4ZI3D

Bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
128
structure length
128
Chain Sequence
AEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 54
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi3D00
4ZI3D 4ZI2D 4ZI3C 4ZI2C 2K9AA
chains in the Genus database with same CATH superfamily
2JQQA 5HXEA 2CCQA 2QVAA 5ABGA 2BVMA 5ABEA 5HXHA 4WBOA 3P4WA 3OPCA 2V7KA 3UU6A 4TWHA 4TN7B 5L4EA 4I50E 4PFOA 4G2AA 1ZKEA 2DCFA 2KZ7B 3NZPA 4JI7T 3UUNA 4X5TA 1MIYA 3VKGA 5HWXA 4K0KT 2X51A 1BR4A 4E7SA 5JRCA 2FJBA 4FJOA 2CPTA 2I0MA 1BR0A 5FXWA 3BQLA 4HEAA 3MXZA 2CXDA 4L0RA 3P4RA 3KV9A 4H9RC 4DR2T 4KHZF 2LHRA 4JI6T 4NUVA 2W0GA 1J1JA 4YT0A 3LJCA 4TX5A 2D2SA 4IIJE 2VL0A 2C5IT 1MMGA 1D1BA 2QYWA 3HR0A 4IE4A 4AXPA 1UX5A 4AKLA 2KWHA 4YSYA 5LG4A 5FY7A 1YQ4A 4DV0T 4U74A 2ODUA 4B3MT 3I0QA 2YINA 3ANWB 2NWBA 4HKAA 2LEHA 5LJMA 4K0UA 2W67A 5FMNA 4KBMB 5EK2A 3RLFF 2ZM0A 5BR8T 4DR1T 5LP6E 5JDGA 2IUBA 4IL9A 5CFBA 4BJNA 1IBKT 3PDYA 4ZI2D 3ZMZB 2LKHA 1UX4A 1LVKA 3AA1B 1IAPA 3ETVA 1WR6A 4DR3T 4QKNA 3A5XA 2XQ9A 2L3LA 5E0OA 5EK3A 5AQOB 3ESLA 4X64T 2D5UA 4DR7T 4NXNT 3I1AA 2WWVA 3EVYA 2V6YB 4HFEA 4PJLA 2W63A 4A5XA 3P4PA 5AQPB 4DBQA 3PUVF 5JDLA 4EEBA 3AEFA 1OXZA 3K8PC 1FMWA 3OKQA 4A98A 5KXJA 5CJ5A 1QUUA 2Q9QB 4I0UA 2LJLA 2CEAA 4IDZA 5HEJA 5CA0E 3ZSTA 2LLYA 3RKOA 4LF6T 3CQCB 5LMNT 3X1DA 1W09A 3RX6A 4AKHA 3LBXA 4X1KE 4YJ2E 2VL8A 3ZC0A 4AISA 1D0ZA 3TLTA 4X65T 3A7MA 4ISTA 2E5VA 4PJMA 4P1NA 3FZHB 3KDSE 2V8SV 1L0VA 2LT3A 5JR9C 4L9IA 4C91A 2MYSA 3P50A 4TNWA 2XM1A 4PAGA 5JTGA 3TLSA 2X0YA 2EHOA 2VQET 5JDMA 3KINB 2J47A 2I6HA 2X0LB 4U2YA 4DR6T 1QSDA 3Q2MA 2NOXA 1N36T 2ZM6T 4WYVA 1N34T 2V26A 2E2AA 4ISSA 2XAJB 4X1IE 1H7CA 2A9UA 3RKGA 4H9OC 3AVRA 5JVDE 2UUBT 1KFYA 2J1DG 4TNVA 2CLYC 4IE7A 1WR0A 4UXNB 1OEDC 3ZSSA 2MBGA 4U2ZA 3KV6A 1IJ5A 2X0HA 4ZS3A 3RIAA 1CUNA 1FIOA 1Y01A 4EEDA 3AXJA 5KDMC 5KX5E 2KLQA 2OA5A 3AE5A 3KVAA 4YJ3E 2VWAA 2HN1A 5AQQB 4TUYE 4H9PC 4HN9A 2BG9E 5F5WA 5FXZA 4OHFA 2XJ7A 3TKLB 1J5ET 3PJAA 4KUMB 3UFGA 4DR4T 5LHGB 4JLEA 3ZCIA 1SE7A 1YQ3A 4JYAT 5HXRA 3O1IA 4XZCA 3AECA 3ZCJA 2XM2A 3ZT6A 4UF0B 3RRCA 4IDOA 1NENA 5J2TE 4U3CA 1D1CA 1XMOT 4YSZA 5LA6E 4UVAB 1KEYA 5HWYA 3ZT7A 5AQFB 2WZHA 3ZN0B 3U3IA 3OYXA 4CXYA 2LM2A 4BA9A 1ZHCA 1MIWA 1LKXA 4IREA 3NKZA 4GYRA 2VKOA 5AQLB 1KK7A 2N9DA 2D9DA 3EDUA 3LFMA 4GYSA 4CN4A 3CX6B 2H89A 2LSJA 4G63A 4CN6A 1N33T 4HE8A 3ONXA 4X62T 2ES0A 2CXFA 1G8XA 5AQKB 5JH7E 5LYJE 2DHRA 4HFCA 2IHR1 1VRBA 5HCJA 4MFRA 1R8IA 2VVNA 2JJ9A 1XWMA 4UR9A 4OYJA 1VOMA 3WI3A 2BKPA 4EV6A 3H37A 4KMCA 2N1GA 2HPLA 5J1GA 3UUBA 3ZMVB 2I59A 3UT5E 1WRDA 2YOEA 3S4UA 1B7TA 3O1JA 5LXTE 5GONE 2KMFA 3E22E 5FKYA 2RPAA 4HFVA 2NTYA 4YTPA 2XY8B 3AEEA 3QOFA 3O4XE 2UXXB 2VK9A 3C4XA 5LMUT 4WW0A 4OK0A 4JI4T 1SA0E 4X66T 4LFBT 1VCTA 2LM9A 1T7SA 1QLBA 2YDRA 3CVRA 2CHOA 3H3MA 2CE7A 5LBQB 5LHIB 3PTRB 3PU3A 1M7KA 3FBZA 1XDOA 3ZJ1A 2XQ5A 5AQJB 2XTLA 2UXNB 4PJNA 1IBMT 2X9XA 4PW8A 5L4HA 3ZLIA 2DLRA 3AE4A 3ONJA 4PK4A 4UVCB 3UU8A 2WS3A 2N2NA 3KBUA 4A97A 2W66A 1KNRA 4ZHQE 3AVSA 2BVLA 5EK4A 4ADZA 4EAHA 3W15B 2LSKA 2XSAA 4AQFA 4MALA 3ZN1B 3E0ZA 3UU3A 3N2KE 1FMVA 3SRZA 4IDQA 2XQ7A 3QNUA 4O4IE 3RIFA 3CIRA 5HYAA 3ZYMA 2XUEA 1NAFA 1N32T 2IC9A 4OFZA 3MJXA 2C5JA 2WCAA 3AEDA 4ANJA 3TLWA 4JI3T 5JQGE 3PJAJ 2LSIA 2E9XB 3NRXA 5LOVE 4IE6A 3SWHA 3IA3A 1T98A 3FB2A 4QH1A 2L9QA 3AEGA 4ZZBA 2DNXA 1G73A 3FZFB 2LHNA 4IT4A 4UEMA 3UU4A 4JUYA 1O3XA 2WDRA 2B1EA 3VRBA 2WDQA 3ONLC 3UU5A 5AQVB 2HPJA 5L3CB 4DV4T 1HFAA 1XNRT 5ABHA 4QWNB 4DIDB 2H3RA 2MTQA 3SFDA 3EI0A 3UUXB 2HHHT 4TWDA 1DU2A 2IIUA 3CQGB 4QX8B 4XAXB 3EUHA 2CWOA 2NTXA 1XMQT 3WAJA 1HNWT 4EYYR 3N9NA 5DQWA 4NIQA 3OYZA 4EZ4A 1D0XA 3ANWA 3PUQA 2Y8DA 3GWHA 4UELA 3P4QA 4ZI2C 3RQWA 2BDEA 1BR1A 4EYUA 2KWIB 2Q9QD 5HAXA 4AKIA 4F8HA 5AFUL 4QXHB 3QB5A 1WLXA 4IHJE 4ZI3D 4CN1A 2W4XA 2NW7A 3IF8B 5JDHA 1E1HB 3NWIA 2WBLA 3L3PA 2VASA 2H7VC 2LE8A 5AQMB 2E8IA 1ZOYA 2JPFA 4GK5E 4FI5A 2C5KT 3P8CD 2EHOC 2KSRA 1XNQT 3HKBE 1Z8UA 3OVUA 3Q5XA 2LSYA 5AQRB 5EZYE 3RH3A 3P7IA 4YHJA 2V6YA 3K3OA 1I6ZA 3BQKA 3T8OA 2BKOA 2V7JA 4I43B 4IDPA 1D0YA 3V5SA 2UU9T 1LRZA 4CI2B 1HTJF 2PBIA 4ZZCA 2BS2A 3PUXF 2H7OA 2L8KA 4P0BA 2NP9A 1OEDE 4Z90A 4NPPA 2Q9QA 4DV1T 4B3RT 3FXDB 4B3ST 2XQ3A 3RYCE 4QHOA 3FHNA 3N9MA 2UUAT 1U5PA 2NR4A 3ZJ2A 3M3ZB 2H88A 3N5LA 3K3QC 2CWYA 1T8BA 3GN5B 3N2OA 4YXDA 4V1Av 4O4JE 4HGAA 4ERRA 3C51A 2YU1A 4IDNA 3HI2A 2AE9A 5JR9B 2FUPA 4ZS2A 2V6XA 4GOUA 3JC6D 2WZIA 2A72A 2IAKA 5HEOA 5JDQA 2VVSA 2W00A 3Q5DA 4JI8T 2JRKA 3UQ7A 4DMWA 4P09A 3SS1A 2ZLYA 2LRKA 4BAYB 4WNKA 4MBQA 2XHEB 2ACZA 4DMVA 3RC3A 4ZXLA 5AQUB 2VB6A 5AQNB 2JMHA 1E2AA 2CXLA 1CHUA 3Q5WA 1MNEA 3N9LA 4YHHT 2CLYB 5DABA 2WSSV 2DWKA 3RYHE 2GK9A 2VKHA 4WZXA 4ILBA 5JDFA 4PNIA 4BJMA 4H9SE 3F2EA 4B3TT 2ACXA 3QK6A 4JI2T 2Z6EA 2CA5A 4UIGA 2CHNA 2WAUA 2DWGA 1FJGT 1MMAA 4AQYT 2JQ9A 2WMOA 3LK3B 4QH5A 1AJ3A 3AAAB 3CMLA 5HCMA 3ZYKA 2M6IA 3JCFA 3FZKB 1JNRA 5J2UE 4AKGA 4J2CA 2CRBA 4COFA 1HNXT 3JAFA 5IYZE 3HKCE 4UF0A 2XAHB 1YKHB 3UULA 2WDVA 3FXEB 1XZYA 2W2UA 5JRCB 4HWDA 2XQ4A 2MPKA 4DBRA 3PV0F 4PK6A 3RYIE 2K5BB 4U7IA 2YKSA 4HFBA 4TV8E 3RQUA 1HF8A 2PFVA 2VQFT 2X9WA 1GQEA 1Z0PA 2BG9B 3MK7C 3E08A 3N9PA 2CMRA 2BS4A 5LGUB 4U31A 3F31A 2VKJA 2XAQB 3CQXC 3L39A 1MMDA 3PUAA 2BBHA 4LMKA 1IZNB 3O9XA 3KV5A 4AQGA 5ETWA 2ZM2A 5HXSA 4JV5T 2BG9A 4GKKT 5CA1E 1W0AA 2RP4A 3R84B 5CGMA 3C4ZA 4O8SA 2G0UA 3P4SA 4JEHB 4H63H 2UUCT 5ABFB 3QC9A 3U78A 2Y48B 3PU8A 4GK0E 3RIUA 2A3DA 4I55E 2YK0A 2IDOB 2W62A 3GA8A 4YTNA 3J9X1 2XZEA 3SFEA 3ZKRA 4DV6T 5L3EB 1NEKA 3AE9A 4CI1B 5AQSB 2V7MA 2XASB 4AQFC 4Z91A 3AEAA 2A2FX 3HL6A 4UV9B 4WBNE 1W9RA 4B6XA 3KV4A 4JBWF 2WQYA 3RF1A 1FEWA 3V5UA 2XAFB 4LMJA 2X68A 5FNVE 2JIWA 2KINB 1S94A 3M65A 1J5WA 4O4LE 4EB6E 1V9DA 3BK9A 1HX1B 4YFSA 3UFEA 4TV9E 4IE5A 1ZP0A 4YLHA 5LCYA 4CXWA 3N9OA 2XSBA 4LF4T 3CX8B 4PK5A 3IBPA 3UQ4A 5FL1A 1OWAA 2JMKA 2SPCA 2FJDA 2E5LT 1WCRA 5IWAT 3PURA 5AQHB 3Q9DA 4HFIA 5L3DB 2E9XD 4H63V 3KFWX 4DV2T 1VCSA 4EXTA 1XDPA 1YW0A 4KHPT 5LGNB 2QRXA 3CX7B 4ILAA 5TAOA 3AA0B 4YY3T 3EDVA 2XQ6A 3B13A 4AKRB 2LRLA 3UUMA 3ZEFB 3T1YT 1UGOA 1YD8G 2YDQA 5LB7B 2V7LA 5H6QB 4U7YA 2CM0A 5LGTB 4Q25A 2QGSA 5J0ZA 3ZMUB 3AAEB 4PFPA 3ZMSB 3FZMB 1U4QA 4ZI7E 5C2TA 4KP3C 5BMVE 2JQKA 3OBVE 1WFDA 2C0SA 1HG5A 2KNDA 4JI5T 2XQYA 5LG3A 4LF5T 3RI5A 2E9XA 5AQTB 3I9WA 3CKDA 2LSGA 3AE2A 2PTFA 3L09A 1ZV4X 3MA9A 1LVFA 2DI4A 4XBFB 2QA7A 3J7Yq 4EZHA 4TZ4C 4DUZT 2IC6A 1KF6A 3VRAA 2MAWA 1MNDA 4CXXA 4LF8T 1BR2A 4HWHA 2JQHA 4A56A 5L47A 3AB3B 1UCUA 5FVKA 3HKDE 4ZOLE 5AQIB 4QXBB 5FL0A 3I9YA 3T1HT 4JI0T 3GMIA 3DJBA 2K24A 4DUYT 4KX6A 3VKHA 1M62A 3ZT5A 3NRYA 1JNZA 2D0UA 4O2AE 4MLKA 5FVLA 2Q9QC 2YN6A 5HEUA 3RC8A 2M67A 2MOZA 2VKDA 4H9NC 2XPKA 2ZMAA 3EHZA 2J62A 3C64A 4IGUA 4ZI3C 4UV8B 2BS3A 2YU2A 3RRWA 3Q5EA 2D0TA 3LK42 3VU7H 3AE7A 5FY0A 2YEVC 2EHOD 5F3JA 3A8YC 2UXCT 2OV9A 4E7ZA 3LBXB 4YSXA 1US7B 3K3NA 4AIUA 4U33A 4L5GA 5FP3A 3KVBA 2V1DB 4HFHA 4N78D 3ZYLA 3VR8A 5H6RB 2EHOB 2DL1A 3SOLA 4DV5T 2V5CA 5L3GB 3RPUA 4PJJA 3RYFE 2F4VT 2BKNA 2CBJA 3FZLB 1KNPA 4HWFA 4O4HE 4I4TE 3PE0A 4QXCB 2UXDT 1X9BA 2CBIA 4GKJT 4O2BE 1WYCA 5JREA 4LF7T 3ETUA 3QB5K 5L2LA 3D0TA 4TWFA 1SHZC 2NW8A 3NBXX 5LJNA 2X66A 4Z8XA 1UUSA 2AXDS 3EAMA 2WY2A 3DTOA 2K9AA 3AA6B 2BZBA 3AXJB 5HEGA 4P0AA 1HG2A 1WYBA 3L8RA 3TLVA 2FJEA 4LFCT 2YDSA 3GN5A 1SUMB 5IUXA 3JC6C 5KMGP 5LHHB 1HNZT 1MIVA 3LK2B 2X67A 3K1SA 5JDNA 4JEUB 4DV7T 1HR0T 2XQAA 3NZQA 5HXCA 3ZC1A 1IJ6A 5JR9A 2FBWA 1Y64B 3CK6A 2PG8A 4LF9T 1OEDB 3MACA 2WU2A 3RGLA 2RA1A 3EABA 3CPZA 4F6RC 5C8YE 4OX9T 2WP9A 3HA4A 1HCIA 2LKGA 5DJQC 2V7IA 4EOZB 1X79A 5FXXA 3JAEA 1HX8A 1W0BA 4CI3B 5IHYA 4UVBB 1OEDA 1ZEEA 4HWCA 5C3JA 4ZEYA 2V5DA 2ODVA 5CB4E 1I94T 2UXBT 2ZM8A 3PUYF 5A1LA 2LOPA 4U72A 3VHLA 1UURA 3H3AA 1S35A 2X9HA 1UK5A 2BG9C 4KI0F 3C98B 5L3FB 5DQVA 4JI1T 4DNDA 3CWZB 3AA7B 3B5MA 4LFAT 3NVOA 3N9QA 3OTOT 3AE1A 3LDQB 4C90A 1YKEB 3PUWF 4DV3T 2KXPB 3RIUC 2IMLA 5HEHA 5FY1A 3PUZF 4MHCA 1IBLT 2BBJA 5M4YA 3TLUA 3UTKA 1EZ3A 4DO0A 4DVDA 1D1AA 4IE0A 3AE3A 2WM9A 4LMLA 3AE8A 2K3WA 3IEEA 3O1HA 4ASKA 4M1PA 2NW9A 3BQIA 3AAIA 5L3BB 5F8PA 2K48A 4EGWA 3F57A 3G06A 4DR5T 3IHRA 3MKDA 3RHWA 2PJQA 2P9BA 4HTEA 3B57A 2WMNA 5LNKA 2FJAA 2X9YA 4HFDA 1YXRA 2B76A 2W61A 3N2GE 3R6NA 4CZZB 2WWUA 3LSVA 4GIWA 4YTMA 2M6BA 3PUGA 1KNZA 3HKEE 4ILCA 4EIWA 2WU5A 3VR9A 3LG7A 2LOSA 2XQ8A 2WB5A 5ABFA 3ZPOA 2VURA 3OJAA 3AEBA 2IW5B 4IL4A 4CQIA 3FBLA 3KBTA 3ZMTB 3AE6A 4HWIB 3DP7A 5FXVA 3I0OA 3JADA 4NUUA 3C50A 4AI6A 4X1YE 5FYMA 3C4WA 3WAKA 2KT9A 5ADXL 3PUSA 2HH7A 4OYKA 2J4GA 2R6GF 4H9QC 2HN2A 4NXMT 2OLTA 2Y6XA 4QX7B 3ABVA 1MMNA 4QH4A 4X20E 5AQGB 1HS7A 1T72A 5LBMA 4ILUA 2E9XC 1NWMX 2XAGB 3MZKB 3QUJA 1E7PA
chains in the Genus database with same CATH topology
2JQQA 2Q9QC 5HXEA 3H37A 2CCQA 4BAYB 4KMCA 4WNKA 2BVMA 2M67A 2MOZA 2N1GA 4MBQA 2VKDA 3RC8A 2XHEB 2HPLA 4H9NC 5HXHA 4WBOA 5J1GA 2ZMAA 4DMVA 3C64A 4IGUA 3RC3A 4ZI3C 2VB6A 2V7KA 2JMHA 3ZMVB 2CXLA 2I59A 3Q5WA 4UV8B 2YU2A 4TN7B 1WRDA 4I50E 4PFOA 3RRWA 3UT5E 1MNEA 3N9LA 3S4UA 2CLYB 2D0TA 5DABA 3LK42 2WSSV 2DWKA 4G2AA 3VU7H 1ZKEA 2DCFA 2KZ7B 2YEVC 3NZPA 5FY0A 1B7TA 3RYHE 3O1JA 2EHOD 2GK9A 2VKHA 3UUNA 5F3JA 4E7ZA 1MIYA 5GONE 3LBXB 2KMFA 3E22E 4PNIA 5JDFA 5LXTE 3VKGA 4BJMA 5HWXA 2X51A 4H9SE 4HFVA 3F2EA 1BR4A 4E7SA 1US7B 2NTYA 5JRCA 2ACXA 4FJOA 3K3NA 4L5GA 5FP3A 1BR0A 3KVBA 3QK6A 5FXWA 2V1DB 2Z6EA 3BQLA 4HEAA 2CA5A 3MXZA 2CXDA 4L0RA 4N78D 4UIGA 3ZYLA 3O4XE 3KV9A 2WAUA 2UXXB 2VK9A 2DWGA 4H9RC 3C4XA 4WW0A 4OK0A 1SA0E 5H6RB 1MMAA 2LHRA 2EHOB 2LM9A 3SOLA 2WMOA 3LK3B 4NUVA 2W0GA 3CVRA 3AAAB 1AJ3A 3CMLA 3RPUA 5L3GB 4PJJA 3RYFE 3LJCA 3ZYKA 2CE7A 4TX5A 5LBQB 5LHIB 2D2SA 3PTRB 5J2UE 4IIJE 2C5IT 3PU3A 4AKGA 1D1BA 1MMGA 4J2CA 3HR0A 4IE4A 3FBZA 4AXPA 1UX5A 4AKLA 2KWHA 4O4HE 4I4TE 3ZJ1A 3PE0A 4QXCB 5LG4A 5FY7A 2XTLA 4U74A 2ODUA 4O2BE 5IYZE 2UXNB 4PJNA 1WYCA 3I0QA 2YINA 3HKCE 5JREA 3ANWB 4UF0A 2X9XA 4PW8A 2XAHB 3ZLIA 1YKHB 2NWBA 4HKAA 3ETUA 3UULA 2DLRA 3FXEB 5L2LA 2LEHA 3D0TA 1SHZC 5LJMA 5JRCB 2NW8A 4K0UA 3NBXX 5LJNA 2X66A 4Z8XA 4PK4A 4UVCB 4DBRA 5FMNA 4KBMB 4PK6A 5EK2A 2N2NA 3RYIE 2K5BB 3KBUA 4TV8E 2ZM0A 1HF8A 3DTOA 4ZHQE 2K9AA 3AA6B 2PFVA 5JDGA 5LP6E 3AVSA 2X9WA 2BZBA 1Z0PA 3MK7C 2BVLA 5EK4A 1HG2A 4P0AA 1WYBA 4ADZA 4BJNA 3E08A 4EAHA 3W15B 3PDYA 3N9PA 2CMRA 2LSKA 4ZI2D 3ZMZB 5LGUB 3GN5A 1UX4A 4MALA 4AQFA 3ZN1B 1LVKA 3F31A 3AA1B 1IAPA 3ETVA 3JC6C 1WR6A 2VKJA 2XAQB 3CQXC 4QKNA 5KMGP 5LHHB 1MMDA 3A5XA 3E0ZA 3PUAA 3N2KE 1MIVA 3LK2B 1FMVA 3SRZA 2L3LA 2X67A 5E0OA 5EK3A 3ESLA 5JDNA 4JEUB 3NZQA 5HXCA 2D5UA 1IZNB 4O4IE 3O9XA 3KV5A 3ZC1A 1IJ6A 5JR9A 4AQGA 5HYAA 3I1AA 3EVYA 5ETWA 2ZM2A 1Y64B 5HXSA 3ZYMA 2XUEA 1NAFA 4PJLA 2W63A 2PG8A 2IC9A 4OFZA 5CA1E 2RP4A 4DBQA 3MJXA 2C5JA 3R84B 3MACA 3C4ZA 5JDLA 4O8SA 2G0UA 4JEHB 2RA1A 4H63H 1OXZA 4ANJA 3CPZA 1FMWA 3K8PC 3OKQA 4F6RC 5C8YE 3QC9A 3U78A 5JQGE 2Y48B 3PU8A 4GK0E 3HA4A 2LSIA 2E9XB 3NRXA 5LOVE 1QUUA 2A3DA 1HCIA 4I55E 4IE6A 2YK0A 3SWHA 5DJQC 2Q9QB 1T98A 3FB2A 2LJLA 2V7IA 2L9QA 2CEAA 4IDZA 4EOZB 1X79A 5CA0E 2W62A 5FXXA 2DNXA 3GA8A 3J9X1 1HX8A 4CI3B 1G73A 3RKOA 2LHNA 5L3EB 5IHYA 4UVBB 4UEMA 1ZEEA 3CQCB 4JUYA 4CI1B 3RX6A 2V7MA 4AKHA 2XASB 4AQFC 3LBXA 4X1KE 4YJ2E 1O3XA 2ODVA 2A2FX 2B1EA 3HL6A 2VL8A 5CB4E 3ZC0A 1D0ZA 2ZM8A 4UV9B 4WBNE 5A1LA 2HPJA 2LOPA 5L3CB 4ISTA 4B6XA 1HFAA 4PJMA 4U72A 3VHLA 3KV4A 3KDSE 4QWNB 2H3RA 2MTQA 5JR9C 2LT3A 1FEWA 3V5UA 2XAFB 3H3AA 4L9IA 4C91A 2MYSA 3UUXB 1S35A 2X9HA 2X68A 5FNVE 4PAGA 3C98B 5L3FB 2KINB 5DQVA 2EHOA 1S94A 3M65A 4DNDA 5JDMA 4P09A 3KINB 3CWZB 3AA7B 2X0LB 4O4LE 3N9QA 3CQGB 1QSDA 1V9DA 4QX8B 4XAXB 4C90A 3EUHA 4EB6E 1YKEB 3Q2MA 2CWOA 2NTXA 2NOXA 2KXPB 3WAJA 3BK9A 4YFSA 3UFEA 4EYYR 4TV9E 2V26A 4IE5A 4ISSA 3N9NA 4YLHA 5DQWA 5FY1A 5LCYA 4CXWA 3N9OA 4MHCA 5M4YA 3OYZA 2XAJB 4X1IE 3UTKA 1H7CA 1EZ3A 4DO0A 3CX8B 4PK5A 4DVDA 1D1AA 4H9OC 3AVRA 3IBPA 5JVDE 4EZ4A 1D0XA 1OWAA 3ANWA 3PUQA 2J1DG 2JMKA 2SPCA 2WM9A 4IE0A 2Y8DA 3GWHA 4UELA 3PURA 2CLYC 4IE7A 3IEEA 4ZI2C 3Q9DA 3O1HA 4UXNB 2BDEA 2E9XD 5L3DB 2MBGA 4H63V 1BR1A 3KV6A 3KFWX 4ASKA 4EYUA 4M1PA 4EXTA 2NW9A 3BQIA 3AAIA 2KWIB 2Q9QD 1YW0A 1IJ5A 5HAXA 4ZS3A 1CUNA 5LGNB 1FIOA 4AKIA 5AFUL 5L3BB 5F8PA 2K48A 4QXHB 3F57A 3CX7B 1WLXA 3IHRA 3MKDA 4IHJE 5KDMC 4ZI3D 5TAOA 5KX5E 2NW7A 2KLQA 3IF8B 2OA5A 5JDHA 2PJQA 1E1HB 3AA0B 2WBLA 3KVAA 3EDVA 4YJ3E 2P9BA 4HTEA 2VWAA 3B13A 3L3PA 2VASA 2H7VC 3B57A 2LE8A 4AKRB 2E8IA 2WMNA 2JPFA 4TUYE 3UUMA 4H9PC 5LNKA 4GK5E 2X9YA 3ZEFB 4FI5A 4HN9A 2C5KT 1YD8G 3P8CD 5FXZA 2EHOC 4OHFA 2V7LA 5H6QB 2W61A 3HKBE 3N2GE 3R6NA 3TKLB 4CZZB 2WWUA 4KUMB 2CM0A 5LGTB 3Q5XA 2LSYA 4GIWA 5EZYE 3RH3A 3PUGA 3P7IA 2QGSA 4YHJA 5LHGB 3ZMUB 3AAEB 1KNZA 4PFPA 3HKEE 4JLEA 3K3OA 3ZCIA 3ZMSB 1U4QA 4ZI7E 4EIWA 4KP3C 5HXRA 5BMVE 3O1IA 3BQKA 4XZCA 3OBVE 3T8OA 3LG7A 2LOSA 2C0SA 2V7JA 4I43B 1HG5A 3ZCJA 2KNDA 1D0YA 3V5SA 3ZPOA 3OJAA 1LRZA 4CI2B 1HTJF 2XQYA 4UF0B 2PBIA 3SS1A 2E9XA 3RRCA 2IW5B 3I9WA 3CKDA 4CQIA 3FBLA 2LSGA 2H7OA 2L8KA 4P0BA 2NP9A 5J2TE 3KBTA 2Q9QA 1D1CA 5LA6E 3ZMTB 3L09A 1ZV4X 3FXDB 3MA9A 4UVAB 1LVFA 2DI4A 4XBFB 2QA7A 5HWYA 3RYCE 3DP7A 4QHOA 3J7Yq 3FHNA 3N9MA 3I0OA 5FXVA 4TZ4C 4EZHA 1U5PA 4NUUA 3C50A 4AI6A 2IC6A 4X1YE 5FYMA 3ZJ2A 1MNDA 3C4WA 4CXXA 3ZN0B 3U3IA 3WAKA 3OYXA 4CXYA 2KT9A 3N5LA 4BA9A 1BR2A 3K3QC 1ZHCA 1MIWA 2CWYA 3GN5B 1LKXA 5ADXL 3N2OA 3PUSA 2HH7A 4A56A 4OYKA 4GYRA 2VKOA 1KK7A 3AB3B 2N9DA 3EDUA 4V1Av 3LFMA 4GYSA 4H9QC 1UCUA 4O4JE 4HGAA 4ERRA 3C51A 3HKDE 3CX6B 2YU1A 4ZOLE 3HI2A 4G63A 2LSJA 4QXBB 5JR9B 4HE8A 3ONXA 4ZS2A 2ES0A 3I9YA 4GOUA 2CXFA 1G8XA 5JH7E 2Y6XA 4QX7B 5LYJE 2DHRA 1MMNA 3JC6D 2A72A 3GMIA 3DJBA 2IAKA 2K24A 1VRBA 4MFRA 3VKHA 4X20E 1HS7A 5JDQA 2JJ9A 2W00A 5LBMA 4ILUA 4OYJA 3NRYA 1VOMA 2E9XC 3WI3A 2JRKA 1NWMX 2XAGB 3MZKB 3QUJA 4DMWA 2D0UA 4O2AE 4MLKA 2ZLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI3 D;  4ZI2 D;  4ZI3 C;  4ZI2 C;  2K9A A; 
#chains in the Genus database with same CATH topology
 2JQQ A;  5HXE A;  2CCQ A;  2QVA A;  5ABG A;  2BVM A;  5ABE A;  5HXH A;  4WBO A;  3P4W A;  3OPC A;  2V7K A;  3UU6 A;  4TWH A;  4TN7 B;  5L4E A;  4I50 E;  4PFO A;  4G2A A;  1ZKE A;  2DCF A;  2KZ7 B;  3NZP A;  4JI7 T;  3UUN A;  4X5T A;  1MIY A;  3VKG A;  5HWX A;  4K0K T;  2X51 A;  1BR4 A;  4E7S A;  5JRC A;  2FJB A;  4FJO A;  2CPT A;  2I0M A;  1BR0 A;  5FXW A;  3BQL A;  4HEA A;  3MXZ A;  2CXD A;  4L0R A;  3P4R A;  3KV9 A;  4H9R C;  4DR2 T;  4KHZ F;  2LHR A;  4JI6 T;  4NUV A;  2W0G A;  1J1J A;  4YT0 A;  3LJC A;  4TX5 A;  2D2S A;  4IIJ E;  2VL0 A;  2C5I T;  1MMG A;  1D1B A;  2QYW A;  3HR0 A;  4IE4 A;  4AXP A;  1UX5 A;  4AKL A;  2KWH A;  4YSY A;  5LG4 A;  5FY7 A;  1YQ4 A;  4DV0 T;  4U74 A;  2ODU A;  4B3M T;  3I0Q A;  2YIN A;  3ANW B;  2NWB A;  4HKA A;  2LEH A;  5LJM A;  4K0U A;  2W67 A;  5FMN A;  4KBM B;  5EK2 A;  3RLF F;  2ZM0 A;  5BR8 T;  4DR1 T;  5LP6 E;  5JDG A;  2IUB A;  4IL9 A;  5CFB A;  4BJN A;  1IBK T;  3PDY A;  4ZI2 D;  3ZMZ B;  2LKH A;  1UX4 A;  1LVK A;  3AA1 B;  1IAP A;  3ETV A;  1WR6 A;  4DR3 T;  4QKN A;  3A5X A;  2XQ9 A;  2L3L A;  5E0O A;  5EK3 A;  5AQO B;  3ESL A;  4X64 T;  2D5U A;  4DR7 T;  4NXN T;  3I1A A;  2WWV A;  3EVY A;  2V6Y B;  4HFE A;  4PJL A;  2W63 A;  4A5X A;  3P4P A;  5AQP B;  4DBQ A;  3PUV F;  5JDL A;  4EEB A;  3AEF A;  1OXZ A;  3K8P C;  1FMW A;  3OKQ A;  4A98 A;  5KXJ A;  5CJ5 A;  1QUU A;  2Q9Q B;  4I0U A;  2LJL A;  2CEA A;  4IDZ A;  5HEJ A;  5CA0 E;  3ZST A;  2LLY A;  3RKO A;  4LF6 T;  3CQC B;  5LMN T;  3X1D A;  1W09 A;  3RX6 A;  4AKH A;  3LBX A;  4X1K E;  4YJ2 E;  2VL8 A;  3ZC0 A;  4AIS A;  1D0Z A;  3TLT A;  4X65 T;  3A7M A;  4IST A;  2E5V A;  4PJM A;  4P1N A;  3FZH B;  3KDS E;  2V8S V;  1L0V A;  2LT3 A;  5JR9 C;  4L9I A;  4C91 A;  2MYS A;  3P50 A;  4TNW A;  2XM1 A;  4PAG A;  5JTG A;  3TLS A;  2X0Y A;  2EHO A;  2VQE T;  5JDM A;  3KIN B;  2J47 A;  2I6H A;  2X0L B;  4U2Y A;  4DR6 T;  1QSD A;  3Q2M A;  2NOX A;  1N36 T;  2ZM6 T;  4WYV A;  1N34 T;  2V26 A;  2E2A A;  4ISS A;  2XAJ B;  4X1I E;  1H7C A;  2A9U A;  3RKG A;  4H9O C;  3AVR A;  5JVD E;  2UUB T;  1KFY A;  2J1D G;  4TNV A;  2CLY C;  4IE7 A;  1WR0 A;  4UXN B;  1OED C;  3ZSS A;  2MBG A;  4U2Z A;  3KV6 A;  1IJ5 A;  2X0H A;  4ZS3 A;  3RIA A;  1CUN A;  1FIO A;  1Y01 A;  4EED A;  3AXJ A;  5KDM C;  5KX5 E;  2KLQ A;  2OA5 A;  3AE5 A;  3KVA A;  4YJ3 E;  2VWA A;  2HN1 A;  5AQQ B;  4TUY E;  4H9P C;  4HN9 A;  2BG9 E;  5F5W A;  5FXZ A;  4OHF A;  2XJ7 A;  3TKL B;  1J5E T;  3PJA A;  4KUM B;  3UFG A;  4DR4 T;  5LHG B;  4JLE A;  3ZCI A;  1SE7 A;  1YQ3 A;  4JYA T;  5HXR A;  3O1I A;  4XZC A;  3AEC A;  3ZCJ A;  2XM2 A;  3ZT6 A;  4UF0 B;  3RRC A;  4IDO A;  1NEN A;  5J2T E;  4U3C A;  1D1C A;  1XMO T;  4YSZ A;  5LA6 E;  4UVA B;  1KEY A;  5HWY A;  3ZT7 A;  5AQF B;  2WZH A;  3ZN0 B;  3U3I A;  3OYX A;  4CXY A;  2LM2 A;  4BA9 A;  1ZHC A;  1MIW A;  1LKX A;  4IRE A;  3NKZ A;  4GYR A;  2VKO A;  5AQL B;  1KK7 A;  2N9D A;  2D9D A;  3EDU A;  3LFM A;  4GYS A;  4CN4 A;  3CX6 B;  2H89 A;  2LSJ A;  4G63 A;  4CN6 A;  1N33 T;  4HE8 A;  3ONX A;  4X62 T;  2ES0 A;  2CXF A;  1G8X A;  5AQK B;  5JH7 E;  5LYJ E;  2DHR A;  4HFC A;  2IHR 1;  1VRB A;  5HCJ A;  4MFR A;  1R8I A;  2VVN A;  2JJ9 A;  1XWM A;  4UR9 A;  4OYJ A;  1VOM A;  3WI3 A;  2BKP A;  4EV6 A;  3H37 A;  4KMC A;  2N1G A;  2HPL A;  5J1G A;  3UUB A;  3ZMV B;  2I59 A;  3UT5 E;  1WRD A;  2YOE A;  3S4U A;  1B7T A;  3O1J A;  5LXT E;  5GON E;  2KMF A;  3E22 E;  5FKY A;  2RPA A;  4HFV A;  2NTY A;  4YTP A;  2XY8 B;  3AEE A;  3QOF A;  3O4X E;  2UXX B;  2VK9 A;  3C4X A;  5LMU T;  4WW0 A;  4OK0 A;  4JI4 T;  1SA0 E;  4X66 T;  4LFB T;  1VCT A;  2LM9 A;  1T7S A;  1QLB A;  2YDR A;  3CVR A;  2CHO A;  3H3M A;  2CE7 A;  5LBQ B;  5LHI B;  3PTR B;  3PU3 A;  1M7K A;  3FBZ A;  1XDO A;  3ZJ1 A;  2XQ5 A;  5AQJ B;  2XTL A;  2UXN B;  4PJN A;  1IBM T;  2X9X A;  4PW8 A;  5L4H A;  3ZLI A;  2DLR A;  3AE4 A;  3ONJ A;  4PK4 A;  4UVC B;  3UU8 A;  2WS3 A;  2N2N A;  3KBU A;  4A97 A;  2W66 A;  1KNR A;  4ZHQ E;  3AVS A;  2BVL A;  5EK4 A;  4ADZ A;  4EAH A;  3W15 B;  2LSK A;  2XSA A;  4AQF A;  4MAL A;  3ZN1 B;  3E0Z A;  3UU3 A;  3N2K E;  1FMV A;  3SRZ A;  4IDQ A;  2XQ7 A;  3QNU A;  4O4I E;  3RIF A;  3CIR A;  5HYA A;  3ZYM A;  2XUE A;  1NAF A;  1N32 T;  2IC9 A;  4OFZ A;  3MJX A;  2C5J A;  2WCA A;  3AED A;  4ANJ A;  3TLW A;  4JI3 T;  5JQG E;  3PJA J;  2LSI A;  2E9X B;  3NRX A;  5LOV E;  4IE6 A;  3SWH A;  3IA3 A;  1T98 A;  3FB2 A;  4QH1 A;  2L9Q A;  3AEG A;  4ZZB A;  2DNX A;  1G73 A;  3FZF B;  2LHN A;  4IT4 A;  4UEM A;  3UU4 A;  4JUY A;  1O3X A;  2WDR A;  2B1E A;  3VRB A;  2WDQ A;  3ONL C;  3UU5 A;  5AQV B;  2HPJ A;  5L3C B;  4DV4 T;  1HFA A;  1XNR T;  5ABH A;  4QWN B;  4DID B;  2H3R A;  2MTQ A;  3SFD A;  3EI0 A;  3UUX B;  2HHH T;  4TWD A;  1DU2 A;  2IIU A;  3CQG B;  4QX8 B;  4XAX B;  3EUH A;  2CWO A;  2NTX A;  1XMQ T;  3WAJ A;  1HNW T;  4EYY R;  3N9N A;  5DQW A;  4NIQ A;  3OYZ A;  4EZ4 A;  1D0X A;  3ANW A;  3PUQ A;  2Y8D A;  3GWH A;  4UEL A;  3P4Q A;  4ZI2 C;  3RQW A;  2BDE A;  1BR1 A;  4EYU A;  2KWI B;  2Q9Q D;  5HAX A;  4AKI A;  4F8H A;  5AFU L;  4QXH B;  3QB5 A;  1WLX A;  4IHJ E;  4ZI3 D;  4CN1 A;  2W4X A;  2NW7 A;  3IF8 B;  5JDH A;  1E1H B;  3NWI A;  2WBL A;  3L3P A;  2VAS A;  2H7V C;  2LE8 A;  5AQM B;  2E8I A;  1ZOY A;  2JPF A;  4GK5 E;  4FI5 A;  2C5K T;  3P8C D;  2EHO C;  2KSR A;  1XNQ T;  3HKB E;  1Z8U A;  3OVU A;  3Q5X A;  2LSY A;  5AQR B;  5EZY E;  3RH3 A;  3P7I A;  4YHJ A;  2V6Y A;  3K3O A;  1I6Z A;  3BQK A;  3T8O A;  2BKO A;  2V7J A;  4I43 B;  4IDP A;  1D0Y A;  3V5S A;  2UU9 T;  1LRZ A;  4CI2 B;  1HTJ F;  2PBI A;  4ZZC A;  2BS2 A;  3PUX F;  2H7O A;  2L8K A;  4P0B A;  2NP9 A;  1OED E;  4Z90 A;  4NPP A;  2Q9Q A;  4DV1 T;  4B3R T;  3FXD B;  4B3S T;  2XQ3 A;  3RYC E;  4QHO A;  3FHN A;  3N9M A;  2UUA T;  1U5P A;  2NR4 A;  3ZJ2 A;  3M3Z B;  2H88 A;  3N5L A;  3K3Q C;  2CWY A;  1T8B A;  3GN5 B;  3N2O A;  4YXD A;  4V1A v;  4O4J E;  4HGA A;  4ERR A;  3C51 A;  2YU1 A;  4IDN A;  3HI2 A;  2AE9 A;  5JR9 B;  2FUP A;  4ZS2 A;  2V6X A;  4GOU A;  3JC6 D;  2WZI A;  2A72 A;  2IAK A;  5HEO A;  5JDQ A;  2VVS A;  2W00 A;  3Q5D A;  4JI8 T;  2JRK A;  3UQ7 A;  4DMW A;  4P09 A;  3SS1 A;  2ZLY A;  2LRK A;  4BAY B;  4WNK A;  4MBQ A;  2XHE B;  2ACZ A;  4DMV A;  3RC3 A;  4ZXL A;  5AQU B;  2VB6 A;  5AQN B;  2JMH A;  1E2A A;  2CXL A;  1CHU A;  3Q5W A;  1MNE A;  3N9L A;  4YHH T;  2CLY B;  5DAB A;  2WSS V;  2DWK A;  3RYH E;  2GK9 A;  2VKH A;  4WZX A;  4ILB A;  5JDF A;  4PNI A;  4BJM A;  4H9S E;  3F2E A;  4B3T T;  2ACX A;  3QK6 A;  4JI2 T;  2Z6E A;  2CA5 A;  4UIG A;  2CHN A;  2WAU A;  2DWG A;  1FJG T;  1MMA A;  4AQY T;  2JQ9 A;  2WMO A;  3LK3 B;  4QH5 A;  1AJ3 A;  3AAA B;  3CML A;  5HCM A;  3ZYK A;  2M6I A;  3JCF A;  3FZK B;  1JNR A;  5J2U E;  4AKG A;  4J2C A;  2CRB A;  4COF A;  1HNX T;  3JAF A;  5IYZ E;  3HKC E;  4UF0 A;  2XAH B;  1YKH B;  3UUL A;  2WDV A;  3FXE B;  1XZY A;  2W2U A;  5JRC B;  4HWD A;  2XQ4 A;  2MPK A;  4DBR A;  3PV0 F;  4PK6 A;  3RYI E;  2K5B B;  4U7I A;  2YKS A;  4HFB A;  4TV8 E;  3RQU A;  1HF8 A;  2PFV A;  2VQF T;  2X9W A;  1GQE A;  1Z0P A;  2BG9 B;  3MK7 C;  3E08 A;  3N9P A;  2CMR A;  2BS4 A;  5LGU B;  4U31 A;  3F31 A;  2VKJ A;  2XAQ B;  3CQX C;  3L39 A;  1MMD A;  3PUA A;  2BBH A;  4LMK A;  1IZN B;  3O9X A;  3KV5 A;  4AQG A;  5ETW A;  2ZM2 A;  5HXS A;  4JV5 T;  2BG9 A;  4GKK T;  5CA1 E;  1W0A A;  2RP4 A;  3R84 B;  5CGM A;  3C4Z A;  4O8S A;  2G0U A;  3P4S A;  4JEH B;  4H63 H;  2UUC T;  5ABF B;  3QC9 A;  3U78 A;  2Y48 B;  3PU8 A;  4GK0 E;  3RIU A;  2A3D A;  4I55 E;  2YK0 A;  2IDO B;  2W62 A;  3GA8 A;  4YTN A;  3J9X 1;  2XZE A;  3SFE A;  3ZKR A;  4DV6 T;  5L3E B;  1NEK A;  3AE9 A;  4CI1 B;  5AQS B;  2V7M A;  2XAS B;  4AQF C;  4Z91 A;  3AEA A;  2A2F X;  3HL6 A;  4UV9 B;  4WBN E;  1W9R A;  4B6X A;  3KV4 A;  4JBW F;  2WQY A;  3RF1 A;  1FEW A;  3V5U A;  2XAF B;  4LMJ A;  2X68 A;  5FNV E;  2JIW A;  2KIN B;  1S94 A;  3M65 A;  1J5W A;  4O4L E;  4EB6 E;  1V9D A;  3BK9 A;  1HX1 B;  4YFS A;  3UFE A;  4TV9 E;  4IE5 A;  1ZP0 A;  4YLH A;  5LCY A;  4CXW A;  3N9O A;  2XSB A;  4LF4 T;  3CX8 B;  4PK5 A;  3IBP A;  3UQ4 A;  5FL1 A;  1OWA A;  2JMK A;  2SPC A;  2FJD A;  2E5L T;  1WCR A;  5IWA T;  3PUR A;  5AQH B;  3Q9D A;  4HFI A;  5L3D B;  2E9X D;  4H63 V;  3KFW X;  4DV2 T;  1VCS A;  4EXT A;  1XDP A;  1YW0 A;  4KHP T;  5LGN B;  2QRX A;  3CX7 B;  4ILA A;  5TAO A;  3AA0 B;  4YY3 T;  3EDV A;  2XQ6 A;  3B13 A;  4AKR B;  2LRL A;  3UUM A;  3ZEF B;  3T1Y T;  1UGO A;  1YD8 G;  2YDQ A;  5LB7 B;  2V7L A;  5H6Q B;  4U7Y A;  2CM0 A;  5LGT B;  4Q25 A;  2QGS A;  5J0Z A;  3ZMU B;  3AAE B;  4PFP A;  3ZMS B;  3FZM B;  1U4Q A;  4ZI7 E;  5C2T A;  4KP3 C;  5BMV E;  2JQK A;  3OBV E;  1WFD A;  2C0S A;  1HG5 A;  2KND A;  4JI5 T;  2XQY A;  5LG3 A;  4LF5 T;  3RI5 A;  2E9X A;  5AQT B;  3I9W A;  3CKD A;  2LSG A;  3AE2 A;  2PTF A;  3L09 A;  1ZV4 X;  3MA9 A;  1LVF A;  2DI4 A;  4XBF B;  2QA7 A;  3J7Y q;  4EZH A;  4TZ4 C;  4DUZ T;  2IC6 A;  1KF6 A;  3VRA A;  2MAW A;  1MND A;  4CXX A;  4LF8 T;  1BR2 A;  4HWH A;  2JQH A;  4A56 A;  5L47 A;  3AB3 B;  1UCU A;  5FVK A;  3HKD E;  4ZOL E;  5AQI B;  4QXB B;  5FL0 A;  3I9Y A;  3T1H T;  4JI0 T;  3GMI A;  3DJB A;  2K24 A;  4DUY T;  4KX6 A;  3VKH A;  1M62 A;  3ZT5 A;  3NRY A;  1JNZ A;  2D0U A;  4O2A E;  4MLK A;  5FVL A;  2Q9Q C;  2YN6 A;  5HEU A;  3RC8 A;  2M67 A;  2MOZ A;  2VKD A;  4H9N C;  2XPK A;  2ZMA A;  3EHZ A;  2J62 A;  3C64 A;  4IGU A;  4ZI3 C;  4UV8 B;  2BS3 A;  2YU2 A;  3RRW A;  3Q5E A;  2D0T A;  3LK4 2;  3VU7 H;  3AE7 A;  5FY0 A;  2YEV C;  2EHO D;  5F3J A;  3A8Y C;  2UXC T;  2OV9 A;  4E7Z A;  3LBX B;  4YSX A;  1US7 B;  3K3N A;  4AIU A;  4U33 A;  4L5G A;  5FP3 A;  3KVB A;  2V1D B;  4HFH A;  4N78 D;  3ZYL A;  3VR8 A;  5H6R B;  2EHO B;  2DL1 A;  3SOL A;  4DV5 T;  2V5C A;  5L3G B;  3RPU A;  4PJJ A;  3RYF E;  2F4V T;  2BKN A;  2CBJ A;  3FZL B;  1KNP A;  4HWF A;  4O4H E;  4I4T E;  3PE0 A;  4QXC B;  2UXD T;  1X9B A;  2CBI A;  4GKJ T;  4O2B E;  1WYC A;  5JRE A;  4LF7 T;  3ETU A;  3QB5 K;  5L2L A;  3D0T A;  4TWF A;  1SHZ C;  2NW8 A;  3NBX X;  5LJN A;  2X66 A;  4Z8X A;  1UUS A;  2AXD S;  3EAM A;  2WY2 A;  3DTO A;  2K9A A;  3AA6 B;  2BZB A;  3AXJ B;  5HEG A;  4P0A A;  1HG2 A;  1WYB A;  3L8R A;  3TLV A;  2FJE A;  4LFC T;  2YDS A;  3GN5 A;  1SUM B;  5IUX A;  3JC6 C;  5KMG P;  5LHH B;  1HNZ T;  1MIV A;  3LK2 B;  2X67 A;  3K1S A;  5JDN A;  4JEU B;  4DV7 T;  1HR0 T;  2XQA A;  3NZQ A;  5HXC A;  3ZC1 A;  1IJ6 A;  5JR9 A;  2FBW A;  1Y64 B;  3CK6 A;  2PG8 A;  4LF9 T;  1OED B;  3MAC A;  2WU2 A;  3RGL A;  2RA1 A;  3EAB A;  3CPZ A;  4F6R C;  5C8Y E;  4OX9 T;  2WP9 A;  3HA4 A;  1HCI A;  2LKG A;  5DJQ C;  2V7I A;  4EOZ B;  1X79 A;  5FXX A;  3JAE A;  1HX8 A;  1W0B A;  4CI3 B;  5IHY A;  4UVB B;  1OED A;  1ZEE A;  4HWC A;  5C3J A;  4ZEY A;  2V5D A;  2ODV A;  5CB4 E;  1I94 T;  2UXB T;  2ZM8 A;  3PUY F;  5A1L A;  2LOP A;  4U72 A;  3VHL A;  1UUR A;  3H3A A;  1S35 A;  2X9H A;  1UK5 A;  2BG9 C;  4KI0 F;  3C98 B;  5L3F B;  5DQV A;  4JI1 T;  4DND A;  3CWZ B;  3AA7 B;  3B5M A;  4LFA T;  3NVO A;  3N9Q A;  3OTO T;  3AE1 A;  3LDQ B;  4C90 A;  1YKE B;  3PUW F;  4DV3 T;  2KXP B;  3RIU C;  2IML A;  5HEH A;  5FY1 A;  3PUZ F;  4MHC A;  1IBL T;  2BBJ A;  5M4Y A;  3TLU A;  3UTK A;  1EZ3 A;  4DO0 A;  4DVD A;  1D1A A;  4IE0 A;  3AE3 A;  2WM9 A;  4LML A;  3AE8 A;  2K3W A;  3IEE A;  3O1H A;  4ASK A;  4M1P A;  2NW9 A;  3BQI A;  3AAI A;  5L3B B;  5F8P A;  2K48 A;  4EGW A;  3F57 A;  3G06 A;  4DR5 T;  3IHR A;  3MKD A;  3RHW A;  2PJQ A;  2P9B A;  4HTE A;  3B57 A;  2WMN A;  5LNK A;  2FJA A;  2X9Y A;  4HFD A;  1YXR A;  2B76 A;  2W61 A;  3N2G E;  3R6N A;  4CZZ B;  2WWU A;  3LSV A;  4GIW A;  4YTM A;  2M6B A;  3PUG A;  1KNZ A;  3HKE E;  4ILC A;  4EIW A;  2WU5 A;  3VR9 A;  3LG7 A;  2LOS A;  2XQ8 A;  2WB5 A;  5ABF A;  3ZPO A;  2VUR A;  3OJA A;  3AEB A;  2IW5 B;  4IL4 A;  4CQI A;  3FBL A;  3KBT A;  3ZMT B;  3AE6 A;  4HWI B;  3DP7 A;  5FXV A;  3I0O A;  3JAD A;  4NUU A;  3C50 A;  4AI6 A;  4X1Y E;  5FYM A;  3C4W A;  3WAK A;  2KT9 A;  5ADX L;  3PUS A;  2HH7 A;  4OYK A;  2J4G A;  2R6G F;  4H9Q C;  2HN2 A;  4NXM T;  2OLT A;  2Y6X A;  4QX7 B;  3ABV A;  1MMN A;  4QH4 A;  4X20 E;  5AQG B;  1HS7 A;  1T72 A;  5LBM A;  4ILU A;  2E9X C;  1NWM X;  2XAG B;  3MZK B;  3QUJ A;  1E7P A; 
#chains in the Genus database with same CATH homology
 2JQQ A;  2Q9Q C;  5HXE A;  3H37 A;  2CCQ A;  4BAY B;  4KMC A;  4WNK A;  2BVM A;  2M67 A;  2MOZ A;  2N1G A;  4MBQ A;  2VKD A;  3RC8 A;  2XHE B;  2HPL A;  4H9N C;  5HXH A;  4WBO A;  5J1G A;  2ZMA A;  4DMV A;  3C64 A;  4IGU A;  3RC3 A;  4ZI3 C;  2VB6 A;  2V7K A;  2JMH A;  3ZMV B;  2CXL A;  2I59 A;  3Q5W A;  4UV8 B;  2YU2 A;  4TN7 B;  1WRD A;  4I50 E;  4PFO A;  3RRW A;  3UT5 E;  1MNE A;  3N9L A;  3S4U A;  2CLY B;  2D0T A;  5DAB A;  3LK4 2;  2WSS V;  2DWK A;  4G2A A;  3VU7 H;  1ZKE A;  2DCF A;  2KZ7 B;  2YEV C;  3NZP A;  5FY0 A;  1B7T A;  3RYH E;  3O1J A;  2EHO D;  2GK9 A;  2VKH A;  3UUN A;  5F3J A;  4E7Z A;  1MIY A;  5GON E;  3LBX B;  2KMF A;  3E22 E;  4PNI A;  5JDF A;  5LXT E;  3VKG A;  4BJM A;  5HWX A;  2X51 A;  4H9S E;  4HFV A;  3F2E A;  1BR4 A;  4E7S A;  1US7 B;  2NTY A;  5JRC A;  2ACX A;  4FJO A;  3K3N A;  4L5G A;  5FP3 A;  1BR0 A;  3KVB A;  3QK6 A;  5FXW A;  2V1D B;  2Z6E A;  3BQL A;  4HEA A;  2CA5 A;  3MXZ A;  2CXD A;  4L0R A;  4N78 D;  4UIG A;  3ZYL A;  3O4X E;  3KV9 A;  2WAU A;  2UXX B;  2VK9 A;  2DWG A;  4H9R C;  3C4X A;  4WW0 A;  4OK0 A;  1SA0 E;  5H6R B;  1MMA A;  2LHR A;  2EHO B;  2LM9 A;  3SOL A;  2WMO A;  3LK3 B;  4NUV A;  2W0G A;  3CVR A;  3AAA B;  1AJ3 A;  3CML A;  3RPU A;  5L3G B;  4PJJ A;  3RYF E;  3LJC A;  3ZYK A;  2CE7 A;  4TX5 A;  5LBQ B;  5LHI B;  2D2S A;  3PTR B;  5J2U E;  4IIJ E;  2C5I T;  3PU3 A;  4AKG A;  1D1B A;  1MMG A;  4J2C A;  3HR0 A;  4IE4 A;  3FBZ A;  4AXP A;  1UX5 A;  4AKL A;  2KWH A;  4O4H E;  4I4T E;  3ZJ1 A;  3PE0 A;  4QXC B;  5LG4 A;  5FY7 A;  2XTL A;  4U74 A;  2ODU A;  4O2B E;  5IYZ E;  2UXN B;  4PJN A;  1WYC A;  3I0Q A;  2YIN A;  3HKC E;  5JRE A;  3ANW B;  4UF0 A;  2X9X A;  4PW8 A;  2XAH B;  3ZLI A;  1YKH B;  2NWB A;  4HKA A;  3ETU A;  3UUL A;  2DLR A;  3FXE B;  5L2L A;  2LEH A;  3D0T A;  1SHZ C;  5LJM A;  5JRC B;  2NW8 A;  4K0U A;  3NBX X;  5LJN A;  2X66 A;  4Z8X A;  4PK4 A;  4UVC B;  4DBR A;  5FMN A;  4KBM B;  4PK6 A;  5EK2 A;  2N2N A;  3RYI E;  2K5B B;  3KBU A;  4TV8 E;  2ZM0 A;  1HF8 A;  3DTO A;  4ZHQ E;  2K9A A;  3AA6 B;  2PFV A;  5JDG A;  5LP6 E;  3AVS A;  2X9W A;  2BZB A;  1Z0P A;  3MK7 C;  2BVL A;  5EK4 A;  1HG2 A;  4P0A A;  1WYB A;  4ADZ A;  4BJN A;  3E08 A;  4EAH A;  3W15 B;  3PDY A;  3N9P A;  2CMR A;  2LSK A;  4ZI2 D;  3ZMZ B;  5LGU B;  3GN5 A;  1UX4 A;  4MAL A;  4AQF A;  3ZN1 B;  1LVK A;  3F31 A;  3AA1 B;  1IAP A;  3ETV A;  3JC6 C;  1WR6 A;  2VKJ A;  2XAQ B;  3CQX C;  4QKN A;  5KMG P;  5LHH B;  1MMD A;  3A5X A;  3E0Z A;  3PUA A;  3N2K E;  1MIV A;  3LK2 B;  1FMV A;  3SRZ A;  2L3L A;  2X67 A;  5E0O A;  5EK3 A;  3ESL A;  5JDN A;  4JEU B;  3NZQ A;  5HXC A;  2D5U A;  1IZN B;  4O4I E;  3O9X A;  3KV5 A;  3ZC1 A;  1IJ6 A;  5JR9 A;  4AQG A;  5HYA A;  3I1A A;  3EVY A;  5ETW A;  2ZM2 A;  1Y64 B;  5HXS A;  3ZYM A;  2XUE A;  1NAF A;  4PJL A;  2W63 A;  2PG8 A;  2IC9 A;  4OFZ A;  5CA1 E;  2RP4 A;  4DBQ A;  3MJX A;  2C5J A;  3R84 B;  3MAC A;  3C4Z A;  5JDL A;  4O8S A;  2G0U A;  4JEH B;  2RA1 A;  4H63 H;  1OXZ A;  4ANJ A;  3CPZ A;  1FMW A;  3K8P C;  3OKQ A;  4F6R C;  5C8Y E;  3QC9 A;  3U78 A;  5JQG E;  2Y48 B;  3PU8 A;  4GK0 E;  3HA4 A;  2LSI A;  2E9X B;  3NRX A;  5LOV E;  1QUU A;  2A3D A;  1HCI A;  4I55 E;  4IE6 A;  2YK0 A;  3SWH A;  5DJQ C;  2Q9Q B;  1T98 A;  3FB2 A;  2LJL A;  2V7I A;  2L9Q A;  2CEA A;  4IDZ A;  4EOZ B;  1X79 A;  5CA0 E;  2W62 A;  5FXX A;  2DNX A;  3GA8 A;  3J9X 1;  1HX8 A;  4CI3 B;  1G73 A;  3RKO A;  2LHN A;  5L3E B;  5IHY A;  4UVB B;  4UEM A;  1ZEE A;  3CQC B;  4JUY A;  4CI1 B;  3RX6 A;  2V7M A;  4AKH A;  2XAS B;  4AQF C;  3LBX A;  4X1K E;  4YJ2 E;  1O3X A;  2ODV A;  2A2F X;  2B1E A;  3HL6 A;  2VL8 A;  5CB4 E;  3ZC0 A;  1D0Z A;  2ZM8 A;  4UV9 B;  4WBN E;  5A1L A;  2HPJ A;  2LOP A;  5L3C B;  4IST A;  4B6X A;  1HFA A;  4PJM A;  4U72 A;  3VHL A;  3KV4 A;  3KDS E;  4QWN B;  2H3R A;  2MTQ A;  5JR9 C;  2LT3 A;  1FEW A;  3V5U A;  2XAF B;  3H3A A;  4L9I A;  4C91 A;  2MYS A;  3UUX B;  1S35 A;  2X9H A;  2X68 A;  5FNV E;  4PAG A;  3C98 B;  5L3F B;  2KIN B;  5DQV A;  2EHO A;  1S94 A;  3M65 A;  4DND A;  5JDM A;  4P09 A;  3KIN B;  3CWZ B;  3AA7 B;  2X0L B;  4O4L E;  3N9Q A;  3CQG B;  1QSD A;  1V9D A;  4QX8 B;  4XAX B;  4C90 A;  3EUH A;  4EB6 E;  1YKE B;  3Q2M A;  2CWO A;  2NTX A;  2NOX A;  2KXP B;  3WAJ A;  3BK9 A;  4YFS A;  3UFE A;  4EYY R;  4TV9 E;  2V26 A;  4IE5 A;  4ISS A;  3N9N A;  4YLH A;  5DQW A;  5FY1 A;  5LCY A;  4CXW A;  3N9O A;  4MHC A;  5M4Y A;  3OYZ A;  2XAJ B;  4X1I E;  3UTK A;  1H7C A;  1EZ3 A;  4DO0 A;  3CX8 B;  4PK5 A;  4DVD A;  1D1A A;  4H9O C;  3AVR A;  3IBP A;  5JVD E;  4EZ4 A;  1D0X A;  1OWA A;  3ANW A;  3PUQ A;  2J1D G;  2JMK A;  2SPC A;  2WM9 A;  4IE0 A;  2Y8D A;  3GWH A;  4UEL A;  3PUR A;  2CLY C;  4IE7 A;  3IEE A;  4ZI2 C;  3Q9D A;  3O1H A;  4UXN B;  2BDE A;  2E9X D;  5L3D B;  2MBG A;  4H63 V;  1BR1 A;  3KV6 A;  3KFW X;  4ASK A;  4EYU A;  4M1P A;  4EXT A;  2NW9 A;  3BQI A;  3AAI A;  2KWI B;  2Q9Q D;  1YW0 A;  1IJ5 A;  5HAX A;  4ZS3 A;  1CUN A;  5LGN B;  1FIO A;  4AKI A;  5AFU L;  5L3B B;  5F8P A;  2K48 A;  4QXH B;  3F57 A;  3CX7 B;  1WLX A;  3IHR A;  3MKD A;  4IHJ E;  5KDM C;  4ZI3 D;  5TAO A;  5KX5 E;  2NW7 A;  2KLQ A;  3IF8 B;  2OA5 A;  5JDH A;  2PJQ A;  1E1H B;  3AA0 B;  2WBL A;  3KVA A;  3EDV A;  4YJ3 E;  2P9B A;  4HTE A;  2VWA A;  3B13 A;  3L3P A;  2VAS A;  2H7V C;  3B57 A;  2LE8 A;  4AKR B;  2E8I A;  2WMN A;  2JPF A;  4TUY E;  3UUM A;  4H9P C;  5LNK A;  4GK5 E;  2X9Y A;  3ZEF B;  4FI5 A;  4HN9 A;  2C5K T;  1YD8 G;  3P8C D;  5FXZ A;  2EHO C;  4OHF A;  2V7L A;  5H6Q B;  2W61 A;  3HKB E;  3N2G E;  3R6N A;  3TKL B;  4CZZ B;  2WWU A;  4KUM B;  2CM0 A;  5LGT B;  3Q5X A;  2LSY A;  4GIW A;  5EZY E;  3RH3 A;  3PUG A;  3P7I A;  2QGS A;  4YHJ A;  5LHG B;  3ZMU B;  3AAE B;  1KNZ A;  4PFP A;  3HKE E;  4JLE A;  3K3O A;  3ZCI A;  3ZMS B;  1U4Q A;  4ZI7 E;  4EIW A;  4KP3 C;  5HXR A;  5BMV E;  3O1I A;  3BQK A;  4XZC A;  3OBV E;  3T8O A;  3LG7 A;  2LOS A;  2C0S A;  2V7J A;  4I43 B;  1HG5 A;  3ZCJ A;  2KND A;  1D0Y A;  3V5S A;  3ZPO A;  3OJA A;  1LRZ A;  4CI2 B;  1HTJ F;  2XQY A;  4UF0 B;  2PBI A;  3SS1 A;  2E9X A;  3RRC A;  2IW5 B;  3I9W A;  3CKD A;  4CQI A;  3FBL A;  2LSG A;  2H7O A;  2L8K A;  4P0B A;  2NP9 A;  5J2T E;  3KBT A;  2Q9Q A;  1D1C A;  5LA6 E;  3ZMT B;  3L09 A;  1ZV4 X;  3FXD B;  3MA9 A;  4UVA B;  1LVF A;  2DI4 A;  4XBF B;  2QA7 A;  5HWY A;  3RYC E;  3DP7 A;  4QHO A;  3J7Y q;  3FHN A;  3N9M A;  3I0O A;  5FXV A;  4TZ4 C;  4EZH A;  1U5P A;  4NUU A;  3C50 A;  4AI6 A;  2IC6 A;  4X1Y E;  5FYM A;  3ZJ2 A;  1MND A;  3C4W A;  4CXX A;  3ZN0 B;  3U3I A;  3WAK A;  3OYX A;  4CXY A;  2KT9 A;  3N5L A;  4BA9 A;  1BR2 A;  3K3Q C;  1ZHC A;  1MIW A;  2CWY A;  3GN5 B;  1LKX A;  5ADX L;  3N2O A;  3PUS A;  2HH7 A;  4A56 A;  4OYK A;  4GYR A;  2VKO A;  1KK7 A;  3AB3 B;  2N9D A;  3EDU A;  4V1A v;  3LFM A;  4GYS A;  4H9Q C;  1UCU A;  4O4J E;  4HGA A;  4ERR A;  3C51 A;  3HKD E;  3CX6 B;  2YU1 A;  4ZOL E;  3HI2 A;  4G63 A;  2LSJ A;  4QXB B;  5JR9 B;  4HE8 A;  3ONX A;  4ZS2 A;  2ES0 A;  3I9Y A;  4GOU A;  2CXF A;  1G8X A;  5JH7 E;  2Y6X A;  4QX7 B;  5LYJ E;  2DHR A;  1MMN A;  3JC6 D;  2A72 A;  3GMI A;  3DJB A;  2IAK A;  2K24 A;  1VRB A;  4MFR A;  3VKH A;  4X20 E;  1HS7 A;  5JDQ A;  2JJ9 A;  2W00 A;  5LBM A;  4ILU A;  4OYJ A;  3NRY A;  1VOM A;  2E9X C;  3WI3 A;  2JRK A;  1NWM X;  2XAG B;  3MZK B;  3QUJ A;  4DMW A;  2D0U A;  4O2A E;  4MLK A;  2ZLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...