4ZI3A

Bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
181
structure length
180
Chain Sequence
LLSILRKLKSAPQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
total genus 65
structure length 180
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4zi3A00
2HCJB 4JSTA 1GUAA 4RD1A 4W7SA 2GZDA 3MWKA 1XRJA 2ORIA 4QFMA 5JMTA 3BWDD 3REFA 2FZ4A 3KUDA 1ZD1A 4DT1B 4ILEA 2AWNA 3PFIA 4PPGA 2QM8A 5EZ5A 3TUZC 4EPWA 2G3YA 2GXUA 1TQ6A 1P3JA 2ZJ5A 5HCNA 1X3SA 5TMPA 3K0FA 1E3MA 3AVOA 2LWIA 4C9BA 4MRNA 4DIDA 3MMPA 4IXMA 3Q7QA 3U61B 4DRZA 2VPPA 3E70C 2BBSA 1OFIA 4BUJA 3IQWA 4AK9A 3OIWA 1VHLA 1G7SA 1NJFA 2J46A 4KODA 2QAGC 2O8FA 4NCKA 1L4YA 4LX0A 3IGFA 1LS6A 3LQQA 4HB0A 2GAAA 2QAJA 2FA9A 3PUZA 4TWZA 1HEIA 3KKNA 3BH0A 2PJRA 2ZEJA 1E9CA 4J0QA 2AXNA 2OLKA 2WJVA 4PAOA 5GVRA 2EW1A 3T12A 2J0QA 1X6VA 3THWA 3LBNA 3PUYA 3ZVLA 1XXHE 1N5LA 1Q3TA 1AS0A 4FINA 2PL3A 4AY2A 2GK7A 3WP1B 2QTFA 1N0WA 4Q4AB 3BD9A 1G21E 4QKQA 3U6BA 5DSZA 2WPDA 1R0YA 2IEZA 3GLIB 5CDFA 3SHWA 2XEXA 3DMNA 1VHTA 2GEDA 2Q3FA 1DVRA 4Q1EA 4IOLA 1S8FA 3BK7A 1LY1A 2VH5R 5IK2D 1COWD 4PQYA 1L2TA 4TLEA 1KOFA 1XF9A 4UNSA 3UG7A 3RABA 4QHYA 3IEVA 3F0TA 4DLTA 1OXSC 2B6HA 2C77A 2WWXA 2VF7A 1Z6TA 2DHRA 4WXPA 3SFVA 1U98A 2GCNA 1P2TA 4IDHA 5HPYB 1SVIA 1GSIA 2YHSA 3MUFA 3SBEA 5K8TA 4E07A 2GA8A 2H8KA 1RYFA 1E32A 1KO7A 1MRNA 4YDHB 2H17A 2QP4A 2IL1A 3AKEA 3MFYA 1O3YA 4UXIA 1YHNA 5KSYA 1XEFA 2WIAA 1IY1A 4BFWA 4NONA 2GDJA 2ZU0C 1NMYA 4ZCLA 5JEDA 5AUPB 3D31A 4G5OA 3OE7A 3H84A 1XJ0A 3C8UA 5C46F 3ZS9A 4B71A 1U9IC 2OG2A 3MGCA 4TLBA 5TARA 2CDNA 1QRAA 4JVLA 2DR3A 5GJCA 1X8LA 3C4JA 4TT3A 2HYIC 4BEJA 2WSMA 1IXRC 3AKYA 2ZTSA 1KI9A 3GJ8A 3RYTC 1IQPA 4QM6A 2Z4RA 1CR2A 1SXJE 1DTSA 1T5IA 2QAGB 3BFVA 3EXAA 3BE4A 5J5CA 4KFRA 5JWRA 5AR1A 1KK0A 2IYWA 3QKSB 4MYTA 2QMEA 3GJ3A 4UNQA 1NSFA 4EPRA 3NDBB 3NBXX 3BB4A 3K9HA 3MG9A 4YONB 1E9RA 1W0KD 4OJKA 4CRWB 4US2R 1OT3A 1ZNWA 2BMDA 4PAMA 2A3RA 4D26A 3I5XA 3RHFA 3ETLA 3EIEA 1ESNA 2F1JA 3FYHA 2B8WA 5DI9A 2YYZA 2WVJA 1IXZA 4LHWA 4HUQB 1VG9B 2EFEB 2ZSDA 1D2EA 5JFGA 3K1JA 3K0SA 5EE9A 2VO1A 5FL3A 4LJ4A 2YKGA 5TY0A 4C30A 3GD7A 2CCGA 5LBIA 1D9XA 2JGNA 4I1OA 3KQLA 1GM5A 5GADl 1PJRA 1M34E 3R9WA 3JZMA 2CVFA 4M22A 1IXSB 2KE5A 3KQNA 2BJWA 5BXQC 2WWHA 3ZIAA 1FW6A 5E7JA 4DEYA 4URUR 4O3MA 5JZVA 5JWHA 2Q6TA 4AURA 1R2QA 4HLQB 1CJVC 1ZIPA 1A5TA 1E1QD 2VF8A 2VIIA 5SZHB 1OXUA 4IDQA 4V0OA 1WBDA 1FQJA 1R0WA 2OCBA 1E2MA 3MWJA 4QJ5A 2ZE8A 4GZMA 3DZ8A 4POAA 3SJBA 3EZ2A 1KO1A 2QQ0A 1MH1A 1PUJA 1N6HA 3SFZA 4DZZA 3OE7D 3VR2A 4E03A 5CB8A 3T1VA 2H5EA 3BC1A 3P32A 4Q4AA 1JR3D 2YOFA 2ZVQX 3PEWA 3REGA 3LVQE 1MO6A 3TQFA 4AWXA 2NG1A 2Q21A 1XD2B 2GJ9A 5G41A 4EFLA 4KAXA 4TZ0A 3RS0A 1X1SA 3VNUA 1II8B 2KWIA 1OXXK 1R0XA 4OK3A 2J9RA 3ZQJA 1K8RA 1E2IA 3E1SA 5FI0B 4IOKA 3O8BA 1AK2A 2QPAA 4AYWA 4B6EA 2BV3A 1T0HB 2C9CA 1G8YA 3H1TA 2HYDA 4G5SA 4KBGA 4Q00A 2NO7A 3OAAA 4B3GA 4KHZA 4C0BA 3WNBA 3NIBA 1K5GA 1M8PA 1OFUX 3U60B 1DAIA 1P9RA 5CM9C 2DY1A 3DVLA 5HKKA 4TN1A 1AZTA 4UQOA 2A30A 2J0UB 1OH7A 3I4LA 4RD3A 4ZCIA 3BIFA 3QVVA 1F5NA 1UADA 3SQWA 4DKXA 1TQ4A 4HLUA 4PZYA 4CT4B 4ZV4A 4L16A 4ZDJA 2BMFA 2RHDA 3B78A 3IPXA 3PV0A 3DMDA 1U99A 3BS4A 1KSHA 1HYQA 3IDQA 1FX0A 3UWOA 4RKEA 3TVDA 1RKBA 4ASUD 3TGPA 3C14C 4DLWA 2ZRHA 4HZUB 2AD1A 5JI3E 3GEEA 1WXQA 1S1MA 2ZS8A 4PC2A 2A9KA 3K8YA 4G5RA 2ZJAA 4DIEA 1MKYA 4IJMA 1AQYA 3PUVA 1M7BA 3RRNA 1KAOA 3GLGB 1CJMA 3DOEA 4TLCA 3TR5A 2I1VB 5CK5A 1NLFA 3RSOA 1DO0A 4UNRA 2DWQA 5KYKA 1PZNA 5C2JB 3TR0A 4NL4H 5FOSA 3CWZA 4OHWA 5AJXA 1ZBDA 1JPNA 3W3ZB 1FPMA 1CJUC 3KFXA 4LHVA 4HAXA 1CP2A 5KSZA 1NKTA 2ZRCA 3OFNA 2R6CA 1FNMA 2ATXA 3BFKA 1RPZA 1QG2A 2YJTD 3X1YA 1NL3A 2IYXA 1F2TB 4M9XA 3FKSD 3WP0A 1KMHB 1VG8A 3OEEA 2ZE5A 3KZ1E 1SVLA 2GETA 4ZCMA 2AHOA 1OXTA 2WMNB 1A4RA 4FMCF 3SYKA 2GBLC 1W47A 3OIYA 4EFNA 4QGGA 1XP8A 4WXRA 4B3BA 5DO9A 1G18A 2DWOA 3RWOA 4A36A 3SZRA 2GK6A 1KI8A 2X2FA 4BFXA 3CZPA 4F93B 4WW0A 3GCGA 4RD2A 4DLSA 4YMTA 1EESA 4LYHA 3SBDA 2GCOA 4PPNA 2JDIA 1N0VC 2G83A 2WICA 3ASZA 4DUGA 2H57A 2REXB 1ANKA 5AUNB 1D9ZA 4Q18A 2VHCA 5L3RA 1W36B 2ZJOA 5HTKA 5L3QB 3PUWA 4BASA 1E79A 2HT1A 3NH6A 5F98A 1P7CA 2C95A 1R8QA 2XJ9A 4NZYA 4TYNA 3P4XA 4YMWA 1Z5ZA 4TQAA 5KPDA 3SYLA 1F2UA 1GKIA 3NEYA 3R7WA 1EK0A 4CEIB 4N0DA 3EAQA 3TE6A 3NWJA 5EXSA 2WJYA 1CR1A 4M21A 1E9EA 1T4GA 4BFUA 4GL2A 1Q57A 4B33A 1II8A 4BLSA 3RLFA 2WJHA 4D82A 2MMCA 1JJVA 2R6FA 1TUEA 2A78A 4F38A 5P21A 3LXRA 3LWNA 4RD0A 1Z28A 2I4IA 3U3JA 1E98A 3B1XA 3KKMA 1D5CA 4PO9A 1MABA 4M53A 3RRZA 3A1VA 5JCPA 5C1BA 4D81A 1W49A 1D6JA 3ZLJA 3OFND 4WBSA 1YZLA 5GJVC 2VTKA 2ZPTX 1OHHD 2RKOA 4MKGA 1MO3A 1G5PA 1XEWX 2J1LA 3K0CA 3U2QA 4L8GA 4JLPA 2WTUA 1IN7A 1WP9A 4N3NA 4D0GA 3ZYCA 3CRVA 1GWNA 1E9SA 2QORA 3HP1A 3TLXA 2IK8A 3UIEA 4PX9A 4AKEA 2ZM5A 3KB1A 2WOOA 2VHUA 2GZAA 2WWIA 4XIGS 2OAQ1 1Q44A 1E9AA 2WWFA 5BW8A 3LW8A 3TJZA 3CPEA 2OFWA 4XSHA 3BBPA 1MRSA 2IW3A 2QL6A 3ZS8A 2ZRJA 3L0SA 1IOZA 2CK3A 3SJZA 4A9AA 4RFVA 2H7VA 4B2PA 1Q22A 2ZROA 2CJWB 4JLDA 5SZIA 4QOSA 4JBWA 3ZVMA 3M6AA 1J7KA 1E2EA 1FX0B 4LV6A 2FEOA 1GAJA 1Q12A 2OXCA 3IHWA 3W6OA 5DYIA 1DAMA 2GESA 1YZUA 3K0FB 4Q1AA 3RAPR 4D0NA 3A1WA 2A5YB 2ZI3A 3CRW1 1AS3A 5KSPA 1NJGA 2FNAA 5LPNA 4NE2A 5F2EA 1CR0A 3CKLA 1UBCA 3B9QA 3KJGA 4PC1A 1GVNB 1P72A 1LNZA 1Z0KA 4IVPA 4CGZA 1WQ1R 4Q1DA 2IHYA 4GT1A 2P2LA 1P5ZB 4QGHA 1M1YE 1M7GA 1GL6A 3CONA 4ERNA 3GPLA 1XTJA 4V02A 1LF0A 4KFUA 4URZR 1P62B 4F92B 4BLPA 3B6EA 3KL4A 1DAHA 2ZJYA 1YRBA 2YVUA 2NOAA 1G7CA 1EXMA 3ND9A 4YDSA 3CX8A 1E0SA 3IO3A 5FFMA 3WRXC 1I4TD 3K0EA 4TQUS 5FPKA 1X8KA 4B3XA 2NO6A 4PR0A 3T5GA 4RZ2A 3B7GA 2J0VA 5FBWB 2FE4A 3R8FA 2D4HA 3PJRA 2BM1A 4GOKA 3NHBA 3A4MA 2Z0MA 3THOA 1AA9A 1VKJA 4DCNA 4M8NE 2F1IA 3ZD7A 1A1VA 2DCUA 3I32A 4D0LB 2GCOB 3X2SA 1W4CA 4P33A 4CW7A 1N6PA 3QOFA 2E1RA 3L8YA 1N6NA 1RRCA 2WAYA 2QPOA 2ZI7A 2FSHA 4QXAA 5FOVA 4XVUA 1NIPA 5AUOB 3LXXA 4Q7LA 1QHXA 2CXXA 4QHTA 3RRYA 5FUWA 5L3QA 1OH5A 2GBLA 3GMTA 3QSYA 2B92A 2WIBA 3Q85A 4UNNA 3FE2A 1IN4A 1E1QA 2GJKA 3F5FA 3DL0A 1ZJ6A 3K0CC 4I81A 1QZXA 4G1UC 1BMFD 3NEJA 3D7MA 1CBUA 3SJCA 3VR1A 3U4QA 1CKEA 4LUCA 3SQXA 1IN6A 3BFXA 5KTYA 3LD9A 2IYQA 2RGBA 1NVUQ 3UMFA 4Q4JA 1QVAA 1E9FA 1SGWA 3K0AB 4PXAA 2J7PD 2R6GA 1Q21A 3ADKA 3HR8A 3T34A 4S35A 1KYIA 1MABB 4TTRA 1E2FA 3I8XA 2DB3A 4DCSA 1MO4A 3N5CA 4OBEA 3NG1A 2Z6VA 2CL7X 2CL6X 2Y8EA 2CLDX 3SE0A 1E9BA 4WA7A 5EXPA 2ZU6A 3CNNA 1U94A 5DN6D 3B60A 3NVAA 4NP6A 4PHHA 2C9YA 1P2UA 3KQUA 3AM1A 3IEUA 5M04A 1HE1C 1NN3A 2H92A 3IBGA 3LY5A 1XTQA 1S9HA 1NMXA 1YQTA 2YC2C 2C78A 4LBYA 5E7IA 4GZLA 4TMZA 2XSZA 4Z1MA 5FH9A 2X19A 4P31A 3NXSA 1P2SA 5J47A 2VLIA 4IVQA 3E5HA 2IX3A 2ZJ8A 4L5BA 2AN9A 1L8QA 1Z0JA 1GNPA 4CEHA 3C41J 5EP4A 2W6JA 2GXSA 1GRRA 1DADA 3EC2A 5HR5A 2KBEA 2IHBA 1XNJA 1IN8A 3VHXA 3N2IA 5FOXA 5FOTA 4A2QA 1ZCBA 2N46A 1RE0A 3QKRA 3AUYA 4HUQA 1AS2A 4HATA 1SXJD 3KKPA 4KFTA 4QGAA 3HPQA 3QUSA 1KI3A 1NBMD 2W2TA 3HYTA 4UKDA 4XVQA 4DSTA 2RGDA 1G6OA 1OYYA 4A8JA 1UF9A 3CB4A 2ODNA 1WMSA 5FBRB 1KDRA 4PFSA 4JKIA 2CE2X 2CNWD 3NKVA 5BYJA 1GKYA 1R5OA 4GOXA 2JLZA 1G3UA 4I4LA 4IEEA 3OZXA 2XX3A 1P75A 2QMHA 4US0R 4BFZA 4F4CA 1T91A 1US8A 2WOJA 5BQ5A 3CF2A 4MUBA 2JA1A 2VHTA 2ZAMA 4OHVA 4Q1CA 4XTRA 1XPUA 2O8BA 3B1YA 2QMOA 4IVRA 5H70A 3HU2A 2ODBA 2ODWA 3IKJA 4B43A 4RCZA 2WWYA 1DAKA 1KZGB 1HV8A 1XU4A 2C04A 2GF9A 3I73A 4EAQA 1VG0B 2P6NA 2ZIAA 5EE3A 5HE8A 3A58B 1NN0A 4P0TA 4TQ9A 3WNDA 4HZUA 2TMKA 2ZRDA 2QGZA 4ZO4A 5EUQB 1LV7A 3GFOA 4XD7A 4Z51A 1OH8A 3ZD6A 1TNDA 3CIOA 4FCVA 4FMDB 3LH5A 1BO6A 1T0JB 5FPHA 5FUYA 4BRUA 3U3RA 4DCTA 4E22A 4Q01A 3HJNA 1Z0IA 3GJ4A 5A4JA 1E1RA 1IONA 3FKQA 1ZU5A 1A82A 2FFQA 3H0KA 4KITB 2FJUA 3RC3A 3BRWD 3PUXA 4S2EA 1SULA 3IILA 1DEKA 1XZPA 3C5HA 1IHUA 3MCAA 4AYTA 1VYTA 4D4KA 2A2ZA 1OIWA 1YZNA 4HYYA 4ZKEA 3LDAA 1C4OA 4JJZA 1KMHA 5DNYB 3KB2A 2UZIR 521PA 4C2UA 5AJWA 1NG9A 2GHIA 2ZE6A 2QSZA 3QPUA 3O8RA 2BMJA 1CF4A 3P26A 1U8YA 3HU3A 4KVAA 1KMQA 2J0UA 3B82A 3TKLA 2GEUA 1D2MA 2P6RA 2AKYA 3TRFA 4YC7A 3QQ5A 4NTZA 3P20A 5KSOA 1VYVA 3TW4A 4AIIA 1F48A 2JEOA 3IIKA 4L9WA 2RAPA 2X77A 5KU1A 2B8TA 2P65A 2Z4SA 4GMDA 3CZQA 2VHJA 4FCTA 2IS1A 4TLDA 3OIUA 1VCIA 2B21A 4B6FA 2O0HA 2AX4A 4LYJA 5CIWA 1GZSA 4DLUA 2HJVA 1E0KA 4JS0A 2IYSA 3A4NA 1J99A 4CIDA 3FTQA 3T61A 1F2UB 1U9IA 1Z2AA 1JI0A 2OXRA 4NYJQ 1JQLB 1KTVA 1U0HC 2FSGA 1XB2A 1E2NA 5JJIA 3VR5A 4DHEA 1W36C 2IYUA 3CX6A 1CULC 2FV8A 2NPIA 4N1AA 5EE0A 1G8HA 2V54A 1ELOA 3A1UA 4ZIRB 1N5JA 1KKMA 1KKLA 1XD8A 4LJ7A 4WIAA 4IOMA 4TL6A 2NO0A 2Q0HA 4US1R 3VMFA 4B2LA 4KSBA 1IBRA 3RVBA 4B35A 5B64A 2EFDB 2IYLD 1KJYA 4Q9JA 5K8IA 1IJEA 3MWYW 4HDOB 1E99A 1F2TA 5EQTA 4NYJR 2ASEA 2CHGA 4DLXA 3I1FA 2NQ2C 4LY6A 5J4VA 1E2GA 3DKVA 3W6PA 4EIWA 4DDTA 1J2JA 4HSEA 1OF1A 3ZDQA 3CH5A 4MDFA 4DUGD 1R10A 1A7JA 2KI5A 2J5XA 4YQFA 1JXMA 3U5ZB 1P9NA 3QXSA 4GNKA 4MQBA 5EXTA 5TV2A 1T8UA 2WV9A 4PC6A 3EW9A 1E2DA 4LJAA 5DHFA 4DB2A 1S9DA 3QG1A 2XTMA 2VSOA 2BIFA 4DSOA 4HUTA 4DLVA 1SVOA 4NCJA 1DAEA 3ADBA 4FI3C 2QROA 3RS3A 1TTTA 3EPLA 2FFHA 4UJ3A 3IBYA 1P4SA 1D8TA 1EFTA 2CBZA 3V9PA 4PHGA 5FL7D 3QI2A 3J81k 1R4AA 2OCYC 4BECA 4CEIA 3ND8A 1E4YA 2W0MA 3LBHA 4MH0R 1JECA 3UANA 2WKRA 4P4UA 3OESA 2GRJA 1TQ2A 1OW3B 4PANA 4LSGA 5HZHA 4ABYA 2FX3A 2YWFA 4LJ8A 2BVNA 1PLKA 1DARA 1EFUA 4JYBA 4JJKA 2J0SA 3LX5A 4PAQA 1SKQA 4NYMQ 1U2RA 2CCKA 2F43A 2JJ2D 2NZJA 4PQFA 4JYCA 3RS2A 4XJXA 2B7CA 2OFXA 1G8PA 1YR6A 2XNDD 4K8OA 4JLAA 4OI1A 1OIVA 2DYKA 4QBFA 3WY9A 1G16A 4LWZA 3AF0A 2J59A 4BFTA 4IDPA 4Q19A 3VR3A 4G0NA 2JJ8A 4RSGA 5KHOC 4R2IA 4Q9IA 2R2AA 1QF9A 3CBQA 5FOWA 2PT7A 4C2TA 5B58C 3NDPA 1KK1A 5CK4A 1SVMA 3UKDA 2O8CB 5GVSA 2EFCB 1CS4C 1KI2A 4RD6A 1C1YA 1CR4A 1ZW6A 1X86B 4Q9LA 1G7TA 2ANBA 1W44A 5LB4A 3CNOA 1UBGA 4ESHA 4IEIA 1U0JA 5FR2A 2P3SA 3QIAA 2WJJA 1XZQA 2ONKA 2ZRMA 3A4LA 3KFVA 5AJVB 3I5YA 3VHLB 5J4HA 4BLTA 5HKKD 1UAAA 3OF5A 2ZYVX 4QJ3A 4HB4A 4NU0A 4TYYA 5H68A 3GFTA 1KI4A 3FKSA 2NMVA 2CLCX 5FTNA 1ZCAA 3QKTA 4GMXA 3VR6A 5AK0A 3G5UA 4QM7A 4LJ9A 2FGJA 2YOHA 2ZUCA 4MA4A 1F6BA 4EPTA 2VSFA 3U4QB 5FTMA 2VP5A 5C18A 4GI7A 5EZ6B 3R9XA 3PENA 1ZNYA 1OH6A 1R5NA 4RJLA 1W48A 1NP6A 3CF0A 3KJIA 3W5JA 2ZYUX 2FPKA 2EWWA 3ZH9B 4Q4JB 4CEJA 4OYHA 2HT6A 3FHOA 5ANRB 2A5FA 2PT5A 4ARZA 4GDFA 2XZPA 2V3CC 5LB2A 4XWAA 2VP0A 4LBVA 5E3HA 1WF3A 5EP1A 4C0QC 1E2LA 4QG7A 1XXHB 3VX3A 2ZXUA 3D8BA 3FDIA 1JR3A 4BFVA 5JI2E 4M4SA 3MD0A 1GNQA 5K8UA 5EE5B 3AH8A 3UWKA 4ASUA 3EX7C 3Q5EA 5H8WA 4EJSC 2BKEA 4BFYA 1P6XA 2IYTA 2A5JA 3EZ9A 3K9NA 3FB4A 2JCSA 2YNMA 5B2ZA 2O8EA 3GLFE 1SQ5A 2OO7A 3TSOA 1NG1A 3QJYA 4MKFA 1CRPA 2R6AA 4B3DA 2BDTA 3WYAA 4A2WA 4M1MA 5HZKA 3CM0A 1LF5A 3THXB 3HPRA 4XSGA 2V6JA 3S1AB 4DB4A 3AKDA 1EWRA 2ZJ2A 4F4JA 4Q48A 2OESA 3NBFA 3WMGA 2VP2A 1XCPA 4JL5A 3DEFA 3KKOA 3PITA 1XEWY 1E94E 2YC4C 4JVMA 2QGNA 2FDCA 3P4YA 3CRMA 4PPQA 4V0ME 4D2IA 1B0UA 1ZMXA 3PQCA 3X1WA 1TQDA 4CZ2A 1Z29A 1N25A 2ODEA 3EZ6A 1A2KC 3VQTA 3VKGA 2CHVA 2G88A 4DLYA 4OK5A 4NYIR 4ZPXA 3DKPA 3TW8B 4FMBB 3VU9B 4IFEA 1HY3A 2C2HA 1W0JD 1Z6AA 3K09A 1NF3A 4AKGA 2GF0A 3QPWA 1FZQA 2F43B 4JVNA 3K0AA 1R6BX 1NY6A 1QHHB 3KXKA 2C99A 1US8B 2MSCB 5B30A 3VR4A 1DPFA 2OSBA 2PBRA 2X8AA 3GEIA 3JVVA 2WMOB 5KDLA 2UKDA 2GTPA 5JCZA 4HAUA 2XAUA 1TMKA 4KSCA 5AWFC 4JBXA 3KXLA 4LYAA 5H1YA 3K09C 3EG5A 4BLRA 4DLZA 3FHCB 1KY3A 5FI1B 1UFQA 1G3RA 2ZR0A 2ZRFA 1XJQA 3DPUA 1X8JA 1Z83A 4MYHA 1KHTA 1VIAA 2OBNA 3GJ6A 3W5IA 4H1UA 4ZI3A 4Q03A 3EPHA 1JNYA 2P5TB 4FD2A 4PSVA 1XTIA 1PLJA 1XTRA 2WSSA 2ZS7A 4CEHB 2PZFA 3WRYC 1W0JA 2VYFA 2FPLA 1NMZA 421PA 3FHTA 1ZU4A 1B23P 2IC5A 4RY2A 1YR7A 4XH9B 4UXJA 4HZIA 1FP7A 1ZM2A 4RZUA 2ZRGA 3DDCA 4HAYA 5DN6A 3RSLA 4DXAA 1HQYE 3QBTA 2AR7A 2J45A 2OV2A 3B1WA 4QJ4A 2MMGA 2ZI4A 5GJBA 3T06B 3QKRB 5L3SA 4MGZR 4MGYR 1G6HA 2OUKA 1KZ7B 2V55B 2JLSA 2BMEA 2QTVB 2VHQA 3TVTA 5CLQA 5KNBA 1MO5A 3E2IA 1KDPA 3NBZC 4LJ5A 3PEUA 1NN1A 1II9A 3TNFA 4M9ZA 4TLAA 1DOAA 1IJFA 3L82B 2QPTA 3EARA 1M74A 4CEJB 1Z63A 2EFHB 4ARZB 1W4AA 2OM2A 2ZSEA 2IYRA 4KXFB 5DYGA 4U02A 5KOYA 2IYVA 2XXAA 2PLFA 2Z83A 3TIFA 4B32A 2IUSA 5FTKA 2RGAA 4QBHA 2HEIA 2WPDD 1EX7A 1VCNA 2XNSA 3O47A 4DDUA 3U6KA 1XBTA 3AVTA 2LKDA 5GJWC 1Q1EA 2FN4A 1YJ5A 2BKUA 1M2OB 2C9OA 4L15A 1FOEB 3L2OB 2ZRNA 3IHLA 2RGEA 3DM9B 2N1BA 3CLVA 1K6MA 1G1MA 4R98A 5IHPA 2J41A 2FWRA 4B74A 1V43A 4C3ZA 4XWKA 3DOFA 3M1IA 4QHSA 4A0GA 2ZI6A 4TZ6A 4BQSA 2RGGA 3A8TA 3VFDA 5JEEA 2AWOA 3SI7A 4TMWA 1NIJA 2K5UA 5G53C 4AG5A 1JALA 1WCV1 4KBFA 4Z8XA 4TMTA 4QC2A 1T5LA 1LTQA 2D06A 2JLWA 121PA 2BOVA 2OT3B 3SNHA 2Q9CA 1GILA 2N42A 5EP2A 1G3IA 1ZNZA 1L4UA 2VL7A 2R6DA 4KYUA 3B85A 4D4JA 2IA5A 1S3GA 2PMDA 4NCIA 4GSYA 4OHYA 1I2MA 4I1VA 3GLHA 4NHOA 2O8DB 4R2HA 4U5XA 2C8VA 2OCAA 2PX0A 3BB1A 4OQNA 1GDDA 2X2EA 1OPXA 4OHXA 1VCOA 2G77B 3QENA 1YU9A 4YXWD 4LZZA 1NRJB 1BIFA 1E0AA 1G5RA 1TAGA 2JATA 4JBYA 3BJIC 4OJQA 2ZS9A 3EC1A 3UXMA 4KYIB 2ZRBA 1NNEA 1QHHA 4LK2A 4KO8A 3C16C 2IS6A 2V9PA 2JLYA 4LYFA 2IYYA 1ZNXA 4A0FA 4O2RA 5FR1A 1W4BA 2FOLA 1RRPA 4LDJA 4RKFA 3THWB 2PJZA 4M1WA 3BAFA 4W5WA 5CJPA 4OI0A 4H1VA 2ZJZA 3QF7A 4F91B 5JS7A 2JDID 3LRPA 3SU8A 1A2BA 3EZ7A 1XFAA 1ZM9A 2AKAB 2P67A 4BGDA 2QU8A 1KJZA 2XNDA 2ZRKA 4L9SA 3GLIA 1OB5A 1XD2A 4KLZA 3RDPA 5JLJA 2IS2A 3X1DA 5JWOA 3QXHA 5BWMA 3UG6A 1QBKC 1VCMA 2FGKA 3OEHA 1H8EA 5KDOA 4NMMA 1RRGA 3MAAC 3K70D 2IWRA 4WZ6A 3T1OA 4PPFA 2GNOA 4F7WA 1Z3IX 1ZUNB 821PA 1FTNA 5HCIA 5J40A 4A4DA 2PZEA 3L8ZA 3M0EA 3OEED 2ERXA 4IHQA 2RB4A 4LBWA 4QL3A 3GLFA 3N70A 4TYPA 2R62A 1R8SA 1DG3A 1BYUA 4Q66C 4DSNA 2OHFA 4FMDF 4D4LA 2IWHA 1SKYE 3ECCA 4Q7JB 2QZ4A 2VA8A 5UKDA 5CDFE 2JIZA 3MWLA 4AC9A 5HE9A 4LCBA 1SXJC 4DCVA 4DVGA 1XMVA 1OIXA 3GQBA 4HDCA 1G4UR 4CF7A 4AYXA 1VIYA 1SZPA 4PHTA 4Q7KA 3G0HA 3F3YA 3AVQA 3PVSA 4WZAE 4Q1BA 1DELA 1Z0DA 3LO5A 3FOZA 1Z47A 2HF9A 3HWSA 5CITA 5JHGB 4KU4A 1ZM3A 2OCPA 2R9VA 3KJHA 4GOJA 3FMPB 1R7RA 1KI7A 1XPRA 1XMIA 1NVVR 2GJSA 2A7QA 4O2LA 2QN6A 1GFIA 2RGCA 1RVDA 4M1SA 4E09A 4I99A 1TF2A 5E95A 2Z5FA 2QA5A 1UM8A 4EKDA 3K9GA 3EA0A 1JJ7A 2QAGA 1OV4A 1ZP6A 2OBMA 4BLOA 2ZRPA 1VTKA 4KV9A 1LVGA 2H16A 3AP3A 1C9KA 4A92A 2FF7A 1FL9A 4IOJA 4BZPA 1ZUIA 1LW7A 2ZI5A 4DDWA 3U7GA 2XJ4A 1U8AA 2W6ID 1UEJA 4YXWA 1IN5A 2YWGA 4JIMA 4NYMR 4I1UA 1NKSA 2MSEB 5J4YA 2QNRA 8OHMA 4OQFA 1KSFX 1DG1G 4ZDKA 3GJXC 4W5JA 1CRQA 1YR9A 4P4SB 4TL8A 3RS4A 1FQKA 2ANCA 2VQSA 5KDDA 1KAGA 3LLMA 5JSZA 3QXJA 1ZINA 1JR3E 4JLBA 4JT4A 5FBLB 1CU1A 1Z0FA 3GLHB 4LI0A 4DEXA 2XZOA 4PC3A 4EJSA 1W36D 1E9DA 4HB3A 2FEMA 3B8HA 4LHZA 1KSGA 1WA5A 4OQMA 3D6TB 4IDOA 4C4PA 5BYKA 1P73A 2F3TA 3B13B 1BS1A 4YLGA 5A5GA 1ZC4A 5SZKB 3UMRA 1IAQA 4MRVA 1G64A 2V7QA 3DZDA 2R65A 4HEJA 1UKYA 4RVCA 2HXYA 3X1ZA 4M9QA 3THXA 2JJ1A 1K5DA 2FSIA 4N0EA 4UXHA 4QBIA 1R5BA 2GZHA 3GJ0A 4MUAA 2D3WA 4W9MC 3T1TA 1TEVA 1Y63A 1KIMA 4ESVA 5KO2A 3MJRA 1G291 3RC8A 2DFLA 4X8OA 3AP2A 4MGIR 3QXCA 3EA5A 2I1QA 2CEAA 2P6UA 2V8OA 1T3SA 2XOKD 1HE8B 4OQLA 1J8YF 1G5TA 3R7WB 4MDEA 1JPJA 2F1HA 3GLHE 2BWJA 2YWHA 3SJAA 3PR1A 2FSFA 2ZSFA 1XTKA 3ZIAD 4B48A 1IY2A 3HR7A 3VU9A 4LC0A 4TL7A 2G9NA 4LHXA 1F3OA 4C7OB 3UATA 1AGRA 1SVSA 3U7EB 4JLNA 4DJTA 3CRRA 1DE0A 1E1RD 2VSXA 4P32A 4LJYA 5IRCD 3EPKA 1I4LD 4TMKA 1Z6XA 1SXJB 5DGXA 2PLRA 4BPBA 4NH0A 1WRBA 3FWYA 4R9UC 4I1SA 3OHMA 3A1TA 3TBKA 1N5KA 1XMJA 2IXFA 4IKEA 2O0KA 2OEPA 5F3WB 1EFCA 5SZJA 4LHYA 1NSTA 3JZAA 5DI3A 4Q9HA 3AVUA 1W2HA 4GPTA 2BHRA 2ORVA 4FIDA 3ZZUA 4LJ6A 2YOGA 3KJEA 3ONWA 1Z07A 1UBFA 1E2KA 1EFRA 3AF2A 5CM8B 4L4UA 3ZZTA 4B47A 3IUYA 1GNRA 3ICEA 4V0LA 1D2NA 3BH7A 4EFMA 3S1AA 1DO2A 3ICQB 3VNVA 2CVHA 3LNCA 2GJ8A 2R44A 2RH5A 4TMXA 4XWOA 1YVDA 4ZDIA 2Q9AA 3B1ZA 1NVVQ 3ZQ6A 1E2QA 2L0XA 1Z6YA 4NYIQ 2X1VA 3C15C 4JLKA 1NBMA 1ZUHA 2IXEA 5EUMA 2V6IA 1LFDB 5L8VA 4D4MA 4QBGB 1IM2A 2BBOA 1TADA 2KSQA 1CEEA 1GL9B 2BM0A 2SHKA 4GRAA 3GLGA 4OKSA 2JAQA 2DFKB 4IW3B 3R8CA 2IBMA 2NZ8A 4II7A 1UJ2A 3Q72A 3SN6A 1KI1A 1WBBA 4BRWA 4U00A 2QP9X 4NKRA 4A0HA 4UNPA 3ZJYA 2AK3A 1EGAA 1XDBA 2OAP1 5CIQA 5DH9A 1Z06A 3T1QA 5E7MA 1CTQA 1KI6B 2GILA 1Y3AA 2PEYA 3RWMB 1GIAA 3B1VA 3B9PA 3QY0A 1KY2A 4B76A 1MT0A 1AN0A 1S3SA 2QM7A 2GXQA 3CUEF 1W1WA 3VTKA 5E4FA 4R71A 4PSAA 5BN3A 5JS8A 1BOFA 5JSZB 1BH2A 1CIPA 3MLEA 2CLSA 2GJAA 3U7FB 4HAWA 3QXXA 2VEDA 2NO1A 5L3VA 4ZKDA 4EJSB 1J90A 3TQCA 4Y0VA 1TF5A 3KXIA 3NTUA 4A6XA 3K70B 2H1LA 1W0KA 4A6PA 1COWA 3QE0A 2QSYA 3AVYA 3U3KA 4TL9A 5EJEA 3PG5A 3QEJA 2Z43A 2O0JA 1AQUA 1MR3F 5C4MA 2VBCA 4WOPA 3TK1A 1G9XA 4TYQA 1W4RA 3WYGA 3ZVNA 4URWR 1S2MA 2YZ2A 4A15A 1HA3A 1W5SA 1PV4A 1OJLA 2BJVA 1E2PA 1T9HA 4UJ5A 2C96A 2HXSA 4XVRA 3ZVRA 4F4IA 1OXVA 3A37A 3A36A 3HYRA 2QBYB 1UBEA 2JJ1D 3ZZ0A 4B73A 5FPSA 3PXGA 5CB6A 4FWIB 1N3BA 2FG5A 2ZUBA 4EQ6B 2QUZA 3EIQA 1NLZA 1GKUB 2ATVA 2ZRLA 1E0JA 3PCRB 5DIFA 2PZGA 3WHLA 3I92A 5AUQA 3UK6A 2GXAA 2D7DA 3BB3A 3KQKA 2F6RA 1DAFA 5KPJA 3R9IA 1OE0A 2OZEA 4EDHA 2WZQA 3VKHA 2JLQA 3NC1C 2QQEA 2WHXA 4JKYA 3SC3A 3EZFA 4EPXA 2XTNA 3LV8A 4OK6A 2EVWX 3EIHA 3TSWA 1HT2E 1U0LA 3I3SR 3U44B 1M6NA 3W3AA 4B44A 4CDGA 1TUIA 1Q1ZA 4HLUC 1UEIA 1JBKA 1AKYA 4KFSA 2QMUA 2D2FA 3D3QA 4LV8B 1JEDA 5KUTA 1SVWA 4FMCB 4TTQA 2G6BA 1TU4A 2W6IA 5IK2A 3WMEA 2OBLA 3SHFA 4BFSA 5FUVA 4P4TA 2C03A 3HU1A 4D25A 1UKVY 4OI4A 1RIFA 1XCMA 1YR8A 1ZM7A 4WVFA 1P9WA 2R8RA 4D80A 3U3OA 2IUTA 3CF6R 3F8TA 1KGDA 4DCUA 1OKKD 1KDTA 3MSXA 2CJWA 1P61B 2CHQA 2KB0A 4MKHA 721PA 4PQRA 1OFTA 1GRQA 4AKIA 2HLDA 4MITA 1G8GA 2QI9C 4CVNA 1GL7A 2QE7D 1JXOA 3OIVA 1LS1A 3PEVA 1KNQA 2IXGA 2JJ2A 1PUIA 4Q4LA 2O8DA 4RZXA 3THYB 1RJ9A 4A8JB 2BBWA 4KLNA 2WWWA 2RGNC 4ACBA 1AZSC 2QG6A 3AF4A 4P3YA 2LKCA 2JLVA 3U7HB 3O8CA 4TSFD 3V00A 1QVRA 1XEXA 4URVR 2ZSBA 1TPZA 1ZD9A 3FFBA 4HAZA 1S0UA 2EWVA 2QT0A 3V4FA 4K46A 5CYPA 4AD8A 2O8BB 1G3MA 4ITRC 5FPYA 3EWSA 3L0IB 4MRSA 4RZ3A 2IT1A 5IDVA 4JL8A 1KO4A 3B5JA 1FNNA 3GP8A 4K81B 2A5DA 3QKUA 1HT1E 1W46A 2D2EA 2PMKA 4O0MA 5A0FA 5FUXA 2KJQA 1NVXQ 1VMAA 2W58A 2F9LA 2Q3HA 2HJGA 1XX6A 2RHMA 1H8ED 2ONJA 1RZ3A 2O5VA 1TL7C 3OEHD 4FW9A 1VDZA 1MOZA 1NBME 1ODFA 4JLJA 4Q47A 3FPAA 3ADCA 4MYCA 4FCWA 4X8HA 5FTLA 2BEKA 2V1UA 2H18A 1G8FA 3LQRA 2F7SA 3SYNA 2W83A 3WNCA 2ZVPX 4PO1A 3O8DA 4M9SA 4C0LA 2HDNB 5KNCA 5CYOA 3W8NA 5TDHA 1XTSA 1S4QA 1T6NA 3C7KA 2DWPA 3GLFB 4P4SA 2QTHA 1ONBA 1N6OA 2OLJA 1TF7A 5JRZA 2D7CA 5LD2B 3AF3A 6Q21A 2CL0X 3T5DA 2JLXA 4D6PA 2WAXA 3GEHA 621PA 1VECA 1ETUA 2HLDD 2PX3A 3G82C 1CXZA 4TTPA 3AP1A 1AJEA 1G4AE 1JQJC 3CH4B 3QF4A 2GKSA 2REOA 2QEQA 2HUPA 1QHSA 3AF1A 4KJZA 2IYZA 3FVQA 3W34A 3I62A 3FMOB 1E4VA 4M2LA 3LLUA 2GAOA 1YZTA 2DFNA 3BERA 4FXPA 4B34A 2W2XA 2A5GA 5K8LA 2G1JA 1NLYA 2CE7A 1II0A 2IEYA 4H9GA 2NIPA 2FFAA 3IIMA 1GRNA 4G5GA 5JJLA 1T8TA 4C0SA 2GCPA 5D3QA 1U81A 2NO9A 3KKQA 2FZLA 3U44A 2RGXA 3AGPA 2REBA 4YMUA 4NDZA 1EWQA 2XTZA 1QG4A 5D3MB 3KTAA 1NY5A 1UPTA 4HLCA 1E96A 4DC9A 1UKZA 3M4YA 4XOIA 3W6NA 4MRPA 3VKWA 2FH5B 1RRFA 3EPJA 1G7RA 3CPHA 3NC0C 3RANA 2Q9BA 3QEOA 2J87A 1GITA 3CR7A 4GP6A 1N6LA 1CJTC 2IF0A 1FUUA 4BLQA 4X8MA 1H8HD 1FFHA 3MRSA 4DSUA 4O25A 3GLIE 2IS4A 2QP3A 2CCJA 3NH9A 1E2HA 4G01B 4Q4HB 4KVGA 3T15A 1FP6A 4C0AC 4C7OA 4QNMA 1MV5A 2PEZA 2YWEA 5DE3A 2W0SA 2WKPA 1CJKC 4LBZA 3T35A 1E69A 3CX7A 4DT1A 1V5WA 2JLUA 1ZIOA 1VPLA 2MSDB 5J4KA 3EWAA 4Q02A 1NI3A 3KX2A 2AD5A 4URYR 3ZGXA 1PVOA 1XPOA 2WM9B 1ZM4A 1M7HA 1Z2CA 4NCNA 2QE7A 3TUJC 4DWJA 1OYWA 5KNDA 3AKCA 3ASYA 2LCFA 3AVXA 2J3EA 3BH6A 4HAVA 5JECA 2W2VA 4FN5A 4A0RA 2GVDC 4URXR 2AFIE 1RJ9B 1Z22A 1N5IA 4DLRA 1OKKA 1W5TA 3KDSE 5J4LA 2O8FB 4R7ZA 5AJZA 2ZYTX 1U8ZA 3BORA 3MJHA 2EU8A 3FFAA 1S96A 1WDTA 2OE2A 3AB3A 3QVUA 4XD7D 4ZI2A 5F9HA 4OL0A 3IPYA 3AVVA 3RS7A 1O87A 2JLRA 3WBJA 3BOSA 3JVUA 3I72A 3W8RA 4LOAA 1P60A 2AXPA 3LAWA 3CR8A 3SDZA 2QENA 3WBKA 4WZBE 2VP4A 1F60A 1X1RA 4BE7B 3DM5A 3OAAD 2PH1A 2WSSD 2RGNA 1DAGA 1NVWQ 2DBYA 2VP6A 2V4ZA 2I3BA 3Q5DA 3QKSA 4JLVA 4IFBA 3WMFA 1TU3A 2QY9A 3Q8XB 1GOTA 3DO6A 2CNWA 2ZR7A 4RCYA 4EPVA 3FMFA 4DDVA 1TX4B 4QRHA 5DLQC 1FTSA 5FOUA 2WJGA 4JZKA 1KK3A 1JR6A 3P27A 4B75A 3WHKA 2ERYA 2XB4A 1WB9A 4C0JA 1XD9A 1KI6A 1YZGA 4DBLC 4A8JC 2E9SA 1PLLA 1SXJA 1I4DD 1UDXA 4X8LA 4IRUB 3L43A 1DS6A 2F1RA 2NTYC 1ZD8A 2ZRAA 4AG6A 1QDEA 1YKSA 4RFSB 5DISB 2BBTA 3AQ4A 5G3YA 3IIJA 3EASA 3LX8A 1N6KA 1I2DA 1ZAKA 5DI3B 3L0PA 4JVSB 4ZDWA 2ZJBA 4TMVA 3B2EA 3FGNA 1BKDR 1W7AA 3H2YA 2W6JD 4LV5B 2WWGA 1T3HA 5CJ2A 3KUCA 1P2VA 5AJYA 5FBVB 5TXGA 2ZAOA 1U90A 2PCJA 1G20E 4MRRA 4YMSA 4G3XA 4M0LA 5ELXA 2XSZD 4Y0AA 4QGFA 3AVPA 3IQXA 4NBSA 4Z1MD 4V0KA 4BZXA 2G1KA 3RS5A 3QBVA 3LFUA 3WXMA 5FBQB 1SKYB 4Z8YA 4V0NA 5TB5A 5D3MA 2HCBA 1RYHA 2VP9A 2W00A 4KI0A 3TAUA 4Z54A 4MYUA 4GP7A 2OILA 4M1OA 2GVZC 2UZ3A 1VYUA 1SHZA 1N6IA 2FMXA 3BGWA 4HB2A 3NBYC 3VX4A 3UPUA 5G3ZA 3AVWA 2JASA 2J7PA 2WKQA 5IF9A 5EXXA 4JSYA 2EQBA 2EFGA 2BC9A 4NPHA 2P0EA 3X1XA 4Q4HA 4U7DA 5F9FA 4C0KA 5C4GB 1CLUA 4ZIRA 3TMKA 2AL7A 5JBQA 5LD2C 1BMFA 5EE1A 4EPYA 4OHZA 1XMSA 3AGQA 1G3QA 4M1KA 3Q7PA 4NCHA 3Q3JB 2OFOA 4JL6A 4LRWA 1S1CA 2BCGY 1YZKA 4HLDA 2RCNA 1KO5A 4IXNA 3K9LA 2FU5C 3SR0A 1XXHA 3I61A 4YMVA 3AEZA 1QHGA 3TUIC 1QHNA 1N2CE 2ZE7A 3AUXA 3RNLA 1W2GA 1J8MF 4PO8A 4TT3D 2F9MA 4MGKR 3TSZA 4IDNA 3K53A 1Z8FA 2O8EB 3QNUA 4PZZA 1EX6A 3NHAA 4MKIA 1YZQA 3GJ7A 1L7VC 4PHFA 1JB1A 1Z0AA 2ZREA 5FPTA 4XTCS 1AIPA 2DPXA 5BN4A 3N2EA 2V7QD 2FPMA 1EFRD 4M1YA 3V4RA 4PZLA 2XZLA 3CWQA 1H65A 1DBSA 3LBIA 2ZI9A 1IY0A 1E2JA 1QHYA 4RD4A 3CW2A 2EYUA 3CRQA 1FMLA 2NPFA 2XITA 2AFHE 1SVKA 2G0NA 3W9YA 3PEYA 1HQCA 2IF2A 4E5UA 4CT5A 3I8SA 4B3FX 1G17A 2F55A 2QBYA 1HTWA 3LW7A 5EP3A 3IO5A 4BZQA 1KNXA 5BN5A 2J7KA 2ZUDA 2ZITA 4ACAA 4OQXA 1NN5A 4EQ6A 4ON9A 4HI0E 3GLGE 3CPJB 1TEXA 2XB2A 4TYWA 3THYA 2WBLC 1JAIA 3QPVA 1SHKA 4GFDA 4AI6A 1FUKA 3TH5A 4WAUA 3BXZA 1GTVA 1Q20A 4A2PA 2ZR9A 3VAAA 3C5CA 2B7BA 2XOKA 5G40A 1KO8A 1GP2A 4M1TA 2E87A 3LA6A 4Q21A 2VRWA 1ESMA 3GJ5A 1KDOA 2YINC 4G5QA 4HDQB 4RFSA 4C0HA 1RC8A 1JEEA 1EFHA 5IT5A 3A6PC 1BYIA 1N0UA 1WE2A 5LDDC 3H4MA 3FMIA 4V03A 1E6CA 2O8CA 2DFTA 3R20A 2P5SA 1Q1QA 4Q5IA 4Q9KA 4LC1A 2KBFA 4LPKA 1H8HA 1UDWA 1EG7A 2O52A 1XCGB 2CK3D 1HUQA 2GWHA 1KSJA 2D62A 2ZYWX 3QG5A 4PSKA 4Q1FA 4W5HA 3RRMA 3L0OA 221PA 4KCGA 1JAHA 1N6RA 5FL7A 1AGPA 1HURA 2FFBA 2Q3MA 3H86A 4PC7A 2QT1A 2V1XA 5JHHB 3Q9LA 1Q0UA 3WYFA 1LB1B 4BEBA 1G41A 3CO5A 3LVRE 3W90A 1KJWA 3SS8A 5B57C 2HF8A 2JIZD 4JLMA 2WJIA 2QRNA 3SOPA 2RMKA 2ZETA 1ZYUA 1J70A 2HV8A 2G0TA 4LGMA 1OHHA 5L3SB 1G19A 3AV0B 1XJCA 1R0ZA 2BEJA 2IUUA 2PCLA 1ZVQA 1Z6GA 3PIRA 2QRZA 4B3CA 2ECKA 4TSFA 5JJKA 2F3RA 1AM4D 4PTLA 3QF4B 1FMJA 1ZRHA 4BWYA 2AK2A 2ORWA 3GFPA 3ADDA 1XWIA 2BCJQ 4JT2A 4QNRA 3UMSA 2XXAB 2YV5A 2D74A 5CLLA 1XEXB 3A1SA 5DHAA 4A82A 3DHWC 4EUNA 3P1JA 3HDTA 1Q3HA 1VG1A 4OI2A 2XGJA 4Q7MB 2ZSAA 4CYMA 1QHIA 1GG2A 1ZC3A 2C5LA 2NGRA 4JMPA 1E79D 1RFLA 3SEAA 2CMKA 2GEVA 3U3MA 1OFHA 1RW4A 1OLOA 2ZANA 3KTAB 1Q1BA 4LPSA 4AKHA 3KQHA 1KK2A 4GBMA 4V0MA 1YE8A 2ZQ5A 5FTJA 1UKEA 2EYQA 3CNLA 1OSNA 1HH4A 2UVQA 4FWTA 3K70C 4JLOA 3TAHA 1AKEA 1T3LA 1Z08A 5TVKA 1YRAA 2C98A 1OB2A 4B2IA 5JRJA 2ZRIA 4A1FA
chains in the Genus database with same CATH superfamily
4RK4A 1I9GA 3H2HA 4UM7A 3SXJA 3TLGB 4QFMA 4G4GA 3REFA 2OHVA 1H9AA 5DLPA 3TDKA 2AWNA 3EVCA 3PFIA 3JARB 4L02A 4FHFA 4PPGA 1EBFA 1I7LA 2BFEB 2J3DA 3W3AD 1KZ4A 1KZ1A 4XLTA 3DXXA 2BZ1A 2GXUA 4GZ6A 1P3JA 1RWQA 1T8PA 2IDMA 2ZJ5A 1X3SA 4RKQA 2JFPA 2VYND 4CQLA 5HGXA 1E3MA 5EZYF 4D9MA 1H5NA 4G0ZA 2XF8A 3GUCA 3MMPA 5BSWA 3NUQA 4MS4A 3Q7QA 3T4UA 3TZQA 5K01A 3PPXA 1N2EA 4XDHA 3D8SA 5E2IA 3F6CA 1XZCA 5BSFA 1X1EA 2VPPA 4FZJA 2BBSA 4RVDA 5DTQA 1ZBQA 2J48A 2FKAA 2J46A 3ZN2A 3G02A 3MK31 1DUSA 2G1PA 1KOJA 2QAGC 2RCYA 4UBOA 4NCKA 5IH7A 2JHCA 2AFIB 1L4YA 2ZBFA 4L9RA 5EGNA 2J8ZA 3K9FC 3N2YA 1EGHA 1ZH2A 5GP1A 1LS6A 2X7XA 1JR2A 4LW8A 1Q7BA 1JDBB 1B1AA 2QAJA 4CM4A 1P0MA 3U48A 5B7GA 3HJHA 4EB6A 1H3FA 5GMOA 3BH0A 2H2WA 1ZG3A 2QAIA 2R48A 3E3LA 5BW4A 1O94C 2BR5A 2ZEJA 4H1TA 4I5GA 2O3TA 4CTOA 1ZO8A 2AXNA 4HR7A 5MDHA 4HQNA 4EY8A 3JW8A 3DEIA 1VLZA 3D8RA 4LISA 1XXHE 3MZ0A 2B98A 3BMXA 3L9XA 1XZ8A 4YV7A 2FZWA 2D2VA 1YZHA 4BV3A 1P1CA 5LYJB 3QU5A 2UUCB 1DTWB 4RDHA 1KY5A 4FDTA 1G21E 1JU3A 1UMBA 2G4CA 2GAFA 2Q5JA 3FNGA 3ONNA 3U6BA 3KXDA 3G89A 5ALHA 1K8YB 3GLIB 1WUJS 3DMNA 4IOLA 5BNIA 2AT1A 2BRUA 2VI5A 4AQDA 1JG3A 2GPBA 2B83A 1MC4A 3NKLA 3KR1A 1X1DA 3D4PA 4MW6A 2PK3A 4WCDA 4ZVVA 3RODA 3NWPA 4DCJA 4QAQA 2FYTA 2BSAA 1PJAA 4P83A 4YRNA 3RABA 2ZUUA 1Q0TA 3L6UA 3IEVA 2ZIXB 1YNSA 3DW3X 1NYTA 4WSOA 1AKWA 4IRXA 4YA6A 4ZQGA 5HKBA 2OB1A 4GOND 4JKOA 2VF7A 2JHFA 3ZY5A 1ZSNA 3LPNA 1EFDN 5T8KA 5AVUA 1WMDA 3QBEA 4YRCA 5HPYB 1FFYA 1BFUA 1BXGB 4UMDA 4KDRA 3SBEA 1ODIA 5K8TA 5J1SB 1T1GA 2H8KA 2D7JA 2DHCA 1K7XB 2J9ZB 1TKAA 1ULSA 3CF4A 3HJTA 2BM8A 4F3TA 1N8SA 1RCUA 4YDHB 4B6SA 4DLBA 1VBFA 4CEIA 2QP4A 4UXIA 4PSDA 1A50B 4LSZA 2X3FA 4Y6PA 1I7PA 1F17A 1XEFA 2A92A 1IY1A 3CLSD 3NVDA 2HZ7A 4JGBA 1CZRA 4ZAGA 2GDJA 2ZU0C 1NMYA 4B4KA 3L7IA 4QTUB 3OZAA 4EGAA 2WIGA 4R3WA 4WY2A 1UBLS 1XJ0A 5F5NA 3ZHBA 3ZS9A 2WM3A 3IP7A 5G0SA 2EFJA 4JBGA 1UBKS 1QGOA 4N6OA 5CAEB 1RQPA 5A1TA 1U9IC 1PYOA 1P29A 1UANA 2HDHA 2WM2A 4TLBA 1PR1A 1XVAA 1EK1A 2H7XA 3AZOA 3C4JA 3O3OB 2IH2A 2NUAB 2PNFA 1OJ7A 2Q8NA 2IQIA 2PMCA 5LQUA 3ZDAA 3RYTC 3OHPA 4WNAB 2Z4RA 1GNSA 1OXBB 2R7KA 3LBFA 1N7HA 1Y1TA 1M2FA 3BE4A 3EFOB 4QOHA 1SIOA 1KEVA 3N7TA 4N3GA 5A4DA 1SUWA 5DK6A 3NBXX 3MG9A 4YONB 1FDTA 1VLMA 3D3KA 4G9GA 3I01M 4M8IA 1M2JA 1OT3A 1ZNWA 1U0SY 2BMDA 3FOBA 4BEVA 4ENVA 4QUBA 1JLKA 3HLKA 4DV2B 3OVMA 1IB0A 1VHDA 3DPIA 2JJMA 2B8WA 1FS5A 2CC2A 5K3EA 1IZZA 4INOA 4LHWA 3V8BA 1IPFA 1H1TA 4HUQB 5ESDA 2ZM6B 3I45A 2EFEB 3R5XA 4FE4A 2Q5LA 3M81A 4RCVA 4XQCA 3WLFA 4DLAA 1ICIA 1T6YA 2W2QA 4RSHA 3VU3A 4YUZA 2YKGA 1KR5A 1J2YA 5TY0A 4C30A 2NXJA 4Q3BA 3GRAA 3V32A 2EX0A 3QVGA 2QRQA 3DBOB 4FDMA 1TUBA 2PIDA 3C24A 3SZMA 3GG9A 4UCXA 3RBAA 1U7UA 4U0KA 3WLLA 3T6KA 3KQNA 4X3OA 2AIRA 3ZIAA 1FBNA 2AUNA 3MTQA 5AW0A 3RVJA 1G8JA 1M8JA 2VDQB 3EIFA 1DIAA 4B34A 5JZVA 2IDJA 4KI7A 4LRTB 5ELMA 2NU7A 3PC3A 1R2QA 2AMFA 4OH7A 1A9RA 4F4UA 1CJVC 2FB9A 1A5TA 2PV0A 4DW8A 4L7VA 1FJ2A 2B99A 3EZYA 1JIVA 3AT1A 3KQSA 3MEQA 5SZHB 3SXUA 1OFGA 1OCEA 1R0WA 4C4OA 3Q2KA 1E2MA 2X5KO 4B5KA 4OD0A 3DHYA 3PWTA 3QW4B 5AW6A 3EZ2A 3ILHA 1DLJA 1M0SA 1MH1A 3F49S 5I51A 3N6XA 1TIBA 2QG4A 3AR4A 5HNKA 5LZ5A 2O7VA 2H5EA 3BC1A 5IM5A 2AKEA 2JGMA 3PP8A 1K2WA 3REGA 5LWQA 4AWXA 4F9TA 2OO5C 2FK7A 3E0XA 4DIFA 4PLGA 1YONA 3KR0A 3BKWA 3LP8A 2FWAA 4NATA 1X7XB 3JVEA 1II8B 2KWIA 1PZFA 1R0XA 3HQ4O 3MELA 2IU3A 3ZPXA 3D64A 1XMQB 4QRDA 2R86A 5FI0B 4H08A 2G67A 3FR8A 4GE0A 4Z0PA 4DC0A 1AK2A 2PS9A 2VDPB 3WLKX 4FDLA 2OORA 4JDUA 2BV3A 3RT9A 4GNRA 3ABRB 2X6RA 1B76A 1G8YA 5C8ZA 2PBLA 3H1TA 4XQEA 1VFNA 3AI3A 2HJ9A 1OVMA 4G5SA 4ERXA 5JIBA 4Q00A 3U3ZA 2NO7A 2GLUA 4B3GA 4KHZA 1X77A 1U0GA 1JFFA 1K5GA 1M8PA 1LDNA 2B2CA 1T3GA 2DECA 2XCRB 1LI7A 2E4AA 1GAEO 2I6TA 2Y76A 3DWEX 5K6RA 4JXZA 4JLSA 4QXRA 4TN1A 1SC9A 3PQFA 1AH2A 3HWWA 1LWOA 4UQOA 5TX7A 2WIDA 4Y2TA 5CEFA 3ORHA 1ZJ4A 2J0UB 3MXOA 3I4LA 1W59A 5LXTF 1JI3A 4ZCIA 2J9FB 1C7EA 3BIFA 3IALA 3QVVA 4R8RA 2BMAA 2EZUA 1CJCA 1NNLA 1Z5OA 4OKIA 5LXTA 3WO1A 4PZYA 5T6BA 2HIHA 4N01A 1JYSA 4RAQA 16PKA 3GRUA 2YNMD 3OT1A 1TJYA 4KGZA 5TJ9A 3KDAA 1QYRA 1SURA 1U99A 2UUOA 1GT6A 3IMGA 4TPKA 3ZJ5A 3IDQA 2QW0X 5AO9A 3UWOA 3TVDA 2WD9A 3PFKA 1YNOA 3O4VA 3DLIA 4D57A 3C14C 3NOVA 4DLWA 2ZRHA 3ZVKA 1TA4A 2QUBA 3IR5A 4KR9A 1I3OA 1O6FA 1S1MA 3FPJA 4WBXC 7ABPA 1JXQA 4G5RA 5EFOA 1OBFO 2QJOA 4IJMA 2YXLA 4JJ6A 1K75A 3KQQA 1KAOA 2E7ZA 2JBHA 3LUAA 2MDTA 2YRWA 4MW9A 2HBZA 5F21A 1NXVA 4X97A 3ST7A 3DOEA 4WI1A 3MWFA 3RG8A 3KWJA 3TR5A 2XIJA 3TW0A 2DSTA 5EL0A 1DO0A 3OLYA 1PZNA 3MRXA 4O6VA 3QJ5A 1LBEA 3D9QX 4BO7A 1G5IA 1O03A 1ZBDA 1JPNA 1YMQA 2J3JA 3QPCA 1FPMA 1CQIB 1CJSA 1CJUC 4MR9A 4XGNA 4Z7QB 3KFXA 6ABPA 3FUCA 2NAPA 4YH1A 3D5EA 2B20A 1E3SA 1OGIA 3JSXA 3KB8A 4HAXA 4LDPA 5LMNB 4C4TA 4L0CA 1L6IA 2LD4A 3BFKA 1BH6A 1CYDA 4NHEA 3T95A 4BO9A 5I7WA 5BMVB 2BFAA 3FKSD 1KMHB 1YDGA 1WZIA 3ONFA 3RJMA 2ZE5A 3KZ1E 3HSKA 5AJTA 3H5OA 3SJ7A 1P1RA 3E9CA 4N3AA 1A4RA 2ZSUA 3LG2A 3OIYA 3OZRA 3WZ2A 1GAWA 5IULC 2IEAA 4OP3A 4WXRA 1G18A 1H6BA 2O9JA 2N1MA 1AXRA 3BIWA 3GT7A 2V0GA 1OC4A 1UBTS 3L05A 3O4HA 3CVWA 2GK6A 2DUJA 1KI8A 4BFXA 3K96A 2QYHA 3B1KA 4D8XA 4BO5A 4H2DA 3G7NA 2EEPA 1QKJA 1EP2B 3PUIA 4D96A 2OAEA 2JDIA 3WGGA 4E88A 2C94A 2VHZA 1IOWA 4DUZB 2WICA 3ASZA 1JZSA 1SKUA 2H57A 3LUBA 3ODGA 1ANKA 3BJRA 1Z68A 3NHUA 2EKBA 4Q18A 1A4UA 5L3RA 1QRDA 5HTKA 3RNOA 4A0QA 3H1BA 3PUWA 1E4OA 3O9ZA 4PPYA 2ZSJA 2R8ZA 1E79A 3KEMA 4CPDA 2F8SA 1KQPA 3NH6A 1R8QA 4MQLA 4E1BA 3IPAA 2X9QA 3P4XA 4TYNA 4QDJA 2PUFA 1WABA 3SYLA 1P19A 4YCSA 1F2UA 1GKIA 4GMGA 3SX0A 3OT4A 2VK1A 3AL0C 2HQRA 3EAQA 4MS4B 4LE0A 3F71A 4XXHA 5E3IA 2NXEA 3HA7A 3NWJA 2ZBRA 4DQXA 4F2HA 2H1CA 2AVNA 4B33A 2NSLA 1ZS9A 1U3DA 1MN6A 3K20A 4KLCA 4OQPA 3RLFA 2DG2A 4GWGA 1R66A 4LZPA 4XIIA 3T3EA 2TECE 3CQ9A 1TUEA 4FS8A 4M7OA 4MUFA 4B4VA 1J23A 2Y1CA 4BP9A 1L7XA 2VZ0A 2PVSA 2AUMA 2VBGA 5BRNA 2HPVA 3B1XA 1D5CA 1RM5A 3PXXA 3RRZA 1ITZA 1IULA 5CTAA 4D81A 1WPRA 4CCYB 2CKMA 5A3SA 1OA0A 4RENA 1QYVA 4C01A 5IKPA 4IUCS 4R2JA 4WBSA 1FEZA 2OWDA 4I9GA 1GSHA 1PFVA 4MV6A 1SD1A 1G5PA 3K0CA 3H5AA 4ZVMA 4L8GA 4CUKA 4EHLA 2VCHA 4MKRA 4D0GA 4NRDA 2DFPA 1JBQA 4Y6LA 3TLXA 4G0WA 1KMNA 4PX9A 1GCOA 2QXTA 2J3HA 2WWIA 3QLTA 1HGXA 4MUYA 2FHPA 1L3CA 4I4TF 1RI1A 4QASA 3AY3A 3CPEA 2FUG6 2OFWA 1GR1A 5EJ9A 1KKUA 2BH9A 1FNBA 2IW3A 3DUFB 3WRYA 4YAFA 4CIXA 4KE6A 3VH2A 1V1RB 2XXBA 2OORC 3AINA 4EEKA 4ZMRA 4A9AA 5JD3A 4YAEA 1Q22A 2ZRQA 2CJWB 3B51X 3MB5A 2QL7A 3QBJA 1CQPA 4JLDA 3ZCRA 3AR3A 2MOKA 3ZVMA 3NUGA 2PD3A 3WL4A 5IN4A 2ZLBA 4YFYA 4ZK2A 3NASA 1XZLA 2JANA 4F21A 2XMGA 2OXCA 3I52A 1I0ZA 1AKRA 3RF6A 2RFLA 3K0FB 4B83A 1JL3A 2O7QA 1U2GA 5BOSA 1H1LB 1GCAA 5K4HA 1YU6A 5F7XA 3H3FA 3F46A 2B78A 3L4KA 1XG5A 1UXJA 1BXGA 1Y4SA 1DMRA 1JW9B 3B9QA 3C3JA 4PC1A 1ZWKA 5DLEA 4Q4DA 2JD0A 3KT8A 1Z0KA 1GYRA 4IVPA 1TFRA 2DOKA 4RACA 4NIMA 4CGZA 4YUVA 4AUMA 3RSQA 2ROQA 1MB3A 5DHUA 1P5ZB 4JI1B 1WXWA 1GL6A 1X14A 1ACMA 4QNNA 1VRCA 4PXSA 2ZB2A 4ERNA 3ZE0B 1WG8A 1Y4DE 4URZR 4D02A 5JH7A 3MJDA 3B5EA 2WZDA 4TVKA 1K06A 4Y6QA 1QC5B 5AK4A 3FPSA 3H3JA 1YRBA 2ZZMA 1U3CA 4N03A 3VUEA 2GN0A 3SQNA 4YDSA 3AM3A 3CX8A 3WRXC 3M3DA 4Z6KA 4P3PA 1I4TD 4P82A 4TQUS 2HSGA 1V7CA 1O96A 3CEAA 4C0XA 5FPKA 2HX1A 4RKRA 4PR0A 1LBIA 2EQAA 2VF4X 1E6UA 2D4HA 4DTIA 5B3JC 2BM1A 4GOKA 1I33A 2H1IA 3A4MA 2X1LA 5BQ3A 3BWCA 1P1BA 3IPLA 3KTOA 4CMBA 4COKA 4CG3A 5HRUA 5BW6B 3DE3X 3SQOA 2JGKA 2D13A 2FKNA 2FPPA 1N6PA 3RFXA 3X2SA 4RTPA 4OXYA 1RRCA 1UXGA 4E46A 4HQ6A 1NIPA 2BFDB 3LXXA 1N36B 2GX6A 2VOJA 3K4PA 4QHTA 1CD5A 3QMVA 4HVCA 4HAOA 1SN7A 2FR1A 3QOWA 2O2DA 1EHYA 2GBLA 3GMTA 1ISFA 3E61A 1QS0A 1A3CA 1MH9A 1XI2A 1TYZA 2P9BA 4KWHA 1E1QA 2BKVA 2NYUA 3P5SA 3FYTA 2EP5A 4UZEA 4XARA 4BNLA 3K0CC 4J16C 3C39A 5JVDF 2A86A 3QVGB 2G76A 1TUBB 5LP6F 1M5RA 3BL5A 3UHPA 3WWDA 1H1DA 1CBUA 2MINA 3VR1A 5LQAA 2CSXA 1CKEA 2NSHA 4ROTA 5KMGA 1A2QA 2HHLA 3LWBA 3QU7A 3UMBA 2IYQA 3KR2A 3HNOA 1Q91A 1XYYA 1EVZA 3HXKA 5K0LA 3QEMA 2HN9A 1XZIA 3FMVA 1PJBA 4BKMA 2B2XA 4BVEA 1Q21A 3HR8A 5DV9A 1E2FA 4KXUA 3GRZA 3VUFA 4DCSA 3KKKA 4LYYA 3NG1A 1I1NA 2CL7X 4M38A 4YWJA 1LQ2A 2FN3A 4N18A 1RKQA 2CYBA 2Y6VA 3KEFA 3ZE1B 2XYQA 1E9BA 3A3PA 4WA7A 3VO9A 3USZA 1M5TA 1U94A 3AEYA 3IS3A 4R6XA 3M4XA 2WU8A 2CLMB 2WAAA 4KR2A 4HPWA 2EEZA 4IZ6A 1NPDA 1HE1C 4W5RA 3WWPA 3I2KA 4OSOA 5EQDA 3VNRA 4RANA 1F0YA 4H0NA 5EJAA 3G5MA 5J58A 2C78A 3OX4A 4Z1MA 5U4QA 2X19A 3FLBA 4P31A 1P2SA 4ARUA 2ZIFA 4KXWA 1CRWG 2VLIA 5J47A 2P2YA 2YXBA 1T9GR 2RBGA 4KLAA 2AN9A 1A98A 1L8QA 2E18A 4HNQA 5AOAA 5SYAA 4OX9Y 4X1KB 1VLVA 2FI1A 5CXSA 1GNPA 1QRSA 4KGDA 1NZJA 4P86A 1I7SB 1IN1A 3A05A 2WHPB 1X7WA 4XUCA 3P5BA 5TLSA 3SCZA 4NPCA 3AONB 2PQ6A 3BCSA 4K40A 1XNJA 4KN8A 4RGYA 1SRQA 3PKIA 3VHXA 4BB9A 1MVOA 3PSHA 1RAEA 4YYZA 3B1FA 3KSMA 4UUAA 4X1YB 5FOXA 5CA1A 1XTUA 3CNBA 1SELA 4R2LA 2EARA 2N46A 2WQ6A 1RE0A 3CUYA 1L4HA 3QKRA 3TFOA 1R74A 3L79A 3M49A 1U1DA 2Q49A 3AJEA 3SC4A 4C4XA 3GCWA 5FT9A 3EXFA 1Y6GA 3KJNA 3GYGA 1U3TA 3KOMA 2H0AA 2ZDQA 3G2IA 4UKDA 3E4CA 4YJHB 2O2EA 3R5SA 2UXBB 2OP1A 2RGDA 1DKLA 1XYVA 4R9SA 1G6OA 5TNXA 3R74A 1N5RA 1OYYA 3C3PA 1F8GA 1HYBA 1UF9A 2BUCA 2C3MA 3ABZA 3EVZA 5AHRA 4RZHA 1QCCA 2CB0A 3BMCA 4LIPD 1BE1A 4MR8B 3W6UA 1FLAA 4KW7A 4KIFA 2CNWD 1XU7A 2W2NA 3ZZNA 3KOOA 1OXKB 3HB0A 2J9FA 3RU3A 2JLZA 1MW8X 3KPYA 3PNVA 4UHKA 3M1YA 1OA1A 2XX3A 5AXDA 5B37A 4REOA 3EXG1 2QMHA 1TAQA 4HFNA 5IAGA 3S3TA 3VC2A 5EMMA 2WOJA 4ARAA 2PKQP 3CF2A 4MUBA 2Q4EA 1WQ3A 2VHTA 1QO9A 4RC9A 3B1YA 1GARA 3SLKA 1CUIA 3AX6A 1RQXA 2ODWA 2ODBA 3IKJA 4RCZA 1AQNA 3ETGA 4EBFA 1C30A 2C04A 4BL5A 2VTEA 4OUDB 5KTKA 3VOTA 4GEGA 1XK7A 2P6NA 2JFZA 2ZIAA 1NJSA 5HE8A 3WNDA 4A8TA 2VTBB 4BP8A 3EXIB 1FU7A 2TMKA 4JEHA 5EUQB 1LV7A 3H9JA 4Z51A 4OXIA 3ZD6A 1GDHA 1TNDA 3DLCA 2XADA 3GVCA 2PO7A 2X2PA 3JQ9A 4ZQIA 1TMOA 5G4KA 2HTEA 5CNMA 3AR8A 4E5MA 1BO6A 4EABA 1P4RA 4DCTA 2WU3A 4Q01A 3HJNA 1Z0IA 3WIOA 1XDSA 1V9SA 2YRXA 1QK4A 1L8AA 1IONA 3H65A 1KYXA 3FKQA 1KAHA 5JR3A 1HKHA 2FFQA 3N75A 3UJHA 4JOCA 2PSSA 4KITB 3MWEA 2QN9A 3W78A 2FJUA 3RC3A 3BRWD 3FJYA 3NEAA 3JR3A 2XYHA 3EUFA 2C97A 1OTHA 1YUMA 1KMMA 3LCVB 2DQYA 2O20A 3GRYA 3QVLA 3ZU5A 2WU4A 4FP9A 3VA7A 3T8YA 1GZ6A 1VGVA 4AYTA 3UENA 1F8UA 4KE7A 4ZKEA 3LDAA 3PQ6A 3I05A 1DX4A 1IPHA 2N0SA 3QYJA 1KMHA 3DFMA 4JJZA 2W6QA 4LQDA 1T9KA 2GUGA 4FU0A 3WLRA 4YUXA 2Y27A 5ALXA 1KBQA 1NX9A 2P91A 3DBVO 3EMVA 3IBSA 1I3MA 3NT5A 1SOWA 2IDKA 2VPWA 3COPA 3P26A 1Z4OA 3HU3A 3NPMA 4LSMA 3UUEA 1U3WA 4IO1A 4ZYYA 3B82A 3HXOA 2P6RA 1D2MA 2RARA 2XVYA 3TRFA 5TPZD 4HQFA 4YC7A 4C2AA 4BO2A 3B52X 2GN2A 3P20A 1GY8A 3SSOA 1S7GA 2Y99A 4F86A 5CEJA 4HWTA 2IZ6A 3GRPA 2BFWA 4B17A 3UMYA 2OO3A 4ZHQB 3IIKA 4RPLA 2RAPA 2X77A 3KAPA 4YPFA 2VQ6A 1CETA 4WFKA 1MEOA 4O2AA 3HO8A 2B8TA 3EZNA 3MW8A 4GMDA 1J97A 1EBUA 4XYMA 4NWIA 1VCIA 3WK6A 3ZWWA 4B6FA 3J81A 1L8LA 3B6IA 3DCJA 5DW3A 2HSEA 3RIGA 5A4FS 5IM4A 3PYXA 3Q9SA 2PSEA 3D2LA 4B3IA 2MSKA 2DPYA 4PNPA 2IYSA 3O91A 4CQJA 1QHEA 2DWCA 1B15A 2PRSA 3A4NA 3PE6A 4FFOA 3FXAA 1F2UB 2XTAA 4NK5A 2GKOA 4PSUA 4RH1A 4WXMA 3UC9A 3EVBA 4L27A 4L6IA 1XB2A 1VE9A 4QA9A 3AY7A 4DY6A 3DBRB 2VNIA 3ED5A 3ZCSA 1JFVA 1QH1A 1U3GA 1EQ2A 1E5QA 5EE0A 2R96A 1G8HA 1KFJB 3ESYA 4QGBA 1QE3A 1G5FA 3KFLA 4IXTA 1ZMTA 1E5DA 2XE7A 3I3OA 3TIGA 1AGNA 3N8IA 5ALPA 2UV8A 1KKLA 1XD8A 1I0IA 1KVRA 3DUWA 1Q0QA 2X9VA 3DA8A 3GELA 4FXOA 3WO0A 1YMVA 2Q3LA 2NO0A 4CI0B 1SXQA 1DGQA 5BURA 3PZRA 1J2EA 1DL5A 1KJYA 4Q9JA 2ERCA 3ZBQA 4MAAA 3TQQA 5K8IA 4ALNA 2ZPUA 5CD1A 1NRWA 1F2TA 2ZYRA 3TD6A 4NYJR 5FUMA 1YZVA 1HL7A 1U2DC 3QLVC 4N6GA 4RY0A 3BXEA 3I1FA 1EWTA 2I78A 3W6PA 4E5KA 1YDWA 2WG0A 2FUEA 4EIWA 1PDVA 2E5FA 4INZA 2UVPA 4U7WA 3ZDQA 3I09A 5E6SA 3CH5A 5BNWA 5CH5A 3BF8A 1B00A 1FMTA 3G2QA 2OCGA 4GOLD 1KEZA 5CT6A 3TOSA 4I4IA 3VYTB 4C14A 1HYHA 1LUAA 4JQYA 1XSEA 4B0PA 3QXSA 3B8EA 1O54A 3IOMA 1JDTA 5BV0A 1KOGA 1H4TA 1V1RA 3H9CA 4LVCA 3EW9A 3L1VA 4ME6A 4KN5A 2FRXA 2V3VA 4F6LA 1ULBA 5I9LA 3DB1A 4KTTE 5EHNA 2OV4A 2VSOA 5C8XA 3GNQA 3JVIA 1XL1A 2GFHA 3H8JA 4C08A 4HUTA 1NW4A 3RS3A 1M6WA 2QROA 1EFPA 1M75A 2R4QA 3L3BA 3N3AC 3U4GA 3WGHA 3KQPA 4WY5A 4OJQA 2CBZA 2FPSA 3M1AA 4NH4A 2R5NA 2YY5A 3KUUA 3OURA 4PHGA 3ZCXA 4EHFA 1RAFA 2CHUA 1R4AA 5HWSA 4BECA 4UDXX 3J81k 2ZAGA 3E18A 1M2HA 2KMLA 4IV8A 3O7WA 4P4UA 1LLDA 1NBHA 1Y1SA 3IQHX 3IXLA 4PNZA 4DLPA 4YB8A 5CDTA 4OX9B 1FZTA 1TQ2A 1OW3B 4ABYA 4LJ8A 1EWKA 2PV7A 1KJ8A 2P5UA 3BGVA 1UXKA 1Y1QA 2PWYA 4JJKA 4TV9A 4U7TB 4HD8A 2YYYA 2HU7A 4PAQA 2VSQA 3H6GA 5J2UA 4M6WA 4CKBB 2CCKA 3PKZA 2NP7A 1QUFA 1Y9AA 4OYRA 3DAFA 3UCXA 4K8OA 4DNXA 1G8PA 1K08A 1YR6A 3Q10A 3WLNA 3UGQA 1DXHA 4XLLA 1E77A 5D84A 2DYKA 1GRVA 4WZBA 1GQRA 1NDQA 4EAAA 2WD7A 5IBPA 3GN1A 2YY6A 4IDPA 4XFJA 4LF5B 4UUMA 2VJPA 9ATCA 3WQHA 2I3ZA 3HTXA 1QF9A 3CBQA 5HVNA 1N2CA 1HTBA 2B4QA 1Z5VA 2JAWA 1LBQA 4WKGA 1ISPA 1EUDB 5B58C 1KK1A 2GM5A 3UKDA 1C7FA 1LRJA 2EFCB 3FBTA 4KQGA 3RB8A 3A0RB 1ZKMA 2G82A 3LU1A 3N2GA 3W4KA 4L4ZA 2DQKA 1RYZA 4NOJA 3ESZA 1S7CA 5MHTA 2HCRA 3PDIB 1LVHA 3CNOA 1FSZA 4WERA 2IELA 3O4IA 3ND6A 5BWLA 4Q6BA 3S99A 4Q15A 5IXJA 2H5JA 3LQ1A 4ZJZA 4ROSA 1XZQA 4TUYB 1AO3A 1T15A 2ZRMA 3EB9A 3HVJA 3JQGA 1WOYA 3AF5A 4QVGA 5AJVB 5E2AA 3TNLA 5J4HA 1OZGA 1U7OA 1M73E 1PQUA 2QVBA 5AK6A 3TRIA 3TLAA 2WFLA 4U7JA 2E37A 4HEHA 2DTDA 2Z58A 3LMKA 5CT9A 5H68A 1LPPA 3WGYA 1H42A 4PYLA 3I1YA 3VR6A 2NMVA 1CDOA 1NDHA 3QKTA 5HILA 1AZWA 5AK0A 5DYYA 2OAGA 4QM7A 2PKEA 4C4ZA 3E4DA 5CG1A 4Q4CA 2I2CA 5ADWA 2YOHA 4RORA 2WUGA 1AGYA 4MA4A 2MINB 4JU8A 3ETEA 1QG6A 4F3YA 2COUA 3V2IA 3CSUA 3IR6A 5AXAA 1BQ3A 1WHTB 1TJ4A 4GI7A 4GZ5A 4K9NA 2CXHA 2PX6A 1KQOA 2XODA 1Y5NA 1OH6A 3KJIA 3LQ4A 3W5JA 5KJ6A 3KXPA 5FNVB 2DLDA 1SCJA 1ODTC 2PT5A 3DR3A 3EMDA 1PJ2A 5ANRB 3GPCA 2XZPA 3FRIA 3V33A 1UDAA 4MR7A 4UVDA 3FG9A 1JHVA 2WFMA 2I4OA 4EUFA 4LBVA 1WF3A 3HFRA 4H4DA 4OGWA 1HLGA 4WN3A 1QLHA 5EP1A 1EYZA 4TKVB 1E2LA 4QG7A 3VX3A 4QG3A 3FDIA 3OCJA 1JR3A 1WEKA 2G06A 4OHUA 4M4SA 4QU0A 3MD0A 1JFTA 3S8EA 2FMIA 4JROA 1NQUA 5KCMA 4DJAA 4F2DA 5EE5B 4EELA 1TTQB 3ES9A 4DGSA 1EVLA 3GXBA 3W5CA 4U3JA 4LE1A 2BKEA 1YB2A 3EZ9A 3OA0A 3UK0A 4HDRA 1QONA 2J5BA 4P7JA 4E11A 1TJPB 2PTGA 1WJGA 3QHQA 5B2ZA 5H81A 2OO7A 3GLFE 1MVLA 1P81A 3RRXA 2BHSA 3PZBA 3QJYA 6REQB 4OFBA 2ZTVA 1VQ1A 1WLYA 4LECA 3UJ8A 1I1OA 3O8NA 2BDTA 2Y0EA 5HZKA 1ABEA 3BICA 1KDZA 4EEXA 3THXB 4TRMA 1WNTA 4TWRA 2PMFA 2BE9A 2BP7A 1CQXA 3BXXA 2F1KA 2VDOB 3KUXA 10MHA 1EWRA 4F4JA 1KFBB 4HGNA 3B48A 3M6LA 4E5PA 1VB5A 3BGOS 1RMYA 2QRPA 5D8DA 4Z9XA 3SYRA 3VOBA 4C5BA 4CKZA 3QIVA 4TX1A 4RHYA 4AKSA 3DEFA 1H66A 3BWBA 3KKOA 3NV9A 4Q3OA 5HFJA 5HM6A 3HB9A 3D0KA 4ID3A 4KREA 4AJKA 1XEWY 4INPA 2I33A 3LY9A 1E94E 3FOCA 2QGNA 1BROA 1GLGA 3P4YA 2DHDA 4X7BA 3JRNA 5KQSA 2DSNA 4O1HA 1RRKA 4V0ME 5CHEA 1ZVKA 3OM9A 3KJXA 1AO0A 4D2IA 4OBBA 3GI1A 4FEGA 4BFLA 3X1WA 3TX2A 1NOJA 3MMNA 3EGOA 1WMBA 4YJHA 1N25A 3EZ6A 3VKGA 2G25A 3PDCA 1HFEL 4P08A 1TO1E 1TYCA 4OK5A 1R15A 4ZPXA 5A7FA 2CFRA 2J3IA 2XNCA 4H7IA 4R8MA 1ADBA 1DI0A 1PZXA 4I9NA 2ZGVA 2C2HA 3VU9B 4IDAA 1XZKA 1Z7BA 2OOKA 1M66A 4Y6RA 1Z6AA 4YCCA 2GBCA 5LIPA 4CCAA 3V1NA 2F43B 4LOKA 4RTQA 2A3NA 4ZJYA 1R6BX 1UZUA 3Q88A 4O4LB 5J5VA 3K31A 1SD2A 5A04A 4DLKA 4RZSA 2C99A 1JIKA 4N8SA 5DTJA 2XGMA 3GEIA 2A0YA 2PBRA 3JVVA 3UEOA 2BF4A 4CCSA 4Q82A 5JCZA 2GTPA 1M10A 3I0ZA 4D44A 3ZJUA 1F20A 3JQBC 3AHCA 4LYAA 3NIFB 1IEXA 5H1YA 2QK4A 1FP1D 1JTFA 3FBWA 4DLZA 2UZAA 3FHCB 3FWPA 3HXPA 1SAYA 1G3RA 1UFQA 2VTDA 4K9RA 5FI1B 5DXAA 3FNBA 3TL2A 1WY5A 4F4IA 1BNCA 2NSJA 4ZOEA 5BWNA 1X8JA 2IODA 3OZUA 1DTWA 1KHTA 1U80A 3FCCA 3G2OA 4AWBA 4MVJP 4XM1A 1ZJ5A 4CU2A 2WEKA 4ZHSA 1QIMA 3GARA 1QYXA 1YR3A 3OKAA 3VI3B 3VI4B 3NTOA 2GPNA 1RM0A 4LXHA 1A76A 2P5TB 3DZIA 1JWAB 4KAJA 4MV8A 3L0BA 5IJ9B 3JQDA 5KAMA 3WRYC 1W0JA 1WCWA 4CEHB 2FPLA 2JGAA 1FS6A 2X9GA 3ESCA 5JQWA 2IC5A 4CIYA 1Q14A 2UYYA 3AYXB 4OO3A 2EW2A 4FS3A 3IQZA 1WMFA 2NU9B 4DKJA 1XDWA 2ZRGA 4RZUA 3HVKA 4HAYA 1BS9A 3CYFA 3G2NA 5DN6A 3SIXA 2AYZA 2J45A 2ODTX 2CUNA 1A0OA 3BK1A 3C8HA 5F9MA 4E5YA 3IPCA 4HSGA 3ZLUA 4F3RA 4Z5XA 2UUAB 5AW5A 4CCWA 2OECA 4MGZR 4P4GA 1ZGGA 3KT0A 1V5EA 3QELA 4C7VA 2BMEA 1T4BA 1GGNA 3NBZC 3E2IA 1MF7A 4LJ5A 1ZQ1A 1LEHA 3O9VA 3SZLA 1R4MA 4MQMA 2J6CA 4L8LA 4M8LA 1C8KA 1GGVA 4OHOA 4TLAA 1IJFA 2IXAA 3GF4A 2DJ5A 4UM5A 3TO5A 2JARA 4EW2A 4ZZIA 3F7TA 3R9KA 1JHQA 1T9ZA 4ARZB 4KXFB 2OM2A 2VH1A 2XXAA 2GPYA 4U02A 4JI5B 5KOYA 2Z8XA 1UFVA 2IUSA 4R8LA 3DFUA 4WADA 1MOSA 2HEIA 4MQFB 1XF1A 3N0XA 5AVQA 3PCXA 5GJWC 3O2JA 2PUWA 3HWRA 2Q5CA 1N0IA 2DH5A 4MV1A 3UTCA 1KIAA 4H59A 2QTBA 4MPTA 4ZCRA 2EHJA 4BXOB 4E3WA 1UK8A 5CDGA 5CVDA 2FXIA 2N1BA 3CLVA 1K6MA 1SEPA 3WOVA 4NARA 2I7DA 2J41A 2FWRA 5TPWA 3OCZA 3UNXA 2MU1A 5IHPA 2JIMA 2HQSA 3DOFA 3P19A 2VCEA 1O2DA 1YCDA 3F4BA 2HA4A 3VISA 5HM8A 2RGGA 2WSBA 2OZPA 2ZIEA 1U3FA 3OM8A 3RC2A 2H1RA 3X1MA 5IC4A 2P2CA 1J2RA 5DMHA 2A94A 2K5UA 3IMKA 3V7WA 3K16A 1WCV1 1T4CB 4KBFA 4YMIA 1ZKDA 4Z8XA 4KO4S 4P3NA 1BTOA 3KT3A 1LTQA 3PRHA 3G6WA 4GHWA 1Y82A 2Q9CA 3N8GA 4IMRA 5EP2A 1EA5A 3WFJA 5ALTA 1DJPA 1RYBA 4D4JA 2PMDA 2O2ZA 2DX7A 3AFHA 4NCIA 3NIGB 1OBHA 3OZVA 2PGIA 1MFZA 2GTHA 4MHSA 1SUFA 4EWLA 1F0KA 4G24A 1M0EA 3NHKA 5KBYA 4WL0A 3TCXB 1V8OA 4LHEA 4YV1A 1PEKE 4AW9A 4BKUA 1ZZGA 4U7PB 5JYDA 2C8VA 3N58A 4YBRA 3IPRA 3UUFA 3T7AA 3TW8A 1OPXA 3NFRA 4OHXA 4CTJA 4ZCTA 2HWWA 1WXFA 3H9GA 3ILVA 4PZUA 1SVNA 3R41A 4P7BA 1BIFA 4PGHA 5ITSA 4JBYA 4NOKA 3DJFA 5DHPA 1MBZA 1D4AA 1E6MA 4J7XA 4KYIB 2XWSA 4UBLA 4IQFA 1NNEA 2AUTA 4ZD6A 1W0CA 4EX6A 1ESCA 1ZH4A 2OGZA 8ADHA 2H1OA 4LYFA 3ZOKA 4BNUA 3Q41A 5IC5A 4G1FA 2BN4A 5FR1A 3D5TA 1LTHR 4TQGA 4C7KA 3PGJA 4LDJA 4RKFA 3WQSB 3ZY4A 1M1YB 2OKCA 1MQ9A 5JNSA 2XNJA 2ZDHA 4OI0A 1DC7A 3TECE 2ARKA 2JFGA 3R24A 4F91B 1I1QB 1SQFA 4RF3A 3LRPA 3SU8A 3RUCA 1XFAA 2P67A 2AKAB 3OTWA 3OFSA 3T7TA 3K35A 4DM4A 2PKQO 3T54A 1P6UA 2WTAA 4PYRA 5CX1B 5EPOA 4KLZA 4KPGA 2AOTA 3I2GA 1ISGA 1RZRD 3A3NA 3QPBA 3UG6A 3V1LA 1DEHA 4H17A 2RGWA 3MILA 3EQ2A 4NMMA 3E22A 3N2ZB 4DQLA 2IWRA 1E20A 2UZ1A 1ODSA 4F7WA 3B3FA 5HCIA 1GAQA 5L3ZA 4MUMA 3U7RA 4CMGA 4RK7A 1C41A 2ERXA 2RB4A