4ZI3C

Bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
123
structure length
123
Chain Sequence
DEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 50
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi3C00
4ZI2D 4ZI3D 2K9AA 4ZI2C 4ZI3C
chains in the Genus database with same CATH superfamily
4G63A 3ZSTA 3FZKB 4AKGA 2B1EA 2E2AA 3CK6A 4JI4T 3RC3A 1YKHB 3UULA 4EYUA 3N9OA 3UUNA 1XNRT 1X9BA 3H3MA 2WP9A 5L3DB 1I6ZA 4P09A 2P9BA 1KF6A 4QH5A 3ETVA 2IMLA 4YXDA 4X65T 4JI3T 4DR5T 5J2UE 4JBWF 3VU7H 3OYXA 2WDQA 2PJQA 4MHCA 3FB2A 2BS4A 1X79A 1NAFA 4DR4T 2J1DG 3OVUA 4KBMB 3NZQA 2ES0A 3LSVA 2XAJB 5HCMA 2L9QA 4I43B 4UVAB 4HFHA 3ZN1B 1MMNA 1XMQT 2XAQB 5HXEA 4U7IA 3AXJB 2CHNA 4B3TT 3QB5A 2YK0A 3RI5A 4AQFC 3FZFB 4ZI3D 4PNIA 3EDVA 4QXCB 3ETUA 4J2CA 3TLTA 2A9UA 2CA5A 2CEAA 2FBWA 2X68A 5L47A 2HH7A 4L0RA 1KEYA 2K9AA 1J5WA 2CBIA 2X9HA 1MIWA 1G73A 1HNWT 3RC8A 4ZI2C 2Z6EA 3P4QA 4IL4A 1LKXA 4P1NA 3S4UA 4HWFA 3J7Yq 3RYFE 2V26A 2LLYA 2WDRA 4QH1A 4O2BE 3UU5A 3VRAA 4IDOA 3VKHA 3L09A 1NWMX 4LF7T 4YJ2E 3SOLA 5FNVE 4H9NC 5KX5E 4KHZF 5JQGE 3AE8A 4C90A 5AQGB 4FI5A 4WYVA 5AQMB 4EAHA 2KNDA 5H6RB 4OK0A 2JQ9A 3TLVA 3UQ7A 3KVAA 2JQKA 4YHJA 2E5LT 3PJAJ 2IUBA 3WAKA 2L8KA 3DTOA 4WZXA 5FMNA 2W4XA 3PUVF 2VKDA 4EZ4A 4HGAA 4NXMT 2WMNA 1HS7A 3A7MA 5BR8T 4ASKA 3GA8A 4DMVA 2LOPA 4EEBA 5CB4E 5C3JA 2CWYA 2RPAA 2YDSA 2WQYA 4H9PC 2Q9QB 2LSYA 2E9XB 4MFRA 2C5JA 5EK4A 4H9RC 4LMKA 3RIUC 5CGMA 1Z0PA 2M6BA 3GN5B 4IIJE 3ZMSB 3Q5WA 4O4HE 5AQVB 3UU4A 4HN9A 1U5PA 4ZS3A 4A97A 2Q9QC 4ZEYA 2V5DA 2E9XC 2NW7A 4IHJE 3UFGA 3KV4A 4XAXB 1IZNB 2WWUA 5ABEA 3CWZB 4NUVA 4LF8T 4AQGA 1J5ET 2VKJA 2BKPA 3UTKA 2K3WA 3ZMVB 2LM9A 3ZYKA 5CFBA 4M1PA 5FVLA 1J1JA 4BJMA 1BR1A 4KMCA 1T98A 3E22E 3I0OA 2KINB 3L8RA 4DR6T 2JPFA 3P8CD 1UK5A 1XZYA 4HEAA 1LRZA 3AEDA 1MMGA 1OEDB 1ZP0A 1UX5A 1IJ6A 1YXRA 4H9SE 3LG7A 1OEDC 4IE4A 1N34T 2JRKA 2XSAA 1SE7A 3M65A 3B5MA 3HA4A 4LFAT 3RH3A 4WBOA 2VKOA 3L39A 2IW5B 4P0BA 3PUQA 2CRBA 2BKNA 2Y6XA 2WZHA 3OJAA 2NTXA 5LBMA 4LF9T 3VR8A 2LRLA 5L4HA 2WB5A 4UR9A 1QSDA 2E5VA 1ZOYA 2XSBA 5AQRB 5J1GA 2JIWA 4QX8B 4V1Av 3RKGA 2VVNA 3AEAA 3FZLB 3KBTA 5AQPB 3PUYF 3AEBA 2UU9T 4IE7A 4YFSA 2D5UA 3JC6D 5EK3A 4LF5T 2CCQA 4JUYA 4TZ4C 4CZZB 2RA1A 2KWHA 3DJBA 3A5XA 4GK5E 1VCTA 3TKLB 2JJ9A 3FXEB 5LP6E 2UXXB 2WMOA 2V7KA 4PW8A 5LHIB 4ILBA 1VRBA 1Y01A 1DU2A 2HPJA 3ZMUB 2XTLA 4U2ZA 2W0GA 5FKYA 1Z8UA 2N1GA 2R6GF 3AE1A 1YKEB 2IHR1 2ODUA 1FMWA 2HN2A 2ACXA 3NBXX 3HI2A 4XZCA 4OHFA 2YINA 4IDNA 5FXXA 2W00A 3T1HT 4U74A 2YEVC 2BVLA 5AQHB 1ZHCA 3O9XA 1WCRA 5C2TA 4QX7B 5AQFB 5IHYA 1HX8A 4DR2T 2D0TA 3UU3A 4ERRA 4ANJA 2WZIA 3MACA 2BG9A 4KP3C 3C4WA 3UUMA 2UUCT 5HWYA 3P4WA 4EB6E 2XM1A 2UXNB 2V7IA 1SA0E 1HX1B 3U78A 1UX4A 3RGLA 4WW0A 4N78D 3ZSSA 4DBQA 2XPKA 2NWBA 1LVKA 4CI1B 3N2KE 2LRKA 4DR3T 3UUBA 1WR6A 4JI7T 2KSRA 2CM0A 3ZMZB 2YOEA 3VR9A 3MKDA 3CMLA 3Q9DA 4GYRA 2ZM0A 3E0ZA 5J2TE 3FBLA 2VK9A 4LF6T 3AECA 3N9LA 1N36T 5LHHB 4X1KE 3RLFF 2J62A 1KNPA 3G06A 3ZMTB 4DV4T 2J47A 3HR0A 4NIQA 3ZN0B 5ABGA 5JDFA 4U72A 2H7OA 2IC9A 4UV8B 5HXHA 5JH7E 3C64A 4A56A 2WSSV 3PJAA 1I94T 3QC9A 3IBPA 2W61A 4TNVA 4DR7T 3Q2MA 2CMRA 2V6YA 4CN1A 5CA1E 3P4PA 1D1CA 3F2EA 3RRCA 4Z91A 2WU2A 5LG4A 2V7JA 1H7CA 2KT9A 4BA9A 4Q25A 3AE4A 2D9DA 3AA1B 1MMDA 5HXSA 3CPZA 3EUHA 2B76A 3H3AA 3Q5EA 1ZEEA 3ZT7A 3OTOT 3ZC1A 3C4ZA 4AKHA 4IDPA 5KMGP 3HKDE 4AKIA 1XDOA 2ZM2A 5ABFA 2XQ3A 3QUJA 3UQ4A 3ZT6A 2MTQA 3HL6A 2PBIA 3N9PA 1SUMB 2WCAA 5JREA 3VKGA 2JMKA 2XAHB 5LGTB 5JDMA 4JI8T 3CQGB 4L5GA 4JEHB 2FUPA 4K0UA 2HHHT 3K3NA 3CKDA 3HKCE 3K3OA 4NUUA 3BQKA 4LMJA 4F6RC 4JYAT 1WLXA 2EHOD 5JR9A 4HFCA 3KINB 3OBVE 3ABVA 5FL0A 2I0MA 3AAIA 2IAKA 2EHOA 4WNKA 4I55E 3V5UA 1NEKA 4UV9B 3ZKRA 1WRDA 2DWKA 3OPCA 2NOXA 4TNWA 4OX9T 2JQQA 4X1IE 1Y64B 3TLSA 1W0BA 3EI0A 4CXYA 3AE3A 5L4EA 4UF0B 5JDHA 5LB7B 4YTMA 2K5BB 1HR0T 3M3ZB 4EYYR 3FXDB 2LHRA 2LE8A 5DQVA 4H9OC 3ANWB 1BR0A 2AXDS 2QGSA 2IDOB 1XNQT 4O4JE 2C5IT 4IE5A 3SRZA 2BZBA 5IUXA 2W2UA 1MNDA 1D0XA 1HCIA 1VCSA 2DWGA 5AQKB 5L3CB 4DUZT 1JNZA 3FBZA 1NENA 5LA6E 2A2FX 3PU8A 2AE9A 3K8PC 3RQUA 2BG9B 3KV9A 2CLYB 3A8YC 4PJMA 3AA0B 2WU5A 2X66A 1MIYA 2OLTA 1W0AA 1T7SA 2W66A 2QVAA 4IDQA 3ZCJA 3NZPA 5LMNT 2BG9C 3QNUA 2CLYC 4YTPA 3P4SA 2LKGA 5HWXA 1S35A 3EABA 4WBNE 5FXVA 1SHZC 4EGWA 1YQ4A 4HFIA 4O2AE 4JV5T 1GQEA 4PK4A 3AEEA 3SWHA 4LF4T 4HTEA 5AQSB 2BBHA 2VQET 4IL9A 2DI4A 4ZZBA 3KVBA 3AE7A 4HWDA 3AEFA 4CXXA 4JLEA 5C8YE 3AVRA 2H88A 4YLHA 4XBFB 3Q5XA 2LSIA 4ZZCA 4QXHB 5A1LA 2LT3A 3D0TA 4ADZA 4MBQA 5EK2A 4JI6T 1FIOA 5HYAA 4DUYT 4O4IE 2ZMAA 2MBGA 2I59A 4I4TE 4AQFA 1XMOT 3AAAB 4I50E 1B7TA 2VVSA 4HE8A 2XQ4A 4ZI7E 5LGNB 3V5SA 5ETWA 4HWCA 2XQ7A 3VRBA 3N9QA 3AXJA 2M6IA 2PFVA 3MZKB 2XHEB 4AKLA 3F31A 1T8BA 3RYIE 2XY8B 4EIWA 3RYHE 5AFUL 2WM9A 1LVFA 3U3IA 2DL1A 5F3JA 4ZI2D 1R8IA 1KK7A 4QXBB 1IBLT 2YKSA 5GONE 5AQTB 2YN6A 5ABFB 2J4GA 3AE2A 4YSXA 3HKEE 2CXDA 2XQAA 2FJAA 4HFEA 5CA0E 3MA9A 2KLQA 3TLUA 4JEUB 2PG8A 3PURA 2F4VT 5LHGB 4AIUA 3KV6A 3KV5A 2VASA 4ZI3C 1FEWA 2LJLA 4U33A 5FY1A 5CJ5A 5ABHA 4BJNA 4LMLA 4IDZA 2VQFT 1KNZA 3ZT5A 3CX8B 4JI1T 3PU3A 4YSZA 3I1AA 4ZOLE 4GYSA 4NPPA 3UT5E 4E7SA 3LJCA 4DV2T 1HNZT 4UVBB 4EV6A 1M62A 1KFYA 3JADA 5JRCA 4PJJA 4JI5T 5J0ZA 3OKQA 1W9RA 2MPKA 4TV8E 3CVRA 4OFZA 5LXTE 1BR2A 3N2GE 4COFA 2CE7A 3ZEFB 3RIAA 3NVOA 5L2LA 4PK6A 4UEMA 1FJGT 4X62T 2E8IA 1MIVA 3RIUA 2Q9QD 3AVSA 3PDYA 2WAUA 4L9IA 1D1AA 4QWNB 1HG5A 2E9XD 4E7ZA 2CXLA 2Q9QA 3QK6A 3GMIA 1YD8G 2SPCA 2E9XA 4EZHA 3BQLA 3PUGA 2JMHA 3C50A 3LBXA 3DP7A 3ZJ1A 3GN5A 4HKAA 2XAFB 2YU2A 5LCYA 4EXTA 3MJXA 5LG3A 3ONXA 5AQNB 3BQIA 3ZPOA 1E7PA 2X9WA 3QOFA 4IE6A 1E1HB 1D0ZA 5JDNA 1XDPA 3NRYA 3T8OA 2OA5A 2XZEA 4TWDA 1WR0A 4LFBT 1CHUA 5FXZA 2Y48B 5FP3A 2QA7A 2FJBA 2BVMA 5AQLB 2K48A 5HXCA 5L3FB 3HKBE 2CXFA 1IBMT 2V7MA 1V9DA 4B3RT 2FJDA 5HEJA 3KFWX 1JNRA 2ACZA 2XQ5A 5LYJE 3H37A 4JI2T 3Q5DA 3IA3A 4U3CA 2WS3A 1OEDA 3AE5A 4CXWA 4DR1T 3AE9A 4BAYB 4YHHT 3T1YT 2VKHA 3RF1A 3WI3A 3NKZA 4PJLA 2M67A 3IF8B 2VL8A 5FXWA 3UU8A 2KWIB 2W62A 2LM2A 5DJQC 3L3PA 5FYMA 1HG2A 2ZM8A 3FHNA 1BR4A 1N32T 4CN4A 3E08A 1OEDE 3NRXA 3N5LA 4NXNT 2CBJA 4GKJT 1UGOA 2V7LA 2X51A 5FVKA 3W15B 3MK7C 2XQ6A 4PJNA 2NTYA 5DQWA 5ADXL 5AQIB 1S94A 4UVCB 3TLWA 4TWHA 1UCUA 2W67A 3RHWA 3RPUA 3ZCIA 3RQWA 3FZMB 3PV0F 5KDMC 5LBQB 4DV6T 3X1DA 4TUYE 1HNXT 5H6QB 2DHRA 5FL1A 3PTRB 4PFPA 5TAOA 4Z8XA 4YY3T 3AAEB 2HN1A 3SFEA 4ISSA 4IGUA 1QLBA 3PUWF 2Y8DA 1FMVA 4HWIB 2ODVA 2KXPB 3UUXB 3ZYLA 4PAGA 3ESLA 4KI0F 3JAEA 5IYZE 5JVDE 4A98A 2YDQA 2QRXA 5DABA 1W09A 2XQ8A 1AJ3A 2A72A 4YT0A 3JC6C 4OYJA 1D0YA 2XJ7A 3O1HA 4PK5A 4DVDA 2LHNA 4DV7T 2XQ9A 4EOZB 2H89A 2ZM6T 4ZXLA 1L0VA 2VWAA 3CX6B 1WYBA 5AQUB 3PUXF 4K0KT 1EZ3A 4IREA 2L3LA 3N2OA 4OYKA 2X9YA 4YSYA 3RKOA 3NWIA 4I0UA 2W63A 4A5XA 3I9YA 3I0QA 5JRCB 4H9QC 4HWHA 2KZ7B 4ZHQE 2JQHA 2X67A 2D2SA 3K1SA 3LK42 4JI0T 5AQJB 3SS1A 5JTGA 2IIUA 4CN6A 3UU6A 1T72A 3ONLC 5L3EB 5AQOB 5KXJA 5LJMA 5LOVE 2H7VC 3MXZA 3EHZA 4ZS2A 1XWMA 3IEEA 1MNEA 4CI2B 1YQ3A 4X64T 2NP9A 4O8SA 3LDQB 2IC6A 2CPTA 3PUSA 2C0SA 4DO0A 5LMUT 3LBXB 5FY7A 4LFCT 2BDEA 1HFAA 4DMWA 4FJOA 4U31A 3K3QC 5AQQB 4AXPA 1VOMA 2NW9A 2FJEA 2LSGA 5EZYE 5LNKA 3SFDA 3LK3B 3JCFA 2VB6A 4U7YA 3I9WA 2OV9A 1G8XA 2XAGB 4DV0T 1OWAA 2I6HA 3O1JA 1HTJF 4U2YA 2LSKA 4HFBA 4PFOA 3RRWA 1WYCA 5E0OA 4AKRB 2XM2A 1U4QA 5LGUB 4QKNA 5L3BB 3ZYMA 2XASB 2VL0A 1HF8A 2GK9A 3CQXC 2X0YA 4ILAA 3AE6A 2V6XA 1OXZA 4DBRA 2WDVA 2A3DA 3B57A 3ONJA 3P4RA 2PTFA 5LJNA 3J9X1 4CI3B 5FY0A 2LKHA 5F5WA 3GWHA 2HPLA 3LFMA 3O1IA 3ZC0A 2X0LB 4AI6A 2N9DA 2CHOA 3C4XA 2V1DB 2V6YB 3AA7B 4UELA 4YJ3E 3AB3B 1E2AA 4DV1T 3EAMA 2LEHA 2WBLA 2KMFA 4H63H 5IWAT 1IJ5A 2LOSA 3O4XE 4X20E 4UXNB 2UUAT 1M7KA 2C5KT 4O4LE 3CQCB 4C91A 2VURA 3BK9A 5BMVE 2N2NA 2NR4A 3ZJ2A 2K24A 3CX7B 1O3XA 1IAPA 1QUUA 3LK2B 3R84B 3KDSE 1ZKEA 4G2AA 1KNRA 4X5TA 4KUMB 2NW8A 2RP4A 4DNDA 2CWOA 3P50A 4B3ST 4GIWA 4EEDA 4IE0A 2UUBT 2DNXA 2UXDT 4TN7B 4H63V 5HEOA 3QB5K 4IT4A 3FZHB 3PE0A 1ZV4X 2X9XA 4Z90A 2UXBT 5JR9B 2XUEA 3WAJA 2BBJA 1YW0A 4MLKA 4B6XA 3ZLIA 4UF0A 2EHOB 4ISTA 5F8PA 5HEGA 1MMAA 5L3GB 4GOUA 5JR9C 2BKOA 5HXRA 2G0UA 3ANWA 5HEUA 5JDQA 2EHOC 2H3RA 2QYWA 2UXCT 4X66T 3EVYA 4HFDA 3VHLA 2DLRA 2YDRA 4X1YE 3EDUA 5M4YA 2YU1A 4DIDB 2V5CA 3PUZF 4AQYT 4F8HA 3C51A 1N33T 4GKKT 4QH4A 2V8SV 3N9MA 2MAWA 4ILUA 5HCJA 1CUNA 3JAFA 1UURA 3RIFA 4CQIA 2ZLYA 3P7IA 2D0UA 4P0AA 3KBUA 4TV9E 2BS2A 4DV5T 4TX5A 3RYCE 2WY2A 4QHOA 1IBKT 2DCFA 1UUSA 5HAXA 3PUAA 4DV3T 3IHRA 1US7B 4MALA 2LSJA 3AA6B 3RX6A 3OYZA 2BS3A 4HFVA 3AEGA 3CIRA 5JDLA 1WFDA 4AISA 5HEHA 4ILCA 2BG9E 4B3MT 3UFEA 3R6NA 3F57A 2XQYA 4UIGA 3B13A 3N9NA 5JDGA 4KHPT 3C98B 4YTNA 2WWVA 4GK0E 2MYSA 2X0HA 4TWFA 1D1BA 4KX6A 2MOZA
chains in the Genus database with same CATH topology
5DABA 4HTEA 4G63A 1AJ3A 2A72A 4AKGA 2B1EA 1VRBA 3JC6C 2HPJA 3ZMUB 4OYJA 2DI4A 2XTLA 3KVBA 3RC3A 1D0YA 1YKHB 3UULA 2W0GA 4CXXA 3O1HA 4PK5A 3N9OA 2LHNA 3UUNA 4DVDA 4EYUA 2N1GA 4EOZB 4JLEA 5L3DB 1YKEB 5C8YE 2ODUA 3AVRA 4P09A 4YLHA 1FMWA 2P9BA 2ACXA 2VWAA 3NBXX 3HI2A 3CX6B 3ETVA 4XZCA 1WYBA 4OHFA 2YINA 5FXXA 1EZ3A 2L3LA 3N2OA 2W00A 4OYKA 2X9YA 4XBFB 4U74A 3RKOA 2YEVC 3Q5XA 5J2UE 2LSIA 2BVLA 4QXHB 1ZHCA 5A1LA 2LT3A 3D0TA 4ADZA 3VU7H 3O9XA 4MBQA 5EK2A 3OYXA 2W63A 4QX7B 2PJQA 3I9YA 4MHCA 3FB2A 1FIOA 5IHYA 3I0QA 5HYAA 1HX8A 1X79A 1NAFA 2D0TA 2ZMAA 4O4IE 2MBGA 4H9QC 4ANJA 2KZ7B 4ERRA 5JRCB 2I59A 2J1DG 3MACA 4I4TE 4KBMB 3NZQA 4AQFA 3AAAB 2ES0A 4I50E 4ZHQE 1B7TA 4HE8A 4KP3C 2X67A 4ZI7E 2XAJB 3C4WA 3UUMA 5LGNB 2D2SA 3V5SA 5ETWA 2L9QA 3N9QA 5HWYA 3LK42 2PFVA 4I43B 3MZKB 4EB6E 3SS1A 2XHEB 4UVAB 4AKLA 3F31A 2UXNB 3RYIE 2V7IA 3ZN1B 5L3EB 1SA0E 1MMNA 2XAQB 4EIWA 5HXEA 3RYHE 5LJMA 5AFUL 5LOVE 2WM9A 2H7VC 3MXZA 1LVFA 4ZS2A 3U3IA 3U78A 3IEEA 1UX4A 5F3JA 4ZI2D 2YK0A 4ZI3D 1MNEA 4AQFC 4CI2B 4WW0A 1KK7A 4N78D 4QXBB 2NP9A 4O8SA 4PNIA 4DBQA 3EDVA 2IC6A 2NWBA 5GONE 3PUSA 2C0SA 4DO0A 1LVKA 4QXCB 3LBXB 5FY7A 4CI1B 2BDEA 3ETUA 1HFAA 3N2KE 4J2CA 1WR6A 2CA5A 2CEAA 4DMWA 4FJOA 2CM0A 3K3QC 3ZMZB 3MKDA 3HKEE 4AXPA 1VOMA 2CXDA 2X68A 2NW9A 2HH7A 4L0RA 2LSGA 5CA0E 5EZYE 2K9AA 5LNKA 3CMLA 3Q9DA 4GYRA 3MA9A 2ZM0A 2X9HA 3E0ZA 3LK3B 2KLQA 1MIWA 5J2TE 1G73A 2VB6A 3FBLA 4JEUB 2PG8A 3I9WA 2VK9A 3PURA 5LHGB 1G8XA 2XAGB 3N9LA 3KV6A 3KV5A 3RC8A 2VASA 4ZI2C 2Z6EA 4ZI3C 1OWAA 1FEWA 5LHHB 2LJLA 4X1KE 1LKXA 5FY1A 3S4UA 3J7Yq 3RYFE 3O1JA 4BJNA 1HTJF 2V26A 2LSKA 4IDZA 3ZMTB 4PFOA 3RRWA 1WYCA 1KNZA 4O2BE 5E0OA 3HR0A 3CX8B 3ZN0B 4AKRB 3PU3A 1U4QA 5LGUB 3I1AA 5JDFA 3VKHA 4ZOLE 4U72A 2H7OA 4QKNA 5L3BB 3L09A 3ZYMA 2IC9A 1NWMX 2XASB 4UV8B 5HXHA 4GYSA 5JH7E 3C64A 3UT5E 4A56A 1HF8A 2WSSV 2GK9A 3CQXC 4E7SA 4YJ2E 3LJCA 1OXZA 3SOLA 4DBRA 5FNVE 4H9NC 5KX5E 2A3DA 3QC9A 3B57A 5JQGE 3IBPA 5LJNA 3J9X1 4UVBB 4C90A 4FI5A 2W61A 5JRCA 4PJJA 3Q2MA 4CI3B 2CMRA 5FY0A 5CA1E 4EAHA 3GWHA 2KNDA 3OKQA 5H6RB 4OK0A 2HPLA 3LFMA 3O1IA 3ZC0A 1D1CA 2X0LB 4AI6A 3F2EA 3RRCA 4TV8E 2N9DA 3KVAA 3C4XA 2V1DB 3CVRA 4OFZA 4YHJA 5LG4A 2V7JA 1H7CA 5LXTE 3AA7B 1BR2A 3N2GE 3WAKA 2KT9A 2L8KA 2CE7A 4UELA 3ZEFB 4BA9A 3DTOA 5FMNA 5L2LA 4PK6A 4UEMA 4YJ3E 2E8IA 3AA1B 1MIVA 1MMDA 3AB3B 2VKDA 4EZ4A 5HXSA 3CPZA 2Q9QD 2LEHA 3AVSA 3EUHA 2WBLA 2WAUA 2WMNA 3H3AA 3PDYA 1D1AA 1ZEEA 4HGAA 4L9IA 2KMFA 4QWNB 1HS7A 1HG5A 2E9XD 4ASKA 3GA8A 4DMVA 3ZC1A 4E7ZA 4H63H 1IJ5A 2CXLA 2LOSA 3O4XE 4X20E 4UXNB 2Q9QA 2LOPA 3QK6A 3C4ZA 2C5KT 3GMIA 1YD8G 4O4LE 2SPCA 2E9XA 3CQCB 5CB4E 4EZHA 3BQLA 3PUGA 4AKHA 2JMHA 4C91A 3BK9A 5BMVE 3C50A 2CWYA 2N2NA 3LBXA 3DP7A 5KMGP 3HKDE 3ZJ2A 4AKIA 2K24A 3ZJ1A 3GN5A 2ZM2A 4H9PC 2Q9QB 3CX7B 1O3XA 3QUJA 2LSYA 2MTQA 3HL6A 1IAPA 2PBIA 3N9PA 1QUUA 3LK2B 4HKAA 3R84B 2E9XB 4MFRA 3VKGA 2XAFB 5JREA 2C5JA 2JMKA 3KDSE 5EK4A 4H9RC 2XAHB 1ZKEA 2YU2A 1Z0PA 4G2AA 5LCYA 5LGTB 5JDMA 3GN5B 4IIJE 4KUMB 3Q5WA 4O4HE 3ZMSB 4EXTA 3CQGB 3MJXA 4L5GA 4HN9A 3ONXA 1U5PA 4ZS3A 4JEHB 2NW8A 2Q9QC 2RP4A 4DNDA 3BQIA 4K0UA 3ZPOA 2X9WA 2CWOA 4IE6A 2E9XC 1E1HB 1D0ZA 2NW7A 5JDNA 3NRYA 4GIWA 3T8OA 2OA5A 4IHJE 3KV4A 3K3NA 4XAXB 1IZNB 2WWUA 3CKDA 3HKCE 3K3OA 4IE0A 4NUUA 2DNXA 3CWZB 5FXZA 2Y48B 3BQKA 5FP3A 4F6RC 1WLXA 2QA7A 4NUVA 2EHOD 4TN7B 5JR9A 4H63V 4AQGA 2BVMA 3KINB 3OBVE 2K48A 3AAIA 3PE0A 2IAKA 2VKJA 1ZV4X 2EHOA 5HXCA 4WNKA 2X9XA 3UTKA 4I55E 5L3FB 3ZMVB 3HKBE 2CXFA 2LM9A 3ZYKA 5JR9B 2V7MA 3V5UA 1V9DA 2XUEA 4UV9B 1WRDA 2DWKA 3KFWX 3WAJA 2NOXA 1YW0A 5LYJE 3H37A 4M1PA 4MLKA 4B6XA 3ZLIA 4BJMA 4UF0A 1BR1A 2EHOB 2JQQA 4ISTA 4X1IE 4KMCA 1T98A 3E22E 1Y64B 2KINB 3I0OA 5F8PA 2JPFA 4CXWA 3P8CD 4CXYA 4BAYB 1MMAA 4HEAA 5L3GB 2VKHA 3WI3A 4GOUA 5JR9C 1LRZA 4UF0B 5HXRA 5JDHA 2G0UA 3ANWA 1MMGA 1UX5A 4PJLA 2M67A 5JDQA 2EHOC 2H3RA 1IJ6A 3IF8B 2K5BB 4EYYR 4H9SE 2VL8A 3FXDB 3EVYA 2LHRA 2LE8A 5DQVA 3VHLA 4H9OC 2DLRA 5FXWA 3ANWB 1BR0A 3LG7A 4X1YE 2KWIB 2W62A 3EDUA 5M4YA 5DJQC 2YU1A 3L3PA 2QGSA 5FYMA 4IE4A 1HG2A 2JRKA 2ZM8A 3C51A 1BR4A 3FHNA 3M65A 3HA4A 3E08A 4O4JE 3RH3A 4WBOA 2C5IT 3N9MA 4IE5A 3SRZA 2BZBA 2VKOA 3NRXA 4ILUA 3N5LA 1CUNA 2IW5B 2V7LA 1MNDA 4P0BA 4CQIA 3PUQA 2X51A 2Y6XA 2ZLYA 3P7IA 3OJAA 2D0UA 4P0AA 2NTXA 5LBMA 3KBUA 4TV9E 1D0XA 1HCIA 2DWGA 5L3CB 3W15B 3MK7C 3FBZA 4PJNA 5DQWA 2NTYA 5LA6E 5ADXL 2A2FX 3PU8A 1S94A 4UVCB 1UCUA 3RPUA 3ZCIA 4TX5A 3RYCE 4QHOA 3K8PC 1QSDA 3KV9A 2DCFA 2CLYB 5J1GA 4PJMA 5HAXA 3AA0B 3PUAA 4QX8B 5KDMC 2X66A 5LBQB 3IHRA 1US7B 4MALA 1MIYA 2LSJA 3AA6B 3RX6A 4V1Av 4TUYE 3OYZA 3KBTA 5H6QB 4HFVA 3ZCJA 3NZPA 2DHRA 3PTRB 4PFPA 4IE7A 5TAOA 5JDLA 2CLYC 4Z8XA 4YFSA 2D5UA 3JC6D 3AAEB 3UFEA 3R6NA 3F57A 5EK3A 2XQYA 4UIGA 5HWXA 3B13A 4ISSA 4IGUA 3N9NA 2CCQA 4JUYA 4TZ4C 2Y8DA 5JDGA 4CZZB 1S35A 1FMVA 2RA1A 2KWHA 3DJBA 5FXVA 1SHZC 4WBNE 2ODVA 2KXPB 3C98B 3UUXB 3A5XA 4GK5E 3TKLB 3ZYLA 4PAGA 3ESLA 4GK0E 2MYSA 2JJ9A 3FXEB 4O2AE 5LP6E 2UXXB 2WMOA 4PK4A 2V7KA 4PW8A 5IYZE 5JVDE 1D1BA 3SWHA 5LHIB 2MOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI2 D;  4ZI3 D;  2K9A A;  4ZI2 C;  4ZI3 C; 
#chains in the Genus database with same CATH topology
 4G63 A;  3ZST A;  3FZK B;  4AKG A;  2B1E A;  2E2A A;  3CK6 A;  4JI4 T;  3RC3 A;  1YKH B;  3UUL A;  4EYU A;  3N9O A;  3UUN A;  1XNR T;  1X9B A;  3H3M A;  2WP9 A;  5L3D B;  1I6Z A;  4P09 A;  2P9B A;  1KF6 A;  4QH5 A;  3ETV A;  2IML A;  4YXD A;  4X65 T;  4JI3 T;  4DR5 T;  5J2U E;  4JBW F;  3VU7 H;  3OYX A;  2WDQ A;  2PJQ A;  4MHC A;  3FB2 A;  2BS4 A;  1X79 A;  1NAF A;  4DR4 T;  2J1D G;  3OVU A;  4KBM B;  3NZQ A;  2ES0 A;  3LSV A;  2XAJ B;  5HCM A;  2L9Q A;  4I43 B;  4UVA B;  4HFH A;  3ZN1 B;  1MMN A;  1XMQ T;  2XAQ B;  5HXE A;  4U7I A;  3AXJ B;  2CHN A;  4B3T T;  3QB5 A;  2YK0 A;  3RI5 A;  4AQF C;  3FZF B;  4ZI3 D;  4PNI A;  3EDV A;  4QXC B;  3ETU A;  4J2C A;  3TLT A;  2A9U A;  2CA5 A;  2CEA A;  2FBW A;  2X68 A;  5L47 A;  2HH7 A;  4L0R A;  1KEY A;  2K9A A;  1J5W A;  2CBI A;  2X9H A;  1MIW A;  1G73 A;  1HNW T;  3RC8 A;  4ZI2 C;  2Z6E A;  3P4Q A;  4IL4 A;  1LKX A;  4P1N A;  3S4U A;  4HWF A;  3J7Y q;  3RYF E;  2V26 A;  2LLY A;  2WDR A;  4QH1 A;  4O2B E;  3UU5 A;  3VRA A;  4IDO A;  3VKH A;  3L09 A;  1NWM X;  4LF7 T;  4YJ2 E;  3SOL A;  5FNV E;  4H9N C;  5KX5 E;  4KHZ F;  5JQG E;  3AE8 A;  4C90 A;  5AQG B;  4FI5 A;  4WYV A;  5AQM B;  4EAH A;  2KND A;  5H6R B;  4OK0 A;  2JQ9 A;  3TLV A;  3UQ7 A;  3KVA A;  2JQK A;  4YHJ A;  2E5L T;  3PJA J;  2IUB A;  3WAK A;  2L8K A;  3DTO A;  4WZX A;  5FMN A;  2W4X A;  3PUV F;  2VKD A;  4EZ4 A;  4HGA A;  4NXM T;  2WMN A;  1HS7 A;  3A7M A;  5BR8 T;  4ASK A;  3GA8 A;  4DMV A;  2LOP A;  4EEB A;  5CB4 E;  5C3J A;  2CWY A;  2RPA A;  2YDS A;  2WQY A;  4H9P C;  2Q9Q B;  2LSY A;  2E9X B;  4MFR A;  2C5J A;  5EK4 A;  4H9R C;  4LMK A;  3RIU C;  5CGM A;  1Z0P A;  2M6B A;  3GN5 B;  4IIJ E;  3ZMS B;  3Q5W A;  4O4H E;  5AQV B;  3UU4 A;  4HN9 A;  1U5P A;  4ZS3 A;  4A97 A;  2Q9Q C;  4ZEY A;  2V5D A;  2E9X C;  2NW7 A;  4IHJ E;  3UFG A;  3KV4 A;  4XAX B;  1IZN B;  2WWU A;  5ABE A;  3CWZ B;  4NUV A;  4LF8 T;  4AQG A;  1J5E T;  2VKJ A;  2BKP A;  3UTK A;  2K3W A;  3ZMV B;  2LM9 A;  3ZYK A;  5CFB A;  4M1P A;  5FVL A;  1J1J A;  4BJM A;  1BR1 A;  4KMC A;  1T98 A;  3E22 E;  3I0O A;  2KIN B;  3L8R A;  4DR6 T;  2JPF A;  3P8C D;  1UK5 A;  1XZY A;  4HEA A;  1LRZ A;  3AED A;  1MMG A;  1OED B;  1ZP0 A;  1UX5 A;  1IJ6 A;  1YXR A;  4H9S E;  3LG7 A;  1OED C;  4IE4 A;  1N34 T;  2JRK A;  2XSA A;  1SE7 A;  3M65 A;  3B5M A;  3HA4 A;  4LFA T;  3RH3 A;  4WBO A;  2VKO A;  3L39 A;  2IW5 B;  4P0B A;  3PUQ A;  2CRB A;  2BKN A;  2Y6X A;  2WZH A;  3OJA A;  2NTX A;  5LBM A;  4LF9 T;  3VR8 A;  2LRL A;  5L4H A;  2WB5 A;  4UR9 A;  1QSD A;  2E5V A;  1ZOY A;  2XSB A;  5AQR B;  5J1G A;  2JIW A;  4QX8 B;  4V1A v;  3RKG A;  2VVN A;  3AEA A;  3FZL B;  3KBT A;  5AQP B;  3PUY F;  3AEB A;  2UU9 T;  4IE7 A;  4YFS A;  2D5U A;  3JC6 D;  5EK3 A;  4LF5 T;  2CCQ A;  4JUY A;  4TZ4 C;  4CZZ B;  2RA1 A;  2KWH A;  3DJB A;  3A5X A;  4GK5 E;  1VCT A;  3TKL B;  2JJ9 A;  3FXE B;  5LP6 E;  2UXX B;  2WMO A;  2V7K A;  4PW8 A;  5LHI B;  4ILB A;  1VRB A;  1Y01 A;  1DU2 A;  2HPJ A;  3ZMU B;  2XTL A;  4U2Z A;  2W0G A;  5FKY A;  1Z8U A;  2N1G A;  2R6G F;  3AE1 A;  1YKE B;  2IHR 1;  2ODU A;  1FMW A;  2HN2 A;  2ACX A;  3NBX X;  3HI2 A;  4XZC A;  4OHF A;  2YIN A;  4IDN A;  5FXX A;  2W00 A;  3T1H T;  4U74 A;  2YEV C;  2BVL A;  5AQH B;  1ZHC A;  3O9X A;  1WCR A;  5C2T A;  4QX7 B;  5AQF B;  5IHY A;  1HX8 A;  4DR2 T;  2D0T A;  3UU3 A;  4ERR A;  4ANJ A;  2WZI A;  3MAC A;  2BG9 A;  4KP3 C;  3C4W A;  3UUM A;  2UUC T;  5HWY A;  3P4W A;  4EB6 E;  2XM1 A;  2UXN B;  2V7I A;  1SA0 E;  1HX1 B;  3U78 A;  1UX4 A;  3RGL A;  4WW0 A;  4N78 D;  3ZSS A;  4DBQ A;  2XPK A;  2NWB A;  1LVK A;  4CI1 B;  3N2K E;  2LRK A;  4DR3 T;  3UUB A;  1WR6 A;  4JI7 T;  2KSR A;  2CM0 A;  3ZMZ B;  2YOE A;  3VR9 A;  3MKD A;  3CML A;  3Q9D A;  4GYR A;  2ZM0 A;  3E0Z A;  5J2T E;  3FBL A;  2VK9 A;  4LF6 T;  3AEC A;  3N9L A;  1N36 T;  5LHH B;  4X1K E;  3RLF F;  2J62 A;  1KNP A;  3G06 A;  3ZMT B;  4DV4 T;  2J47 A;  3HR0 A;  4NIQ A;  3ZN0 B;  5ABG A;  5JDF A;  4U72 A;  2H7O A;  2IC9 A;  4UV8 B;  5HXH A;  5JH7 E;  3C64 A;  4A56 A;  2WSS V;  3PJA A;  1I94 T;  3QC9 A;  3IBP A;  2W61 A;  4TNV A;  4DR7 T;  3Q2M A;  2CMR A;  2V6Y A;  4CN1 A;  5CA1 E;  3P4P A;  1D1C A;  3F2E A;  3RRC A;  4Z91 A;  2WU2 A;  5LG4 A;  2V7J A;  1H7C A;  2KT9 A;  4BA9 A;  4Q25 A;  3AE4 A;  2D9D A;  3AA1 B;  1MMD A;  5HXS A;  3CPZ A;  3EUH A;  2B76 A;  3H3A A;  3Q5E A;  1ZEE A;  3ZT7 A;  3OTO T;  3ZC1 A;  3C4Z A;  4AKH A;  4IDP A;  5KMG P;  3HKD E;  4AKI A;  1XDO A;  2ZM2 A;  5ABF A;  2XQ3 A;  3QUJ A;  3UQ4 A;  3ZT6 A;  2MTQ A;  3HL6 A;  2PBI A;  3N9P A;  1SUM B;  2WCA A;  5JRE A;  3VKG A;  2JMK A;  2XAH B;  5LGT B;  5JDM A;  4JI8 T;  3CQG B;  4L5G A;  4JEH B;  2FUP A;  4K0U A;  2HHH T;  3K3N A;  3CKD A;  3HKC E;  3K3O A;  4NUU A;  3BQK A;  4LMJ A;  4F6R C;  4JYA T;  1WLX A;  2EHO D;  5JR9 A;  4HFC A;  3KIN B;  3OBV E;  3ABV A;  5FL0 A;  2I0M A;  3AAI A;  2IAK A;  2EHO A;  4WNK A;  4I55 E;  3V5U A;  1NEK A;  4UV9 B;  3ZKR A;  1WRD A;  2DWK A;  3OPC A;  2NOX A;  4TNW A;  4OX9 T;  2JQQ A;  4X1I E;  1Y64 B;  3TLS A;  1W0B A;  3EI0 A;  4CXY A;  3AE3 A;  5L4E A;  4UF0 B;  5JDH A;  5LB7 B;  4YTM A;  2K5B B;  1HR0 T;  3M3Z B;  4EYY R;  3FXD B;  2LHR A;  2LE8 A;  5DQV A;  4H9O C;  3ANW B;  1BR0 A;  2AXD S;  2QGS A;  2IDO B;  1XNQ T;  4O4J E;  2C5I T;  4IE5 A;  3SRZ A;  2BZB A;  5IUX A;  2W2U A;  1MND A;  1D0X A;  1HCI A;  1VCS A;  2DWG A;  5AQK B;  5L3C B;  4DUZ T;  1JNZ A;  3FBZ A;  1NEN A;  5LA6 E;  2A2F X;  3PU8 A;  2AE9 A;  3K8P C;  3RQU A;  2BG9 B;  3KV9 A;  2CLY B;  3A8Y C;  4PJM A;  3AA0 B;  2WU5 A;  2X66 A;  1MIY A;  2OLT A;  1W0A A;  1T7S A;  2W66 A;  2QVA A;  4IDQ A;  3ZCJ A;  3NZP A;  5LMN T;  2BG9 C;  3QNU A;  2CLY C;  4YTP A;  3P4S A;  2LKG A;  5HWX A;  1S35 A;  3EAB A;  4WBN E;  5FXV A;  1SHZ C;  4EGW A;  1YQ4 A;  4HFI A;  4O2A E;  4JV5 T;  1GQE A;  4PK4 A;  3AEE A;  3SWH A;  4LF4 T;  4HTE A;  5AQS B;  2BBH A;  2VQE T;  4IL9 A;  2DI4 A;  4ZZB A;  3KVB A;  3AE7 A;  4HWD A;  3AEF A;  4CXX A;  4JLE A;  5C8Y E;  3AVR A;  2H88 A;  4YLH A;  4XBF B;  3Q5X A;  2LSI A;  4ZZC A;  4QXH B;  5A1L A;  2LT3 A;  3D0T A;  4ADZ A;  4MBQ A;  5EK2 A;  4JI6 T;  1FIO A;  5HYA A;  4DUY T;  4O4I E;  2ZMA A;  2MBG A;  2I59 A;  4I4T E;  4AQF A;  1XMO T;  3AAA B;  4I50 E;  1B7T A;  2VVS A;  4HE8 A;  2XQ4 A;  4ZI7 E;  5LGN B;  3V5S A;  5ETW A;  4HWC A;  2XQ7 A;  3VRB A;  3N9Q A;  3AXJ A;  2M6I A;  2PFV A;  3MZK B;  2XHE B;  4AKL A;  3F31 A;  1T8B A;  3RYI E;  2XY8 B;  4EIW A;  3RYH E;  5AFU L;  2WM9 A;  1LVF A;  3U3I A;  2DL1 A;  5F3J A;  4ZI2 D;  1R8I A;  1KK7 A;  4QXB B;  1IBL T;  2YKS A;  5GON E;  5AQT B;  2YN6 A;  5ABF B;  2J4G A;  3AE2 A;  4YSX A;  3HKE E;  2CXD A;  2XQA A;  2FJA A;  4HFE A;  5CA0 E;  3MA9 A;  2KLQ A;  3TLU A;  4JEU B;  2PG8 A;  3PUR A;  2F4V T;  5LHG B;  4AIU A;  3KV6 A;  3KV5 A;  2VAS A;  4ZI3 C;  1FEW A;  2LJL A;  4U33 A;  5FY1 A;  5CJ5 A;  5ABH A;  4BJN A;  4LML A;  4IDZ A;  2VQF T;  1KNZ A;  3ZT5 A;  3CX8 B;  4JI1 T;  3PU3 A;  4YSZ A;  3I1A A;  4ZOL E;  4GYS A;  4NPP A;  3UT5 E;  4E7S A;  3LJC A;  4DV2 T;  1HNZ T;  4UVB B;  4EV6 A;  1M62 A;  1KFY A;  3JAD A;  5JRC A;  4PJJ A;  4JI5 T;  5J0Z A;  3OKQ A;  1W9R A;  2MPK A;  4TV8 E;  3CVR A;  4OFZ A;  5LXT E;  1BR2 A;  3N2G E;  4COF A;  2CE7 A;  3ZEF B;  3RIA A;  3NVO A;  5L2L A;  4PK6 A;  4UEM A;  1FJG T;  4X62 T;  2E8I A;  1MIV A;  3RIU A;  2Q9Q D;  3AVS A;  3PDY A;  2WAU A;  4L9I A;  1D1A A;  4QWN B;  1HG5 A;  2E9X D;  4E7Z A;  2CXL A;  2Q9Q A;  3QK6 A;  3GMI A;  1YD8 G;  2SPC A;  2E9X A;  4EZH A;  3BQL A;  3PUG A;  2JMH A;  3C50 A;  3LBX A;  3DP7 A;  3ZJ1 A;  3GN5 A;  4HKA A;  2XAF B;  2YU2 A;  5LCY A;  4EXT A;  3MJX A;  5LG3 A;  3ONX A;  5AQN B;  3BQI A;  3ZPO A;  1E7P A;  2X9W A;  3QOF A;  4IE6 A;  1E1H B;  1D0Z A;  5JDN A;  1XDP A;  3NRY A;  3T8O A;  2OA5 A;  2XZE A;  4TWD A;  1WR0 A;  4LFB T;  1CHU A;  5FXZ A;  2Y48 B;  5FP3 A;  2QA7 A;  2FJB A;  2BVM A;  5AQL B;  2K48 A;  5HXC A;  5L3F B;  3HKB E;  2CXF A;  1IBM T;  2V7M A;  1V9D A;  4B3R T;  2FJD A;  5HEJ A;  3KFW X;  1JNR A;  2ACZ A;  2XQ5 A;  5LYJ E;  3H37 A;  4JI2 T;  3Q5D A;  3IA3 A;  4U3C A;  2WS3 A;  1OED A;  3AE5 A;  4CXW A;  4DR1 T;  3AE9 A;  4BAY B;  4YHH T;  3T1Y T;  2VKH A;  3RF1 A;  3WI3 A;  3NKZ A;  4PJL A;  2M67 A;  3IF8 B;  2VL8 A;  5FXW A;  3UU8 A;  2KWI B;  2W62 A;  2LM2 A;  5DJQ C;  3L3P A;  5FYM A;  1HG2 A;  2ZM8 A;  3FHN A;  1BR4 A;  1N32 T;  4CN4 A;  3E08 A;  1OED E;  3NRX A;  3N5L A;  4NXN T;  2CBJ A;  4GKJ T;  1UGO A;  2V7L A;  2X51 A;  5FVK A;  3W15 B;  3MK7 C;  2XQ6 A;  4PJN A;  2NTY A;  5DQW A;  5ADX L;  5AQI B;  1S94 A;  4UVC B;  3TLW A;  4TWH A;  1UCU A;  2W67 A;  3RHW A;  3RPU A;  3ZCI A;  3RQW A;  3FZM B;  3PV0 F;  5KDM C;  5LBQ B;  4DV6 T;  3X1D A;  4TUY E;  1HNX T;  5H6Q B;  2DHR A;  5FL1 A;  3PTR B;  4PFP A;  5TAO A;  4Z8X A;  4YY3 T;  3AAE B;  2HN1 A;  3SFE A;  4ISS A;  4IGU A;  1QLB A;  3PUW F;  2Y8D A;  1FMV A;  4HWI B;  2ODV A;  2KXP B;  3UUX B;  3ZYL A;  4PAG A;  3ESL A;  4KI0 F;  3JAE A;  5IYZ E;  5JVD E;  4A98 A;  2YDQ A;  2QRX A;  5DAB A;  1W09 A;  2XQ8 A;  1AJ3 A;  2A72 A;  4YT0 A;  3JC6 C;  4OYJ A;  1D0Y A;  2XJ7 A;  3O1H A;  4PK5 A;  4DVD A;  2LHN A;  4DV7 T;  2XQ9 A;  4EOZ B;  2H89 A;  2ZM6 T;  4ZXL A;  1L0V A;  2VWA A;  3CX6 B;  1WYB A;  5AQU B;  3PUX F;  4K0K T;  1EZ3 A;  4IRE A;  2L3L A;  3N2O A;  4OYK A;  2X9Y A;  4YSY A;  3RKO A;  3NWI A;  4I0U A;  2W63 A;  4A5X A;  3I9Y A;  3I0Q A;  5JRC B;  4H9Q C;  4HWH A;  2KZ7 B;  4ZHQ E;  2JQH A;  2X67 A;  2D2S A;  3K1S A;  3LK4 2;  4JI0 T;  5AQJ B;  3SS1 A;  5JTG A;  2IIU A;  4CN6 A;  3UU6 A;  1T72 A;  3ONL C;  5L3E B;  5AQO B;  5KXJ A;  5LJM A;  5LOV E;  2H7V C;  3MXZ A;  3EHZ A;  4ZS2 A;  1XWM A;  3IEE A;  1MNE A;  4CI2 B;  1YQ3 A;  4X64 T;  2NP9 A;  4O8S A;  3LDQ B;  2IC6 A;  2CPT A;  3PUS A;  2C0S A;  4DO0 A;  5LMU T;  3LBX B;  5FY7 A;  4LFC T;  2BDE A;  1HFA A;  4DMW A;  4FJO A;  4U31 A;  3K3Q C;  5AQQ B;  4AXP A;  1VOM A;  2NW9 A;  2FJE A;  2LSG A;  5EZY E;  5LNK A;  3SFD A;  3LK3 B;  3JCF A;  2VB6 A;  4U7Y A;  3I9W A;  2OV9 A;  1G8X A;  2XAG B;  4DV0 T;  1OWA A;  2I6H A;  3O1J A;  1HTJ F;  4U2Y A;  2LSK A;  4HFB A;  4PFO A;  3RRW A;  1WYC A;  5E0O A;  4AKR B;  2XM2 A;  1U4Q A;  5LGU B;  4QKN A;  5L3B B;  3ZYM A;  2XAS B;  2VL0 A;  1HF8 A;  2GK9 A;  3CQX C;  2X0Y A;  4ILA A;  3AE6 A;  2V6X A;  1OXZ A;  4DBR A;  2WDV A;  2A3D A;  3B57 A;  3ONJ A;  3P4R A;  2PTF A;  5LJN A;  3J9X 1;  4CI3 B;  5FY0 A;  2LKH A;  5F5W A;  3GWH A;  2HPL A;  3LFM A;  3O1I A;  3ZC0 A;  2X0L B;  4AI6 A;  2N9D A;  2CHO A;  3C4X A;  2V1D B;  2V6Y B;  3AA7 B;  4UEL A;  4YJ3 E;  3AB3 B;  1E2A A;  4DV1 T;  3EAM A;  2LEH A;  2WBL A;  2KMF A;  4H63 H;  5IWA T;  1IJ5 A;  2LOS A;  3O4X E;  4X20 E;  4UXN B;  2UUA T;  1M7K A;  2C5K T;  4O4L E;  3CQC B;  4C91 A;  2VUR A;  3BK9 A;  5BMV E;  2N2N A;  2NR4 A;  3ZJ2 A;  2K24 A;  3CX7 B;  1O3X A;  1IAP A;  1QUU A;  3LK2 B;  3R84 B;  3KDS E;  1ZKE A;  4G2A A;  1KNR A;  4X5T A;  4KUM B;  2NW8 A;  2RP4 A;  4DND A;  2CWO A;  3P50 A;  4B3S T;  4GIW A;  4EED A;  4IE0 A;  2UUB T;  2DNX A;  2UXD T;  4TN7 B;  4H63 V;  5HEO A;  3QB5 K;  4IT4 A;  3FZH B;  3PE0 A;  1ZV4 X;  2X9X A;  4Z90 A;  2UXB T;  5JR9 B;  2XUE A;  3WAJ A;  2BBJ A;  1YW0 A;  4MLK A;  4B6X A;  3ZLI A;  4UF0 A;  2EHO B;  4IST A;  5F8P A;  5HEG A;  1MMA A;  5L3G B;  4GOU A;  5JR9 C;  2BKO A;  5HXR A;  2G0U A;  3ANW A;  5HEU A;  5JDQ A;  2EHO C;  2H3R A;  2QYW A;  2UXC T;  4X66 T;  3EVY A;  4HFD A;  3VHL A;  2DLR A;  2YDR A;  4X1Y E;  3EDU A;  5M4Y A;  2YU1 A;  4DID B;  2V5C A;  3PUZ F;  4AQY T;  4F8H A;  3C51 A;  1N33 T;  4GKK T;  4QH4 A;  2V8S V;  3N9M A;  2MAW A;  4ILU A;  5HCJ A;  1CUN A;  3JAF A;  1UUR A;  3RIF A;  4CQI A;  2ZLY A;  3P7I A;  2D0U A;  4P0A A;  3KBU A;  4TV9 E;  2BS2 A;  4DV5 T;  4TX5 A;  3RYC E;  2WY2 A;  4QHO A;  1IBK T;  2DCF A;  1UUS A;  5HAX A;  3PUA A;  4DV3 T;  3IHR A;  1US7 B;  4MAL A;  2LSJ A;  3AA6 B;  3RX6 A;  3OYZ A;  2BS3 A;  4HFV A;  3AEG A;  3CIR A;  5JDL A;  1WFD A;  4AIS A;  5HEH A;  4ILC A;  2BG9 E;  4B3M T;  3UFE A;  3R6N A;  3F57 A;  2XQY A;  4UIG A;  3B13 A;  3N9N A;  5JDG A;  4KHP T;  3C98 B;  4YTN A;  2WWV A;  4GK0 E;  2MYS A;  2X0H A;  4TWF A;  1D1B A;  4KX6 A;  2MOZ A; 
#chains in the Genus database with same CATH homology
 5DAB A;  4HTE A;  4G63 A;  1AJ3 A;  2A72 A;  4AKG A;  2B1E A;  1VRB A;  3JC6 C;  2HPJ A;  3ZMU B;  4OYJ A;  2DI4 A;  2XTL A;  3KVB A;  3RC3 A;  1D0Y A;  1YKH B;  3UUL A;  2W0G A;  4CXX A;  3O1H A;  4PK5 A;  3N9O A;  2LHN A;  3UUN A;  4DVD A;  4EYU A;  2N1G A;  4EOZ B;  4JLE A;  5L3D B;  1YKE B;  5C8Y E;  2ODU A;  3AVR A;  4P09 A;  4YLH A;  1FMW A;  2P9B A;  2ACX A;  2VWA A;  3NBX X;  3HI2 A;  3CX6 B;  3ETV A;  4XZC A;  1WYB A;  4OHF A;  2YIN A;  5FXX A;  1EZ3 A;  2L3L A;  3N2O A;  2W00 A;  4OYK A;  2X9Y A;  4XBF B;  4U74 A;  3RKO A;  2YEV C;  3Q5X A;  5J2U E;  2LSI A;  2BVL A;  4QXH B;  1ZHC A;  5A1L A;  2LT3 A;  3D0T A;  4ADZ A;  3VU7 H;  3O9X A;  4MBQ A;  5EK2 A;  3OYX A;  2W63 A;  4QX7 B;  2PJQ A;  3I9Y A;  4MHC A;  3FB2 A;  1FIO A;  5IHY A;  3I0Q A;  5HYA A;  1HX8 A;  1X79 A;  1NAF A;  2D0T A;  2ZMA A;  4O4I E;  2MBG A;  4H9Q C;  4ANJ A;  2KZ7 B;  4ERR A;  5JRC B;  2I59 A;  2J1D G;  3MAC A;  4I4T E;  4KBM B;  3NZQ A;  4AQF A;  3AAA B;  2ES0 A;  4I50 E;  4ZHQ E;  1B7T A;  4HE8 A;  4KP3 C;  2X67 A;  4ZI7 E;  2XAJ B;  3C4W A;  3UUM A;  5LGN B;  2D2S A;  3V5S A;  5ETW A;  2L9Q A;  3N9Q A;  5HWY A;  3LK4 2;  2PFV A;  4I43 B;  3MZK B;  4EB6 E;  3SS1 A;  2XHE B;  4UVA B;  4AKL A;  3F31 A;  2UXN B;  3RYI E;  2V7I A;  3ZN1 B;  5L3E B;  1SA0 E;  1MMN A;  2XAQ B;  4EIW A;  5HXE A;  3RYH E;  5LJM A;  5AFU L;  5LOV E;  2WM9 A;  2H7V C;  3MXZ A;  1LVF A;  4ZS2 A;  3U3I A;  3U78 A;  3IEE A;  1UX4 A;  5F3J A;  4ZI2 D;  2YK0 A;  4ZI3 D;  1MNE A;  4AQF C;  4CI2 B;  4WW0 A;  1KK7 A;  4N78 D;  4QXB B;  2NP9 A;  4O8S A;  4PNI A;  4DBQ A;  3EDV A;  2IC6 A;  2NWB A;  5GON E;  3PUS A;  2C0S A;  4DO0 A;  1LVK A;  4QXC B;  3LBX B;  5FY7 A;  4CI1 B;  2BDE A;  3ETU A;  1HFA A;  3N2K E;  4J2C A;  1WR6 A;  2CA5 A;  2CEA A;  4DMW A;  4FJO A;  2CM0 A;  3K3Q C;  3ZMZ B;  3MKD A;  3HKE E;  4AXP A;  1VOM A;  2CXD A;  2X68 A;  2NW9 A;  2HH7 A;  4L0R A;  2LSG A;  5CA0 E;  5EZY E;  2K9A A;  5LNK A;  3CML A;  3Q9D A;  4GYR A;  3MA9 A;  2ZM0 A;  2X9H A;  3E0Z A;  3LK3 B;  2KLQ A;  1MIW A;  5J2T E;  1G73 A;  2VB6 A;  3FBL A;  4JEU B;  2PG8 A;  3I9W A;  2VK9 A;  3PUR A;  5LHG B;  1G8X A;  2XAG B;  3N9L A;  3KV6 A;  3KV5 A;  3RC8 A;  2VAS A;  4ZI2 C;  2Z6E A;  4ZI3 C;  1OWA A;  1FEW A;  5LHH B;  2LJL A;  4X1K E;  1LKX A;  5FY1 A;  3S4U A;  3J7Y q;  3RYF E;  3O1J A;  4BJN A;  1HTJ F;  2V26 A;  2LSK A;  4IDZ A;  3ZMT B;  4PFO A;  3RRW A;  1WYC A;  1KNZ A;  4O2B E;  5E0O A;  3HR0 A;  3CX8 B;  3ZN0 B;  4AKR B;  3PU3 A;  1U4Q A;  5LGU B;  3I1A A;  5JDF A;  3VKH A;  4ZOL E;  4U72 A;  2H7O A;  4QKN A;  5L3B B;  3L09 A;  3ZYM A;  2IC9 A;  1NWM X;  2XAS B;  4UV8 B;  5HXH A;  4GYS A;  5JH7 E;  3C64 A;  3UT5 E;  4A56 A;  1HF8 A;  2WSS V;  2GK9 A;  3CQX C;  4E7S A;  4YJ2 E;  3LJC A;  1OXZ A;  3SOL A;  4DBR A;  5FNV E;  4H9N C;  5KX5 E;  2A3D A;  3QC9 A;  3B57 A;  5JQG E;  3IBP A;  5LJN A;  3J9X 1;  4UVB B;  4C90 A;  4FI5 A;  2W61 A;  5JRC A;  4PJJ A;  3Q2M A;  4CI3 B;  2CMR A;  5FY0 A;  5CA1 E;  4EAH A;  3GWH A;  2KND A;  3OKQ A;  5H6R B;  4OK0 A;  2HPL A;  3LFM A;  3O1I A;  3ZC0 A;  1D1C A;  2X0L B;  4AI6 A;  3F2E A;  3RRC A;  4TV8 E;  2N9D A;  3KVA A;  3C4X A;  2V1D B;  3CVR A;  4OFZ A;  4YHJ A;  5LG4 A;  2V7J A;  1H7C A;  5LXT E;  3AA7 B;  1BR2 A;  3N2G E;  3WAK A;  2KT9 A;  2L8K A;  2CE7 A;  4UEL A;  3ZEF B;  4BA9 A;  3DTO A;  5FMN A;  5L2L A;  4PK6 A;  4UEM A;  4YJ3 E;  2E8I A;  3AA1 B;  1MIV A;  1MMD A;  3AB3 B;  2VKD A;  4EZ4 A;  5HXS A;  3CPZ A;  2Q9Q D;  2LEH A;  3AVS A;  3EUH A;  2WBL A;  2WAU A;  2WMN A;  3H3A A;  3PDY A;  1D1A A;  1ZEE A;  4HGA A;  4L9I A;  2KMF A;  4QWN B;  1HS7 A;  1HG5 A;  2E9X D;  4ASK A;  3GA8 A;  4DMV A;  3ZC1 A;  4E7Z A;  4H63 H;  1IJ5 A;  2CXL A;  2LOS A;  3O4X E;  4X20 E;  4UXN B;  2Q9Q A;  2LOP A;  3QK6 A;  3C4Z A;  2C5K T;  3GMI A;  1YD8 G;  4O4L E;  2SPC A;  2E9X A;  3CQC B;  5CB4 E;  4EZH A;  3BQL A;  3PUG A;  4AKH A;  2JMH A;  4C91 A;  3BK9 A;  5BMV E;  3C50 A;  2CWY A;  2N2N A;  3LBX A;  3DP7 A;  5KMG P;  3HKD E;  3ZJ2 A;  4AKI A;  2K24 A;  3ZJ1 A;  3GN5 A;  2ZM2 A;  4H9P C;  2Q9Q B;  3CX7 B;  1O3X A;  3QUJ A;  2LSY A;  2MTQ A;  3HL6 A;  1IAP A;  2PBI A;  3N9P A;  1QUU A;  3LK2 B;  4HKA A;  3R84 B;  2E9X B;  4MFR A;  3VKG A;  2XAF B;  5JRE A;  2C5J A;  2JMK A;  3KDS E;  5EK4 A;  4H9R C;  2XAH B;  1ZKE A;  2YU2 A;  1Z0P A;  4G2A A;  5LCY A;  5LGT B;  5JDM A;  3GN5 B;  4IIJ E;  4KUM B;  3Q5W A;  4O4H E;  3ZMS B;  4EXT A;  3CQG B;  3MJX A;  4L5G A;  4HN9 A;  3ONX A;  1U5P A;  4ZS3 A;  4JEH B;  2NW8 A;  2Q9Q C;  2RP4 A;  4DND A;  3BQI A;  4K0U A;  3ZPO A;  2X9W A;  2CWO A;  4IE6 A;  2E9X C;  1E1H B;  1D0Z A;  2NW7 A;  5JDN A;  3NRY A;  4GIW A;  3T8O A;  2OA5 A;  4IHJ E;  3KV4 A;  3K3N A;  4XAX B;  1IZN B;  2WWU A;  3CKD A;  3HKC E;  3K3O A;  4IE0 A;  4NUU A;  2DNX A;  3CWZ B;  5FXZ A;  2Y48 B;  3BQK A;  5FP3 A;  4F6R C;  1WLX A;  2QA7 A;  4NUV A;  2EHO D;  4TN7 B;  5JR9 A;  4H63 V;  4AQG A;  2BVM A;  3KIN B;  3OBV E;  2K48 A;  3AAI A;  3PE0 A;  2IAK A;  2VKJ A;  1ZV4 X;  2EHO A;  5HXC A;  4WNK A;  2X9X A;  3UTK A;  4I55 E;  5L3F B;  3ZMV B;  3HKB E;  2CXF A;  2LM9 A;  3ZYK A;  5JR9 B;  2V7M A;  3V5U A;  1V9D A;  2XUE A;  4UV9 B;  1WRD A;  2DWK A;  3KFW X;  3WAJ A;  2NOX A;  1YW0 A;  5LYJ E;  3H37 A;  4M1P A;  4MLK A;  4B6X A;  3ZLI A;  4BJM A;  4UF0 A;  1BR1 A;  2EHO B;  2JQQ A;  4IST A;  4X1I E;  4KMC A;  1T98 A;  3E22 E;  1Y64 B;  2KIN B;  3I0O A;  5F8P A;  2JPF A;  4CXW A;  3P8C D;  4CXY A;  4BAY B;  1MMA A;  4HEA A;  5L3G B;  2VKH A;  3WI3 A;  4GOU A;  5JR9 C;  1LRZ A;  4UF0 B;  5HXR A;  5JDH A;  2G0U A;  3ANW A;  1MMG A;  1UX5 A;  4PJL A;  2M67 A;  5JDQ A;  2EHO C;  2H3R A;  1IJ6 A;  3IF8 B;  2K5B B;  4EYY R;  4H9S E;  2VL8 A;  3FXD B;  3EVY A;  2LHR A;  2LE8 A;  5DQV A;  3VHL A;  4H9O C;  2DLR A;  5FXW A;  3ANW B;  1BR0 A;  3LG7 A;  4X1Y E;  2KWI B;  2W62 A;  3EDU A;  5M4Y A;  5DJQ C;  2YU1 A;  3L3P A;  2QGS A;  5FYM A;  4IE4 A;  1HG2 A;  2JRK A;  2ZM8 A;  3C51 A;  1BR4 A;  3FHN A;  3M65 A;  3HA4 A;  3E08 A;  4O4J E;  3RH3 A;  4WBO A;  2C5I T;  3N9M A;  4IE5 A;  3SRZ A;  2BZB A;  2VKO A;  3NRX A;  4ILU A;  3N5L A;  1CUN A;  2IW5 B;  2V7L A;  1MND A;  4P0B A;  4CQI A;  3PUQ A;  2X51 A;  2Y6X A;  2ZLY A;  3P7I A;  3OJA A;  2D0U A;  4P0A A;  2NTX A;  5LBM A;  3KBU A;  4TV9 E;  1D0X A;  1HCI A;  2DWG A;  5L3C B;  3W15 B;  3MK7 C;  3FBZ A;  4PJN A;  5DQW A;  2NTY A;  5LA6 E;  5ADX L;  2A2F X;  3PU8 A;  1S94 A;  4UVC B;  1UCU A;  3RPU A;  3ZCI A;  4TX5 A;  3RYC E;  4QHO A;  3K8P C;  1QSD A;  3KV9 A;  2DCF A;  2CLY B;  5J1G A;  4PJM A;  5HAX A;  3AA0 B;  3PUA A;  4QX8 B;  5KDM C;  2X66 A;  5LBQ B;  3IHR A;  1US7 B;  4MAL A;  1MIY A;  2LSJ A;  3AA6 B;  3RX6 A;  4V1A v;  4TUY E;  3OYZ A;  3KBT A;  5H6Q B;  4HFV A;  3ZCJ A;  3NZP A;  2DHR A;  3PTR B;  4PFP A;  4IE7 A;  5TAO A;  5JDL A;  2CLY C;  4Z8X A;  4YFS A;  2D5U A;  3JC6 D;  3AAE B;  3UFE A;  3R6N A;  3F57 A;  5EK3 A;  2XQY A;  4UIG A;  5HWX A;  3B13 A;  4ISS A;  4IGU A;  3N9N A;  2CCQ A;  4JUY A;  4TZ4 C;  2Y8D A;  5JDG A;  4CZZ B;  1S35 A;  1FMV A;  2RA1 A;  2KWH A;  3DJB A;  5FXV A;  1SHZ C;  4WBN E;  2ODV A;  2KXP B;  3C98 B;  3UUX B;  3A5X A;  4GK5 E;  3TKL B;  3ZYL A;  4PAG A;  3ESL A;  4GK0 E;  2MYS A;  2JJ9 A;  3FXE B;  4O2A E;  5LP6 E;  2UXX B;  2WMO A;  4PK4 A;  2V7K A;  4PW8 A;  5IYZ E;  5JVD E;  1D1B A;  3SWH A;  5LHI B;  2MOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...