4ZI3C

Bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
123
structure length
123
Chain Sequence
b'DEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 50
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi3C00
4ZI3D 4ZI2D 4ZI3C 2K9AA 4ZI2C
chains in the Genus database with same CATH superfamily
3M65A 1HG5A 2BZBA 3WAJA 4P1NA 5AQHB 2X0YA 4ZS3A 3V5UA 3R84B 1KFYA 5F8PA 3ETVA 2V7LA 2WZIA 3PU3A 4IIJE 4OYKA 3ETUA 4F6RC 2XQYA 2ZLYA 4DR5T 4ANJA 4KHZF 2A3DA 4EAHA 5LOVE 2D5UA 5LBQB 4JBWF 1AJ3A 4FI5A 1N34T 2BG9A 4LMJA 3UU8A 2VURA 1Z0PA 2K3WA 5ADXL 5FP3A 4KP3C 2BDEA 4IHJE 4MLKA 4DV1T 4HWIB 1EZ3A 1S94A 5JH7E 1SUMB 5L4HA 1J1JA 1HTJF 2WM9A 2KZ7B 4TWFA 4QX8B 2V7IA 1ZP0A 4ZI7E 5BR8T 2DCFA 4AISA 4U31A 1IJ6A 4BJMA 3UU4A 1MMDA 4I4TE 4MFRA 3PUYF 4UXNB 2L3LA 2V6YB 2LHRA 3AE4A 3SFDA 5FVKA 5H6RB 5LHHB 2XQ8A 3LK42 5EK3A 3RYFE 2YDQA 2K9AA 3N2OA 2NR4A 3AA1B 3AA0B 3UU6A 3ZSTA 2H7OA 3LSVA 1OXZA 3AE6A 5AQNB 1X9BA 3N2KE 3RRWA 4DV3T 1UURA 2C5IT 2R6GF 2LSJA 3C4ZA 2V5DA 3OYXA 3O1JA 1GQEA 2V7JA 4PFPA 3MZKB 5JR9B 5J1GA 2K48A 3ZC1A 4DR7T 1LKXA 2LSYA 5JTGA 3ZT6A 2MYSA 2X9WA 4PJNA 3F2EA 4U2ZA 4ISTA 3DJBA 2QVAA 3RYCE 3CVRA 2BBJA 3ONLC 3G06A 3JAFA 4NXNT 3QOFA 4IDQA 5KDMC 1WCRA 2Q9QD 3ZMTB 4H9OC 5LMNT 3UFGA 5CB4E 4HFBA 4IE0A 4IE4A 4GIWA 2WCAA 4WBOA 5AFUL 5AQOB 4HEAA 4AXPA 3O4XE 5FNVE 5FXVA 2CBIA 2XQ3A 3SOLA 1HNXT 3UT5E 2W62A 2XQ6A 2VVNA 5LG4A 4X1KE 5HYAA 3B5MA 2B76A 3UUNA 5J0ZA 1XDOA 2IMLA 4UR9A 4X1YE 1WFDA 3P4SA 1HR0T 5AQPB 3AA7B 4QKNA 1FMVA 3VRAA 1DU2A 4WYVA 2CMRA 4YJ2E 3NBXX 2CHNA 3AE3A 4LMKA 3H37A 5JREA 4N78D 4JI5T 1OEDA 2BKNA 4U2YA 3SRZA 4ILCA 5ABFB 2JQHA 2CCQA 4HWHA 4WBNE 4U33A 2HPLA 2LEHA 3F57A 3AE5A 5FVLA 3N9NA 2HN1A 2YDSA 2G0UA 4DR3T 2E9XB 4ZI2D 3GMIA 4EV6A 2XQ9A 1WYCA 2X68A 3AA6B 4HGAA 3DP7A 2KT9A 4ZZCA 2ODUA 4JLEA 4E7SA 3MXZA 3AAAB 3CPZA 2M6BA 3AAEB 4YHJA 1L0VA 2MAWA 4DR2T 4XAXB 3I1AA 4CN4A 5L3CB 4GYSA 3ABVA 2XAFB 2A2FX 3P8CD 4K0KT 3ZMVB 1US7B 5LNKA 4IDPA 2XQAA 2BS2A 3EUHA 4K0UA 2XM1A 4HFHA 1FIOA 1G8XA 4QWNB 2YKSA 2UUBT 2XQ5A 1BR4A 5HXSA 4H9NC 2I6HA 2Y6XA 1UGOA 3EABA 4IGUA 3ZN1B 4OX9T 3ZN0B 4HFIA 4EYUA 3ZYLA 2OV9A 3C98B 4AQFA 4C91A 4DVDA 4AKGA 2UUCT 2V26A 5E0OA 2QRXA 3N9LA 5KX5E 2Y48B 2V5CA 1W0BA 2V7MA 2ZM0A 1YD8G 4MALA 1YKHB 1SHZC 3UFEA 2WU2A 2LSIA 4UV9B 2LT3A 2CXLA 3AE1A 3Q2MA 3PE0A 3P7IA 4CQIA 2OA5A 1BR1A 2F4VT 3PDYA 4X62T 1BR2A 5LGTB 1HCIA 4X64T 5AQLB 3AEDA 2RA1A 5JDFA 1LRZA 5HEOA 3HKDE 5DABA 4U72A 3LK3B 2UXXB 4IL4A 2XSBA 5EZYE 4UV8B 4XZCA 5L2LA 4FJOA 4B6XA 4H63H 4YTNA 2LRLA 4TWHA 2XAHB 2XM2A 3KBUA 3MJXA 4PAGA 3UQ7A 4CI2B 2YU1A 3E0ZA 4PJJA 2EHOA 4YY3T 2CM0A 2DLRA 2HPJA 3VKHA 4A98A 3ZPOA 5JQGE 2WDVA 2V6XA 4H9QC 4AQGA 2MPKA 3ZKRA 1YKEB 2XQ4A 3SS1A 4U3CA 3FBZA 3SFEA 2QGSA 3K1SA 2PG8A 4UVCB 4PNIA 3MACA 4JUYA 1XNRT 3AVSA 4AI6A 3N2GE 5JRCB 3AEGA 2VASA 3ZC0A 3L8RA 4ZEYA 4ZHQE 2MOZA 3ANWB 2CLYB 3LBXB 3PV0F 3ZT5A 2QYWA 3PUQA 5CGMA 3CX7B 3PU8A 3ZMSB 4NPPA 3AEBA 3U78A 3OKQA 4J2CA 2FJDA 4A5XA 3B57A 1VCTA 4CXYA 2J4GA 5H6QB 2KWIB 2CEAA 3NVOA 2LE8A 4DBQA 4TN7B 2CWOA 2RPAA 1QUUA 1XDPA 3AECA 4TZ4C 2E9XD 2X0HA 3CK6A 2WWVA 1E2AA 1ZV4X 5FL0A 3UTKA 4JI3T 3R6NA 1I6ZA 1XZYA 2RP4A 3AE2A 2GK9A 1ZHCA 3KDSE 2XASB 5EK4A 2DL1A 2XAQB 4CN1A 4AQFC 3LG7A 4QH5A 2H7VC 3BQIA 4HE8A 2KMFA 4JYAT 1E7PA 3PJAJ 3AEFA 5ABEA 5L4EA 4HKAA 3OVUA 2N2NA 3B13A 1H7CA 4PJLA 2ZMAA 5FY1A 4DV4T 2H88A 1Y01A 4JI8T 1VRBA 1NENA 5AQFB 1D1CA 1YW0A 5AQVB 3Q5EA 5HWYA 4O4HE 4ILAA 4QXBB 3QUJA 1MNDA 5FY7A 2C0SA 4Z91A 4GKJT 5JVDE 2LSKA 3P50A 4I55E 3KINB 3RIUC 2IC6A 5LA6E 4IDOA 5L3BB 3GWHA 3FZMB 4LF8T 5AQQB 4QX7B 3PJAA 4EGWA 3AE7A 3M3ZB 3KVAA 4ASKA 5JR9C 4PK5A 3IF8B 1SA0E 3KV6A 5DJQC 3L09A 2WMOA 2ODVA 2WS3A 1IBLT 3RF1A 3JC6C 4ZI3C 2XZEA 1G73A 5ETWA 2X66A 4GOUA 2EHOC 5M4YA 3TKLB 3E22E 1UX5A 2JQQA 1X79A 3ZJ2A 4KX6A 3OTOT 2Y8DA 3RYHE 4H9PC 1O3XA 3ZYMA 2AE9A 2BVMA 3CKDA 4QXCB 2WP9A 3C50A 5LJNA 4KI0F 1D1BA 1D0ZA 5DQVA 2WWUA 2VK9A 2VWAA 1T8BA 4B3TT 2V1DB 4EXTA 2LRKA 2N1GA 3A7MA 2CXDA 4UF0B 4LFCT 2JRKA 3ONXA 4IE6A 3BQKA 2WDQA 4G63A 5LP6E 3RPUA 1UX4A 5ABHA 4AKIA 4QHOA 5FL1A 2AXDS 4ZOLE 5HEHA 4B3RT 3GN5B 3KV5A 5HEGA 2KLQA 2V8SV 2L9QA 1S35A 2XY8B 2IAKA 3P4PA 2HN2A 5LGNB 1U4QA 2DNXA 1ZKEA 1U5PA 4HFEA 4DO0A 3RX6A 3I0OA 3QC9A 2A9UA 2C5KT 5JDQA 2LOSA 1WRDA 2KINB 4Z8XA 3ZT7A 4AQYT 2D0TA 4JI0T 3Q5WA 2D0UA 4COFA 2ACXA 3N9QA 3C64A 3HKEE 3NWIA 3UU5A 5JDLA 3ZCIA 3BK9A 5L3DB 4EEDA 5LHIB 3IBPA 5FXXA 3CQCB 4JEHB 4YSYA 4EZHA 3L39A 4YTPA 3N9PA 2BG9B 2NW8A 1Y64B 2DI4A 2NW9A 4DNDA 4P09A 5LXTE 4WZXA 4BJNA 4H63V 3FB2A 2WSSV 4OK0A 1W0AA 1HFAA 2W61A 2VKDA 2J47A 3UULA 1UK5A 5C8YE 3EI0A 5FKYA 5HCJA 2UXDT 4JI7T 2VVSA 4U7IA 3RYIE 3UU3A 3VRBA 3DTOA 4L0RA 2UXCT 1YXRA 1IJ5A 2IIUA 4NXMT 4DV2T 4C90A 2FJAA 4UVBB 4LFBT 4WNKA 4IL9A 2XSAA 4IE7A 3EHZA 5ABGA 2IHR1 4CN6A 3AVRA 5AQSB 4JV5T 2UXBT 5IYZE 3PUZF 5AQRB 4X5TA 4ILBA 3N9MA 2K5BB 2MBGA 3C51A 1HF8A 3AAIA 1XWMA 3Q5DA 4KBMB 2CBJA 3UUBA 1J5ET 3TLSA 2YK0A 3UUXB 2ZM6T 5AQJB 4GKKT 1KF6A 3Q5XA 2DWKA 3K3QC 2FBWA 1UUSA 2VB6A 5HXHA 2WDRA 2WY2A 2DHRA 4IREA 5CFBA 5HWXA 5FY0A 2V6YA 1MIVA 5FYMA 5IHYA 3F31A 3QK6A 5LB7B 3GA8A 2Q9QC 3RIUA 3E08A 3PUSA 4PK6A 1MMAA 3RC8A 4IT4A 1HNWT 2LM9A 2YU2A 5KMGP 4UEMA 2WBLA 4NUUA 2IDOB 2PJQA 3RIFA 5HCMA 4HFVA 4DUYT 3AEEA 4DUZT 1YQ3A 1N36T 5JR9A 1J5WA 1NWMX 1HG2A 2BG9E 3VR8A 1HX8A 3C4XA 2FUPA 3WAKA 4KUMB 4CI3B 2LM2A 4LF9T 1FJGT 5AQMB 2KSRA 2W00A 2VKJA 1T98A 1XMOT 5J2TE 4JEUB 4IDNA 2A72A 3ONJA 4GK5E 4HWFA 1NAFA 3T1HT 2H3RA 3ZJ1A 2CLYC 3MKDA 2YEVC 2BKPA 4O4LE 3HKBE 1OEDB 4LMLA 2NOXA 4BAYB 2UUAT 3PUVF 3RKOA 4UVAB 5C3JA 4O4IE 5L3FB 4GK0E 5LBMA 4A97A 4DIDB 4U7YA 4LF6T 2XTLA 4ISSA 4L5GA 3CIRA 2L8KA 4DV6T 3J9X1 4ZI2C 4OFZA 2HH7A 2K24A 4NUVA 1XMQT 2YN6A 2V7KA 2ZM8A 4DR6T 2LOPA 2HHHT 5AQTB 4JI2T 2W66A 3IA3A 3AXJA 2BS3A 2D9DA 3K3OA 1MIWA 5LYJE 2JPFA 1VOMA 1JNZA 4HFDA 2W4XA 4E7ZA 3PUWF 2W2UA 5HEJA 2CWYA 4HTEA 4TWDA 2FJBA 4CXWA 2UU9T 3KV9A 5LJMA 2SPCA 5L47A 5ABFA 3MK7C 3VR9A 1QSDA 4CXXA 5JDGA 1HNZT 2I59A 2E9XA 2LLYA 3KVBA 4Q25A 5IWAT 3HL6A 1ZEEA 4LF4T 4JI6T 4PW8A 3N9OA 2VKHA 3FXEB 2JJ9A 4HWCA 2PBIA 3CQXC 5J2UE 3KBTA 2JQKA 2NP9A 3PUXF 1IZNB 4Z90A 4YJ3E 3T1YT 2J1DG 2IC9A 3P4QA 3RRCA 4UELA 2CRBA 4B3ST 4OYJA 3UQ4A 2YDRA 2FJEA 4H9SE 5CA1E 4HN9A 2XJ7A 4TUYE 4TX5A 1FEWA 3P4WA 4KMCA 4I43B 4TNVA 2JQ9A 4EZ4A 4TNWA 3AEAA 3LDQB 5HXCA 4EEBA 1FMWA 5FXWA 4ADZA 4PJMA 4MHCA 3H3MA 2KNDA 3EDUA 1M7KA 2PTFA 5C2TA 3KV4A 4NIQA 5DQWA 3RQUA 4XBFB 3ZMZB 4X65T 1OEDE 3TLVA 1N32T 4ZS2A 5JDNA 2BKOA 3QB5K 3PURA 3BQLA 4G2AA 1W09A 2PFVA 4M1PA 2NTXA 3JADA 2VKOA 2X51A 3I0QA 3FHNA 1KEYA 3VKGA 1T7SA 2E8IA 3CQGB 2JMKA 3JCFA 2NWBA 1T72A 3FXDB 3AB3B 2WQYA 4A56A 4YSZA 3CWZB 2M6IA 3NKZA 3ESLA 3X1DA 4QXHB 4P0BA 2ZM2A 4DV0T 1IBKT 4H9RC 1CHUA 2CXFA 2OLTA 3L3PA 2EHOB 3ZEFB 4DR1T 1IBMT 2CHOA 3D0TA 5LG3A 3HKCE 3CMLA 3FZFB 3LK2B 2W67A 4PFOA 4YHHT 4IE5A 4HFCA 3S4UA 4ERRA 3NRYA 5HXRA 3P4RA 2X9YA 3PUGA 2WZHA 3RI5A 3U3IA 3QB5A 2LKHA 2Q9QA 2X9HA 1D0YA 3EDVA 1HS7A 3LJCA 2LHNA 4YFSA 5F3JA 5A1LA 1WLXA 2WB5A 1JNRA 1W9RA 2IUBA 4O2AE 1BR0A 1KK7A 3K3NA 3KFWX 3HA4A 4AKRB 3OYZA 3SWHA 2M67A 2CE7A 1UCUA 2B1EA 3AXJB 4YLHA 2XQ7A 4DV5T 3RLFF 4L9IA 3QNUA 3Q9DA 2WAUA 3FZKB 2BG9C 2E9XC 3TLTA 4DR4T 2BVLA 1IAPA 1WR6A 4ZZBA 4YSXA 2CA5A 5JRCA 5HXEA 3RH3A 3TLUA 3ANWA 3I9YA 1N33T 3LBXA 1MNEA 3OPCA 4HWDA 5BMVE 5LGUB 4IDZA 3J7Yq 4I50E 3RQWA 5CA0E 2CPTA 2W63A 4MBQA 3H3AA 3HR0A 3WI3A 4EOZB 4KHPT 2D2SA 1QLBA 2P9BA 4TV9E 2XPKA 5AQIB 2VL8A 3ZLIA 1MMGA 3RHWA 3O1IA 2XUEA 4O2BE 1VCSA 2ACZA 1V9DA 3O1HA 4UIGA 4YXDA 4JI1T 3FZHB 5FXZA 1CUNA 2XAGB 3CX8B 3EAMA 4X1IE 2E5LT 3JAEA 4CI1B 3LFMA 3FBLA 2J62A 3TLWA 3V5SA 5F5WA 3K8PC 3A8YC 3OBVE 1YQ4A 2ES0A 2VQET 4QH4A 4YTMA 5HAXA 3ZSSA 5AQGB 3UUMA 1D0XA 1LVFA 2XHEB 3RGLA 4EIWA 3RC3A 3A5XA 1B7TA 4LF5T 1KNPA 2YOEA 5EK2A 2BBHA 4B3MT 3AE9A 2C5JA 4F8HA 4TV8E 3ZCJA 3NRXA 5L3GB 1OWAA 3RKGA 5LHGB 1WYBA 5AQKB 1ZOYA 4LFAT 4OHFA 2VL0A 4X20E 3PUAA 3AE8A 2BS4A 4O8SA 5IUXA 2YINA 1D1AA 3HI2A 4O4JE 5LMUT 3CX6B 3IEEA 4GYRA 4LF7T 3ZYKA 1E1HB 1KNRA 5FMNA 4DMVA 2X67A 3W15B 2W0GA 4PK4A 2IW5B 5TAOA 4P0AA 4X66T 2LKGA 2KWHA 4JI4T 2LJLA 2X0LB 3EVYA 2N9DA 4EB6E 5CJ5A 3VHLA 2JIWA 3JC6D 4ZI3D 4QH1A 5JDHA 3IHRA 4I0UA 2NW7A 2EHOD 1WR0A 1MIYA 2Q9QB 3FZLB 2MTQA 3C4WA 2X9XA 5HEUA 5JDMA 4U74A 1MMNA 1NEKA 2WU5A 4DBRA 4EYYR 4DMWA 2I0MA 4AIUA 4WW0A 3ZMUB 2VQFT 2E2AA 4CZZB 1OEDC 4AKHA 3N5LA 2JMHA 1R8IA 4ZXLA 1KNZA 2NTYA 3RIAA 3OJAA 4ILUA 2DWGA 5AQUB 2KXPB 4UF0A 3T8OA 4YT0A 2Z6EA 3I9WA 2WMNA 5KXJA 1M62A 4AKLA 3PTRB 4DV7T 2E5VA 4BA9A 5L3EB 3GN5A 5GONE 2XAJB 2H89A 5LCYA 1Z8UA 2UXNB 1SE7A 3NZPA 4V1Av 2LSGA 3O9XA 1HX1B 1LVKA 3MA9A 1XNQT 3VU7H 1I94T 2QA7A 3NZQA
chains in the Genus database with same CATH topology
3M65A 3HKEE 1HG5A 3UFEA 2BZBA 4ZS2A 5JDNA 3WAJA 5JDLA 2LSIA 3PURA 3ZCIA 3BK9A 3BQLA 4G2AA 5L3DB 5LHIB 3IBPA 4UV9B 2PFVA 5FXXA 2LT3A 3CQCB 2CXLA 4M1PA 2NTXA 4ZS3A 2VKOA 3V5UA 2X51A 4JEHB 4EZHA 3R84B 3Q2MA 3PE0A 3N9PA 3I0QA 3FHNA 2NW8A 1Y64B 3P7IA 4CQIA 5F8PA 3VKGA 3ETVA 2DI4A 2OA5A 2E8IA 3CQGB 2JMKA 1BR1A 2V7LA 2NW9A 3PU3A 4IIJE 4DNDA 4P09A 3PDYA 4OYKA 5LXTE 3ETUA 2NWBA 4F6RC 4BJNA 2XQYA 4H63V 3FXDB 2ZLYA 3AB3B 4A56A 1BR2A 4ANJA 5LGTB 3CWZB 3FB2A 3ESLA 2WSSV 4QXHB 4OK0A 1HCIA 1HFAA 2A3DA 4EAHA 4P0BA 5LOVE 2D5UA 2RA1A 5JDFA 2W61A 5LBQB 2VKDA 1LRZA 2ZM2A 3HKDE 4H9RC 5DABA 4U72A 1AJ3A 2CXFA 3UULA 3L3PA 4FI5A 2EHOB 3ZEFB 3LK3B 2UXXB 5C8YE 3D0TA 5EZYE 1Z0PA 3CMLA 3HKCE 4UV8B 5ADXL 3LK2B 5FP3A 4KP3C 4PFOA 4XZCA 4IE5A 3RYIE 2BDEA 5L2LA 3S4UA 4IHJE 4ERRA 4FJOA 4B6XA 3NRYA 4H63H 4MLKA 5HXRA 1EZ3A 3DTOA 2X9YA 2XAHB 4L0RA 3PUGA 1S94A 1IJ5A 3KBUA 3MJXA 5JH7E 4PAGA 4C90A 3U3IA 4CI2B 1HTJF 4UVBB 2YU1A 3E0ZA 2Q9QA 2WM9A 2X9HA 4PJJA 2KZ7B 2EHOA 1D0YA 3EDVA 4WNKA 4QX8B 2CM0A 1HS7A 2DLRA 2HPJA 3VKHA 2V7IA 3ZPOA 4IE7A 5JQGE 4ZI7E 3LJCA 2LHNA 4H9QC 4YFSA 2DCFA 5F3JA 4AQGA 5A1LA 1WLXA 3AVRA 1IJ6A 4BJMA 1YKEB 3SS1A 3FBZA 4O2AE 1MMDA 4I4TE 4MFRA 5IYZE 2QGSA 1BR0A 1KK7A 3N9MA 3K3NA 3KFWX 2PG8A 4UVCB 4PNIA 3HA4A 2K5BB 2MBGA 3MACA 4AKRB 3OYZA 3C51A 2M67A 4JUYA 1HF8A 1UCUA 2CE7A 2B1EA 3AAIA 3AVSA 3SWHA 4AI6A 3N2GE 5JRCB 4YLHA 4KBMB 4UXNB 2VASA 3ZC0A 2L3LA 4L9IA 2LHRA 3Q9DA 4ZHQE 2MOZA 3ANWB 2CLYB 2WAUA 3LBXB 5H6RB 3PUQA 2YK0A 5LHHB 3LK42 5EK3A 3RYFE 3CX7B 3UUXB 2K9AA 3N2OA 3AA0B 3AA1B 2E9XC 3PU8A 3ZMSB 2H7OA 3U78A 3OKQA 1OXZA 3Q5XA 2DWKA 3K3QC 4J2CA 2BVLA 2VB6A 1IAPA 1WR6A 3N2KE 5HXHA 3RRWA 2CA5A 5JRCA 2DHRA 2C5IT 3B57A 5HXEA 2LSJA 4CXYA 3C4ZA 3RH3A 3OYXA 5HWXA 5FY0A 3O1JA 5H6QB 3ANWA 1MIVA 2V7JA 4PFPA 5FYMA 5IHYA 2KWIB 3F31A 2CEAA 3I9YA 3MZKB 5JR9B 2LE8A 3QK6A 3GA8A 5J1GA 3LBXA 2K48A 1MNEA 2Q9QC 4DBQA 3E08A 3ZC1A 3PUSA 4PK6A 1MMAA 4TN7B 3RC8A 5BMVE 5LGUB 4IDZA 1LKXA 2CWOA 2LM9A 2LSYA 2YU2A 1QUUA 5KMGP 3J7Yq 4I50E 4UEMA 5CA0E 2WBLA 4TZ4C 2E9XD 2MYSA 2X9WA 1ZV4X 4NUUA 2W63A 4MBQA 4PJNA 3H3AA 3HR0A 3UTKA 3F2EA 3WI3A 3R6NA 4EOZB 2RP4A 2D2SA 2PJQA 2P9BA 4TV9E 2VL8A 4HFVA 3ZLIA 4ISTA 1MMGA 3DJBA 2GK9A 1ZHCA 3KDSE 3O1IA 3RYCE 3CVRA 2XASB 2XUEA 4O2BE 5EK4A 2XAQB 5JR9A 4AQFC 1V9DA 3O1HA 3LG7A 4UIGA 1NWMX 1HG2A 2H7VC 3BQIA 5FXZA 1CUNA 4HE8A 1HX8A 2XAGB 2KMFA 5KDMC 3CX8B 2Q9QD 3ZMTB 4H9OC 4X1IE 5CB4E 3C4XA 3WAKA 4IE0A 4IE4A 4GIWA 4KUMB 4CI3B 4WBOA 4HKAA 5AFUL 2N2NA 3B13A 1H7CA 4HEAA 2ZMAA 4PJLA 4AXPA 4CI1B 5FY1A 3O4XE 5FNVE 3LFMA 5FXVA 3FBLA 2W00A 1VRBA 2VKJA 3SOLA 3V5SA 3UT5E 2W62A 1T98A 1D1CA 1YW0A 5J2TE 5LG4A 4JEUB 4X1KE 2A72A 5HYAA 3K8PC 3OBVE 4GK5E 5HWYA 4O4HE 4QXBB 3QUJA 2ES0A 1MNDA 5FY7A 1NAFA 2C0SA 5HAXA 3UUMA 1D0XA 3UUNA 2H3RA 1LVFA 3ZJ1A 2XHEB 4EIWA 3RC3A 4X1YE 2CLYC 3A5XA 1B7TA 5JVDE 3MKDA 2LSKA 4I55E 3KINB 2YEVC 4O4LE 2IC6A 5EK2A 3HKBE 3AA7B 5LA6E 2NOXA 4BAYB 5L3BB 2C5JA 3RKOA 3GWHA 4UVAB 4O4IE 4TV8E 5L3FB 4GK0E 4QKNA 3ZCJA 3NRXA 5LBMA 1FMVA 5L3GB 1OWAA 4QX7B 2XTLA 4ISSA 4L5GA 5LHGB 2CMRA 4YJ2E 3NBXX 1WYBA 2L8KA 4OHFA 3J9X1 3KVAA 4ASKA 4ZI2C 4OFZA 2HH7A 2K24A 4NUVA 5JR9C 4X20E 3PUAA 2V7KA 2ZM8A 4O8SA 2LOPA 4PK5A 3IF8B 2YINA 1D1AA 3H37A 5JREA 4N78D 1SA0E 3KV6A 5DJQC 3HI2A 4O4JE 3K3OA 1MIWA 3L09A 3SRZA 2CCQA 3CX6B 2WMOA 2ODVA 3IEEA 4GYRA 5LYJE 2JPFA 4WBNE 3ZYKA 1VOMA 2HPLA 2LEHA 3JC6C 4ZI3C 3F57A 1E1HB 1G73A 5ETWA 2X66A 3N9NA 4GOUA 5FMNA 2EHOC 4DMVA 5M4YA 2X67A 4E7ZA 3W15B 3TKLB 2CWYA 3E22E 4HTEA 2W0GA 1UX5A 2G0UA 2JQQA 4CXWA 4PK4A 1X79A 3KV9A 2IW5B 5TAOA 3ZJ2A 4P0AA 2E9XB 4ZI2D 5LJMA 2KWHA 3GMIA 2LJLA 2Y8DA 3RYHE 4H9PC 2SPCA 1O3XA 2X0LB 3EVYA 2N9DA 4EB6E 3ZYMA 1WYCA 2X68A 3AA6B 2BVMA 4HGAA 3DP7A 3MK7C 2KT9A 3CKDA 4QXCB 3VHLA 1QSDA 3C50A 2ODUA 4JLEA 5LJNA 4E7SA 3MXZA 3AAAB 3JC6D 4ZI3D 5JDHA 3CPZA 3IHRA 1D1BA 1D0ZA 3AAEB 4YHJA 5DQVA 2WWUA 4CXXA 2NW7A 2EHOD 2VK9A 5JDGA 2VWAA 1MIYA 2I59A 2Q9QB 2V1DB 2MTQA 3C4WA 2X9XA 4XAXB 3I1AA 4EXTA 5JDMA 2E9XA 2N1GA 5L3CB 4GYSA 4U74A 3KVBA 1MMNA 2CXDA 3HL6A 4DBRA 1ZEEA 4UF0B 2JRKA 3ONXA 4IE6A 2XAFB 3BQKA 4EYYR 4DMWA 2A2FX 3P8CD 3N9OA 4PW8A 2VKHA 3ZMVB 1US7B 4WW0A 3ZMUB 3FXEB 2JJ9A 4G63A 5LNKA 5LP6E 3RPUA 2PBIA 1UX4A 3CQXC 5J2UE 3KBTA 4AKIA 4CZZB 2NP9A 4QHOA 1IZNB 4YJ3E 4ZOLE 4AKHA 3EUHA 4K0UA 2J1DG 2IC9A 3N5LA 1FIOA 3GN5B 3RRCA 3KV5A 2JMHA 1KNZA 1G8XA 2NTYA 4QWNB 2KLQA 4UELA 3OJAA 4ILUA 1BR4A 5HXSA 2DWGA 4OYJA 4H9NC 2L9QA 1S35A 2KXPB 2Y6XA 4UF0A 2IAKA 3T8OA 4H9SE 5CA1E 2Z6EA 3I9WA 4HN9A 5LGNB 2WMNA 4IGUA 1U4QA 4TUYE 4TX5A 2DNXA 1ZKEA 1FEWA 4KMCA 4I43B 3ZN1B 3ZN0B 4EZ4A 1U5PA 4AKLA 3PTRB 4EYUA 3ZYLA 4DO0A 3C98B 5HXCA 4BA9A 3RX6A 5L3EB 3I0OA 3GN5A 4AQFA 5GONE 4C91A 2XAJB 4DVDA 3QC9A 4AKGA 1FMWA 5FXWA 4ADZA 5LCYA 2V26A 5E0OA 4PJMA 2C5KT 3N9LA 4MHCA 5KX5E 2KNDA 2UXNB 3EDUA 3NZPA 5JDQA 2LOSA 4V1Av 2LSGA 2Y48B 3O9XA 1WRDA 3KV4A 2KINB 4Z8XA 2D0TA 5DQWA 4XBFB 2V7MA 2ZM0A 3Q5WA 1LVKA 2D0UA 3MA9A 2ACXA 3VU7H 1YD8G 4MALA 3ZMZB 2QA7A 3NZQA 1YKHB 1SHZC 3N9QA 3C64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI3 D;  4ZI2 D;  4ZI3 C;  2K9A A;  4ZI2 C; 
#chains in the Genus database with same CATH topology
 3M65 A;  1HG5 A;  2BZB A;  3WAJ A;  4P1N A;  5AQH B;  2X0Y A;  4ZS3 A;  3V5U A;  3R84 B;  1KFY A;  5F8P A;  3ETV A;  2V7L A;  2WZI A;  3PU3 A;  4IIJ E;  4OYK A;  3ETU A;  4F6R C;  2XQY A;  2ZLY A;  4DR5 T;  4ANJ A;  4KHZ F;  2A3D A;  4EAH A;  5LOV E;  2D5U A;  5LBQ B;  4JBW F;  1AJ3 A;  4FI5 A;  1N34 T;  2BG9 A;  4LMJ A;  3UU8 A;  2VUR A;  1Z0P A;  2K3W A;  5ADX L;  5FP3 A;  4KP3 C;  2BDE A;  4IHJ E;  4MLK A;  4DV1 T;  4HWI B;  1EZ3 A;  1S94 A;  5JH7 E;  1SUM B;  5L4H A;  1J1J A;  1HTJ F;  2WM9 A;  2KZ7 B;  4TWF A;  4QX8 B;  2V7I A;  1ZP0 A;  4ZI7 E;  5BR8 T;  2DCF A;  4AIS A;  4U31 A;  1IJ6 A;  4BJM A;  3UU4 A;  1MMD A;  4I4T E;  4MFR A;  3PUY F;  4UXN B;  2L3L A;  2V6Y B;  2LHR A;  3AE4 A;  3SFD A;  5FVK A;  5H6R B;  5LHH B;  2XQ8 A;  3LK4 2;  5EK3 A;  3RYF E;  2YDQ A;  2K9A A;  3N2O A;  2NR4 A;  3AA1 B;  3AA0 B;  3UU6 A;  3ZST A;  2H7O A;  3LSV A;  1OXZ A;  3AE6 A;  5AQN B;  1X9B A;  3N2K E;  3RRW A;  4DV3 T;  1UUR A;  2C5I T;  2R6G F;  2LSJ A;  3C4Z A;  2V5D A;  3OYX A;  3O1J A;  1GQE A;  2V7J A;  4PFP A;  3MZK B;  5JR9 B;  5J1G A;  2K48 A;  3ZC1 A;  4DR7 T;  1LKX A;  2LSY A;  5JTG A;  3ZT6 A;  2MYS A;  2X9W A;  4PJN A;  3F2E A;  4U2Z A;  4IST A;  3DJB A;  2QVA A;  3RYC E;  3CVR A;  2BBJ A;  3ONL C;  3G06 A;  3JAF A;  4NXN T;  3QOF A;  4IDQ A;  5KDM C;  1WCR A;  2Q9Q D;  3ZMT B;  4H9O C;  5LMN T;  3UFG A;  5CB4 E;  4HFB A;  4IE0 A;  4IE4 A;  4GIW A;  2WCA A;  4WBO A;  5AFU L;  5AQO B;  4HEA A;  4AXP A;  3O4X E;  5FNV E;  5FXV A;  2CBI A;  2XQ3 A;  3SOL A;  1HNX T;  3UT5 E;  2W62 A;  2XQ6 A;  2VVN A;  5LG4 A;  4X1K E;  5HYA A;  3B5M A;  2B76 A;  3UUN A;  5J0Z A;  1XDO A;  2IML A;  4UR9 A;  4X1Y E;  1WFD A;  3P4S A;  1HR0 T;  5AQP B;  3AA7 B;  4QKN A;  1FMV A;  3VRA A;  1DU2 A;  4WYV A;  2CMR A;  4YJ2 E;  3NBX X;  2CHN A;  3AE3 A;  4LMK A;  3H37 A;  5JRE A;  4N78 D;  4JI5 T;  1OED A;  2BKN A;  4U2Y A;  3SRZ A;  4ILC A;  5ABF B;  2JQH A;  2CCQ A;  4HWH A;  4WBN E;  4U33 A;  2HPL A;  2LEH A;  3F57 A;  3AE5 A;  5FVL A;  3N9N A;  2HN1 A;  2YDS A;  2G0U A;  4DR3 T;  2E9X B;  4ZI2 D;  3GMI A;  4EV6 A;  2XQ9 A;  1WYC A;  2X68 A;  3AA6 B;  4HGA A;  3DP7 A;  2KT9 A;  4ZZC A;  2ODU A;  4JLE A;  4E7S A;  3MXZ A;  3AAA B;  3CPZ A;  2M6B A;  3AAE B;  4YHJ A;  1L0V A;  2MAW A;  4DR2 T;  4XAX B;  3I1A A;  4CN4 A;  5L3C B;  4GYS A;  3ABV A;  2XAF B;  2A2F X;  3P8C D;  4K0K T;  3ZMV B;  1US7 B;  5LNK A;  4IDP A;  2XQA A;  2BS2 A;  3EUH A;  4K0U A;  2XM1 A;  4HFH A;  1FIO A;  1G8X A;  4QWN B;  2YKS A;  2UUB T;  2XQ5 A;  1BR4 A;  5HXS A;  4H9N C;  2I6H A;  2Y6X A;  1UGO A;  3EAB A;  4IGU A;  3ZN1 B;  4OX9 T;  3ZN0 B;  4HFI A;  4EYU A;  3ZYL A;  2OV9 A;  3C98 B;  4AQF A;  4C91 A;  4DVD A;  4AKG A;  2UUC T;  2V26 A;  5E0O A;  2QRX A;  3N9L A;  5KX5 E;  2Y48 B;  2V5C A;  1W0B A;  2V7M A;  2ZM0 A;  1YD8 G;  4MAL A;  1YKH B;  1SHZ C;  3UFE A;  2WU2 A;  2LSI A;  4UV9 B;  2LT3 A;  2CXL A;  3AE1 A;  3Q2M A;  3PE0 A;  3P7I A;  4CQI A;  2OA5 A;  1BR1 A;  2F4V T;  3PDY A;  4X62 T;  1BR2 A;  5LGT B;  1HCI A;  4X64 T;  5AQL B;  3AED A;  2RA1 A;  5JDF A;  1LRZ A;  5HEO A;  3HKD E;  5DAB A;  4U72 A;  3LK3 B;  2UXX B;  4IL4 A;  2XSB A;  5EZY E;  4UV8 B;  4XZC A;  5L2L A;  4FJO A;  4B6X A;  4H63 H;  4YTN A;  2LRL A;  4TWH A;  2XAH B;  2XM2 A;  3KBU A;  3MJX A;  4PAG A;  3UQ7 A;  4CI2 B;  2YU1 A;  3E0Z A;  4PJJ A;  2EHO A;  4YY3 T;  2CM0 A;  2DLR A;  2HPJ A;  3VKH A;  4A98 A;  3ZPO A;  5JQG E;  2WDV A;  2V6X A;  4H9Q C;  4AQG A;  2MPK A;  3ZKR A;  1YKE B;  2XQ4 A;  3SS1 A;  4U3C A;  3FBZ A;  3SFE A;  2QGS A;  3K1S A;  2PG8 A;  4UVC B;  4PNI A;  3MAC A;  4JUY A;  1XNR T;  3AVS A;  4AI6 A;  3N2G E;  5JRC B;  3AEG A;  2VAS A;  3ZC0 A;  3L8R A;  4ZEY A;  4ZHQ E;  2MOZ A;  3ANW B;  2CLY B;  3LBX B;  3PV0 F;  3ZT5 A;  2QYW A;  3PUQ A;  5CGM A;  3CX7 B;  3PU8 A;  3ZMS B;  4NPP A;  3AEB A;  3U78 A;  3OKQ A;  4J2C A;  2FJD A;  4A5X A;  3B57 A;  1VCT A;  4CXY A;  2J4G A;  5H6Q B;  2KWI B;  2CEA A;  3NVO A;  2LE8 A;  4DBQ A;  4TN7 B;  2CWO A;  2RPA A;  1QUU A;  1XDP A;  3AEC A;  4TZ4 C;  2E9X D;  2X0H A;  3CK6 A;  2WWV A;  1E2A A;  1ZV4 X;  5FL0 A;  3UTK A;  4JI3 T;  3R6N A;  1I6Z A;  1XZY A;  2RP4 A;  3AE2 A;  2GK9 A;  1ZHC A;  3KDS E;  2XAS B;  5EK4 A;  2DL1 A;  2XAQ B;  4CN1 A;  4AQF C;  3LG7 A;  4QH5 A;  2H7V C;  3BQI A;  4HE8 A;  2KMF A;  4JYA T;  1E7P A;  3PJA J;  3AEF A;  5ABE A;  5L4E A;  4HKA A;  3OVU A;  2N2N A;  3B13 A;  1H7C A;  4PJL A;  2ZMA A;  5FY1 A;  4DV4 T;  2H88 A;  1Y01 A;  4JI8 T;  1VRB A;  1NEN A;  5AQF B;  1D1C A;  1YW0 A;  5AQV B;  3Q5E A;  5HWY A;  4O4H E;  4ILA A;  4QXB B;  3QUJ A;  1MND A;  5FY7 A;  2C0S A;  4Z91 A;  4GKJ T;  5JVD E;  2LSK A;  3P50 A;  4I55 E;  3KIN B;  3RIU C;  2IC6 A;  5LA6 E;  4IDO A;  5L3B B;  3GWH A;  3FZM B;  4LF8 T;  5AQQ B;  4QX7 B;  3PJA A;  4EGW A;  3AE7 A;  3M3Z B;  3KVA A;  4ASK A;  5JR9 C;  4PK5 A;  3IF8 B;  1SA0 E;  3KV6 A;  5DJQ C;  3L09 A;  2WMO A;  2ODV A;  2WS3 A;  1IBL T;  3RF1 A;  3JC6 C;  4ZI3 C;  2XZE A;  1G73 A;  5ETW A;  2X66 A;  4GOU A;  2EHO C;  5M4Y A;  3TKL B;  3E22 E;  1UX5 A;  2JQQ A;  1X79 A;  3ZJ2 A;  4KX6 A;  3OTO T;  2Y8D A;  3RYH E;  4H9P C;  1O3X A;  3ZYM A;  2AE9 A;  2BVM A;  3CKD A;  4QXC B;  2WP9 A;  3C50 A;  5LJN A;  4KI0 F;  1D1B A;  1D0Z A;  5DQV A;  2WWU A;  2VK9 A;  2VWA A;  1T8B A;  4B3T T;  2V1D B;  4EXT A;  2LRK A;  2N1G A;  3A7M A;  2CXD A;  4UF0 B;  4LFC T;  2JRK A;  3ONX A;  4IE6 A;  3BQK A;  2WDQ A;  4G63 A;  5LP6 E;  3RPU A;  1UX4 A;  5ABH A;  4AKI A;  4QHO A;  5FL1 A;  2AXD S;  4ZOL E;  5HEH A;  4B3R T;  3GN5 B;  3KV5 A;  5HEG A;  2KLQ A;  2V8S V;  2L9Q A;  1S35 A;  2XY8 B;  2IAK A;  3P4P A;  2HN2 A;  5LGN B;  1U4Q A;  2DNX A;  1ZKE A;  1U5P A;  4HFE A;  4DO0 A;  3RX6 A;  3I0O A;  3QC9 A;  2A9U A;  2C5K T;  5JDQ A;  2LOS A;  1WRD A;  2KIN B;  4Z8X A;  3ZT7 A;  4AQY T;  2D0T A;  4JI0 T;  3Q5W A;  2D0U A;  4COF A;  2ACX A;  3N9Q A;  3C64 A;  3HKE E;  3NWI A;  3UU5 A;  5JDL A;  3ZCI A;  3BK9 A;  5L3D B;  4EED A;  5LHI B;  3IBP A;  5FXX A;  3CQC B;  4JEH B;  4YSY A;  4EZH A;  3L39 A;  4YTP A;  3N9P A;  2BG9 B;  2NW8 A;  1Y64 B;  2DI4 A;  2NW9 A;  4DND A;  4P09 A;  5LXT E;  4WZX A;  4BJN A;  4H63 V;  3FB2 A;  2WSS V;  4OK0 A;  1W0A A;  1HFA A;  2W61 A;  2VKD A;  2J47 A;  3UUL A;  1UK5 A;  5C8Y E;  3EI0 A;  5FKY A;  5HCJ A;  2UXD T;  4JI7 T;  2VVS A;  4U7I A;  3RYI E;  3UU3 A;  3VRB A;  3DTO A;  4L0R A;  2UXC T;  1YXR A;  1IJ5 A;  2IIU A;  4NXM T;  4DV2 T;  4C90 A;  2FJA A;  4UVB B;  4LFB T;  4WNK A;  4IL9 A;  2XSA A;  4IE7 A;  3EHZ A;  5ABG A;  2IHR 1;  4CN6 A;  3AVR A;  5AQS B;  4JV5 T;  2UXB T;  5IYZ E;  3PUZ F;  5AQR B;  4X5T A;  4ILB A;  3N9M A;  2K5B B;  2MBG A;  3C51 A;  1HF8 A;  3AAI A;  1XWM A;  3Q5D A;  4KBM B;  2CBJ A;  3UUB A;  1J5E T;  3TLS A;  2YK0 A;  3UUX B;  2ZM6 T;  5AQJ B;  4GKK T;  1KF6 A;  3Q5X A;  2DWK A;  3K3Q C;  2FBW A;  1UUS A;  2VB6 A;  5HXH A;  2WDR A;  2WY2 A;  2DHR A;  4IRE A;  5CFB A;  5HWX A;  5FY0 A;  2V6Y A;  1MIV A;  5FYM A;  5IHY A;  3F31 A;  3QK6 A;  5LB7 B;  3GA8 A;  2Q9Q C;  3RIU A;  3E08 A;  3PUS A;  4PK6 A;  1MMA A;  3RC8 A;  4IT4 A;  1HNW T;  2LM9 A;  2YU2 A;  5KMG P;  4UEM A;  2WBL A;  4NUU A;  2IDO B;  2PJQ A;  3RIF A;  5HCM A;  4HFV A;  4DUY T;  3AEE A;  4DUZ T;  1YQ3 A;  1N36 T;  5JR9 A;  1J5W A;  1NWM X;  1HG2 A;  2BG9 E;  3VR8 A;  1HX8 A;  3C4X A;  2FUP A;  3WAK A;  4KUM B;  4CI3 B;  2LM2 A;  4LF9 T;  1FJG T;  5AQM B;  2KSR A;  2W00 A;  2VKJ A;  1T98 A;  1XMO T;  5J2T E;  4JEU B;  4IDN A;  2A72 A;  3ONJ A;  4GK5 E;  4HWF A;  1NAF A;  3T1H T;  2H3R A;  3ZJ1 A;  2CLY C;  3MKD A;  2YEV C;  2BKP A;  4O4L E;  3HKB E;  1OED B;  4LML A;  2NOX A;  4BAY B;  2UUA T;  3PUV F;  3RKO A;  4UVA B;  5C3J A;  4O4I E;  5L3F B;  4GK0 E;  5LBM A;  4A97 A;  4DID B;  4U7Y A;  4LF6 T;  2XTL A;  4ISS A;  4L5G A;  3CIR A;  2L8K A;  4DV6 T;  3J9X 1;  4ZI2 C;  4OFZ A;  2HH7 A;  2K24 A;  4NUV A;  1XMQ T;  2YN6 A;  2V7K A;  2ZM8 A;  4DR6 T;  2LOP A;  2HHH T;  5AQT B;  4JI2 T;  2W66 A;  3IA3 A;  3AXJ A;  2BS3 A;  2D9D A;  3K3O A;  1MIW A;  5LYJ E;  2JPF A;  1VOM A;  1JNZ A;  4HFD A;  2W4X A;  4E7Z A;  3PUW F;  2W2U A;  5HEJ A;  2CWY A;  4HTE A;  4TWD A;  2FJB A;  4CXW A;  2UU9 T;  3KV9 A;  5LJM A;  2SPC A;  5L47 A;  5ABF A;  3MK7 C;  3VR9 A;  1QSD A;  4CXX A;  5JDG A;  1HNZ T;  2I59 A;  2E9X A;  2LLY A;  3KVB A;  4Q25 A;  5IWA T;  3HL6 A;  1ZEE A;  4LF4 T;  4JI6 T;  4PW8 A;  3N9O A;  2VKH A;  3FXE B;  2JJ9 A;  4HWC A;  2PBI A;  3CQX C;  5J2U E;  3KBT A;  2JQK A;  2NP9 A;  3PUX F;  1IZN B;  4Z90 A;  4YJ3 E;  3T1Y T;  2J1D G;  2IC9 A;  3P4Q A;  3RRC A;  4UEL A;  2CRB A;  4B3S T;  4OYJ A;  3UQ4 A;  2YDR A;  2FJE A;  4H9S E;  5CA1 E;  4HN9 A;  2XJ7 A;  4TUY E;  4TX5 A;  1FEW A;  3P4W A;  4KMC A;  4I43 B;  4TNV A;  2JQ9 A;  4EZ4 A;  4TNW A;  3AEA A;  3LDQ B;  5HXC A;  4EEB A;  1FMW A;  5FXW A;  4ADZ A;  4PJM A;  4MHC A;  3H3M A;  2KND A;  3EDU A;  1M7K A;  2PTF A;  5C2T A;  3KV4 A;  4NIQ A;  5DQW A;  3RQU A;  4XBF B;  3ZMZ B;  4X65 T;  1OED E;  3TLV A;  1N32 T;  4ZS2 A;  5JDN A;  2BKO A;  3QB5 K;  3PUR A;  3BQL A;  4G2A A;  1W09 A;  2PFV A;  4M1P A;  2NTX A;  3JAD A;  2VKO A;  2X51 A;  3I0Q A;  3FHN A;  1KEY A;  3VKG A;  1T7S A;  2E8I A;  3CQG B;  2JMK A;  3JCF A;  2NWB A;  1T72 A;  3FXD B;  3AB3 B;  2WQY A;  4A56 A;  4YSZ A;  3CWZ B;  2M6I A;  3NKZ A;  3ESL A;  3X1D A;  4QXH B;  4P0B A;  2ZM2 A;  4DV0 T;  1IBK T;  4H9R C;  1CHU A;  2CXF A;  2OLT A;  3L3P A;  2EHO B;  3ZEF B;  4DR1 T;  1IBM T;  2CHO A;  3D0T A;  5LG3 A;  3HKC E;  3CML A;  3FZF B;  3LK2 B;  2W67 A;  4PFO A;  4YHH T;  4IE5 A;  4HFC A;  3S4U A;  4ERR A;  3NRY A;  5HXR A;  3P4R A;  2X9Y A;  3PUG A;  2WZH A;  3RI5 A;  3U3I A;  3QB5 A;  2LKH A;  2Q9Q A;  2X9H A;  1D0Y A;  3EDV A;  1HS7 A;  3LJC A;  2LHN A;  4YFS A;  5F3J A;  5A1L A;  1WLX A;  2WB5 A;  1JNR A;  1W9R A;  2IUB A;  4O2A E;  1BR0 A;  1KK7 A;  3K3N A;  3KFW X;  3HA4 A;  4AKR B;  3OYZ A;  3SWH A;  2M67 A;  2CE7 A;  1UCU A;  2B1E A;  3AXJ B;  4YLH A;  2XQ7 A;  4DV5 T;  3RLF F;  4L9I A;  3QNU A;  3Q9D A;  2WAU A;  3FZK B;  2BG9 C;  2E9X C;  3TLT A;  4DR4 T;  2BVL A;  1IAP A;  1WR6 A;  4ZZB A;  4YSX A;  2CA5 A;  5JRC A;  5HXE A;  3RH3 A;  3TLU A;  3ANW A;  3I9Y A;  1N33 T;  3LBX A;  1MNE A;  3OPC A;  4HWD A;  5BMV E;  5LGU B;  4IDZ A;  3J7Y q;  4I50 E;  3RQW A;  5CA0 E;  2CPT A;  2W63 A;  4MBQ A;  3H3A A;  3HR0 A;  3WI3 A;  4EOZ B;  4KHP T;  2D2S A;  1QLB A;  2P9B A;  4TV9 E;  2XPK A;  5AQI B;  2VL8 A;  3ZLI A;  1MMG A;  3RHW A;  3O1I A;  2XUE A;  4O2B E;  1VCS A;  2ACZ A;  1V9D A;  3O1H A;  4UIG A;  4YXD A;  4JI1 T;  3FZH B;  5FXZ A;  1CUN A;  2XAG B;  3CX8 B;  3EAM A;  4X1I E;  2E5L T;  3JAE A;  4CI1 B;  3LFM A;  3FBL A;  2J62 A;  3TLW A;  3V5S A;  5F5W A;  3K8P C;  3A8Y C;  3OBV E;  1YQ4 A;  2ES0 A;  2VQE T;  4QH4 A;  4YTM A;  5HAX A;  3ZSS A;  5AQG B;  3UUM A;  1D0X A;  1LVF A;  2XHE B;  3RGL A;  4EIW A;  3RC3 A;  3A5X A;  1B7T A;  4LF5 T;  1KNP A;  2YOE A;  5EK2 A;  2BBH A;  4B3M T;  3AE9 A;  2C5J A;  4F8H A;  4TV8 E;  3ZCJ A;  3NRX A;  5L3G B;  1OWA A;  3RKG A;  5LHG B;  1WYB A;  5AQK B;  1ZOY A;  4LFA T;  4OHF A;  2VL0 A;  4X20 E;  3PUA A;  3AE8 A;  2BS4 A;  4O8S A;  5IUX A;  2YIN A;  1D1A A;  3HI2 A;  4O4J E;  5LMU T;  3CX6 B;  3IEE A;  4GYR A;  4LF7 T;  3ZYK A;  1E1H B;  1KNR A;  5FMN A;  4DMV A;  2X67 A;  3W15 B;  2W0G A;  4PK4 A;  2IW5 B;  5TAO A;  4P0A A;  4X66 T;  2LKG A;  2KWH A;  4JI4 T;  2LJL A;  2X0L B;  3EVY A;  2N9D A;  4EB6 E;  5CJ5 A;  3VHL A;  2JIW A;  3JC6 D;  4ZI3 D;  4QH1 A;  5JDH A;  3IHR A;  4I0U A;  2NW7 A;  2EHO D;  1WR0 A;  1MIY A;  2Q9Q B;  3FZL B;  2MTQ A;  3C4W A;  2X9X A;  5HEU A;  5JDM A;  4U74 A;  1MMN A;  1NEK A;  2WU5 A;  4DBR A;  4EYY R;  4DMW A;  2I0M A;  4AIU A;  4WW0 A;  3ZMU B;  2VQF T;  2E2A A;  4CZZ B;  1OED C;  4AKH A;  3N5L A;  2JMH A;  1R8I A;  4ZXL A;  1KNZ A;  2NTY A;  3RIA A;  3OJA A;  4ILU A;  2DWG A;  5AQU B;  2KXP B;  4UF0 A;  3T8O A;  4YT0 A;  2Z6E A;  3I9W A;  2WMN A;  5KXJ A;  1M62 A;  4AKL A;  3PTR B;  4DV7 T;  2E5V A;  4BA9 A;  5L3E B;  3GN5 A;  5GON E;  2XAJ B;  2H89 A;  5LCY A;  1Z8U A;  2UXN B;  1SE7 A;  3NZP A;  4V1A v;  2LSG A;  3O9X A;  1HX1 B;  1LVK A;  3MA9 A;  1XNQ T;  3VU7 H;  1I94 T;  2QA7 A;  3NZQ A; 
#chains in the Genus database with same CATH homology
 3M65 A;  3HKE E;  1HG5 A;  3UFE A;  2BZB A;  4ZS2 A;  5JDN A;  3WAJ A;  5JDL A;  2LSI A;  3PUR A;  3ZCI A;  3BK9 A;  3BQL A;  4G2A A;  5L3D B;  5LHI B;  3IBP A;  4UV9 B;  2PFV A;  5FXX A;  2LT3 A;  3CQC B;  2CXL A;  4M1P A;  2NTX A;  4ZS3 A;  2VKO A;  3V5U A;  2X51 A;  4JEH B;  4EZH A;  3R84 B;  3Q2M A;  3PE0 A;  3N9P A;  3I0Q A;  3FHN A;  2NW8 A;  1Y64 B;  3P7I A;  4CQI A;  5F8P A;  3VKG A;  3ETV A;  2DI4 A;  2OA5 A;  2E8I A;  3CQG B;  2JMK A;  1BR1 A;  2V7L A;  2NW9 A;  3PU3 A;  4IIJ E;  4DND A;  4P09 A;  3PDY A;  4OYK A;  5LXT E;  3ETU A;  2NWB A;  4F6R C;  4BJN A;  2XQY A;  4H63 V;  3FXD B;  2ZLY A;  3AB3 B;  4A56 A;  1BR2 A;  4ANJ A;  5LGT B;  3CWZ B;  3FB2 A;  3ESL A;  2WSS V;  4QXH B;  4OK0 A;  1HCI A;  1HFA A;  2A3D A;  4EAH A;  4P0B A;  5LOV E;  2D5U A;  2RA1 A;  5JDF A;  2W61 A;  5LBQ B;  2VKD A;  1LRZ A;  2ZM2 A;  3HKD E;  4H9R C;  5DAB A;  4U72 A;  1AJ3 A;  2CXF A;  3UUL A;  3L3P A;  4FI5 A;  2EHO B;  3ZEF B;  3LK3 B;  2UXX B;  5C8Y E;  3D0T A;  5EZY E;  1Z0P A;  3CML A;  3HKC E;  4UV8 B;  5ADX L;  3LK2 B;  5FP3 A;  4KP3 C;  4PFO A;  4XZC A;  4IE5 A;  3RYI E;  2BDE A;  5L2L A;  3S4U A;  4IHJ E;  4ERR A;  4FJO A;  4B6X A;  3NRY A;  4H63 H;  4MLK A;  5HXR A;  1EZ3 A;  3DTO A;  2X9Y A;  2XAH B;  4L0R A;  3PUG A;  1S94 A;  1IJ5 A;  3KBU A;  3MJX A;  5JH7 E;  4PAG A;  4C90 A;  3U3I A;  4CI2 B;  1HTJ F;  4UVB B;  2YU1 A;  3E0Z A;  2Q9Q A;  2WM9 A;  2X9H A;  4PJJ A;  2KZ7 B;  2EHO A;  1D0Y A;  3EDV A;  4WNK A;  4QX8 B;  2CM0 A;  1HS7 A;  2DLR A;  2HPJ A;  3VKH A;  2V7I A;  3ZPO A;  4IE7 A;  5JQG E;  4ZI7 E;  3LJC A;  2LHN A;  4H9Q C;  4YFS A;  2DCF A;  5F3J A;  4AQG A;  5A1L A;  1WLX A;  3AVR A;  1IJ6 A;  4BJM A;  1YKE B;  3SS1 A;  3FBZ A;  4O2A E;  1MMD A;  4I4T E;  4MFR A;  5IYZ E;  2QGS A;  1BR0 A;  1KK7 A;  3N9M A;  3K3N A;  3KFW X;  2PG8 A;  4UVC B;  4PNI A;  3HA4 A;  2K5B B;  2MBG A;  3MAC A;  4AKR B;  3OYZ A;  3C51 A;  2M67 A;  4JUY A;  1HF8 A;  1UCU A;  2CE7 A;  2B1E A;  3AAI A;  3AVS A;  3SWH A;  4AI6 A;  3N2G E;  5JRC B;  4YLH A;  4KBM B;  4UXN B;  2VAS A;  3ZC0 A;  2L3L A;  4L9I A;  2LHR A;  3Q9D A;  4ZHQ E;  2MOZ A;  3ANW B;  2CLY B;  2WAU A;  3LBX B;  5H6R B;  3PUQ A;  2YK0 A;  5LHH B;  3LK4 2;  5EK3 A;  3RYF E;  3CX7 B;  3UUX B;  2K9A A;  3N2O A;  3AA0 B;  3AA1 B;  2E9X C;  3PU8 A;  3ZMS B;  2H7O A;  3U78 A;  3OKQ A;  1OXZ A;  3Q5X A;  2DWK A;  3K3Q C;  4J2C A;  2BVL A;  2VB6 A;  1IAP A;  1WR6 A;  3N2K E;  5HXH A;  3RRW A;  2CA5 A;  5JRC A;  2DHR A;  2C5I T;  3B57 A;  5HXE A;  2LSJ A;  4CXY A;  3C4Z A;  3RH3 A;  3OYX A;  5HWX A;  5FY0 A;  3O1J A;  5H6Q B;  3ANW A;  1MIV A;  2V7J A;  4PFP A;  5FYM A;  5IHY A;  2KWI B;  3F31 A;  2CEA A;  3I9Y A;  3MZK B;  5JR9 B;  2LE8 A;  3QK6 A;  3GA8 A;  5J1G A;  3LBX A;  2K48 A;  1MNE A;  2Q9Q C;  4DBQ A;  3E08 A;  3ZC1 A;  3PUS A;  4PK6 A;  1MMA A;  4TN7 B;  3RC8 A;  5BMV E;  5LGU B;  4IDZ A;  1LKX A;  2CWO A;  2LM9 A;  2LSY A;  2YU2 A;  1QUU A;  5KMG P;  3J7Y q;  4I50 E;  4UEM A;  5CA0 E;  2WBL A;  4TZ4 C;  2E9X D;  2MYS A;  2X9W A;  1ZV4 X;  4NUU A;  2W63 A;  4MBQ A;  4PJN A;  3H3A A;  3HR0 A;  3UTK A;  3F2E A;  3WI3 A;  3R6N A;  4EOZ B;  2RP4 A;  2D2S A;  2PJQ A;  2P9B A;  4TV9 E;  2VL8 A;  4HFV A;  3ZLI A;  4IST A;  1MMG A;  3DJB A;  2GK9 A;  1ZHC A;  3KDS E;  3O1I A;  3RYC E;  3CVR A;  2XAS B;  2XUE A;  4O2B E;  5EK4 A;  2XAQ B;  5JR9 A;  4AQF C;  1V9D A;  3O1H A;  3LG7 A;  4UIG A;  1NWM X;  1HG2 A;  2H7V C;  3BQI A;  5FXZ A;  1CUN A;  4HE8 A;  1HX8 A;  2XAG B;  2KMF A;  5KDM C;  3CX8 B;  2Q9Q D;  3ZMT B;  4H9O C;  4X1I E;  5CB4 E;  3C4X A;  3WAK A;  4IE0 A;  4IE4 A;  4GIW A;  4KUM B;  4CI3 B;  4WBO A;  4HKA A;  5AFU L;  2N2N A;  3B13 A;  1H7C A;  4HEA A;  2ZMA A;  4PJL A;  4AXP A;  4CI1 B;  5FY1 A;  3O4X E;  5FNV E;  3LFM A;  5FXV A;  3FBL A;  2W00 A;  1VRB A;  2VKJ A;  3SOL A;  3V5S A;  3UT5 E;  2W62 A;  1T98 A;  1D1C A;  1YW0 A;  5J2T E;  5LG4 A;  4JEU B;  4X1K E;  2A72 A;  5HYA A;  3K8P C;  3OBV E;  4GK5 E;  5HWY A;  4O4H E;  4QXB B;  3QUJ A;  2ES0 A;  1MND A;  5FY7 A;  1NAF A;  2C0S A;  5HAX A;  3UUM A;  1D0X A;  3UUN A;  2H3R A;  1LVF A;  3ZJ1 A;  2XHE B;  4EIW A;  3RC3 A;  4X1Y E;  2CLY C;  3A5X A;  1B7T A;  5JVD E;  3MKD A;  2LSK A;  4I55 E;  3KIN B;  2YEV C;  4O4L E;  2IC6 A;  5EK2 A;  3HKB E;  3AA7 B;  5LA6 E;  2NOX A;  4BAY B;  5L3B B;  2C5J A;  3RKO A;  3GWH A;  4UVA B;  4O4I E;  4TV8 E;  5L3F B;  4GK0 E;  4QKN A;  3ZCJ A;  3NRX A;  5LBM A;  1FMV A;  5L3G B;  1OWA A;  4QX7 B;  2XTL A;  4ISS A;  4L5G A;  5LHG B;  2CMR A;  4YJ2 E;  3NBX X;  1WYB A;  2L8K A;  4OHF A;  3J9X 1;  3KVA A;  4ASK A;  4ZI2 C;  4OFZ A;  2HH7 A;  2K24 A;  4NUV A;  5JR9 C;  4X20 E;  3PUA A;  2V7K A;  2ZM8 A;  4O8S A;  2LOP A;  4PK5 A;  3IF8 B;  2YIN A;  1D1A A;  3H37 A;  5JRE A;  4N78 D;  1SA0 E;  3KV6 A;  5DJQ C;  3HI2 A;  4O4J E;  3K3O A;  1MIW A;  3L09 A;  3SRZ A;  2CCQ A;  3CX6 B;  2WMO A;  2ODV A;  3IEE A;  4GYR A;  5LYJ E;  2JPF A;  4WBN E;  3ZYK A;  1VOM A;  2HPL A;  2LEH A;  3JC6 C;  4ZI3 C;  3F57 A;  1E1H B;  1G73 A;  5ETW A;  2X66 A;  3N9N A;  4GOU A;  5FMN A;  2EHO C;  4DMV A;  5M4Y A;  2X67 A;  4E7Z A;  3W15 B;  3TKL B;  2CWY A;  3E22 E;  4HTE A;  2W0G A;  1UX5 A;  2G0U A;  2JQQ A;  4CXW A;  4PK4 A;  1X79 A;  3KV9 A;  2IW5 B;  5TAO A;  3ZJ2 A;  4P0A A;  2E9X B;  4ZI2 D;  5LJM A;  2KWH A;  3GMI A;  2LJL A;  2Y8D A;  3RYH E;  4H9P C;  2SPC A;  1O3X A;  2X0L B;  3EVY A;  2N9D A;  4EB6 E;  3ZYM A;  1WYC A;  2X68 A;  3AA6 B;  2BVM A;  4HGA A;  3DP7 A;  3MK7 C;  2KT9 A;  3CKD A;  4QXC B;  3VHL A;  1QSD A;  3C50 A;  2ODU A;  4JLE A;  5LJN A;  4E7S A;  3MXZ A;  3AAA B;  3JC6 D;  4ZI3 D;  5JDH A;  3CPZ A;  3IHR A;  1D1B A;  1D0Z A;  3AAE B;  4YHJ A;  5DQV A;  2WWU A;  4CXX A;  2NW7 A;  2EHO D;  2VK9 A;  5JDG A;  2VWA A;  1MIY A;  2I59 A;  2Q9Q B;  2V1D B;  2MTQ A;  3C4W A;  2X9X A;  4XAX B;  3I1A A;  4EXT A;  5JDM A;  2E9X A;  2N1G A;  5L3C B;  4GYS A;  4U74 A;  3KVB A;  1MMN A;  2CXD A;  3HL6 A;  4DBR A;  1ZEE A;  4UF0 B;  2JRK A;  3ONX A;  4IE6 A;  2XAF B;  3BQK A;  4EYY R;  4DMW A;  2A2F X;  3P8C D;  3N9O A;  4PW8 A;  2VKH A;  3ZMV B;  1US7 B;  4WW0 A;  3ZMU B;  3FXE B;  2JJ9 A;  4G63 A;  5LNK A;  5LP6 E;  3RPU A;  2PBI A;  1UX4 A;  3CQX C;  5J2U E;  3KBT A;  4AKI A;  4CZZ B;  2NP9 A;  4QHO A;  1IZN B;  4YJ3 E;  4ZOL E;  4AKH A;  3EUH A;  4K0U A;  2J1D G;  2IC9 A;  3N5L A;  1FIO A;  3GN5 B;  3RRC A;  3KV5 A;  2JMH A;  1KNZ A;  1G8X A;  2NTY A;  4QWN B;  2KLQ A;  4UEL A;  3OJA A;  4ILU A;  1BR4 A;  5HXS A;  2DWG A;  4OYJ A;  4H9N C;  2L9Q A;  1S35 A;  2KXP B;  2Y6X A;  4UF0 A;  2IAK A;  3T8O A;  4H9S E;  5CA1 E;  2Z6E A;  3I9W A;  4HN9 A;  5LGN B;  2WMN A;  4IGU A;  1U4Q A;  4TUY E;  4TX5 A;  2DNX A;  1ZKE A;  1FEW A;  4KMC A;  4I43 B;  3ZN1 B;  3ZN0 B;  4EZ4 A;  1U5P A;  4AKL A;  3PTR B;  4EYU A;  3ZYL A;  4DO0 A;  3C98 B;  5HXC A;  4BA9 A;  3RX6 A;  5L3E B;  3I0O A;  3GN5 A;  4AQF A;  5GON E;  4C91 A;  2XAJ B;  4DVD A;  3QC9 A;  4AKG A;  1FMW A;  5FXW A;  4ADZ A;  5LCY A;  2V26 A;  5E0O A;  4PJM A;  2C5K T;  3N9L A;  4MHC A;  5KX5 E;  2KND A;  2UXN B;  3EDU A;  3NZP A;  5JDQ A;  2LOS A;  4V1A v;  2LSG A;  2Y48 B;  3O9X A;  1WRD A;  3KV4 A;  2KIN B;  4Z8X A;  2D0T A;  5DQW A;  4XBF B;  2V7M A;  2ZM0 A;  3Q5W A;  1LVK A;  2D0U A;  3MA9 A;  2ACX A;  3VU7 H;  1YD8 G;  4MAL A;  3ZMZ B;  2QA7 A;  3NZQ A;  1YKH B;  1SHZ C;  3N9Q A;  3C64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...