4ZI3C

Bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
123
structure length
123
Chain Sequence
DEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
total genus 50
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi3C00
2K9AA 4ZI3C 4ZI2D 4ZI2C 4ZI3D
chains in the Genus database with same CATH superfamily
5J2TE 2X0LB 4L5GA 5L2LA 1XMOT 2K24A 2XQ9A 4HKAA 3UUNA 3QB5A 4CQIA 5KMGP 3A7MA 5LBQB 2XUEA 2BBJA 4CN4A 4C90A 5L3DB 3P4RA 1I6ZA 4QXBB 4X62T 5LJNA 1V9DA 2WU5A 1Y01A 2WZHA 1ZEEA 5FP3A 3E08A 3N2KE 4P0BA 4CI2B 4AKGA 3PJAJ 3TLTA 1T8BA 2BZBA 3E0ZA 4NIQA 4G63A 3TLSA 4BJNA 4X65T 4QH4A 3JC6D 4PK4A 1HNZT 4PFPA 4IREA 1MMGA 2V26A 3VRBA 4IDQA 1VCTA 3ABVA 3ZMSB 3AXJA 3WAKA 2LLYA 3C64A 4CI3B 4UVBB 2XASB 3KINB 2ODVA 3L3PA 2VWAA 5LCYA 3BQLA 2LSYA 3OVUA 4ILCA 3TLWA 4ISSA 5EK3A 3UFEA 3N5LA 3CQXC 3CIRA 4J2CA 5AFUL 1L0VA 3C4XA 3PURA 3F2EA 1G73A 3PDYA 3J7Yq 1MNDA 2HH7A 3ANWA 4ZI7E 1JNRA 1S94A 3AA6B 3OYXA 3PJAA 4YFSA 3ZC0A 3EDVA 4MFRA 5CA1E 4HFDA 4YSXA 2E5VA 3I9YA 4B3MT 5LGNB 2X68A 3RYHE 2LM9A 3KVAA 5AQJB 2I0MA 2YOEA 5FYMA 3FZKB 4AKHA 3ZJ2A 3H37A 2IAKA 3SRZA 5LP6E 3HR0A 3NZQA 4HN9A 1FMVA 1HFAA 2LSIA 4KMCA 4A97A 1XNRT 5LGUB 4HFHA 4QXHB 1SHZC 4EXTA 3ZCIA 4DBRA 3JAFA 2BG9B 5FVKA 2YN6A 1Z0PA 3A5XA 4G2AA 4LFCT 1S35A 2Y8DA 5ADXL 3ZT7A 1FMWA 2ACXA 2BG9A 3LDQB 5FY1A 4CN1A 4IE0A 3ZEFB 3AE2A 3HKEE 4DR7T 1MMNA 2V6YB 5FXZA 4GKJT 3AE4A 1KF6A 4IE5A 2F4VT 1BR1A 3AE5A 2Q9QA 4JUYA 5F5WA 5F3JA 2RA1A 2H88A 2JIWA 2FBWA 3HKCE 1UX4A 5ABFA 2CMRA 4YHHT 5FXWA 2OA5A 2ZMAA 1OEDE 2V1DB 5FXXA 1LRZA 3UU4A 2MAWA 3ZT6A 5C2TA 5EK2A 2D0UA 3IHRA 3HL6A 1N34T 3M65A 3N2OA 5AQNB 3RPUA 4LMJA 4AIUA 1LVKA 2X66A 1GQEA 3V5UA 4ERRA 4X64T 4U7YA 4IGUA 2IC9A 2NWBA 3JAEA 3EDUA 5ABGA 2UXCT 1LVFA 2FUPA 3PTRB 3AAEB 2PFVA 4JI3T 3OTOT 4DNDA 2HPLA 4QHOA 2WWVA 4HFBA 3FXEB 2LOSA 3MK7C 2V6YA 3AE9A 3ZLIA 4LF7T 2L8KA 2V6XA 4EEBA 2IHR1 3EAMA 2PTFA 3VU7H 5DQVA 2H3RA 2VKOA 2OV9A 3OJAA 4TNVA 1XZYA 1E2AA 4I55E 3UT5E 3ZYKA 4MHCA 4JI8T 1NAFA 2D5UA 2L3LA 4F8HA 3RRWA 1N33T 2G0UA 3QB5K 3IF8B 4IL9A 4PK6A 2DI4A 5AQUB 1NWMX 3I0QA 3UU8A 1KEYA 1HTJF 4DR5T 4JV5T 4P1NA 2D0TA 2VVNA 2X0YA 3E22E 3HKDE 2E9XD 3FZHB 3AAIA 4LF8T 3ZSTA 4ASKA 5HXEA 3CVRA 4DVDA 3EI0A 1UGOA 3CMLA 5HCMA 4HWFA 2VK9A 1BR4A 1MIYA 4MALA 1VRBA 5FY7A 4ZI3D 2LSJA 5JQGE 3PUGA 4U2YA 5DQWA 2YINA 4TV9E 1UUSA 1EZ3A 2XQ8A 2BKOA 3DP7A 5L4HA 2JJ9A 4NXNT 3RH3A 2V5DA 1E1HB 3K1SA 3P50A 4CXXA 5C8YE 4X66T 5HEGA 3RX6A 2NTYA 2I59A 4JI7T 4B3ST 2KINB 2XQAA 3NKZA 2Y48B 2C5JA 2HN1A 3AEAA 4TWFA 5GONE 5LOVE 2YDQA 3K3OA 2QVAA 2CPTA 2CM0A 5L3EB 1T7SA 3KBTA 5A1LA 2V7MA 4K0UA 5BR8T 5LG4A 2JMKA 3P4PA 3VKHA 3ETVA 4X1KE 3N2GE 2XPKA 2WWUA 4UXNB 4Z90A 3RIUA 3NWIA 4DMWA 4EOZB 3RYIE 5IWAT 4JBWF 2KZ7B 4AQYT 4O4IE 1BR0A 3CQCB 3Q5WA 2LEHA 3HI2A 4WNKA 3RLFF 4AQGA 3LG7A 5JDGA 4XBFB 4Z8XA 5L4EA 3LBXB 4COFA 2VB6A 4LFBT 1VCSA 1IAPA 3N9LA 3ONJA 1UCUA 4UF0B 4V1Av 3RKGA 2LRLA 2WCAA 2E2AA 1IBKT 4L9IA 5CJ5A 1N32T 2NW8A 4BA9A 3P4QA 3UUXB 2B76A 3O4XE 4U74A 5C3JA 4DV3T 2WMOA 3NVOA 3KVBA 4OYJA 3BK9A 4DO0A 3BQKA 2XAFB 2J4GA 3OBVE 1VOMA 2J62A 4IIJE 4DBQA 4DV1T 3PUAA 2NW9A 2XQ7A 1OXZA 3QC9A 4GYSA 2UU9T 4KHPT 2LHNA 4DR1T 2CBJA 4AXPA 1YKHB 3UFGA 2E9XC 3AEEA 4YTPA 4ZEYA 5AQQB 4JEHB 5JDFA 2WY2A 5JH7E 4WZXA 3K3NA 2OLTA 5HXCA 3UTKA 4BJMA 5ABFB 5JTGA 5LYJE 1HNXT 4DMVA 3MZKB 3C98B 2K9AA 4ZI3C 2M6BA 2UXBT 4H9NC 4YTNA 3U3IA 2UXNB 2BVLA 2QYWA 1D0ZA 3NRXA 4JYAT 1G8XA 2X9XA 4O2AE 2XAGB 5LJMA 1SUMB 5DJQC 5HEJA 2CEAA 2M67A 2WDQA 3B13A 3B5MA 3PU3A 3RIAA 2V7JA 2VL8A 2N9DA 3OPCA 1SA0E 1ZV4X 2CBIA 3N9MA 3P8CD 1NENA 1QUUA 1OEDC 4JEUB 1JNZA 4QX8B 3AAAB 5JR9C 4DV4T 2XQ4A 3Q2MA 2RPAA 1B7TA 4ZS2A 5AQMB 1UX5A 1HX1B 2IC6A 4ZXLA 3MJXA 3ZMVB 4HWIB 3W15B 2C5KT 3Q5DA 4X5TA 3LFMA 4HE8A 3PU8A 2W66A 2X9YA 2KT9A 1XDPA 2LKHA 4CZZB 2X0HA 3S4UA 3AEGA 3CKDA 4DV6T 4YSZA 2SPCA 3AA7B 4PJJA 4U33A 2ZM0A 4X20E 1AJ3A 4CXWA 4UV9B 2DCFA 4CXYA 1KNPA 4DR6T 4ADZA 4LMLA 4MLKA 2XJ7A 3AVRA 3MACA 2BS2A 4O4JE 4QXCB 3BQIA 1D0XA 3RIUC 3KV9A 5JREA 4JI1T 4YXDA 5JRCB 3UU6A 3GA8A 5LNKA 3C4WA 5AQOB 1MMAA 4NUVA 1J1JA 1KFYA 5AQTB 4EV6A 4YSYA 3L09A 3N9NA 1WRDA 3GMIA 3IA3A 3LK2B 2A9UA 2LSKA 2W62A 1T72A 1FJGT 5IUXA 2V7LA 5FVLA 2XM1A 4TN7B 3MKDA 4I4TE 2BKPA 3ZYMA 2KXPB 4X1YE 4KI0F 2QRXA 4IE4A 5FXVA 5L3CB 4OFZA 3P4SA 5AQFB 3ANWB 4M1PA 5FMNA 4JI5T 1HF8A 2M6IA 3IEEA 4JI4T 2W2UA 5F8PA 5J0ZA 1HS7A 4HWCA 1I94T 1ZKEA 3ZJ1A 3O9XA 2W61A 4U3CA 3AA0B 2LOPA 3ZC1A 2JMHA 1M62A 3UUBA 1UK5A 4KUMB 3P7IA 2L9QA 1X79A 4FI5A 1WYBA 3AE8A 4IL4A 4LFAT 3OYZA 3ZN1B 2CRBA 1T98A 1ZP0A 2CXDA 5HXSA 5EZYE 2WS3A 3VRAA 2WM9A 2KNDA 5KXJA 2W4XA 2YK0A 4JLEA 5E0OA 1H7CA 2PBIA 4NUUA 2B1EA 1QSDA 2CWOA 3QNUA 1W09A 1XNQT 2XM2A 5JR9B 1IJ6A 2XZEA 3CQGB 3SFEA 4EB6E 4AI6A 4UVAB 5AQPB 4TV8E 5JDMA 3JADA 3C4ZA 2EHOB 3DTOA 3ONLC 4H9OC 5CFBA 4QWNB 2DWKA 3FHNA 4ILAA 4UVCB 5L3BB 2WAUA 3HKBE 5HAXA 3PUSA 3TLVA 2EHOA 2J1DG 2KMFA 3LBXA 4PJNA 3UU5A 4JI6T 2N1GA 1UURA 5BMVE 2ZM2A 2IW5B 2NW7A 5AQLB 1HG5A 2FJAA 3ZN0B 2P9BA 2LKGA 2CLYB 5L47A 3RHWA 4DUZT 5HXRA 5CB4E 2MYSA 5HCJA 2JPFA 2W00A 4CI1B 3H3MA 1QLBA 3MA9A 4I50E 3DJBA 3RF1A 2LM2A 4AKRB 1D0YA 3Q5XA 4U31A 3MXZA 4B3TT 3H3AA 4TNWA 2X51A 4C91A 5HWYA 2E8IA 1KNZA 3SS1A 5FY0A 2DHRA 2HPJA 3RQWA 2UUAT 4DIDB 2W63A 1WCRA 2YU2A 3AE6A 4H63H 4O8SA 1WLXA 4YTMA 1LKXA 1W0AA 3R84B 3CWZB 1WR6A 1FIOA 3K8PC 3UQ4A 3EHZA 4DR2T 5J2UE 3D0TA 2CLYC 2ES0A 3NBXX 4DV2T 1W9RA 4KHZF 3NRYA 4UEMA 3O1HA 3J9X1 1W0BA 3SFDA 4U72A 1MNEA 2PJQA 3PUZF 4GK0E 5LB7B 2Y6XA 4O4HE 4WYVA 2CWYA 2LT3A 3TKLB 2J47A 3Q5EA 4L0RA 5ABHA 4ZI2D 2EHOC 1IBLT 1J5WA 4LMKA 2Q9QB 2W67A 3ZMZB 5HYAA 1YKEB 2E9XB 1YQ3A 2KWIB 1X9BA 2CHOA 2A3DA 2BKNA 4H9SE 3PUYF 2ACZA 3ZT5A 3ZSSA 3LJCA 2HN2A 3A8YC 4EIWA 2LRKA 4PK5A 2IDOB 3AXJB 5M4YA 3IBPA 1XDOA 5H6QB 2YDRA 4WW0A 3AE7A 2K48A 5DABA 4PJLA 3RC3A 4AKIA 3I9WA 1HCIA 3O1JA 4Q25A 2JQ9A 2A2FX 4GYRA 1MIVA 1O3XA 3RYFE 3ZPOA 4AISA 3AEFA 4EEDA 5LXTE 4HWDA 4HEAA 2CCQA 2CE7A 2XAHB 2JQKA 4IDNA 4JI0T 3L39A 1E7PA 2H7VC 2BS4A 2H89A 3FBLA 4TZ4C 2VKDA 5LA6E 3QUJA 4N78D 5HEHA 5FNVE 1MIWA 4ZZBA 2XY8B 3JCFA 4JI2T 2UXDT 4BAYB 5ABEA 4EZHA 4O2BE 2WZIA 1BR2A 2D9DA 3ESLA 1D1BA 4IDOA 4O4LE 5AQIB 1D1AA 3RGLA 5AQHB 4OHFA 3AECA 3FZFB 3UQ7A 1YD8G 2JRKA 4UELA 4ZS3A 3C51A 5HEOA 5JDQA 2BG9E 2KLQA 2MPKA 3PUWF 2WMNA 5JDLA 2DNXA 2IMLA 3KDSE 3KV5A 2CXLA 2JQHA 1R8IA 4H9PC 4QH1A 2FJDA 4A98A 5JR9A 1N36T 4UIGA 2XTLA 1CHUA 4DR4T 1WR0A 3ZKRA 3I0OA 2Q9QD 2PG8A 2XHEB 3LK42 3RRCA 2WU2A 3F31A 5LHGB 4EYYR 3GN5A 2IUBA 2R6GF 2X67A 4P0AA 2XQ5A 2CHNA 2BBHA 2DWGA 4TUYE 4ZI2C 2EHOD 4XZCA 2BDEA 3SWHA 3KFWX 1HNWT 2H7OA 2BVMA 2AE9A 3CX6B 3CPZA 3ZMTB 2JQQA 4PW8A 4AKLA 2MTQA 3EVYA 4LF9T 3VKGA 3PUQA 4XAXB 1HG2A 2ODUA 3AE3A 4YJ3E 3V5SA 4EGWA 5HWXA 2HHHT 3FZLB 4HFIA 5TAOA 4TWDA 4I0UA 2MBGA 5KX5E 4HFCA 1DU2A 5H6RB 4B3RT 4UF0A 1XWMA 5FKYA 4NPPA 2NTXA 2FJBA 3PV0F 1IBMT 5LG3A 3AB3B 3T1HT 4YHJA 2E5LT 1KK7A 4QH5A 2YKSA 4WBOA 4U7IA 4HGAA 4EZ4A 1WYCA 4YT0A 2QA7A 3Q9DA 2XQYA 3F57A 5FL0A 2UUCT 5AQGB 4ZZCA 2N2NA 2LJLA 1IJ5A 2VKHA 4OYKA 3T8OA 3ETUA 3QOFA 5LGTB 2XAQB 4LF5T 3FZMB 2UXXB 2A72A 1D1CA 2KSRA 2V8SV 3SOLA 4H9RC 3CX8B 5FL1A 4YY3T 4ILBA 4U2ZA 5LHHB 5J1GA 2ZM6T 5JRCA 2VURA 4DR3T 3FBZA 1OEDA 4PFOA 5L3GB 2X9HA 2NR4A 3AVSA 3P4WA 3PUXF 4GK5E 2VASA 3AEDA 4E7SA 2W0GA 4CN6A 4E7ZA 1OWAA 2E9XA 4AQFC 3X1DA 4HWHA 4YJ2E 1J5ET 3AA1B 2Q9QC 3N9QA 4GOUA 2X9WA 4ILUA 4PJMA 3RC8A 5CGMA 2ZM8A 4YLHA 5AQSB 1HR0T 4X1IE 2I6HA 3QK6A 3WAJA 2WDRA 2MOZA 2YEVC 4UV8B 4A56A 1KNRA 2LHRA 1YW0A 2WQYA 3G06A 3K3QC 3VR9A 3KBUA 3N9OA 3O1IA 5HEUA 4EYUA 2RP4A 4ZHQE 2WB5A 4DV5T 4NXMT 2WDVA 2WSSV 2XQ3A 4GIWA 2XSBA 2BS3A 2CXFA 5IYZE 1U4QA 4I43B 4IHJE 4QKNA 3FXDB 2VVSA 3N9PA 4OK0A 3RYCE 3EUHA 5LBMA 4PAGA 3RI5A 1M7KA 3HA4A 4UR9A 5JDNA 5KDMC 1NEKA 3ZYLA 1U5PA 1ZOYA 2AXDS 3KV4A 4FJOA 4P09A 5L3FB 2C0SA 4DV7T 4OX9T 4IDPA 2V5CA 2YDSA 1YXRA 3PUVF 4HFEA 5JVDE 3R6NA 3NZPA 4LF6T 4QX7B 2WP9A 3LK3B 5AQKB 2K5BB 2K3WA 4HTEA 4DUYT 1YQ4A 4F6RC 3CX7B 1HX8A 3VHLA 3WI3A 4A5XA 2QGSA 3UULA 4B6XA 4ZOLE 3T1YT 2XSAA 2IIUA 2KWHA 3JC6C 4ISTA 4IE6A 4IE7A 4TX5A 2CA5A 2VL0A 3C50A 3FB2A 1WFDA 4PNIA 4ANJA 2VQET 4KP3C 2VQFT 5LMUT 1ZHCA 5ETWA 3VR8A 2VKJA 3CK6A 3AEBA 4IT4A 5AQVB 4AQFA 2D2SA 2V7KA 3AE1A 5LHIB 2DL1A 2ZLYA 2GK9A 3EABA 3RQUA 4Z91A 4LF4T 4H9QC 1Z8UA 3B57A 4HFVA 1MMDA 1US7B 5IHYA 3M3ZB 1CUNA 3OKQA 2NOXA 3KV6A 3L8RA 3ZCJA 3UU3A 4K0KT 4MBQA 1Y64B 2LSGA 2NP9A 4GKKT 3TLUA 4KBMB 1OEDB 3LSVA 4IDZA 3I1AA 1XMQT 3GWHA 3PE0A 5CA0E 4DV0T 3ONXA 1SE7A 2XQ6A 2DLRA 3GN5B 3ZMUB 2LE8A 2Z6EA 1FEWA 2BG9C 2FJEA 4WBNE 4TWHA 2V7IA 2XAJB 5HXHA 3RKOA 2UUBT 5EK4A 4EAHA 3RIFA 5LMNT 1IZNB 2C5IT 5JDHA 3U78A 4H63V 3UUMA 2WBLA 4KX6A 5AQRB 2YU1A
chains in the Genus database with same CATH topology
5J2TE 2X0LB 4L5GA 5L2LA 2K24A 4HKAA 5KMGP 3UUNA 4CQIA 5LBQB 2XUEA 4C90A 5L3DB 4QXBB 5LJNA 1V9DA 1ZEEA 5FP3A 3E08A 3N2KE 4P0BA 4CI2B 4AKGA 4BJNA 2BZBA 3E0ZA 4G63A 3JC6D 4PK4A 4PFPA 1MMGA 2V26A 3WAKA 3C64A 4CI3B 4UVBB 2XASB 3KINB 2ODVA 3L3PA 2VWAA 5LCYA 3BQLA 2LSYA 4ISSA 5EK3A 3UFEA 3N5LA 3CQXC 5AFUL 4J2CA 3C4XA 3PURA 3F2EA 1G73A 3PDYA 1MNDA 2HH7A 3ANWA 4ZI7E 1S94A 3AA6B 3OYXA 4YFSA 3ZC0A 3EDVA 4MFRA 5CA1E 3I9YA 2X68A 3RYHE 2LM9A 3KVAA 4AKHA 5FYMA 3ZJ2A 3H37A 2IAKA 3SRZA 5LP6E 3HR0A 3NZQA 4HN9A 1FMVA 1HFAA 2LSIA 4KMCA 5LGUB 4QXHB 1SHZC 4EXTA 3ZCIA 4DBRA 3A5XA 1Z0PA 4G2AA 1S35A 2Y8DA 5ADXL 3ZEFB 1FMWA 2ACXA 5FY1A 4IE0A 3HKEE 1MMNA 5FXZA 4IE5A 1BR1A 2Q9QA 4JUYA 2RA1A 3HKCE 1UX4A 2CMRA 5FXWA 2OA5A 2ZMAA 2V1DB 5FXXA 1LRZA 5EK2A 2D0UA 3IHRA 3HL6A 3M65A 3N2OA 3RPUA 1LVKA 2X66A 3V5UA 4ERRA 4IGUA 2IC9A 2NWBA 3EDUA 1LVFA 3PTRB 3AAEB 2PFVA 4DNDA 2HPLA 4QHOA 3FXEB 2LOSA 3MK7C 3ZLIA 2L8KA 3VU7H 5DQVA 2H3RA 2VKOA 3UT5E 3OJAA 4I55E 3ZYKA 4MHCA 1NAFA 2D5UA 2L3LA 3RRWA 2G0UA 4PK6A 3IF8B 2DI4A 1NWMX 3I0QA 1HTJF 2D0TA 3HKDE 3E22E 5HXEA 2E9XD 3AAIA 4ASKA 3CVRA 4DVDA 3CMLA 2VK9A 1BR4A 1MIYA 4MALA 1VRBA 5FY7A 4ZI3D 2LSJA 5JQGE 3PUGA 5DQWA 2YINA 4TV9E 1EZ3A 3DP7A 2JJ9A 3RH3A 1E1HB 4CXXA 5C8YE 3RX6A 2NTYA 2I59A 2KINB 2Y48B 2C5JA 5LOVE 5GONE 5L3EB 3K3OA 2CM0A 3KBTA 5A1LA 2V7MA 4K0UA 5LG4A 2JMKA 3VKHA 3ETVA 4X1KE 3N2GE 4UXNB 2WWUA 4DMWA 4EOZB 3RYIE 2KZ7B 4O4IE 1BR0A 3CQCB 3Q5WA 2LEHA 3HI2A 4WNKA 4AQGA 5JDGA 3LG7A 4XBFB 4Z8XA 3LBXB 2VB6A 1IAPA 3N9LA 1UCUA 4UF0B 4V1Av 4L9IA 2NW8A 4BA9A 3UUXB 3O4XE 4U74A 2WMOA 3KVBA 4OYJA 3BK9A 4DO0A 3BQKA 2XAFB 3OBVE 4DBQA 1VOMA 4IIJE 3PUAA 2NW9A 4GYSA 1OXZA 3QC9A 2LHNA 4AXPA 1YKHB 2E9XC 4JEHB 5JDFA 5JH7E 5HXCA 3K3NA 3UTKA 4BJMA 5LYJE 4DMVA 3MZKB 3C98B 2K9AA 4ZI3C 4H9NC 3U3IA 2UXNB 2BVLA 1D0ZA 3NRXA 1G8XA 2X9XA 4O2AE 2XAGB 5LJMA 5DJQC 2CEAA 2M67A 3B13A 5F3JA 3PU3A 2V7JA 2VL8A 2N9DA 3P8CD 1SA0E 1ZV4X 3N9MA 4JEUB 4QX8B 4XZCA 1QUUA 5HYAA 5JREA 3AAAB 5JR9C 3Q2MA 4ZS2A 1B7TA 1UX5A 2IC6A 3ZMVB 3MJXA 3W15B 2C5KT 3LFMA 4HE8A 3PU8A 2X9YA 2KT9A 4CZZB 3S4UA 3CKDA 2SPCA 3AA7B 4PJJA 4X20E 2ZM0A 1AJ3A 4CXWA 4UV9B 2DCFA 4CXYA 4ADZA 4MLKA 3AVRA 3MACA 4O4JE 4QXCB 3BQIA 1D0XA 3KV9A 5JRCB 3GA8A 5LNKA 3C4WA 1MMAA 4NUVA 3L09A 3N9NA 1WRDA 3GMIA 3LK2B 2W62A 2LSKA 2V7LA 4TN7B 3MKDA 4I4TE 3ZYMA 2KXPB 4X1YE 4IE4A 5FXVA 5L3CB 4OFZA 3ANWB 4M1PA 5FMNA 1HF8A 3IEEA 1HS7A 5F8PA 1ZKEA 3ZJ1A 3O9XA 2W61A 3AA0B 2LOPA 3ZC1A 2JMHA 4KUMB 3P7IA 2L9QA 1X79A 4FI5A 1WYBA 3OYZA 3ZN1B 5HXSA 1T98A 2CXDA 5EZYE 2WM9A 2KNDA 2YK0A 4JLEA 5E0OA 1H7CA 2PBIA 4NUUA 2B1EA 1QSDA 2CWOA 5JR9B 1IJ6A 3CQGB 4EB6E 4AI6A 4UVAB 5JDMA 4TV8E 3C4ZA 2EHOB 3DTOA 4H9OC 4QWNB 2DWKA 3FHNA 4UVCB 5L3BB 5LGNB 2WAUA 3HKBE 5HAXA 3PUSA 3J7Yq 2EHOA 2J1DG 2KMFA 3LBXA 4PJNA 2N1GA 5BMVE 2ZM2A 2IW5B 2NW7A 1HG5A 3ZN0B 2P9BA 2CLYB 5HXRA 5CB4E 2MYSA 2JPFA 2W00A 4CI1B 3MA9A 4I50E 3DJBA 4AKRB 1D0YA 3Q5XA 3MXZA 3H3AA 4C91A 2X51A 5HWYA 2E8IA 1KNZA 3SS1A 5FY0A 2DHRA 2HPJA 2W63A 4H63H 2YU2A 4O8SA 1WLXA 1LKXA 3R84B 3CWZB 1WR6A 1FIOA 3K8PC 5J2UE 3D0TA 2CLYC 2ES0A 3NBXX 3NRYA 4UEMA 3O1HA 3J9X1 4U72A 1MNEA 2PJQA 4GK0E 2Y6XA 4O4HE 2CWYA 2LT3A 3TKLB 4L0RA 4ZI2D 2EHOC 3ZMZB 2Q9QB 1YKEB 2E9XB 2KWIB 5JRCA 2A3DA 4H9SE 4EIWA 3LJCA 4PK5A 5M4YA 3IBPA 5H6QB 4WW0A 2K48A 5DABA 4PJLA 3RC3A 4AKIA 3I9WA 1HCIA 3O1JA 3RYFE 3ZPOA 2A2FX 4GYRA 1MIVA 1O3XA 5LXTE 4HEAA 2CCQA 2CE7A 2XAHB 2H7VC 3FBLA 5LA6E 3ZMSB 4TZ4C 2VKDA 3QUJA 4N78D 5FNVE 1MIWA 4BAYB 4EZHA 4O2BE 1BR2A 3ESLA 1D1BA 4O4LE 1D1AA 4OHFA 1YD8G 2JRKA 4UELA 4ZS3A 3C51A 5JDQA 2KLQA 2WMNA 5JDLA 2DNXA 3KDSE 3KV5A 2CXLA 4H9PC 5JR9A 4UIGA 2XTLA 3I0OA 2Q9QD 2PG8A 2XHEB 3LK42 3RRCA 3F31A 5LHGB 4EYYR 3GN5A 2X67A 4P0AA 2DWGA 4TUYE 4ZI2C 2EHOD 2BDEA 3SWHA 3KFWX 2H7OA 2BVMA 3CX6B 3ZMTB 3CPZA 4AKLA 2JQQA 4PW8A 2MTQA 3EVYA 3VKGA 3PUQA 4XAXB 1HG2A 2ODUA 4YJ3E 3V5SA 5HWXA 5TAOA 2MBGA 5KX5E 5H6RB 4UF0A 2NTXA 3AB3B 4YHJA 1KK7A 4WBOA 4EZ4A 4HGAA 1WYCA 2QA7A 3Q9DA 2XQYA 3F57A 2N2NA 2LJLA 1IJ5A 2VKHA 4OYKA 3T8OA 3ETUA 5LGTB 2XAQB 2UXXB 2A72A 1D1CA 3SOLA 4H9RC 3CX8B 5LHHB 5J1GA 3FBZA 4PFOA 5L3GB 2X9HA 3AVSA 4GK5E 2VASA 4E7SA 2W0GA 4E7ZA 1OWAA 2E9XA 4AQFC 4YJ2E 3AA1B 2Q9QC 3N9QA 4GOUA 2X9WA 4ILUA 4PJMA 3RC8A 2ZM8A 4YLHA 4X1IE 3QK6A 3WAJA 4A56A 2MOZA 2YEVC 4UV8B 2LHRA 1YW0A 3K3QC 4ZHQE 3KBUA 3N9OA 3O1IA 4EYUA 2RP4A 2WSSV 4GIWA 5IYZE 2CXFA 1U4QA 4I43B 4IHJE 4QKNA 3FXDB 3N9PA 4OK0A 3RYCE 3EUHA 5LBMA 4PAGA 3HA4A 5JDNA 5KDMC 3ZYLA 1U5PA 3KV4A 4FJOA 4P09A 5L3FB 2C0SA 5JVDE 3R6NA 3NZPA 4QX7B 3LK3B 2K5BB 4HTEA 4F6RC 3CX7B 1HX8A 3VHLA 3WI3A 4B6XA 2QGSA 3UULA 4ZOLE 3JC6C 2KWHA 4ISTA 4IE6A 4IE7A 4TX5A 3FB2A 2CA5A 3C50A 4ANJA 4PNIA 4KP3C 1ZHCA 5ETWA 2VKJA 4AQFA 2D2SA 2V7KA 5LHIB 2ZLYA 2GK9A 4H9QC 3B57A 4HFVA 1MMDA 1US7B 5IHYA 1CUNA 3OKQA 2NOXA 3KV6A 3ZCJA 4MBQA 1Y64B 2LSGA 2NP9A 4KBMB 4IDZA 3I1AA 3GWHA 3PE0A 5CA0E 3ONXA 3GN5B 2DLRA 3ZMUB 2LE8A 2Z6EA 1FEWA 4WBNE 2V7IA 2XAJB 5HXHA 3RKOA 5EK4A 4EAHA 1IZNB 2C5IT 5JDHA 3U78A 4H63V 3UUMA 2WBLA 2YU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9A A;  4ZI3 C;  4ZI2 D;  4ZI2 C;  4ZI3 D; 
#chains in the Genus database with same CATH topology
 5J2T E;  2X0L B;  4L5G A;  5L2L A;  1XMO T;  2K24 A;  2XQ9 A;  4HKA A;  3UUN A;  3QB5 A;  4CQI A;  5KMG P;  3A7M A;  5LBQ B;  2XUE A;  2BBJ A;  4CN4 A;  4C90 A;  5L3D B;  3P4R A;  1I6Z A;  4QXB B;  4X62 T;  5LJN A;  1V9D A;  2WU5 A;  1Y01 A;  2WZH A;  1ZEE A;  5FP3 A;  3E08 A;  3N2K E;  4P0B A;  4CI2 B;  4AKG A;  3PJA J;  3TLT A;  1T8B A;  2BZB A;  3E0Z A;  4NIQ A;  4G63 A;  3TLS A;  4BJN A;  4X65 T;  4QH4 A;  3JC6 D;  4PK4 A;  1HNZ T;  4PFP A;  4IRE A;  1MMG A;  2V26 A;  3VRB A;  4IDQ A;  1VCT A;  3ABV A;  3ZMS B;  3AXJ A;  3WAK A;  2LLY A;  3C64 A;  4CI3 B;  4UVB B;  2XAS B;  3KIN B;  2ODV A;  3L3P A;  2VWA A;  5LCY A;  3BQL A;  2LSY A;  3OVU A;  4ILC A;  3TLW A;  4ISS A;  5EK3 A;  3UFE A;  3N5L A;  3CQX C;  3CIR A;  4J2C A;  5AFU L;  1L0V A;  3C4X A;  3PUR A;  3F2E A;  1G73 A;  3PDY A;  3J7Y q;  1MND A;  2HH7 A;  3ANW A;  4ZI7 E;  1JNR A;  1S94 A;  3AA6 B;  3OYX A;  3PJA A;  4YFS A;  3ZC0 A;  3EDV A;  4MFR A;  5CA1 E;  4HFD A;  4YSX A;  2E5V A;  3I9Y A;  4B3M T;  5LGN B;  2X68 A;  3RYH E;  2LM9 A;  3KVA A;  5AQJ B;  2I0M A;  2YOE A;  5FYM A;  3FZK B;  4AKH A;  3ZJ2 A;  3H37 A;  2IAK A;  3SRZ A;  5LP6 E;  3HR0 A;  3NZQ A;  4HN9 A;  1FMV A;  1HFA A;  2LSI A;  4KMC A;  4A97 A;  1XNR T;  5LGU B;  4HFH A;  4QXH B;  1SHZ C;  4EXT A;  3ZCI A;  4DBR A;  3JAF A;  2BG9 B;  5FVK A;  2YN6 A;  1Z0P A;  3A5X A;  4G2A A;  4LFC T;  1S35 A;  2Y8D A;  5ADX L;  3ZT7 A;  1FMW A;  2ACX A;  2BG9 A;  3LDQ B;  5FY1 A;  4CN1 A;  4IE0 A;  3ZEF B;  3AE2 A;  3HKE E;  4DR7 T;  1MMN A;  2V6Y B;  5FXZ A;  4GKJ T;  3AE4 A;  1KF6 A;  4IE5 A;  2F4V T;  1BR1 A;  3AE5 A;  2Q9Q A;  4JUY A;  5F5W A;  5F3J A;  2RA1 A;  2H88 A;  2JIW A;  2FBW A;  3HKC E;  1UX4 A;  5ABF A;  2CMR A;  4YHH T;  5FXW A;  2OA5 A;  2ZMA A;  1OED E;  2V1D B;  5FXX A;  1LRZ A;  3UU4 A;  2MAW A;  3ZT6 A;  5C2T A;  5EK2 A;  2D0U A;  3IHR A;  3HL6 A;  1N34 T;  3M65 A;  3N2O A;  5AQN B;  3RPU A;  4LMJ A;  4AIU A;  1LVK A;  2X66 A;  1GQE A;  3V5U A;  4ERR A;  4X64 T;  4U7Y A;  4IGU A;  2IC9 A;  2NWB A;  3JAE A;  3EDU A;  5ABG A;  2UXC T;  1LVF A;  2FUP A;  3PTR B;  3AAE B;  2PFV A;  4JI3 T;  3OTO T;  4DND A;  2HPL A;  4QHO A;  2WWV A;  4HFB A;  3FXE B;  2LOS A;  3MK7 C;  2V6Y A;  3AE9 A;  3ZLI A;  4LF7 T;  2L8K A;  2V6X A;  4EEB A;  2IHR 1;  3EAM A;  2PTF A;  3VU7 H;  5DQV A;  2H3R A;  2VKO A;  2OV9 A;  3OJA A;  4TNV A;  1XZY A;  1E2A A;  4I55 E;  3UT5 E;  3ZYK A;  4MHC A;  4JI8 T;  1NAF A;  2D5U A;  2L3L A;  4F8H A;  3RRW A;  1N33 T;  2G0U A;  3QB5 K;  3IF8 B;  4IL9 A;  4PK6 A;  2DI4 A;  5AQU B;  1NWM X;  3I0Q A;  3UU8 A;  1KEY A;  1HTJ F;  4DR5 T;  4JV5 T;  4P1N A;  2D0T A;  2VVN A;  2X0Y A;  3E22 E;  3HKD E;  2E9X D;  3FZH B;  3AAI A;  4LF8 T;  3ZST A;  4ASK A;  5HXE A;  3CVR A;  4DVD A;  3EI0 A;  1UGO A;  3CML A;  5HCM A;  4HWF A;  2VK9 A;  1BR4 A;  1MIY A;  4MAL A;  1VRB A;  5FY7 A;  4ZI3 D;  2LSJ A;  5JQG E;  3PUG A;  4U2Y A;  5DQW A;  2YIN A;  4TV9 E;  1UUS A;  1EZ3 A;  2XQ8 A;  2BKO A;  3DP7 A;  5L4H A;  2JJ9 A;  4NXN T;  3RH3 A;  2V5D A;  1E1H B;  3K1S A;  3P50 A;  4CXX A;  5C8Y E;  4X66 T;  5HEG A;  3RX6 A;  2NTY A;  2I59 A;  4JI7 T;  4B3S T;  2KIN B;  2XQA A;  3NKZ A;  2Y48 B;  2C5J A;  2HN1 A;  3AEA A;  4TWF A;  5GON E;  5LOV E;  2YDQ A;  3K3O A;  2QVA A;  2CPT A;  2CM0 A;  5L3E B;  1T7S A;  3KBT A;  5A1L A;  2V7M A;  4K0U A;  5BR8 T;  5LG4 A;  2JMK A;  3P4P A;  3VKH A;  3ETV A;  4X1K E;  3N2G E;  2XPK A;  2WWU A;  4UXN B;  4Z90 A;  3RIU A;  3NWI A;  4DMW A;  4EOZ B;  3RYI E;  5IWA T;  4JBW F;  2KZ7 B;  4AQY T;  4O4I E;  1BR0 A;  3CQC B;  3Q5W A;  2LEH A;  3HI2 A;  4WNK A;  3RLF F;  4AQG A;  3LG7 A;  5JDG A;  4XBF B;  4Z8X A;  5L4E A;  3LBX B;  4COF A;  2VB6 A;  4LFB T;  1VCS A;  1IAP A;  3N9L A;  3ONJ A;  1UCU A;  4UF0 B;  4V1A v;  3RKG A;  2LRL A;  2WCA A;  2E2A A;  1IBK T;  4L9I A;  5CJ5 A;  1N32 T;  2NW8 A;  4BA9 A;  3P4Q A;  3UUX B;  2B76 A;  3O4X E;  4U74 A;  5C3J A;  4DV3 T;  2WMO A;  3NVO A;  3KVB A;  4OYJ A;  3BK9 A;  4DO0 A;  3BQK A;  2XAF B;  2J4G A;  3OBV E;  1VOM A;  2J62 A;  4IIJ E;  4DBQ A;  4DV1 T;  3PUA A;  2NW9 A;  2XQ7 A;  1OXZ A;  3QC9 A;  4GYS A;  2UU9 T;  4KHP T;  2LHN A;  4DR1 T;  2CBJ A;  4AXP A;  1YKH B;  3UFG A;  2E9X C;  3AEE A;  4YTP A;  4ZEY A;  5AQQ B;  4JEH B;  5JDF A;  2WY2 A;  5JH7 E;  4WZX A;  3K3N A;  2OLT A;  5HXC A;  3UTK A;  4BJM A;  5ABF B;  5JTG A;  5LYJ E;  1HNX T;  4DMV A;  3MZK B;  3C98 B;  2K9A A;  4ZI3 C;  2M6B A;  2UXB T;  4H9N C;  4YTN A;  3U3I A;  2UXN B;  2BVL A;  2QYW A;  1D0Z A;  3NRX A;  4JYA T;  1G8X A;  2X9X A;  4O2A E;  2XAG B;  5LJM A;  1SUM B;  5DJQ C;  5HEJ A;  2CEA A;  2M67 A;  2WDQ A;  3B13 A;  3B5M A;  3PU3 A;  3RIA A;  2V7J A;  2VL8 A;  2N9D A;  3OPC A;  1SA0 E;  1ZV4 X;  2CBI A;  3N9M A;  3P8C D;  1NEN A;  1QUU A;  1OED C;  4JEU B;  1JNZ A;  4QX8 B;  3AAA B;  5JR9 C;  4DV4 T;  2XQ4 A;  3Q2M A;  2RPA A;  1B7T A;  4ZS2 A;  5AQM B;  1UX5 A;  1HX1 B;  2IC6 A;  4ZXL A;  3MJX A;  3ZMV B;  4HWI B;  3W15 B;  2C5K T;  3Q5D A;  4X5T A;  3LFM A;  4HE8 A;  3PU8 A;  2W66 A;  2X9Y A;  2KT9 A;  1XDP A;  2LKH A;  4CZZ B;  2X0H A;  3S4U A;  3AEG A;  3CKD A;  4DV6 T;  4YSZ A;  2SPC A;  3AA7 B;  4PJJ A;  4U33 A;  2ZM0 A;  4X20 E;  1AJ3 A;  4CXW A;  4UV9 B;  2DCF A;  4CXY A;  1KNP A;  4DR6 T;  4ADZ A;  4LML A;  4MLK A;  2XJ7 A;  3AVR A;  3MAC A;  2BS2 A;  4O4J E;  4QXC B;  3BQI A;  1D0X A;  3RIU C;  3KV9 A;  5JRE A;  4JI1 T;  4YXD A;  5JRC B;  3UU6 A;  3GA8 A;  5LNK A;  3C4W A;  5AQO B;  1MMA A;  4NUV A;  1J1J A;  1KFY A;  5AQT B;  4EV6 A;  4YSY A;  3L09 A;  3N9N A;  1WRD A;  3GMI A;  3IA3 A;  3LK2 B;  2A9U A;  2LSK A;  2W62 A;  1T72 A;  1FJG T;  5IUX A;  2V7L A;  5FVL A;  2XM1 A;  4TN7 B;  3MKD A;  4I4T E;  2BKP A;  3ZYM A;  2KXP B;  4X1Y E;  4KI0 F;  2QRX A;  4IE4 A;  5FXV A;  5L3C B;  4OFZ A;  3P4S A;  5AQF B;  3ANW B;  4M1P A;  5FMN A;  4JI5 T;  1HF8 A;  2M6I A;  3IEE A;  4JI4 T;  2W2U A;  5F8P A;  5J0Z A;  1HS7 A;  4HWC A;  1I94 T;  1ZKE A;  3ZJ1 A;  3O9X A;  2W61 A;  4U3C A;  3AA0 B;  2LOP A;  3ZC1 A;  2JMH A;  1M62 A;  3UUB A;  1UK5 A;  4KUM B;  3P7I A;  2L9Q A;  1X79 A;  4FI5 A;  1WYB A;  3AE8 A;  4IL4 A;  4LFA T;  3OYZ A;  3ZN1 B;  2CRB A;  1T98 A;  1ZP0 A;  2CXD A;  5HXS A;  5EZY E;  2WS3 A;  3VRA A;  2WM9 A;  2KND A;  5KXJ A;  2W4X A;  2YK0 A;  4JLE A;  5E0O A;  1H7C A;  2PBI A;  4NUU A;  2B1E A;  1QSD A;  2CWO A;  3QNU A;  1W09 A;  1XNQ T;  2XM2 A;  5JR9 B;  1IJ6 A;  2XZE A;  3CQG B;  3SFE A;  4EB6 E;  4AI6 A;  4UVA B;  5AQP B;  4TV8 E;  5JDM A;  3JAD A;  3C4Z A;  2EHO B;  3DTO A;  3ONL C;  4H9O C;  5CFB A;  4QWN B;  2DWK A;  3FHN A;  4ILA A;  4UVC B;  5L3B B;  2WAU A;  3HKB E;  5HAX A;  3PUS A;  3TLV A;  2EHO A;  2J1D G;  2KMF A;  3LBX A;  4PJN A;  3UU5 A;  4JI6 T;  2N1G A;  1UUR A;  5BMV E;  2ZM2 A;  2IW5 B;  2NW7 A;  5AQL B;  1HG5 A;  2FJA A;  3ZN0 B;  2P9B A;  2LKG A;  2CLY B;  5L47 A;  3RHW A;  4DUZ T;  5HXR A;  5CB4 E;  2MYS A;  5HCJ A;  2JPF A;  2W00 A;  4CI1 B;  3H3M A;  1QLB A;  3MA9 A;  4I50 E;  3DJB A;  3RF1 A;  2LM2 A;  4AKR B;  1D0Y A;  3Q5X A;  4U31 A;  3MXZ A;  4B3T T;  3H3A A;  4TNW A;  2X51 A;  4C91 A;  5HWY A;  2E8I A;  1KNZ A;  3SS1 A;  5FY0 A;  2DHR A;  2HPJ A;  3RQW A;  2UUA T;  4DID B;  2W63 A;  1WCR A;  2YU2 A;  3AE6 A;  4H63 H;  4O8S A;  1WLX A;  4YTM A;  1LKX A;  1W0A A;  3R84 B;  3CWZ B;  1WR6 A;  1FIO A;  3K8P C;  3UQ4 A;  3EHZ A;  4DR2 T;  5J2U E;  3D0T A;  2CLY C;  2ES0 A;  3NBX X;  4DV2 T;  1W9R A;  4KHZ F;  3NRY A;  4UEM A;  3O1H A;  3J9X 1;  1W0B A;  3SFD A;  4U72 A;  1MNE A;  2PJQ A;  3PUZ F;  4GK0 E;  5LB7 B;  2Y6X A;  4O4H E;  4WYV A;  2CWY A;  2LT3 A;  3TKL B;  2J47 A;  3Q5E A;  4L0R A;  5ABH A;  4ZI2 D;  2EHO C;  1IBL T;  1J5W A;  4LMK A;  2Q9Q B;  2W67 A;  3ZMZ B;  5HYA A;  1YKE B;  2E9X B;  1YQ3 A;  2KWI B;  1X9B A;  2CHO A;  2A3D A;  2BKN A;  4H9S E;  3PUY F;  2ACZ A;  3ZT5 A;  3ZSS A;  3LJC A;  2HN2 A;  3A8Y C;  4EIW A;  2LRK A;  4PK5 A;  2IDO B;  3AXJ B;  5M4Y A;  3IBP A;  1XDO A;  5H6Q B;  2YDR A;  4WW0 A;  3AE7 A;  2K48 A;  5DAB A;  4PJL A;  3RC3 A;  4AKI A;  3I9W A;  1HCI A;  3O1J A;  4Q25 A;  2JQ9 A;  2A2F X;  4GYR A;  1MIV A;  1O3X A;  3RYF E;  3ZPO A;  4AIS A;  3AEF A;  4EED A;  5LXT E;  4HWD A;  4HEA A;  2CCQ A;  2CE7 A;  2XAH B;  2JQK A;  4IDN A;  4JI0 T;  3L39 A;  1E7P A;  2H7V C;  2BS4 A;  2H89 A;  3FBL A;  4TZ4 C;  2VKD A;  5LA6 E;  3QUJ A;  4N78 D;  5HEH A;  5FNV E;  1MIW A;  4ZZB A;  2XY8 B;  3JCF A;  4JI2 T;  2UXD T;  4BAY B;  5ABE A;  4EZH A;  4O2B E;  2WZI A;  1BR2 A;  2D9D A;  3ESL A;  1D1B A;  4IDO A;  4O4L E;  5AQI B;  1D1A A;  3RGL A;  5AQH B;  4OHF A;  3AEC A;  3FZF B;  3UQ7 A;  1YD8 G;  2JRK A;  4UEL A;  4ZS3 A;  3C51 A;  5HEO A;  5JDQ A;  2BG9 E;  2KLQ A;  2MPK A;  3PUW F;  2WMN A;  5JDL A;  2DNX A;  2IML A;  3KDS E;  3KV5 A;  2CXL A;  2JQH A;  1R8I A;  4H9P C;  4QH1 A;  2FJD A;  4A98 A;  5JR9 A;  1N36 T;  4UIG A;  2XTL A;  1CHU A;  4DR4 T;  1WR0 A;  3ZKR A;  3I0O A;  2Q9Q D;  2PG8 A;  2XHE B;  3LK4 2;  3RRC A;  2WU2 A;  3F31 A;  5LHG B;  4EYY R;  3GN5 A;  2IUB A;  2R6G F;  2X67 A;  4P0A A;  2XQ5 A;  2CHN A;  2BBH A;  2DWG A;  4TUY E;  4ZI2 C;  2EHO D;  4XZC A;  2BDE A;  3SWH A;  3KFW X;  1HNW T;  2H7O A;  2BVM A;  2AE9 A;  3CX6 B;  3CPZ A;  3ZMT B;  2JQQ A;  4PW8 A;  4AKL A;  2MTQ A;  3EVY A;  4LF9 T;  3VKG A;  3PUQ A;  4XAX B;  1HG2 A;  2ODU A;  3AE3 A;  4YJ3 E;  3V5S A;  4EGW A;  5HWX A;  2HHH T;  3FZL B;  4HFI A;  5TAO A;  4TWD A;  4I0U A;  2MBG A;  5KX5 E;  4HFC A;  1DU2 A;  5H6R B;  4B3R T;  4UF0 A;  1XWM A;  5FKY A;  4NPP A;  2NTX A;  2FJB A;  3PV0 F;  1IBM T;  5LG3 A;  3AB3 B;  3T1H T;  4YHJ A;  2E5L T;  1KK7 A;  4QH5 A;  2YKS A;  4WBO A;  4U7I A;  4HGA A;  4EZ4 A;  1WYC A;  4YT0 A;  2QA7 A;  3Q9D A;  2XQY A;  3F57 A;  5FL0 A;  2UUC T;  5AQG B;  4ZZC A;  2N2N A;  2LJL A;  1IJ5 A;  2VKH A;  4OYK A;  3T8O A;  3ETU A;  3QOF A;  5LGT B;  2XAQ B;  4LF5 T;  3FZM B;  2UXX B;  2A72 A;  1D1C A;  2KSR A;  2V8S V;  3SOL A;  4H9R C;  3CX8 B;  5FL1 A;  4YY3 T;  4ILB A;  4U2Z A;  5LHH B;  5J1G A;  2ZM6 T;  5JRC A;  2VUR A;  4DR3 T;  3FBZ A;  1OED A;  4PFO A;  5L3G B;  2X9H A;  2NR4 A;  3AVS A;  3P4W A;  3PUX F;  4GK5 E;  2VAS A;  3AED A;  4E7S A;  2W0G A;  4CN6 A;  4E7Z A;  1OWA A;  2E9X A;  4AQF C;  3X1D A;  4HWH A;  4YJ2 E;  1J5E T;  3AA1 B;  2Q9Q C;  3N9Q A;  4GOU A;  2X9W A;  4ILU A;  4PJM A;  3RC8 A;  5CGM A;  2ZM8 A;  4YLH A;  5AQS B;  1HR0 T;  4X1I E;  2I6H A;  3QK6 A;  3WAJ A;  2WDR A;  2MOZ A;  2YEV C;  4UV8 B;  4A56 A;  1KNR A;  2LHR A;  1YW0 A;  2WQY A;  3G06 A;  3K3Q C;  3VR9 A;  3KBU A;  3N9O A;  3O1I A;  5HEU A;  4EYU A;  2RP4 A;  4ZHQ E;  2WB5 A;  4DV5 T;  4NXM T;  2WDV A;  2WSS V;  2XQ3 A;  4GIW A;  2XSB A;  2BS3 A;  2CXF A;  5IYZ E;  1U4Q A;  4I43 B;  4IHJ E;  4QKN A;  3FXD B;  2VVS A;  3N9P A;  4OK0 A;  3RYC E;  3EUH A;  5LBM A;  4PAG A;  3RI5 A;  1M7K A;  3HA4 A;  4UR9 A;  5JDN A;  5KDM C;  1NEK A;  3ZYL A;  1U5P A;  1ZOY A;  2AXD S;  3KV4 A;  4FJO A;  4P09 A;  5L3F B;  2C0S A;  4DV7 T;  4OX9 T;  4IDP A;  2V5C A;  2YDS A;  1YXR A;  3PUV F;  4HFE A;  5JVD E;  3R6N A;  3NZP A;  4LF6 T;  4QX7 B;  2WP9 A;  3LK3 B;  5AQK B;  2K5B B;  2K3W A;  4HTE A;  4DUY T;  1YQ4 A;  4F6R C;  3CX7 B;  1HX8 A;  3VHL A;  3WI3 A;  4A5X A;  2QGS A;  3UUL A;  4B6X A;  4ZOL E;  3T1Y T;  2XSA A;  2IIU A;  2KWH A;  3JC6 C;  4IST A;  4IE6 A;  4IE7 A;  4TX5 A;  2CA5 A;  2VL0 A;  3C50 A;  3FB2 A;  1WFD A;  4PNI A;  4ANJ A;  2VQE T;  4KP3 C;  2VQF T;  5LMU T;  1ZHC A;  5ETW A;  3VR8 A;  2VKJ A;  3CK6 A;  3AEB A;  4IT4 A;  5AQV B;  4AQF A;  2D2S A;  2V7K A;  3AE1 A;  5LHI B;  2DL1 A;  2ZLY A;  2GK9 A;  3EAB A;  3RQU A;  4Z91 A;  4LF4 T;  4H9Q C;  1Z8U A;  3B57 A;  4HFV A;  1MMD A;  1US7 B;  5IHY A;  3M3Z B;  1CUN A;  3OKQ A;  2NOX A;  3KV6 A;  3L8R A;  3ZCJ A;  3UU3 A;  4K0K T;  4MBQ A;  1Y64 B;  2LSG A;  2NP9 A;  4GKK T;  3TLU A;  4KBM B;  1OED B;  3LSV A;  4IDZ A;  3I1A A;  1XMQ T;  3GWH A;  3PE0 A;  5CA0 E;  4DV0 T;  3ONX A;  1SE7 A;  2XQ6 A;  2DLR A;  3GN5 B;  3ZMU B;  2LE8 A;  2Z6E A;  1FEW A;  2BG9 C;  2FJE A;  4WBN E;  4TWH A;  2V7I A;  2XAJ B;  5HXH A;  3RKO A;  2UUB T;  5EK4 A;  4EAH A;  3RIF A;  5LMN T;  1IZN B;  2C5I T;  5JDH A;  3U78 A;  4H63 V;  3UUM A;  2WBL A;  4KX6 A;  5AQR B;  2YU1 A; 
#chains in the Genus database with same CATH homology
 5J2T E;  2X0L B;  4L5G A;  5L2L A;  2K24 A;  4HKA A;  5KMG P;  3UUN A;  4CQI A;  5LBQ B;  2XUE A;  4C90 A;  5L3D B;  4QXB B;  5LJN A;  1V9D A;  1ZEE A;  5FP3 A;  3E08 A;  3N2K E;  4P0B A;  4CI2 B;  4AKG A;  4BJN A;  2BZB A;  3E0Z A;  4G63 A;  3JC6 D;  4PK4 A;  4PFP A;  1MMG A;  2V26 A;  3WAK A;  3C64 A;  4CI3 B;  4UVB B;  2XAS B;  3KIN B;  2ODV A;  3L3P A;  2VWA A;  5LCY A;  3BQL A;  2LSY A;  4ISS A;  5EK3 A;  3UFE A;  3N5L A;  3CQX C;  5AFU L;  4J2C A;  3C4X A;  3PUR A;  3F2E A;  1G73 A;  3PDY A;  1MND A;  2HH7 A;  3ANW A;  4ZI7 E;  1S94 A;  3AA6 B;  3OYX A;  4YFS A;  3ZC0 A;  3EDV A;  4MFR A;  5CA1 E;  3I9Y A;  2X68 A;  3RYH E;  2LM9 A;  3KVA A;  4AKH A;  5FYM A;  3ZJ2 A;  3H37 A;  2IAK A;  3SRZ A;  5LP6 E;  3HR0 A;  3NZQ A;  4HN9 A;  1FMV A;  1HFA A;  2LSI A;  4KMC A;  5LGU B;  4QXH B;  1SHZ C;  4EXT A;  3ZCI A;  4DBR A;  3A5X A;  1Z0P A;  4G2A A;  1S35 A;  2Y8D A;  5ADX L;  3ZEF B;  1FMW A;  2ACX A;  5FY1 A;  4IE0 A;  3HKE E;  1MMN A;  5FXZ A;  4IE5 A;  1BR1 A;  2Q9Q A;  4JUY A;  2RA1 A;  3HKC E;  1UX4 A;  2CMR A;  5FXW A;  2OA5 A;  2ZMA A;  2V1D B;  5FXX A;  1LRZ A;  5EK2 A;  2D0U A;  3IHR A;  3HL6 A;  3M65 A;  3N2O A;  3RPU A;  1LVK A;  2X66 A;  3V5U A;  4ERR A;  4IGU A;  2IC9 A;  2NWB A;  3EDU A;  1LVF A;  3PTR B;  3AAE B;  2PFV A;  4DND A;  2HPL A;  4QHO A;  3FXE B;  2LOS A;  3MK7 C;  3ZLI A;  2L8K A;  3VU7 H;  5DQV A;  2H3R A;  2VKO A;  3UT5 E;  3OJA A;  4I55 E;  3ZYK A;  4MHC A;  1NAF A;  2D5U A;  2L3L A;  3RRW A;  2G0U A;  4PK6 A;  3IF8 B;  2DI4 A;  1NWM X;  3I0Q A;  1HTJ F;  2D0T A;  3HKD E;  3E22 E;  5HXE A;  2E9X D;  3AAI A;  4ASK A;  3CVR A;  4DVD A;  3CML A;  2VK9 A;  1BR4 A;  1MIY A;  4MAL A;  1VRB A;  5FY7 A;  4ZI3 D;  2LSJ A;  5JQG E;  3PUG A;  5DQW A;  2YIN A;  4TV9 E;  1EZ3 A;  3DP7 A;  2JJ9 A;  3RH3 A;  1E1H B;  4CXX A;  5C8Y E;  3RX6 A;  2NTY A;  2I59 A;  2KIN B;  2Y48 B;  2C5J A;  5LOV E;  5GON E;  5L3E B;  3K3O A;  2CM0 A;  3KBT A;  5A1L A;  2V7M A;  4K0U A;  5LG4 A;  2JMK A;  3VKH A;  3ETV A;  4X1K E;  3N2G E;  4UXN B;  2WWU A;  4DMW A;  4EOZ B;  3RYI E;  2KZ7 B;  4O4I E;  1BR0 A;  3CQC B;  3Q5W A;  2LEH A;  3HI2 A;  4WNK A;  4AQG A;  5JDG A;  3LG7 A;  4XBF B;  4Z8X A;  3LBX B;  2VB6 A;  1IAP A;  3N9L A;  1UCU A;  4UF0 B;  4V1A v;  4L9I A;  2NW8 A;  4BA9 A;  3UUX B;  3O4X E;  4U74 A;  2WMO A;  3KVB A;  4OYJ A;  3BK9 A;  4DO0 A;  3BQK A;  2XAF B;  3OBV E;  4DBQ A;  1VOM A;  4IIJ E;  3PUA A;  2NW9 A;  4GYS A;  1OXZ A;  3QC9 A;  2LHN A;  4AXP A;  1YKH B;  2E9X C;  4JEH B;  5JDF A;  5JH7 E;  5HXC A;  3K3N A;  3UTK A;  4BJM A;  5LYJ E;  4DMV A;  3MZK B;  3C98 B;  2K9A A;  4ZI3 C;  4H9N C;  3U3I A;  2UXN B;  2BVL A;  1D0Z A;  3NRX A;  1G8X A;  2X9X A;  4O2A E;  2XAG B;  5LJM A;  5DJQ C;  2CEA A;  2M67 A;  3B13 A;  5F3J A;  3PU3 A;  2V7J A;  2VL8 A;  2N9D A;  3P8C D;  1SA0 E;  1ZV4 X;  3N9M A;  4JEU B;  4QX8 B;  4XZC A;  1QUU A;  5HYA A;  5JRE A;  3AAA B;  5JR9 C;  3Q2M A;  4ZS2 A;  1B7T A;  1UX5 A;  2IC6 A;  3ZMV B;  3MJX A;  3W15 B;  2C5K T;  3LFM A;  4HE8 A;  3PU8 A;  2X9Y A;  2KT9 A;  4CZZ B;  3S4U A;  3CKD A;  2SPC A;  3AA7 B;  4PJJ A;  4X20 E;  2ZM0 A;  1AJ3 A;  4CXW A;  4UV9 B;  2DCF A;  4CXY A;  4ADZ A;  4MLK A;  3AVR A;  3MAC A;  4O4J E;  4QXC B;  3BQI A;  1D0X A;  3KV9 A;  5JRC B;  3GA8 A;  5LNK A;  3C4W A;  1MMA A;  4NUV A;  3L09 A;  3N9N A;  1WRD A;  3GMI A;  3LK2 B;  2W62 A;  2LSK A;  2V7L A;  4TN7 B;  3MKD A;  4I4T E;  3ZYM A;  2KXP B;  4X1Y E;  4IE4 A;  5FXV A;  5L3C B;  4OFZ A;  3ANW B;  4M1P A;  5FMN A;  1HF8 A;  3IEE A;  1HS7 A;  5F8P A;  1ZKE A;  3ZJ1 A;  3O9X A;  2W61 A;  3AA0 B;  2LOP A;  3ZC1 A;  2JMH A;  4KUM B;  3P7I A;  2L9Q A;  1X79 A;  4FI5 A;  1WYB A;  3OYZ A;  3ZN1 B;  5HXS A;  1T98 A;  2CXD A;  5EZY E;  2WM9 A;  2KND A;  2YK0 A;  4JLE A;  5E0O A;  1H7C A;  2PBI A;  4NUU A;  2B1E A;  1QSD A;  2CWO A;  5JR9 B;  1IJ6 A;  3CQG B;  4EB6 E;  4AI6 A;  4UVA B;  5JDM A;  4TV8 E;  3C4Z A;  2EHO B;  3DTO A;  4H9O C;  4QWN B;  2DWK A;  3FHN A;  4UVC B;  5L3B B;  5LGN B;  2WAU A;  3HKB E;  5HAX A;  3PUS A;  3J7Y q;  2EHO A;  2J1D G;  2KMF A;  3LBX A;  4PJN A;  2N1G A;  5BMV E;  2ZM2 A;  2IW5 B;  2NW7 A;  1HG5 A;  3ZN0 B;  2P9B A;  2CLY B;  5HXR A;  5CB4 E;  2MYS A;  2JPF A;  2W00 A;  4CI1 B;  3MA9 A;  4I50 E;  3DJB A;  4AKR B;  1D0Y A;  3Q5X A;  3MXZ A;  3H3A A;  4C91 A;  2X51 A;  5HWY A;  2E8I A;  1KNZ A;  3SS1 A;  5FY0 A;  2DHR A;  2HPJ A;  2W63 A;  4H63 H;  2YU2 A;  4O8S A;  1WLX A;  1LKX A;  3R84 B;  3CWZ B;  1WR6 A;  1FIO A;  3K8P C;  5J2U E;  3D0T A;  2CLY C;  2ES0 A;  3NBX X;  3NRY A;  4UEM A;  3O1H A;  3J9X 1;  4U72 A;  1MNE A;  2PJQ A;  4GK0 E;  2Y6X A;  4O4H E;  2CWY A;  2LT3 A;  3TKL B;  4L0R A;  4ZI2 D;  2EHO C;  3ZMZ B;  2Q9Q B;  1YKE B;  2E9X B;  2KWI B;  5JRC A;  2A3D A;  4H9S E;  4EIW A;  3LJC A;  4PK5 A;  5M4Y A;  3IBP A;  5H6Q B;  4WW0 A;  2K48 A;  5DAB A;  4PJL A;  3RC3 A;  4AKI A;  3I9W A;  1HCI A;  3O1J A;  3RYF E;  3ZPO A;  2A2F X;  4GYR A;  1MIV A;  1O3X A;  5LXT E;  4HEA A;  2CCQ A;  2CE7 A;  2XAH B;  2H7V C;  3FBL A;  5LA6 E;  3ZMS B;  4TZ4 C;  2VKD A;  3QUJ A;  4N78 D;  5FNV E;  1MIW A;  4BAY B;  4EZH A;  4O2B E;  1BR2 A;  3ESL A;  1D1B A;  4O4L E;  1D1A A;  4OHF A;  1YD8 G;  2JRK A;  4UEL A;  4ZS3 A;  3C51 A;  5JDQ A;  2KLQ A;  2WMN A;  5JDL A;  2DNX A;  3KDS E;  3KV5 A;  2CXL A;  4H9P C;  5JR9 A;  4UIG A;  2XTL A;  3I0O A;  2Q9Q D;  2PG8 A;  2XHE B;  3LK4 2;  3RRC A;  3F31 A;  5LHG B;  4EYY R;  3GN5 A;  2X67 A;  4P0A A;  2DWG A;  4TUY E;  4ZI2 C;  2EHO D;  2BDE A;  3SWH A;  3KFW X;  2H7O A;  2BVM A;  3CX6 B;  3ZMT B;  3CPZ A;  4AKL A;  2JQQ A;  4PW8 A;  2MTQ A;  3EVY A;  3VKG A;  3PUQ A;  4XAX B;  1HG2 A;  2ODU A;  4YJ3 E;  3V5S A;  5HWX A;  5TAO A;  2MBG A;  5KX5 E;  5H6R B;  4UF0 A;  2NTX A;  3AB3 B;  4YHJ A;  1KK7 A;  4WBO A;  4EZ4 A;  4HGA A;  1WYC A;  2QA7 A;  3Q9D A;  2XQY A;  3F57 A;  2N2N A;  2LJL A;  1IJ5 A;  2VKH A;  4OYK A;  3T8O A;  3ETU A;  5LGT B;  2XAQ B;  2UXX B;  2A72 A;  1D1C A;  3SOL A;  4H9R C;  3CX8 B;  5LHH B;  5J1G A;  3FBZ A;  4PFO A;  5L3G B;  2X9H A;  3AVS A;  4GK5 E;  2VAS A;  4E7S A;  2W0G A;  4E7Z A;  1OWA A;  2E9X A;  4AQF C;  4YJ2 E;  3AA1 B;  2Q9Q C;  3N9Q A;  4GOU A;  2X9W A;  4ILU A;  4PJM A;  3RC8 A;  2ZM8 A;  4YLH A;  4X1I E;  3QK6 A;  3WAJ A;  4A56 A;  2MOZ A;  2YEV C;  4UV8 B;  2LHR A;  1YW0 A;  3K3Q C;  4ZHQ E;  3KBU A;  3N9O A;  3O1I A;  4EYU A;  2RP4 A;  2WSS V;  4GIW A;  5IYZ E;  2CXF A;  1U4Q A;  4I43 B;  4IHJ E;  4QKN A;  3FXD B;  3N9P A;  4OK0 A;  3RYC E;  3EUH A;  5LBM A;  4PAG A;  3HA4 A;  5JDN A;  5KDM C;  3ZYL A;  1U5P A;  3KV4 A;  4FJO A;  4P09 A;  5L3F B;  2C0S A;  5JVD E;  3R6N A;  3NZP A;  4QX7 B;  3LK3 B;  2K5B B;  4HTE A;  4F6R C;  3CX7 B;  1HX8 A;  3VHL A;  3WI3 A;  4B6X A;  2QGS A;  3UUL A;  4ZOL E;  3JC6 C;  2KWH A;  4IST A;  4IE6 A;  4IE7 A;  4TX5 A;  3FB2 A;  2CA5 A;  3C50 A;  4ANJ A;  4PNI A;  4KP3 C;  1ZHC A;  5ETW A;  2VKJ A;  4AQF A;  2D2S A;  2V7K A;  5LHI B;  2ZLY A;  2GK9 A;  4H9Q C;  3B57 A;  4HFV A;  1MMD A;  1US7 B;  5IHY A;  1CUN A;  3OKQ A;  2NOX A;  3KV6 A;  3ZCJ A;  4MBQ A;  1Y64 B;  2LSG A;  2NP9 A;  4KBM B;  4IDZ A;  3I1A A;  3GWH A;  3PE0 A;  5CA0 E;  3ONX A;  3GN5 B;  2DLR A;  3ZMU B;  2LE8 A;  2Z6E A;  1FEW A;  4WBN E;  2V7I A;  2XAJ B;  5HXH A;  3RKO A;  5EK4 A;  4EAH A;  1IZN B;  2C5I T;  5JDH A;  3U78 A;  4H63 V;  3UUM A;  2WBL A;  2YU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...