 4LFAT 2L3LA 4DR7T 1XDOA 2XAFB 4BA9A 5HCJA 2M6BA 5A1LA 4B3TT 3B13A 4IDQA 5LOVE 5AQSB 3E0ZA 3LK42 2X0LB 4ZZCA 4HFBA 3OTOT 3AA7B 3O1IA 3PUXF 2W63A 2J4GA 3JADA 2HHHT 2UUAT 4DV2T 2XM2A 4ILUA 3SOLA 4ZEYA 2VQFT 5CB4E 4KI0F 2WP9A 2D5UA 3VRAA 4X62T 5LGNB 2WBLA 4PK5A 3TLVA 3AEDA 5AQJB 2H3RA 4DR6T 4P09A 2CBIA 1IJ5A 5EK2A 2OA5A 3E08A 4XZCA 1MIYA 4ZHQE 3BK9A 4CI3B 2NW9A 2NWBA 4JLEA 1WYBA 3AAEB 5AQLB 4H9PC 2ODUA 3CWZB 2IC6A 1Y64B 2D2SA 1NENA 4A97A 1HNZT 4HFDA 2PFVA 3RIUA 4GK5E 3H37A 2LSJA 4PFOA 3SFDA 5AFUL 4B3RT 5LGTB 3RF1A 2JMKA 2YK0A 3AA6B 2C0SA 4TWFA 5AQQB 1HCIA 3EAMA 4KBMB 2QYWA 2M67A 3EDUA 1HFAA 2JJ9A 1HX1B 3DTOA 4IE7A 3N5LA 4F6RC 2V7MA 4I55E 2QA7A 3JAEA 3AE2A 3PUYF 2RP4A 1T7SA 4ZI3C 3M3ZB 4CQIA 1B7TA 1YQ4A 4C91A 2UU9T 4AQGA 2FJDA 2V7LA 5EK3A 3ZN0B 3RYHE 5JDGA 3AB3B 4NXNT 5L3GB 5BMVE 3CVRA 4HE8A 3RRCA 4HWDA 2ZM2A 3UU6A 1YKHB 2I59A 3RC3A 3FZFB 5LCYA 3ZJ2A 3F57A 4PNIA 3AE7A 3FZLB 2DLRA 3R84B 3RQWA 4CZZB 3Q5WA 2IC9A 3AE9A 4O4HE 2NW7A 2DWGA 4FJOA 2CBJA 1UX4A 1ZKEA 3HA4A 3ANWB 1D0XA 3MXZA 3QOFA 2WMOA 5L3EB 5HXEA 4L0RA 2ZM6T 3FB2A 2X68A 4MBQA 4PJLA 4ZI3D 2WDVA 1WRDA 1UCUA 1OEDA 2P9BA 3HL6A 2Q9QA 3OKQA 5H6RB 1BR1A 2CE7A 2XY8B 2XM1A 4AIUA 2LT3A 4C90A 1HR0T 3VKHA 4TWHA 3N9OA 2UUCT 4JI8T 4JUYA 2XQ5A 3CIRA 2IUBA 2K24A 2WZIA 3OBVE 2R6GF 4JEHB 2A9UA 5C2TA 5AQNB 1T98A 1IBLT 2KWIB 4ZI2C 2WAUA 2BKNA 3PUWF 4B3ST 2BVMA 5FKYA 1IAPA 5ABEA 1YD8G 2C5IT 2WB5A 2CHOA 2V5DA 3Q5EA 4AQFC 3OJAA 1HTJF 5L2LA 2IAKA 3O1HA 1D0YA 1MIVA 1NAFA 5LNKA 2MOZA 1EZ3A 1Y01A 1BR0A 2B1EA 4E7ZA 3SRZA 4TZ4C 4O2BE 4PK4A 4DIDB 1OWAA 3HKDE 4ZOLE 3C4WA 1HNWT 4WZXA 3OYZA 4DR1T 4CI1B 3L09A 2Y48B 2QVAA 2F4VT 5LMUT 5J1GA 3VR8A 4ZI2D 4EAHA 3CK6A 2V26A 3P4RA 2Q9QC 2J1DG 4U7IA 2Q9QB 2XAGB 2LJLA 2A3DA 1XZYA 2V6YA 4X1KE 3F31A 5AQIB 2W62A 3LSVA 4LF6T 3AA1B 5FYMA 2VL0A 4GIWA 5LP6E 3RLFF 3K3NA 2XQ8A 3FZMB 1KNZA 2JQKA 4IHJE 4PAGA 5FL1A 3KINB 2BG9E 5DJQC 4AKRB 3Q9DA 4HWCA 3MK7C 2OV9A 5LJMA 4P0AA 2X9YA 4GYSA 3LJCA 3BQLA 4DO0A 3RH3A 4U2YA 3AEGA 4X1YE 2MAWA 2XZEA 2Q9QD 2GK9A 1MMNA 5AQGB 2XAJB 1SE7A 2BG9C 3KV5A 1D0ZA 2BG9B 3RRWA 2BS4A 4WBNE 4DVDA 3VU7H 2YEVC 4ISSA 2YU2A 3UFGA 3GWHA 4TV8E 3ZMTB 4H9OC 3V5SA 1HF8A 4ZS2A 4HKAA 2JQ9A 3N2OA 2XASB 2RPAA 3RHWA 3P7IA 5DQVA 3TLWA 4OK0A 2V6YB 5FXWA 3ZC0A 3KFWX 3J7Yq 2H7VC 4ERRA 4EZ4A 1UGOA 4GYRA 3MA9A 1HX8A 4PJMA 3P4QA 3MACA 5IHYA 3KBTA 2CCQA 3CKDA 4LF5T 4QH1A 3P4WA 3IF8B 4JI2T 4GK0E 4YSZA 4TX5A 4DV5T 2E2AA 2YDSA 1N33T 4UVAB 5AQFB 2NR4A 3ZSSA 5L4EA 3RIFA 2E8IA 5AQPB 5BR8T 4G2AA 2E9XA 4HFEA 4YTPA 2DCFA 1LVKA 4HFIA 2JPFA 3AE6A 3AXJA 5H6QB 4YHHT 2WZHA 3QC9A 1J5ET 4KUMB 2VURA 2IDOB 1Z0PA 3GN5A 4YY3T 5C3JA 3I1AA 3WAKA 4PK6A 5L3CB 2L8KA 4DMWA 4HFHA 4Z8XA 4DV7T 5HWYA 2W0GA 2OLTA 5LA6E 3X1DA 1MMGA 2BDEA 3P4SA 3ZSTA 2J62A 1LKXA 4HN9A 3KDSE 5F8PA 4JI5T 4DNDA 2LKHA 2NTYA 4NUVA 4E7SA 2H7OA 1SHZC 1D1AA 4OHFA 5FL0A 3PUVF 5FXZA 4MLKA 2VKJA 5JQGE 3R6NA 4CXWA 2LM9A 4A98A 2K3WA 5L3BB 2N9DA 3HKCE 3RPUA 1ZOYA 2MPKA 5ABHA 4IDPA 2E9XC 1YKEB 2VK9A 2E9XB 3PTRB 1W0AA 2KLQA 3ZPOA 5JRCB 1BR2A 3CMLA 4U31A 1KF6A 5LXTE 2JRKA 4IL4A 2ZMAA 4AKIA 2QGSA 4AI6A 5HXHA 1XDPA 4Z91A 2D0TA 4CN6A 2BS3A 3A5XA 1FMVA 3J9X1 1KNRA 2RA1A 1V9DA 3N9NA 2X0HA 3TKLB 3L8RA 3O1JA 3UU8A 1MNEA 2CEAA 2MBGA 3P50A 1I6ZA 3DP7A 3C64A 5ABFA 2Y8DA 3UU4A 4B6XA 4B3MT 1KFYA 3WAJA 5HEHA 2IHR1 3FZKB 2WS3A 3N9QA 3ZN1B 1J1JA 3L3PA 1XWMA 3N9MA 3PDYA 2NTXA 2E9XD 3PUGA 4EIWA 5JTGA 3ZYKA 5GONE 4KHPT 2YOEA 2E5VA 2XQ3A 3ZMSB 1UX5A 2KNDA 4U72A 3O4XE 4QWNB 1WR0A 4L9IA 3AAAB 3WI3A 5LHIB 5J2UE 4DR5T 4AQYT 1ZHCA 1FEWA 4UELA 3N2KE 4IIJE 2D0UA 2LRKA 5JDMA 5JDFA 2VVSA 3RIAA 4H63V 2WDRA 4DR4T 5ABGA 4YTMA 5HEJA 4COFA 5L47A 1YW0A 2XQYA 2IW5B 5AQKB 1T72A 3CQXC 5LGUB 4JEUB 4QKNA 4EB6E 3PUQA 5DQWA 2E5LT 4FI5A 4ILCA 5AQMB 3TLSA 1FMWA 1QUUA 5ADXL 2X67A 1MMAA 3RIUC 4J2CA 2X66A 2K5BB 3AEAA 1O3XA 2ZM0A 5KX5E 5KDMC 4M1PA 2W61A 3UU3A 3AA0B 4DV0T 5L3FB 3Q5DA 2XUEA 2VB6A 1KNPA 2A2FX 3U3IA 1E7PA 3PURA 3ZYMA 1CUNA 4NPPA 3A7MA 5JH7E 4MALA 5CFBA 3N9PA 4QHOA 1W0BA 2V7JA 3NRXA 5JDNA 1ZP0A 2WSSV 1ZEEA 4X1IE 2M6IA 4QXBB 4LF4T 2K48A 4X66T 2V6XA 1KEYA 3RKGA 3UQ7A 2CM0A 3ZLIA 3ZJ1A 2DWKA 4KX6A 5JDQA 2C5JA 2QRXA 2ACXA 3CQGB 3C50A 2AE9A 3FZHB 4KMCA 2FJEA 3M65A 2LHRA 4LMLA 4IE5A 4U33A 3LK2B 2XSAA 3ZEFB 4TV9E 3PU8A 3ZC1A 4H9QC 4UV9B 2WMNA 3TLUA 4GOUA 1OEDE 2DHRA 4OX9T 2CMRA 4ZI7E 4ZXLA 4X5TA 3ZKRA 4YSXA 2BBJA 3NVOA 1G73A 3D0TA 4O2AE 2ZM8A 3CX6B 3DJBA 3FBZA 5CA1E 2DL1A 2H88A 1XMQT 2CWYA 3AAIA 3ZYLA 1OEDC 1OEDB 2WDQA 1U5PA 5LYJE 2WCAA 2PG8A 2EHOA 3NWIA 2WQYA 3SFEA 1GQEA 4LMJA 4IGUA 4QXHB 3AEBA 4AISA 3FXEB 2CXDA 5JVDE 5FXXA 4TUYE 5IUXA 4GKJT 2WM9A 2XQ6A 4DV1T 3I0QA 2ES0A 3MZKB 1IJ6A 4ADZA 2D9DA 1VOMA 4DV6T 4OYJA 3P8CD 2CXLA 4N78D 3UUBA 1XMOT 3N2GE 4HEAA 4EEDA 3UUMA 4DBRA 4U74A 4ILBA 3IHRA 3EABA 2G0UA 4O8SA 4UV8B 5JDHA 4XAXB 4LFCT 4HWHA 4TNWA 3RQUA 3KV6A 2WU5A 4CXXA 5F3JA 4QH5A 2JQQA 4TN7B 4UVCB 4YJ2E 5AQHB 3UULA 3ZMUB 4UEMA 5LMNT 3B57A 3AE1A 2CWOA 4AXPA 5IYZE 5HAXA 2SPCA 2EHOC 4HTEA 5HWXA 2EHOB 2DNXA 2V1DB 2WU2A 5JR9A 3C98B 3KV9A 5CGMA 5KXJA 3GMIA 2K9AA 3SWHA 5F5WA 5ETWA 4BAYB 1BR4A 4DR3T 2VVNA 1T8BA 2WWUA 4HFVA 3ZMZB 2JQHA 3FHNA 4H63H 2UXXB 1WCRA 4O4IE 3ZT7A 2LE8A 4X20E 3NZQA 3L39A 1JNZA 2V5CA 3AE4A 1DU2A 5AQVB 3IEEA 3CX7B 2LSYA 4I50E 4CN4A 2XJ7A 4PJJA 3KVBA 4PFPA 3FXDB 4L5GA 4DV4T 4NUUA 2LOSA 2HPJA 1XNRT 2XHEB 4JI0T 3MJXA 4IDOA 5FVLA 5HYAA 2EHOD 1G8XA 2HPLA 2ZLYA 1MIWA 1FJGT 5FY0A 3NRYA 3QB5K 3ETUA 5LBMA 4IE0A 4JI6T 3U78A 3VR9A 3I9YA 2BKOA 3QB5A 3ZT5A 1VCTA 3BQIA 2Z6EA 3AE5A 3GA8A 1W09A 3EVYA 3C4XA 3TLTA 4ANJA 2X0YA 3VRBA 3AVSA 2YINA 3PV0F 4DBQA 2UXCT 2VKDA 5CA0E 3LG7A 4XBFB 2W4XA 4OFZA 3E22E 2VWAA 4QX8B 2X51A 4K0UA 3ZT6A 5FP3A 3UT5E 3KBUA 1YQ3A 2X9HA 4UR9A 1UURA 3IA3A 3K8PC 2VQET 3QUJA 1UK5A 4YHJA 4QXCB 3ETVA 2N1GA 2MYSA 3JC6C 1WR6A 5AQUB 3N9LA 2NW8A 3EI0A 3Q5XA 3AXJB 2UXBT 5LJNA 3T1YT 1W9RA 3QNUA 3C51A 2XAQB 4DUZT 3GN5B 1SA0E 3ONLC 5JDLA 4WNKA 1LVFA 3JCFA 2UXNB 4CXYA 4H9NC 4I0UA 1QSDA 3LDQB 4F8HA 4OYKA 2LKGA 2LOPA 4JI7T 2VL8A 2W2UA 2LSIA 5IWAT 3H3AA 3UFEA 4EOZB 2XSBA 2PTFA 3EHZA 2KZ7B 3ANWA 3OPCA 1WFDA 4P0BA 4QX7B 3UUXB 2H89A 3ONXA 2FBWA 4DR2T 2KMFA 3JC6D 3K1SA 5CJ5A 3LK3B 3OVUA 4G63A 2LEHA 3H3MA 3PU3A 2FUPA 3RYCE 3I0OA 2LM2A 4JI4T 2IMLA 3NKZA 4PW8A 1KK7A 4Q25A 4X64T 1U4QA 2VASA 4YXDA 5HEUA 1IBMT 2A72A 1H7CA 2JMHA 2KT9A 2VKHA 3RC8A 3ZCJA 2Y6XA 4UXNB 4MHCA 2IIUA 4BJMA 4U7YA 2WWVA 3HI2A 5HXSA 3PUZF 5AQRB 5FNVE 3CQCB 2J47A 4WBOA 2X9XA 2B76A 4AQFA 3ABVA 2XQ7A 5C8YE 2W00A 3KV4A 3C4ZA 3HR0A 4UF0A 1N32T 3RGLA 2XAHB 5ABFB 3O9XA 5LBQB 2CA5A 2N2NA 5AQOB 3UU5A 4CN1A 4GKKT 4HWIB 4JI1T 3ZMVB 4KP3C 2LSKA 2CXFA 4WW0A 3NZPA 4UVBB 4DUYT 3KVAA 4EZHA 3AE8A 4U2ZA 1AJ3A 2C5KT 1M7KA 3FBLA 4ZZBA 2YDQA 3NBXX 4A5XA 3T8OA 3RX6A 3Q2MA 2CLYC 4LF7T 2BKPA 2CLYB 2CHNA 1HG5A 1HS7A 4ILAA 4O4JE 3PUAA 5LHGB 1US7B 1MNDA 4Z90A 4H9RC 4BJNA 5EZYE 4AKLA 3QK6A 4AKGA 4DMVA 2FJBA 3V5UA 3VKGA 2BVLA 4TWDA 2UXDT 3AEEA 4IL9A 4A56A 4KHZF 4YSYA 3PE0A 4CI2B 2BZBA 4LF8T 4EYYR 3VHLA 2W66A 5HXRA 2KXPB 1E2AA 4X65T 1JNRA 3AE3A 3PUSA 4UF0B 1X79A 2MTQA 1ZV4X 2XQ9A 1L0VA 4I43B 4YFSA 4P1NA 4V1Av 2ODVA 2BS2A 3T1HT 4LMKA 4EXTA 4EGWA 5FMNA 4IREA 3MKDA 2JIWA 5HCMA 4UIGA 2BG9A 1LRZA 1J5WA 5HEOA 4LF9T 5L3DB 4I4TE 4AKHA 4IE6A 3B5MA 3CPZA 1R8IA
chains in the Genus database with same CATH topology
5JRCB 2LSYA 2VKOA 3EUHA 1UX4A 1ZKEA 3HA4A 4I50E 1D1BA 1BR2A 3CMLA 3ANWB 1D0XA 3MXZA 2NP9A 2WMOA 5L3EB 4PJJA 5HXEA 2DI4A 5LXTE 4L0RA 3OYXA 3KVBA 3FB2A 4PFPA 2X68A 3FXDB 4L5GA 4MBQA 2JRKA 4PJLA 3RKOA 4ZI3D 2ZMAA 4AKIA 2QGSA 4NUUA 4AI6A 2LOSA 1MMDA 1WLXA 2HPJA 2XHEB 5HXHA 2D0TA 3MJXA 3A5XA 1FMVA 3J9X1 2RA1A 1V9DA 3N9NA 3TKLB 5HYAA 1WRDA 3O1JA 1UCUA 1MNEA 2EHOD 2CEAA 2P9BA 5FY1A 1G8XA 2MBGA 3HL6A 3ESLA 2HPLA 2ZLYA 1MIWA 3DP7A 2Q9QA 2V7KA 3OKQA 4MFRA 3C64A 5H6RB 2KINB 2Y8DA 3I9WA 5FY0A 3NRYA 1BR1A 4B6XA 2CE7A 2LT3A 3WAJA 3ETUA 4C90A 5LBMA 3VKHA 3N9OA 3N9QA 5HXCA 3ZN1B 4IE0A 3U78A 3L3PA 4JUYA 5LG4A 3I9YA 1VRBA 2K24A 5FY7A 3OBVE 3BQIA 3F2EA 2Z6EA 4JEHB 5EK4A 1T98A 3GA8A 2KWIB 3EVYA 2WAUA 3N9MA 3PDYA 3C4XA 1OXZA 2NTXA 4IDZA 2BVMA 2E9XD 3UUNA 4ANJA 2YU1A 1IAPA 3PUGA 4EIWA 4ZS3A 4ZI2C 1YD8G 2C5IT 3AVSA 5GONE 3ZYKA 2YINA 3OJAA 4AQFC 1HTJF 4DBQA 5JREA 3ZMSB 5L2LA 2X9WA 5KMGP 3LBXA 1UX5A 2IAKA 2VKDA 5CA0E 2KNDA 3O1HA 1S35A 3LG7A 4U72A 4XBFB 3CX8B 1D0YA 3O4XE 4QWNB 1MIVA 3IBPA 1FIOA 4OFZA 1NAFA 5TAOA 5LNKA 4L9IA 4IE4A 3AAAB 3WI3A 3E22E 5LHIB 5J2UE 2MOZA 2VWAA 1EZ3A 1BR0A 2B1EA 4HGAA 4QX8B 1ZHCA 2X51A 4K0UA 4YJ3E 1FEWA 4E7ZA 5J2TE 3SRZA 4UELA 2L9QA 4H9SE 5FP3A 4TZ4C 3N2KE 2LHNA 4O2BE 4PK4A 4IIJE 2D0UA 3LFMA 3UT5E 5JDMA 5JDFA 4EYUA 5M4YA 4H63V 1OWAA 3KBUA 3HKDE 1YW0A 4ZOLE 2X9HA 3C4WA 2XQYA 4YLHA 2IW5B 2HH7A 3OYZA 3HKEE 3ZCIA 3K8PC 3S4UA 3QUJA 3CQXC 5LGUB 4JEUB 4QKNA 4YHJA 4EB6E 4CI1B 3PUQA 4QXCB 3ETVA 4FI5A 5DQWA 3RYIE 1FMWA 1QUUA 2N1GA 5ADXL 2MYSA 3JC6C 3L09A 3BQKA 1WR6A 2X67A 1MMAA 2V7IA 4ASKA 3N9LA 4J2CA 2NW8A 2Y48B 2X66A 2K5BB 3Q5XA 1O3XA 2ZM0A 1S94A 5KX5E 5KDMC 5LJNA 5J1GA 4ZI2D 4EAHA 3W15B 4M1PA 2W61A 2V26A 3AA0B 3C51A 2Q9QC 2J1DG 5L3FB 2Q9QB 2XAGB 2XUEA 2LJLA 2XAQB 2A3DA 2VB6A 3GN5B 2A2FX 1SA0E 3U3IA 5JDLA 3PURA 4WNKA 4X1KE 1CUNA 1LVFA 3ZYMA 3RYFE 2UXNB 4CXYA 4H9NC 1QSDA 3F31A 4ISTA 5JH7E 2W62A 2PJQA 4MALA 3N9PA 4QHOA 1WYCA 1HG2A 3K3QC 3AA1B 4OYKA 2V7JA 3NRXA 5E0OA 5FYMA 4GIWA 5LP6E 3K3OA 2LOPA 2PBIA 5JDNA 2VL8A 3K3NA 2LSIA 2WSSV 1ZEEA 3EDVA 1D1CA 2NOXA 3AVRA 4O4LE 3H3AA 1KNZA 4X1IE 5DABA 4QXBB 3UFEA 4EOZB 4IHJE 4PAGA 1E1HB 3KINB 5JRCA 4PJNA 2K48A 1IZNB 2XTLA 5LHHB 2KZ7B 3ANWA 3LBXB 4P0BA 4QX7B 3UUXB 5DJQC 2CM0A 4AKRB 3Q9DA 3MK7C 3ZLIA 3ZJ1A 2DWKA 3ONXA 5JDQA 5LJMA 4P0AA 2X9YA 3SS1A 2C5JA 2ACXA 2KWHA 2KMFA 3C50A 3CQGB 3JC6D 4KMCA 5JR9C 2LSGA 1NWMX 3M65A 2LHRA 4GYSA 3LK3B 5FXVA 5JR9B 3LJCA 3BQLA 3HKBE 4IE5A 3UTKA 4DO0A 2L3LA 3RH3A 4G63A 2LEHA 2XAFB 3LK2B 3ZEFB 4BA9A 3PU3A 4TV9E 4X1YE 5A1LA 3RYCE 3B13A 3I0OA 3PU8A 3ZC1A 2Q9QD 2GK9A 4H9QC 1MMNA 5LOVE 3E0ZA 2XAJB 4UV9B 2WMNA 3LK42 4GOUA 2X0LB 4PW8A 1KK7A 3KV5A 1D0ZA 1U4QA 2VASA 3RRWA 2DHRA 3AA7B 4WBNE 3O1IA 4DVDA 3VU7H 2A72A 2W63A 1H7CA 2CMRA 2YEVC 4ISSA 2YU2A 2JMHA 2KT9A 2VKHA 4ZI7E 3GWHA 3RC8A 4TV8E 3ZCJA 4ILUA 2Y6XA 3IEEA 3SOLA 3ZMTB 4H9OC 3V5SA 1HF8A 5CB4E 4ZS2A 4UXNB 4MHCA 4HKAA 4BJMA 1G73A 3N2OA 3D0TA 2XASB 2D5UA 4O2AE 3HI2A 2ZM8A 3CX6B 3DJBA 5HXSA 5LGNB 5FNVE 3CQCB 2WBLA 3P7IA 4WBOA 5DQVA 3FBZA 5CA1E 4OK0A 2X9XA 4AQFA 4PK5A 5FXWA 2H3RA 3ZC0A 3KFWX 3J7Yq 2CWYA 2H7VC 4ERRA 3AAIA 4EZ4A 4P09A 5C8YE 3ZYLA 2W00A 4GYRA 1IJ5A 3KV4A 5EK2A 3C4ZA 1U5PA 5LYJE 3HR0A 2PG8A 2OA5A 3E08A 1HX8A 3MA9A 4PJMA 2EHOA 3MACA 4XZCA 4UF0A 5IHYA 1MIYA 4ZHQE 2XAHB 3KBTA 2CCQA 3CKDA 4IGUA 4QXHB 3IF8B 3BK9A 4GK0E 3O9XA 5LBQB 4CI3B 2CA5A 2N2NA 3FXEB 2NW9A 2CXDA 4TX5A 2NWBA 4JLEA 5JVDE 1WYBA 5FXXA 4TUYE 3AAEB 4H9PC 2WM9A 3ZMVB 2ODUA 4UVAB 3CWZB 4KP3C 2LSKA 2IC6A 3I0QA 1Y64B 2D2SA 2ES0A 2CXFA 2E8IA 3MZKB 4WW0A 3NZPA 4UVBB 1IJ6A 4ADZA 3KVAA 4EZHA 1VOMA 4G2AA 2E9XA 4OYJA 2DCFA 1LVKA 2PFVA 3P8CD 2CXLA 2C5KT 1AJ3A 3FBLA 2JPFA 4GK5E 3H37A 3NBXX 2LSJA 4PFOA 4N78D 5AFUL 5H6QB 3T8OA 3N2GE 3Q2MA 3RX6A 2CLYC 5LGTB 3QC9A 2CLYB 4KUMB 4HEAA 1HG5A 1Z0PA 2JMKA 3GN5A 2YK0A 3UUMA 4DBRA 3I1AA 3WAKA 1HS7A 4PK6A 3AA6B 2C0SA 4U74A 4O4JE 3PUAA 5L3CB 1HCIA 5LHGB 1US7B 3IHRA 2L8KA 2G0UA 4KBMB 1MNDA 4O8SA 4H9RC 2M67A 4DMWA 4UV8B 4BJNA 3EDUA 5JDHA 1HFAA 5EZYE 4XAXB 4Z8XA 2JJ9A 4AKLA 3QK6A 5HWYA 3DTOA 4AKGA 3KV6A 4DMVA 4IE7A 3V5UA 4CXXA 3N5LA 2W0GA 4F6RC 5F3JA 2V7MA 4I55E 2QA7A 2JQQA 4TN7B 3VKGA 5LA6E 4UVCB 4YJ2E 1MMGA 2RP4A 2BDEA 3UULA 3ZMUB 2BVLA 1LKXA 4HN9A 4ZI3C 4UEMA 3KDSE 5F8PA 4A56A 4CQIA 4DNDA 1B7TA 3B57A 4C91A 2CWOA 3PE0A 5HWXA 4CI2B 4AQGA 2BZBA 4AXPA 5IYZE 4EYYR 2NTYA 4NUVA 4E7SA 3VHLA 5HAXA 2H7OA 2SPCA 2KXPB 5HXRA 1SHZC 2EHOC 2V7LA 4HTEA 5EK3A 2EHOB 2DNXA 2V1DB 3PUSA 3RYHE 3ZN0B 1D1AA 4OHFA 4UF0B 5JR9A 1X79A 3AB3B 5JDGA 2MTQA 1ZV4X 3C98B 5L3GB 5BMVE 3KV9A 4I43B 3CVRA 4HE8A 5FXZA 4YFSA 3RRCA 3GMIA 4MLKA 2VKJA 2K9AA 4V1Av 2ODVA 2ZM2A 3SWHA 5ETWA 4BAYB 5JQGE 1YKHB 2I59A 1BR4A 3R6NA 3RC3A 4CXWA 2WWUA 4HFVA 3ZMZB 2LM9A 5LCYA 3FHNA 5L3BB 3ZJ2A 4EXTA 3F57A 5FMNA 3MKDA 4H63H 4PNIA 2N9DA 2UXXB 3HKCE 3RPUA 2DLRA 4O4IE 3R84B 2LE8A 4X20E 4CZZB 3NZQA 4UIGA 1LRZA 3Q5WA 2IC9A 5L3DB 2E9XC 1YKEB 4O4HE 4I4TE 4AKHA 2VK9A 2E9XB 3PTRB 2NW7A 4IE6A 3CPZA 2DWGA 4FJOA 2KLQA 3CX7B 3ZPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI3 C;  2K9A A;  4ZI3 D;  4ZI2 C;  4ZI2 D; 
#chains in the Genus database with same CATH topology
 4JYA T;  3EUH A;  2VKO A;  1D1B A;  2NP9 A;  2W67 A;  2DI4 A;  3OYX A;  1YXR A;  2YN6 A;  3RKO A;  2XQA A;  1N34 T;  4JV5 T;  1MMD A;  1WLX A;  3A8Y C;  3UQ4 A;  1X9B A;  2BBH A;  5FVK A;  1SUM B;  2CPT A;  5FY1 A;  4HFC A;  3ESL A;  2V7K A;  4MFR A;  2KIN B;  3I9W A;  4U3C A;  5HXC A;  4EEB A;  2KSR A;  5LG4 A;  4HWF A;  1VRB A;  5FY7 A;  3F2E A;  5EK4 A;  1I94 T;  4IDZ A;  4LFB T;  1OXZ A;  3UUN A;  2I6H A;  3RI5 A;  2YU1 A;  4ZS3 A;  5LG3 A;  5J0Z A;  1IBK T;  5JRE A;  2X9W A;  5KMG P;  3LBX A;  4IDN A;  1S35 A;  3CX8 B;  1M62 A;  2V8S V;  3IBP A;  1FIO A;  5TAO A;  3AEF A;  4IE4 A;  4HGA A;  4QH4 A;  4YJ3 E;  4JBW F;  5J2T E;  2L9Q A;  4H9S E;  2LHN A;  3LFM A;  1Z8U A;  3ONJ A;  4EYU A;  5M4Y A;  2HN2 A;  4EV6 A;  3PJA J;  4YLH A;  4WYV A;  2YKS A;  2HH7 A;  3HKE E;  3ZCI A;  3S4U A;  2CRB A;  4DV3 T;  3RYI E;  3BQK A;  4JI3 T;  2V7I A;  3AEC A;  4ASK A;  2UUB T;  1S94 A;  1XNQ T;  3JAF A;  1HNX T;  3W15 B;  2I0M A;  1N36 T;  5AQT B;  3RYF E;  2YDR A;  4IST A;  1UUS A;  2XQ4 A;  2PJQ A;  4YTN A;  4NXM T;  1WYC A;  1HG2 A;  3K3Q C;  5E0O A;  2ACZ A;  3K3O A;  2PBI A;  4IT4 A;  1VCS A;  3EDV A;  1D1C A;  2NOX A;  3AVR A;  4O4L E;  5L4H A;  1CHU A;  4TNV A;  5DAB A;  5LB7 B;  2WY2 A;  1E1H B;  2HN1 A;  5JRC A;  4PJN A;  2LLY A;  1IZN B;  2XTL A;  5LHH B;  4K0K T;  4YT0 A;  3LBX B;  3P4P A;  2AXD S;  2XPK A;  3SS1 A;  2LRL A;  4NIQ A;  2KWH A;  1QLB A;  5JR9 C;  3G06 A;  2LSG A;  5JR9 B;  1NWM X;  2FJA A;  3PJA A;  5FXV A;  1NEK A;  5HEG A;  3HKB E;  3UTK A;  4LFA T;  2L3L A;  4DR7 T;  1XDO A;  2XAF B;  4BA9 A;  5HCJ A;  2M6B A;  5A1L A;  4B3T T;  3B13 A;  4IDQ A;  5LOV E;  5AQS B;  3E0Z A;  3LK4 2;  2X0L B;  4ZZC A;  4HFB A;  3OTO T;  3AA7 B;  3O1I A;  3PUX F;  2W63 A;  2J4G A;  3JAD A;  2HHH T;  2UUA T;  4DV2 T;  2XM2 A;  4ILU A;  3SOL A;  4ZEY A;  2VQF T;  5CB4 E;  4KI0 F;  2WP9 A;  2D5U A;  3VRA A;  4X62 T;  5LGN B;  2WBL A;  4PK5 A;  3TLV A;  3AED A;  5AQJ B;  2H3R A;  4DR6 T;  4P09 A;  2CBI A;  1IJ5 A;  5EK2 A;  2OA5 A;  3E08 A;  4XZC A;  1MIY A;  4ZHQ E;  3BK9 A;  4CI3 B;  2NW9 A;  2NWB A;  4JLE A;  1WYB A;  3AAE B;  5AQL B;  4H9P C;  2ODU A;  3CWZ B;  2IC6 A;  1Y64 B;  2D2S A;  1NEN A;  4A97 A;  1HNZ T;  4HFD A;  2PFV A;  3RIU A;  4GK5 E;  3H37 A;  2LSJ A;  4PFO A;  3SFD A;  5AFU L;  4B3R T;  5LGT B;  3RF1 A;  2JMK A;  2YK0 A;  3AA6 B;  2C0S A;  4TWF A;  5AQQ B;  1HCI A;  3EAM A;  4KBM B;  2QYW A;  2M67 A;  3EDU A;  1HFA A;  2JJ9 A;  1HX1 B;  3DTO A;  4IE7 A;  3N5L A;  4F6R C;  2V7M A;  4I55 E;  2QA7 A;  3JAE A;  3AE2 A;  3PUY F;  2RP4 A;  1T7S A;  4ZI3 C;  3M3Z B;  4CQI A;  1B7T A;  1YQ4 A;  4C91 A;  2UU9 T;  4AQG A;  2FJD A;  2V7L A;  5EK3 A;  3ZN0 B;  3RYH E;  5JDG A;  3AB3 B;  4NXN T;  5L3G B;  5BMV E;  3CVR A;  4HE8 A;  3RRC A;  4HWD A;  2ZM2 A;  3UU6 A;  1YKH B;  2I59 A;  3RC3 A;  3FZF B;  5LCY A;  3ZJ2 A;  3F57 A;  4PNI A;  3AE7 A;  3FZL B;  2DLR A;  3R84 B;  3RQW A;  4CZZ B;  3Q5W A;  2IC9 A;  3AE9 A;  4O4H E;  2NW7 A;  2DWG A;  4FJO A;  2CBJ A;  1UX4 A;  1ZKE A;  3HA4 A;  3ANW B;  1D0X A;  3MXZ A;  3QOF A;  2WMO A;  5L3E B;  5HXE A;  4L0R A;  2ZM6 T;  3FB2 A;  2X68 A;  4MBQ A;  4PJL A;  4ZI3 D;  2WDV A;  1WRD A;  1UCU A;  1OED A;  2P9B A;  3HL6 A;  2Q9Q A;  3OKQ A;  5H6R B;  1BR1 A;  2CE7 A;  2XY8 B;  2XM1 A;  4AIU A;  2LT3 A;  4C90 A;  1HR0 T;  3VKH A;  4TWH A;  3N9O A;  2UUC T;  4JI8 T;  4JUY A;  2XQ5 A;  3CIR A;  2IUB A;  2K24 A;  2WZI A;  3OBV E;  2R6G F;  4JEH B;  2A9U A;  5C2T A;  5AQN B;  1T98 A;  1IBL T;  2KWI B;  4ZI2 C;  2WAU A;  2BKN A;  3PUW F;  4B3S T;  2BVM A;  5FKY A;  1IAP A;  5ABE A;  1YD8 G;  2C5I T;  2WB5 A;  2CHO A;  2V5D A;  3Q5E A;  4AQF C;  3OJA A;  1HTJ F;  5L2L A;  2IAK A;  3O1H A;  1D0Y A;  1MIV A;  1NAF A;  5LNK A;  2MOZ A;  1EZ3 A;  1Y01 A;  1BR0 A;  2B1E A;  4E7Z A;  3SRZ A;  4TZ4 C;  4O2B E;  4PK4 A;  4DID B;  1OWA A;  3HKD E;  4ZOL E;  3C4W A;  1HNW T;  4WZX A;  3OYZ A;  4DR1 T;  4CI1 B;  3L09 A;  2Y48 B;  2QVA A;  2F4V T;  5LMU T;  5J1G A;  3VR8 A;  4ZI2 D;  4EAH A;  3CK6 A;  2V26 A;  3P4R A;  2Q9Q C;  2J1D G;  4U7I A;  2Q9Q B;  2XAG B;  2LJL A;  2A3D A;  1XZY A;  2V6Y A;  4X1K E;  3F31 A;  5AQI B;  2W62 A;  3LSV A;  4LF6 T;  3AA1 B;  5FYM A;  2VL0 A;  4GIW A;  5LP6 E;  3RLF F;  3K3N A;  2XQ8 A;  3FZM B;  1KNZ A;  2JQK A;  4IHJ E;  4PAG A;  5FL1 A;  3KIN B;  2BG9 E;  5DJQ C;  4AKR B;  3Q9D A;  4HWC A;  3MK7 C;  2OV9 A;  5LJM A;  4P0A A;  2X9Y A;  4GYS A;  3LJC A;  3BQL A;  4DO0 A;  3RH3 A;  4U2Y A;  3AEG A;  4X1Y E;  2MAW A;  2XZE A;  2Q9Q D;  2GK9 A;  1MMN A;  5AQG B;  2XAJ B;  1SE7 A;  2BG9 C;  3KV5 A;  1D0Z A;  2BG9 B;  3RRW A;  2BS4 A;  4WBN E;  4DVD A;  3VU7 H;  2YEV C;  4ISS A;  2YU2 A;  3UFG A;  3GWH A;  4TV8 E;  3ZMT B;  4H9O C;  3V5S A;  1HF8 A;  4ZS2 A;  4HKA A;  2JQ9 A;  3N2O A;  2XAS B;  2RPA A;  3RHW A;  3P7I A;  5DQV A;  3TLW A;  4OK0 A;  2V6Y B;  5FXW A;  3ZC0 A;  3KFW X;  3J7Y q;  2H7V C;  4ERR A;  4EZ4 A;  1UGO A;  4GYR A;  3MA9 A;  1HX8 A;  4PJM A;  3P4Q A;  3MAC A;  5IHY A;  3KBT A;  2CCQ A;  3CKD A;  4LF5 T;  4QH1 A;  3P4W A;  3IF8 B;  4JI2 T;  4GK0 E;  4YSZ A;  4TX5 A;  4DV5 T;  2E2A A;  2YDS A;  1N33 T;  4UVA B;  5AQF B;  2NR4 A;  3ZSS A;  5L4E A;  3RIF A;  2E8I A;  5AQP B;  5BR8 T;  4G2A A;  2E9X A;  4HFE A;  4YTP A;  2DCF A;  1LVK A;  4HFI A;  2JPF A;  3AE6 A;  3AXJ A;  5H6Q B;  4YHH T;  2WZH A;  3QC9 A;  1J5E T;  4KUM B;  2VUR A;  2IDO B;  1Z0P A;  3GN5 A;  4YY3 T;  5C3J A;  3I1A A;  3WAK A;  4PK6 A;  5L3C B;  2L8K A;  4DMW A;  4HFH A;  4Z8X A;  4DV7 T;  5HWY A;  2W0G A;  2OLT A;  5LA6 E;  3X1D A;  1MMG A;  2BDE A;  3P4S A;  3ZST A;  2J62 A;  1LKX A;  4HN9 A;  3KDS E;  5F8P A;  4JI5 T;  4DND A;  2LKH A;  2NTY A;  4NUV A;  4E7S A;  2H7O A;  1SHZ C;  1D1A A;  4OHF A;  5FL0 A;  3PUV F;  5FXZ A;  4MLK A;  2VKJ A;  5JQG E;  3R6N A;  4CXW A;  2LM9 A;  4A98 A;  2K3W A;  5L3B B;  2N9D A;  3HKC E;  3RPU A;  1ZOY A;  2MPK A;  5ABH A;  4IDP A;  2E9X C;  1YKE B;  2VK9 A;  2E9X B;  3PTR B;  1W0A A;  2KLQ A;  3ZPO A;  5JRC B;  1BR2 A;  3CML A;  4U31 A;  1KF6 A;  5LXT E;  2JRK A;  4IL4 A;  2ZMA A;  4AKI A;  2QGS A;  4AI6 A;  5HXH A;  1XDP A;  4Z91 A;  2D0T A;  4CN6 A;  2BS3 A;  3A5X A;  1FMV A;  3J9X 1;  1KNR A;  2RA1 A;  1V9D A;  3N9N A;  2X0H A;  3TKL B;  3L8R A;  3O1J A;  3UU8 A;  1MNE A;  2CEA A;  2MBG A;  3P50 A;  1I6Z A;  3DP7 A;  3C64 A;  5ABF A;  2Y8D A;  3UU4 A;  4B6X A;  4B3M T;  1KFY A;  3WAJ A;  5HEH A;  2IHR 1;  3FZK B;  2WS3 A;  3N9Q A;  3ZN1 B;  1J1J A;  3L3P A;  1XWM A;  3N9M A;  3PDY A;  2NTX A;  2E9X D;  3PUG A;  4EIW A;  5JTG A;  3ZYK A;  5GON E;  4KHP T;  2YOE A;  2E5V A;  2XQ3 A;  3ZMS B;  1UX5 A;  2KND A;  4U72 A;  3O4X E;  4QWN B;  1WR0 A;  4L9I A;  3AAA B;  3WI3 A;  5LHI B;  5J2U E;  4DR5 T;  4AQY T;  1ZHC A;  1FEW A;  4UEL A;  3N2K E;  4IIJ E;  2D0U A;  2LRK A;  5JDM A;  5JDF A;  2VVS A;  3RIA A;  4H63 V;  2WDR A;  4DR4 T;  5ABG A;  4YTM A;  5HEJ A;  4COF A;  5L47 A;  1YW0 A;  2XQY A;  2IW5 B;  5AQK B;  1T72 A;  3CQX C;  5LGU B;  4JEU B;  4QKN A;  4EB6 E;  3PUQ A;  5DQW A;  2E5L T;  4FI5 A;  4ILC A;  5AQM B;  3TLS A;  1FMW A;  1QUU A;  5ADX L;  2X67 A;  1MMA A;  3RIU C;  4J2C A;  2X66 A;  2K5B B;  3AEA A;  1O3X A;  2ZM0 A;  5KX5 E;  5KDM C;  4M1P A;  2W61 A;  3UU3 A;  3AA0 B;  4DV0 T;  5L3F B;  3Q5D A;  2XUE A;  2VB6 A;  1KNP A;  2A2F X;  3U3I A;  1E7P A;  3PUR A;  3ZYM A;  1CUN A;  4NPP A;  3A7M A;  5JH7 E;  4MAL A;  5CFB A;  3N9P A;  4QHO A;  1W0B A;  2V7J A;  3NRX A;  5JDN A;  1ZP0 A;  2WSS V;  1ZEE A;  4X1I E;  2M6I A;  4QXB B;  4LF4 T;  2K48 A;  4X66 T;  2V6X A;  1KEY A;  3RKG A;  3UQ7 A;  2CM0 A;  3ZLI A;  3ZJ1 A;  2DWK A;  4KX6 A;  5JDQ A;  2C5J A;  2QRX A;  2ACX A;  3CQG B;  3C50 A;  2AE9 A;  3FZH B;  4KMC A;  2FJE A;  3M65 A;  2LHR A;  4LML A;  4IE5 A;  4U33 A;  3LK2 B;  2XSA A;  3ZEF B;  4TV9 E;  3PU8 A;  3ZC1 A;  4H9Q C;  4UV9 B;  2WMN A;  3TLU A;  4GOU A;  1OED E;  2DHR A;  4OX9 T;  2CMR A;  4ZI7 E;  4ZXL A;  4X5T A;  3ZKR A;  4YSX A;  2BBJ A;  3NVO A;  1G73 A;  3D0T A;  4O2A E;  2ZM8 A;  3CX6 B;  3DJB A;  3FBZ A;  5CA1 E;  2DL1 A;  2H88 A;  1XMQ T;  2CWY A;  3AAI A;  3ZYL A;  1OED C;  1OED B;  2WDQ A;  1U5P A;  5LYJ E;  2WCA A;  2PG8 A;  2EHO A;  3NWI A;  2WQY A;  3SFE A;  1GQE A;  4LMJ A;  4IGU A;  4QXH B;  3AEB A;  4AIS A;  3FXE B;  2CXD A;  5JVD E;  5FXX A;  4TUY E;  5IUX A;  4GKJ T;  2WM9 A;  2XQ6 A;  4DV1 T;  3I0Q A;  2ES0 A;  3MZK B;  1IJ6 A;  4ADZ A;  2D9D A;  1VOM A;  4DV6 T;  4OYJ A;  3P8C D;  2CXL A;  4N78 D;  3UUB A;  1XMO T;  3N2G E;  4HEA A;  4EED A;  3UUM A;  4DBR A;  4U74 A;  4ILB A;  3IHR A;  3EAB A;  2G0U A;  4O8S A;  4UV8 B;  5JDH A;  4XAX B;  4LFC T;  4HWH A;  4TNW A;  3RQU A;  3KV6 A;  2WU5 A;  4CXX A;  5F3J A;  4QH5 A;  2JQQ A;  4TN7 B;  4UVC B;  4YJ2 E;  5AQH B;  3UUL A;  3ZMU B;  4UEM A;  5LMN T;  3B57 A;  3AE1 A;  2CWO A;  4AXP A;  5IYZ E;  5HAX A;  2SPC A;  2EHO C;  4HTE A;  5HWX A;  2EHO B;  2DNX A;  2V1D B;  2WU2 A;  5JR9 A;  3C98 B;  3KV9 A;  5CGM A;  5KXJ A;  3GMI A;  2K9A A;  3SWH A;  5F5W A;  5ETW A;  4BAY B;  1BR4 A;  4DR3 T;  2VVN A;  1T8B A;  2WWU A;  4HFV A;  3ZMZ B;  2JQH A;  3FHN A;  4H63 H;  2UXX B;  1WCR A;  4O4I E;  3ZT7 A;  2LE8 A;  4X20 E;  3NZQ A;  3L39 A;  1JNZ A;  2V5C A;  3AE4 A;  1DU2 A;  5AQV B;  3IEE A;  3CX7 B;  2LSY A;  4I50 E;  4CN4 A;  2XJ7 A;  4PJJ A;  3KVB A;  4PFP A;  3FXD B;  4L5G A;  4DV4 T;  4NUU A;  2LOS A;  2HPJ A;  1XNR T;  2XHE B;  4JI0 T;  3MJX A;  4IDO A;  5FVL A;  5HYA A;  2EHO D;  1G8X A;  2HPL A;  2ZLY A;  1MIW A;  1FJG T;  5FY0 A;  3NRY A;  3QB5 K;  3ETU A;  5LBM A;  4IE0 A;  4JI6 T;  3U78 A;  3VR9 A;  3I9Y A;  2BKO A;  3QB5 A;  3ZT5 A;  1VCT A;  3BQI A;  2Z6E A;  3AE5 A;  3GA8 A;  1W09 A;  3EVY A;  3C4X A;  3TLT A;  4ANJ A;  2X0Y A;  3VRB A;  3AVS A;  2YIN A;  3PV0 F;  4DBQ A;  2UXC T;  2VKD A;  5CA0 E;  3LG7 A;  4XBF B;  2W4X A;  4OFZ A;  3E22 E;  2VWA A;  4QX8 B;  2X51 A;  4K0U A;  3ZT6 A;  5FP3 A;  3UT5 E;  3KBU A;  1YQ3 A;  2X9H A;  4UR9 A;  1UUR A;  3IA3 A;  3K8P C;  2VQE T;  3QUJ A;  1UK5 A;  4YHJ A;  4QXC B;  3ETV A;  2N1G A;  2MYS A;  3JC6 C;  1WR6 A;  5AQU B;  3N9L A;  2NW8 A;  3EI0 A;  3Q5X A;  3AXJ B;  2UXB T;  5LJN A;  3T1Y T;  1W9R A;  3QNU A;  3C51 A;  2XAQ B;  4DUZ T;  3GN5 B;  1SA0 E;  3ONL C;  5JDL A;  4WNK A;  1LVF A;  3JCF A;  2UXN B;  4CXY A;  4H9N C;  4I0U A;  1QSD A;  3LDQ B;  4F8H A;  4OYK A;  2LKG A;  2LOP A;  4JI7 T;  2VL8 A;  2W2U A;  2LSI A;  5IWA T;  3H3A A;  3UFE A;  4EOZ B;  2XSB A;  2PTF A;  3EHZ A;  2KZ7 B;  3ANW A;  3OPC A;  1WFD A;  4P0B A;  4QX7 B;  3UUX B;  2H89 A;  3ONX A;  2FBW A;  4DR2 T;  2KMF A;  3JC6 D;  3K1S A;  5CJ5 A;  3LK3 B;  3OVU A;  4G63 A;  2LEH A;  3H3M A;  3PU3 A;  2FUP A;  3RYC E;  3I0O A;  2LM2 A;  4JI4 T;  2IML A;  3NKZ A;  4PW8 A;  1KK7 A;  4Q25 A;  4X64 T;  1U4Q A;  2VAS A;  4YXD A;  5HEU A;  1IBM T;  2A72 A;  1H7C A;  2JMH A;  2KT9 A;  2VKH A;  3RC8 A;  3ZCJ A;  2Y6X A;  4UXN B;  4MHC A;  2IIU A;  4BJM A;  4U7Y A;  2WWV A;  3HI2 A;  5HXS A;  3PUZ F;  5AQR B;  5FNV E;  3CQC B;  2J47 A;  4WBO A;  2X9X A;  2B76 A;  4AQF A;  3ABV A;  2XQ7 A;  5C8Y E;  2W00 A;  3KV4 A;  3C4Z A;  3HR0 A;  4UF0 A;  1N32 T;  3RGL A;  2XAH B;  5ABF B;  3O9X A;  5LBQ B;  2CA5 A;  2N2N A;  5AQO B;  3UU5 A;  4CN1 A;  4GKK T;  4HWI B;  4JI1 T;  3ZMV B;  4KP3 C;  2LSK A;  2CXF A;  4WW0 A;  3NZP A;  4UVB B;  4DUY T;  3KVA A;  4EZH A;  3AE8 A;  4U2Z A;  1AJ3 A;  2C5K T;  1M7K A;  3FBL A;  4ZZB A;  2YDQ A;  3NBX X;  4A5X A;  3T8O A;  3RX6 A;  3Q2M A;  2CLY C;  4LF7 T;  2BKP A;  2CLY B;  2CHN A;  1HG5 A;  1HS7 A;  4ILA A;  4O4J E;  3PUA A;  5LHG B;  1US7 B;  1MND A;  4Z90 A;  4H9R C;  4BJN A;  5EZY E;  4AKL A;  3QK6 A;  4AKG A;  4DMV A;  2FJB A;  3V5U A;  3VKG A;  2BVL A;  4TWD A;  2UXD T;  3AEE A;  4IL9 A;  4A56 A;  4KHZ F;  4YSY A;  3PE0 A;  4CI2 B;  2BZB A;  4LF8 T;  4EYY R;  3VHL A;  2W66 A;  5HXR A;  2KXP B;  1E2A A;  4X65 T;  1JNR A;  3AE3 A;  3PUS A;  4UF0 B;  1X79 A;  2MTQ A;  1ZV4 X;  2XQ9 A;  1L0V A;  4I43 B;  4YFS A;  4P1N A;  4V1A v;  2ODV A;  2BS2 A;  3T1H T;  4LMK A;  4EXT A;  4EGW A;  5FMN A;  4IRE A;  3MKD A;  2JIW A;  5HCM A;  4UIG A;  2BG9 A;  1LRZ A;  1J5W A;  5HEO A;  4LF9 T;  5L3D B;  4I4T E;  4AKH A;  4IE6 A;  3B5M A;  3CPZ A;  1R8I A; 
#chains in the Genus database with same CATH homology
 5JRC B;  2LSY A;  2VKO A;  3EUH A;  1UX4 A;  1ZKE A;  3HA4 A;  4I50 E;  1D1B A;  1BR2 A;  3CML A;  3ANW B;  1D0X A;  3MXZ A;  2NP9 A;  2WMO A;  5L3E B;  4PJJ A;  5HXE A;  2DI4 A;  5LXT E;  4L0R A;  3OYX A;  3KVB A;  3FB2 A;  4PFP A;  2X68 A;  3FXD B;  4L5G A;  4MBQ A;  2JRK A;  4PJL A;  3RKO A;  4ZI3 D;  2ZMA A;  4AKI A;  2QGS A;  4NUU A;  4AI6 A;  2LOS A;  1MMD A;  1WLX A;  2HPJ A;  2XHE B;  5HXH A;  2D0T A;  3MJX A;  3A5X A;  1FMV A;  3J9X 1;  2RA1 A;  1V9D A;  3N9N A;  3TKL B;  5HYA A;  1WRD A;  3O1J A;  1UCU A;  1MNE A;  2EHO D;  2CEA A;  2P9B A;  5FY1 A;  1G8X A;  2MBG A;  3HL6 A;  3ESL A;  2HPL A;  2ZLY A;  1MIW A;  3DP7 A;  2Q9Q A;  2V7K A;  3OKQ A;  4MFR A;  3C64 A;  5H6R B;  2KIN B;  2Y8D A;  3I9W A;  5FY0 A;  3NRY A;  1BR1 A;  4B6X A;  2CE7 A;  2LT3 A;  3WAJ A;  3ETU A;  4C90 A;  5LBM A;  3VKH A;  3N9O A;  3N9Q A;  5HXC A;  3ZN1 B;  4IE0 A;  3U78 A;  3L3P A;  4JUY A;  5LG4 A;  3I9Y A;  1VRB A;  2K24 A;  5FY7 A;  3OBV E;  3BQI A;  3F2E A;  2Z6E A;  4JEH B;  5EK4 A;  1T98 A;  3GA8 A;  2KWI B;  3EVY A;  2WAU A;  3N9M A;  3PDY A;  3C4X A;  1OXZ A;  2NTX A;  4IDZ A;  2BVM A;  2E9X D;  3UUN A;  4ANJ A;  2YU1 A;  1IAP A;  3PUG A;  4EIW A;  4ZS3 A;  4ZI2 C;  1YD8 G;  2C5I T;  3AVS A;  5GON E;  3ZYK A;  2YIN A;  3OJA A;  4AQF C;  1HTJ F;  4DBQ A;  5JRE A;  3ZMS B;  5L2L A;  2X9W A;  5KMG P;  3LBX A;  1UX5 A;  2IAK A;  2VKD A;  5CA0 E;  2KND A;  3O1H A;  1S35 A;  3LG7 A;  4U72 A;  4XBF B;  3CX8 B;  1D0Y A;  3O4X E;  4QWN B;  1MIV A;  3IBP A;  1FIO A;  4OFZ A;  1NAF A;  5TAO A;  5LNK A;  4L9I A;  4IE4 A;  3AAA B;  3WI3 A;  3E22 E;  5LHI B;  5J2U E;  2MOZ A;  2VWA A;  1EZ3 A;  1BR0 A;  2B1E A;  4HGA A;  4QX8 B;  1ZHC A;  2X51 A;  4K0U A;  4YJ3 E;  1FEW A;  4E7Z A;  5J2T E;  3SRZ A;  4UEL A;  2L9Q A;  4H9S E;  5FP3 A;  4TZ4 C;  3N2K E;  2LHN A;  4O2B E;  4PK4 A;  4IIJ E;  2D0U A;  3LFM A;  3UT5 E;  5JDM A;  5JDF A;  4EYU A;  5M4Y A;  4H63 V;  1OWA A;  3KBU A;  3HKD E;  1YW0 A;  4ZOL E;  2X9H A;  3C4W A;  2XQY A;  4YLH A;  2IW5 B;  2HH7 A;  3OYZ A;  3HKE E;  3ZCI A;  3K8P C;  3S4U A;  3QUJ A;  3CQX C;  5LGU B;  4JEU B;  4QKN A;  4YHJ A;  4EB6 E;  4CI1 B;  3PUQ A;  4QXC B;  3ETV A;  4FI5 A;  5DQW A;  3RYI E;  1FMW A;  1QUU A;  2N1G A;  5ADX L;  2MYS A;  3JC6 C;  3L09 A;  3BQK A;  1WR6 A;  2X67 A;  1MMA A;  2V7I A;  4ASK A;  3N9L A;  4J2C A;  2NW8 A;  2Y48 B;  2X66 A;  2K5B B;  3Q5X A;  1O3X A;  2ZM0 A;  1S94 A;  5KX5 E;  5KDM C;  5LJN A;  5J1G A;  4ZI2 D;  4EAH A;  3W15 B;  4M1P A;  2W61 A;  2V26 A;  3AA0 B;  3C51 A;  2Q9Q C;  2J1D G;  5L3F B;  2Q9Q B;  2XAG B;  2XUE A;  2LJL A;  2XAQ B;  2A3D A;  2VB6 A;  3GN5 B;  2A2F X;  1SA0 E;  3U3I A;  5JDL A;  3PUR A;  4WNK A;  4X1K E;  1CUN A;  1LVF A;  3ZYM A;  3RYF E;  2UXN B;  4CXY A;  4H9N C;  1QSD A;  3F31 A;  4IST A;  5JH7 E;  2W62 A;  2PJQ A;  4MAL A;  3N9P A;  4QHO A;  1WYC A;  1HG2 A;  3K3Q C;  3AA1 B;  4OYK A;  2V7J A;  3NRX A;  5E0O A;  5FYM A;  4GIW A;  5LP6 E;  3K3O A;  2LOP A;  2PBI A;  5JDN A;  2VL8 A;  3K3N A;  2LSI A;  2WSS V;  1ZEE A;  3EDV A;  1D1C A;  2NOX A;  3AVR A;  4O4L E;  3H3A A;  1KNZ A;  4X1I E;  5DAB A;  4QXB B;  3UFE A;  4EOZ B;  4IHJ E;  4PAG A;  1E1H B;  3KIN B;  5JRC A;  4PJN A;  2K48 A;  1IZN B;  2XTL A;  5LHH B;  2KZ7 B;  3ANW A;  3LBX B;  4P0B A;  4QX7 B;  3UUX B;  5DJQ C;  2CM0 A;  4AKR B;  3Q9D A;  3MK7 C;  3ZLI A;  3ZJ1 A;  2DWK A;  3ONX A;  5JDQ A;  5LJM A;  4P0A A;  2X9Y A;  3SS1 A;  2C5J A;  2ACX A;  2KWH A;  2KMF A;  3C50 A;  3CQG B;  3JC6 D;  4KMC A;  5JR9 C;  2LSG A;  1NWM X;  3M65 A;  2LHR A;  4GYS A;  3LK3 B;  5FXV A;  5JR9 B;  3LJC A;  3BQL A;  3HKB E;  4IE5 A;  3UTK A;  4DO0 A;  2L3L A;  3RH3 A;  4G63 A;  2LEH A;  2XAF B;  3LK2 B;  3ZEF B;  4BA9 A;  3PU3 A;  4TV9 E;  4X1Y E;  5A1L A;  3RYC E;  3B13 A;  3I0O A;  3PU8 A;  3ZC1 A;  2Q9Q D;  2GK9 A;  4H9Q C;  1MMN A;  5LOV E;  3E0Z A;  2XAJ B;  4UV9 B;  2WMN A;  3LK4 2;  4GOU A;  2X0L B;  4PW8 A;  1KK7 A;  3KV5 A;  1D0Z A;  1U4Q A;  2VAS A;  3RRW A;  2DHR A;  3AA7 B;  4WBN E;  3O1I A;  4DVD A;  3VU7 H;  2A72 A;  2W63 A;  1H7C A;  2CMR A;  2YEV C;  4ISS A;  2YU2 A;  2JMH A;  2KT9 A;  2VKH A;  4ZI7 E;  3GWH A;  3RC8 A;  4TV8 E;  3ZCJ A;  4ILU A;  2Y6X A;  3IEE A;  3SOL A;  3ZMT B;  4H9O C;  3V5S A;  1HF8 A;  5CB4 E;  4ZS2 A;  4UXN B;  4MHC A;  4HKA A;  4BJM A;  1G73 A;  3N2O A;  3D0T A;  2XAS B;  2D5U A;  4O2A E;  3HI2 A;  2ZM8 A;  3CX6 B;  3DJB A;  5HXS A;  5LGN B;  5FNV E;  3CQC B;  2WBL A;  3P7I A;  4WBO A;  5DQV A;  3FBZ A;  5CA1 E;  4OK0 A;  2X9X A;  4AQF A;  4PK5 A;  5FXW A;  2H3R A;  3ZC0 A;  3KFW X;  3J7Y q;  2CWY A;  2H7V C;  4ERR A;  3AAI A;  4EZ4 A;  4P09 A;  5C8Y E;  3ZYL A;  2W00 A;  4GYR A;  1IJ5 A;  3KV4 A;  5EK2 A;  3C4Z A;  1U5P A;  5LYJ E;  3HR0 A;  2PG8 A;  2OA5 A;  3E08 A;  1HX8 A;  3MA9 A;  4PJM A;  2EHO A;  3MAC A;  4XZC A;  4UF0 A;  5IHY A;  1MIY A;  4ZHQ E;  2XAH B;  3KBT A;  2CCQ A;  3CKD A;  4IGU A;  4QXH B;  3IF8 B;  3BK9 A;  4GK0 E;  3O9X A;  5LBQ B;  4CI3 B;  2CA5 A;  2N2N A;  3FXE B;  2NW9 A;  2CXD A;  4TX5 A;  2NWB A;  4JLE A;  5JVD E;  1WYB A;  5FXX A;  4TUY E;  3AAE B;  4H9P C;  2WM9 A;  3ZMV B;  2ODU A;  4UVA B;  3CWZ B;  4KP3 C;  2LSK A;  2IC6 A;  3I0Q A;  1Y64 B;  2D2S A;  2ES0 A;  2CXF A;  2E8I A;  3MZK B;  4WW0 A;  3NZP A;  4UVB B;  1IJ6 A;  4ADZ A;  3KVA A;  4EZH A;  1VOM A;  4G2A A;  2E9X A;  4OYJ A;  2DCF A;  1LVK A;  2PFV A;  3P8C D;  2CXL A;  2C5K T;  1AJ3 A;  3FBL A;  2JPF A;  4GK5 E;  3H37 A;  3NBX X;  2LSJ A;  4PFO A;  4N78 D;  5AFU L;  5H6Q B;  3T8O A;  3N2G E;  3Q2M A;  3RX6 A;  2CLY C;  5LGT B;  3QC9 A;  2CLY B;  4KUM B;  4HEA A;  1HG5 A;  1Z0P A;  2JMK A;  3GN5 A;  2YK0 A;  3UUM A;  4DBR A;  3I1A A;  3WAK A;  1HS7 A;  4PK6 A;  3AA6 B;  2C0S A;  4U74 A;  4O4J E;  3PUA A;  5L3C B;  1HCI A;  5LHG B;  1US7 B;  3IHR A;  2L8K A;  2G0U A;  4KBM B;  1MND A;  4O8S A;  4H9R C;  2M67 A;  4DMW A;  4UV8 B;  4BJN A;  3EDU A;  5JDH A;  1HFA A;  5EZY E;  4XAX B;  4Z8X A;  2JJ9 A;  4AKL A;  3QK6 A;  5HWY A;  3DTO A;  4AKG A;  3KV6 A;  4DMV A;  4IE7 A;  3V5U A;  4CXX A;  3N5L A;  2W0G A;  4F6R C;  5F3J A;  2V7M A;  4I55 E;  2QA7 A;  2JQQ A;  4TN7 B;  3VKG A;  5LA6 E;  4UVC B;  4YJ2 E;  1MMG A;  2RP4 A;  2BDE A;  3UUL A;  3ZMU B;  2BVL A;  1LKX A;  4HN9 A;  4ZI3 C;  4UEM A;  3KDS E;  5F8P A;  4A56 A;  4CQI A;  4DND A;  1B7T A;  3B57 A;  4C91 A;  2CWO A;  3PE0 A;  5HWX A;  4CI2 B;  4AQG A;  2BZB A;  4AXP A;  5IYZ E;  4EYY R;  2NTY A;  4NUV A;  4E7S A;  3VHL A;  5HAX A;  2H7O A;  2SPC A;  2KXP B;  5HXR A;  1SHZ C;  2EHO C;  2V7L A;  4HTE A;  5EK3 A;  2EHO B;  2DNX A;  2V1D B;  3PUS A;  3RYH E;  3ZN0 B;  1D1A A;  4OHF A;  4UF0 B;  5JR9 A;  1X79 A;  3AB3 B;  5JDG A;  2MTQ A;  1ZV4 X;  3C98 B;  5L3G B;  5BMV E;  3KV9 A;  4I43 B;  3CVR A;  4HE8 A;  5FXZ A;  4YFS A;  3RRC A;  3GMI A;  4MLK A;  2VKJ A;  2K9A A;  4V1A v;  2ODV A;  2ZM2 A;  3SWH A;  5ETW A;  4BAY B;  5JQG E;  1YKH B;  2I59 A;  1BR4 A;  3R6N A;  3RC3 A;  4CXW A;  2WWU A;  4HFV A;  3ZMZ B;  2LM9 A;  5LCY A;  3FHN A;  5L3B B;  3ZJ2 A;  4EXT A;  3F57 A;  5FMN A;  3MKD A;  4H63 H;  4PNI A;  2N9D A;  2UXX B;  3HKC E;  3RPU A;  2DLR A;  4O4I E;  3R84 B;  2LE8 A;  4X20 E;  4CZZ B;  3NZQ A;  4UIG A;  1LRZ A;  3Q5W A;  2IC9 A;  5L3D B;  2E9X C;  1YKE B;  4O4H E;  4I4T E;  4AKH A;  2VK9 A;  2E9X B;  3PTR B;  2NW7 A;  4IE6 A;  3CPZ A;  2DWG A;  4FJO A;  2KLQ A;  3CX7 B;  3ZPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...