4ZI3D

Bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
128
structure length
128
Chain Sequence
b'AEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
molecule tags Hydrolase
source organism Mus musculus
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
total genus 54
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi3D00
4ZI2C 4ZI2D 2K9AA 4ZI3C 4ZI3D
chains in the Genus database with same CATH superfamily
4QXCB 1R8IA 2LM9A 1FIOA 4YJ2E 1ZV4X 1OEDE 2D5UA 2H3RA 4QWNB 2XQ8A 5KX5E 3CMLA 4L9IA 1N36T 2XM1A 1D0XA 3I1AA 3RKGA 2WWUA 3FBZA 4ANJA 5JTGA 5DQVA 3OTOT 3HKCE 1YD8G 3JADA 2LHRA 1Y01A 2XSBA 4G2AA 5L3CB 3CQCB 1FMWA 2JQKA 3ZPOA 4B3RT 3RPUA 4UELA 2XY8B 1G8XA 2X0HA 1NAFA 2M6BA 5LGTB 2CMRA 2VASA 1T7SA 3C50A 3GWHA 3K8PC 3Q5EA 3ZC1A 3CWZB 2V1DB 2Q9QA 3MK7C 4ZI3D 1WRDA 5JDFA 4DR5T 1YKEB 5JR9C 3DP7A 3V5UA 4Z91A 2XPKA 2FJDA 1MMGA 3AAIA 3F31A 3KV6A 3DJBA 3LSVA 3ONXA 2WU2A 4PW8A 3OPCA 5HEGA 5BMVE 3UT5E 5FKYA 2VL8A 4MLKA 4NIQA 4QXHB 2QVAA 2VVNA 3CQXC 4UV8B 4EZ4A 4YTPA 4DR3T 3I0OA 2YOEA 2LKGA 3AEGA 2XM2A 3EAMA 4KP3C 5FVLA 2YK0A 5CB4E 5C3JA 5JH7E 3TLTA 2YU2A 3RIUA 4DNDA 2EHOB 4CXWA 3UUNA 2J47A 1LVFA 1MNEA 2VVSA 3EHZA 4DIDB 1UGOA 2VQET 1KNZA 2XAHB 3W15B 1XMOT 3VKGA 1MIYA 1WLXA 2XJ7A 5FY1A 2IW5B 3PJAA 3L39A 3OJAA 3VHLA 2ZM6T 4CI2B 3AVRA 1KFYA 1SHZC 3GN5A 5JQGE 2B76A 3ABVA 5FYMA 2ZLYA 4UR9A 3KBUA 2WWVA 2V26A 4YTMA 1XDOA 3E08A 5F5WA 3M65A 4EGWA 2V7IA 2XZEA 4DR7T 3HA4A 4O2BE 3DTOA 4IDPA 2Y48B 4H9RC 1HF8A 3RRWA 2C5KT 4PJLA 2WMOA 4FI5A 4TX5A 2OV9A 4H9OC 3ZN0B 4E7ZA 3ZCIA 5LGNB 2LOSA 4NUUA 2WDRA 3H3MA 3L3PA 4AKLA 4GIWA 4DBRA 2LEHA 5LYJE 3IEEA 4U7YA 3FZLB 4NXMT 3F2EA 1N33T 2QRXA 3QOFA 4UXNB 2Y8DA 4L5GA 2X0LB 4TWFA 2ACZA 3P4RA 3WAJA 2K5BB 3ETUA 5LMUT 4DBQA 4FJOA 4TNVA 4U7IA 5ABGA 2CLYB 2XQ6A 3L8RA 4JV5T 3E0ZA 2N2NA 3P4SA 4F8HA 2VWAA 5L47A 2CXDA 2JQ9A 4U74A 1MIVA 4WNKA 5C8YE 2XQ3A 3EABA 4GKJT 2C0SA 2Q9QB 3UUMA 2K24A 4ZOLE 5A1LA 4YTNA 2DHRA 2C5JA 1OEDC 2IMLA 2NTXA 2E9XB 2WDVA 5HYAA 3CPZA 3HKDE 4TN7B 4YXDA 2JQQA 2W62A 4H9SE 3ETVA 2BS3A 2D0UA 2JIWA 3AEEA 4KX6A 3QUJA 4U33A 5EZYE 3UUBA 5ABFB 1HR0T 2MOZA 2YKSA 2NP9A 2OLTA 2XQ5A 1S94A 5AQNB 3P4PA 2W0GA 4QXBB 4PAGA 3UFEA 2V6YA 1QLBA 1YKHB 3PU3A 2E9XC 4ZS2A 4LMJA 4KBMB 3LBXA 3C4WA 4WW0A 4WYVA 3GMIA 4XZCA 5HXRA 4DV5T 4AKHA 3RIUC 5FY0A 4QH4A 3NBXX 2ZM0A 1NENA 2K48A 1HNWT 4U2YA 4PK5A 1IZNB 2VB6A 3ZYMA 2XQ4A 3LFMA 5L3EB 1NEKA 3N9OA 1MMAA 5BR8T 4TWDA 1VCSA 2MBGA 5FL1A 5JDQA 3H37A 4ISSA 3ANWB 4UVCB 3J7Yq 3VKHA 3A8YC 2BKPA 2P9BA 4OHFA 2CM0A 5ADXL 4IE0A 2WQYA 4N78D 2B1EA 3FZKB 3O1JA 4DR1T 2QGSA 3RLFF 3PDYA 3Q5XA 1Y64B 1ZP0A 4Z8XA 3VR9A 4JI1T 3ZKRA 4JI0T 5J1GA 1MIWA 5LXTE 5GONE 4LF9T 2DL1A 1E2AA 4IIJE 3UU6A 4HWFA 3PURA 2JRKA 5AQIB 5ABEA 4CXYA 5FP3A 5J2TE 2D9DA 4ZS3A 5JRCB 4DV1T 2BG9E 5IUXA 4AQYT 1N32T 3LDQB 3CX8B 2X9YA 2ZM2A 3AEBA 4P1NA 4ASKA 2E5LT 4B3ST 3ESLA 4DV0T 2AXDS 4U2ZA 1FEWA 2KWIB 1SA0E 2BS4A 4PJJA 1J5ET 2PG8A 1JNZA 4HGAA 3UQ4A 4YT0A 5L3BB 1Z8UA 4YSZA 2KMFA 4AQFC 2UUCT 1QSDA 4AI6A 2YU1A 3A5XA 2JPFA 4ZI3C 4JYAT 2ODUA 5E0OA 1O3XA 2BDEA 3H3AA 2V7MA 3LBXB 2DI4A 3P4QA 4CN6A 2W61A 4LFAT 2X68A 3ZC0A 5CA0E 2LE8A 4MALA 4X62T 3FZMB 5L3FB 3EDVA 4ILAA 1Z0PA 2VKDA 1E7PA 2MYSA 1UK5A 2FJAA 2YDSA 3C4XA 3CQGB 2CXFA 3N9QA 2H88A 2NOXA 4H63H 4LMLA 4P0BA 4ZI7E 4JI7T 1HFAA 3UU3A 1T98A 4CN4A 2VQFT 3SWHA 4HTEA 5LA6E 3ZLIA 3RIAA 2W63A 5JDGA 2Z6EA 3RH3A 2I0MA 4A5XA 1QUUA 2XAJB 3U3IA 4IHJE 4COFA 1LKXA 2W00A 5ABHA 2KXPB 1OEDB 5DQWA 4GKKT 1W0AA 3JC6D 3N5LA 3UU4A 2CBJA 1ZHCA 2L8KA 1KNPA 2M67A 3IF8B 3AEFA 4MHCA 3ZMZB 5LHGB 1YXRA 4YSXA 5LMNT 5JR9A 2FUPA 2RA1A 3M3ZB 1IJ5A 1MMDA 4HFEA 4WBOA 4DUYT 4JI6T 4HFVA 1FJGT 3CX7B 5HEHA 4A56A 3C64A 2N1GA 3N9LA 3QK6A 3RX6A 1CHUA 3OKQA 2PTFA 3HI2A 4PK6A 3ZT5A 5AQFB 2V6XA 4X64T 4X20E 4BA9A 2IIUA 4JUYA 4LMKA 2YINA 5HEJA 2D0TA 2V8SV 1NWMX 4O4JE 2WAUA 5J2UE 3AA6B 3AA0B 1IBLT 1HX8A 5AQHB 2W67A 4IE5A 2H7OA 5HEOA 3RC3A 3ZJ2A 5L2LA 2EHOC 2IUBA 1WR0A 1SE7A 2G0UA 2XASB 5FXWA 3NRXA 3GN5B 3T8OA 1IBKT 3NRYA 1T72A 2BBHA 4UEMA 2H7VC 4GK0E 4ILCA 2WBLA 5AQQB 4EEDA 4X1YE 4EAHA 4ERRA 5ABFA 1D0YA 1CUNA 4ILBA 3NWIA 2XUEA 3FB2A 4TUYE 1D1BA 4AISA 4C91A 5JDMA 2E2AA 2H89A 2VL0A 1W0BA 2KNDA 4YFSA 3RI5A 1US7B 2UXCT 3UUXB 1ZKEA 3O1HA 1WYCA 4UVBB 4GOUA 3ZMSB 2X9XA 4BJMA 2E8IA 3ZMUB 3N9MA 2L3LA 2XTLA 2WCAA 4O8SA 3X1DA 2E9XD 3KINB 2NW9A 3TKLB 5LNKA 5AQUB 4EB6E 4MFRA 2GK9A 3I9WA 3RF1A 4QH5A 3WI3A 3L09A 4WBNE 5AFUL 1BR1A 4DO0A 4BJNA 2WB5A 3SFEA 5H6RB 5AQSB 5EK2A 3E22E 5LHIB 4ZZCA 4X65T 1M7KA 2DWKA 3EI0A 2YEVC 3CK6A 5F8PA 2ZM8A 4IREA 5FL0A 2ACXA 2HH7A 1HX1B 3CKDA 3N2OA 4HFBA 4YJ3E 3R84B 3RQWA 5LB7B 2PBIA 4OK0A 5AQOB 3RRCA 2KT9A 3SFDA 3UULA 4CQIA 2CEAA 2LJLA 4IDQA 2XQYA 1J1JA 1HG2A 2A72A 2DNXA 1BR2A 3MZKB 1JNRA 2Q9QD 3G06A 3AVSA 3AE8A 5CGMA 4AXPA 1AJ3A 1J5WA 4NUVA 2EHOD 2ODVA 1ZOYA 1VCTA 3AA7B 1IJ6A 3AA1B 3ZT7A 4EV6A 2HHHT 3PU8A 4CXXA 4JLEA 2V7JA 2XQ9A 4K0UA 1UCUA 5DJQC 5AQLB 4DMVA 4TWHA 5EK4A 2L9QA 5L4HA 2C5IT 3AE1A 2XQAA 3LK2B 4F6RC 3KV5A 3S4UA 2WZHA 3QC9A 4X1KE 3GA8A 2VURA 3TLUA 2X9HA 4QH1A 4LF5T 4U3CA 3VR8A 2CWOA 2XSAA 3RQUA 3MACA 4O4IE 3T1HT 2LSYA 4LF8T 3AB3B 2IC9A 4EXTA 1IBMT 5HWYA 3P7IA 3RYIE 4HWIB 3AEDA 2WDQA 2WM9A 3FXEB 4DV7T 4B3TT 2W4XA 2SPCA 5HCJA 4EYYR 5FXZA 5JDHA 3OBVE 2V7KA 2LM2A 3PJAJ 4PJNA 1WFDA 4X5TA 3C51A 1T8BA 4HKAA 2IHR1 2LSGA 1OXZA 2MPKA 4O4HE 4EZHA 5J0ZA 3B5MA 3Q5WA 4UF0B 2BKNA 4PFPA 4ZI2D 1D0ZA 2KSRA 3B13A 4HWCA 4P09A 1I6ZA 4AIUA 4CI3B 2J1DG 1H7CA 5JDNA 4IE7A 3AE6A 1S35A 2D2SA 3NVOA 2WY2A 2BS2A 3PV0F 4HEAA 2W2UA 4HFDA 3VU7H 5C2TA 5HWXA 5HEUA 4U72A 2Y6XA 3BQIA 4G63A 4O4LE 4B6XA 5CFBA 2FJBA 5AQJB 3JC6C 2Q9QC 3ZJ1A 4Z90A 1SUMB 5FMNA 1WCRA 2EHOA 4KHPT 3MJXA 1KEYA 2VKOA 3K1SA 4JI4T 5HXHA 4EYUA 4P0AA 5LCYA 1XMQT 3PUVF 1XDPA 3IBPA 4IGUA 5AQPB 2VKHA 4GYSA 1EZ3A 3N2GE 4QKNA 4L0RA 4PFOA 3CVRA 2LLYA 2MAWA 2QA7A 3IHRA 3PUAA 2I59A 2KWHA 4DV2T 4QHOA 3PUQA 3PUZF 3PE0A 3N9NA 4LF6T 5JDLA 1XZYA 4JI8T 2WU5A 3K3QC 4M1PA 3AE5A 2X51A 2RPAA 3O1IA 4J2CA 3SOLA 5FVKA 4HWHA 4YLHA 4DMWA 2X67A 5JVDE 3OVUA 3JAEA 3UQ7A 5HXEA 2IC6A 2HN1A 4X66T 1WYBA 1UX5A 2IAKA 3OYXA 4I4TE 5KMGP 4DVDA 3Q5DA 4ISTA 4JEUB 4KUMB 2N9DA 3CIRA 4ZXLA 3HL6A 3AAAB 1U5PA 2WP9A 5FXXA 1VOMA 1XWMA 2JMHA 3KVBA 4ILUA 4OYKA 4LFBT 3EVYA 3ONJA 4A98A 1D1CA 3P4WA 3J9X1 4LF4T 1W09A 4HWDA 2NWBA 4UV9B 4UF0A 2X9WA 3EUHA 4IDOA 1UUSA 2FBWA 3HR0A 2NW8A 3Q9DA 4KI0F 3P8CD 2LSJA 3CX6B 5AQGB 1VRBA 2JQHA 5HCMA 4A97A 5CJ5A 1G73A 4CI1B 1FMVA 1DU2A 2LRLA 1W9RA 3BQKA 4NPPA 5KDMC 3ZN1B 5M4YA 2CE7A 5JR9B 2UUAT 5AQRB 2BVLA 3PUSA 2LSKA 2J4GA 3QB5K 3UTKA 2RP4A 1MMNA 1D1AA 3F57A 3ZT6A 5CA1E 4DV4T 3VRAA 1GQEA 5AQKB 5FY7A 3OYZA 4V1Av 3LJCA 2XHEB 5FNVE 5LJNA 2OA5A 2WS3A 3WAKA 3KBTA 3RYCE 1HTJF 4PNIA 2JMKA 3RHWA 2BZBA 4TNWA 2A9UA 5HAXA 5IYZE 3ZCJA 4GK5E 3ZMTB 3LG7A 3UFGA 4JI5T 3KV9A 4IT4A 5LBMA 3PUYF 3AXJB 2LT3A 1LRZA 3ANWA 2ES0A 3AEAA 2YDRA 4HE8A 2HPJA 3FHNA 3ZYLA 4ADZA 2WSSV 2F4VT 2BG9C 4KHZF 2CLYC 2A2FX 4Q25A 2LSIA 4PJMA 3ZYKA 3N9PA 4GYRA 5JRCA 2KLQA 3I9YA 4OYJA 4HFIA 4JEHB 1LVKA 4DR4T 2K9AA 3AE9A 3V5SA 2CHNA 3LK42 2KINB 4HFHA 1YW0A 2CPTA 4ZZBA 2I6HA 2NW7A 2E5VA 2FJEA 2UXXB 3FXDB 2J62A 2NTYA 4E7SA 5EK3A 4AQGA 5LG3A 5IWAT 1HCIA 3BK9A 4I0UA 5IHYA 4DUZT 4ZEYA 2X66A 3KV4A 4PK4A 4UIGA 1HS7A 2BVMA 2YDQA 3C98B 4AKRB 3AE4A 4I55E 3RGLA 3C4ZA 1UURA 3D0TA 3MXZA 4UVAB 4YHJA 3AXJA 3FZFB 3P50A 2M6IA 3AE3A 3SS1A 5L3DB 3AE7A 4DR2T 2UXBT 2UUBT 2CA5A 2CWYA 3K3NA 4TZ4C 3RYHE 5LHHB 3IA3A 3PUGA 2E9XA 2JJ9A 2XAGB 5HXSA 2XQ7A 2AE9A 1N34T 1X9BA 1KF6A 3O4XE 5LOVE 1B7TA 4O2AE 4H9QC 3TLSA 1ZEEA 5JREA 1OWAA 4TV8E 1BR0A 1OEDA 4JBWF 3QNUA 4QX8B 4CN1A 4ZI2C 4EIWA 5LJMA 5LG4A 4DV6T 3RKOA 4AKIA 4HFCA 1KK7A 1UX4A 4IL9A 4LFCT 2UXDT 4EOZB 4H63V 3TLVA 4K0KT 2K3WA 3KVAA 5TAOA 3UU5A 4HN9A 2BKOA 2ZMAA 4I50E 2NR4A 5AQTB 2UU9T 3Q2MA 2BBJA 2BG9A 2DCFA 5ETWA 4YSYA 1WR6A 3K3OA 1I94T 3RIFA 3T1YT 4IE4A 4ZHQE 5H6QB 4C90A 3AECA 2X0YA 3B57A 1M62A 3NZQA 1HG5A 1L0VA 4JI2T 1HNZT 4YY3T 4EEBA 1KNRA 3PTRB 3RYFE 1YQ4A 2V5DA 2PJQA 4KMCA 2MTQA 3ZSTA 2PFVA 3PUWF 4U31A 2HPLA 2IDOB 5L4EA 2V7LA 3O9XA 3FBLA 4I43B 3R6NA 4BAYB 3A7MA 4QX7B 4IL4A 2V6YB 3TLWA 4JI3T 4CZZB 2QYWA 2XAQB 2VK9A 3KFWX 4LF7T 4B3MT 2WMNA 3NKZA 4DR6T 2LOPA 2CBIA 3EDUA 5FXVA 2BG9B 2UXNB 4IDNA 3QB5A 4IE6A 1XNRT 4H9PC 1IAPA 3JAFA 3PUXF 3ZMVB 2W66A 1U4QA 4XBFB 2HN2A 1X79A 5DABA 4NXNT 3BQLA 3MA9A 5LGUB 4X1IE 3N2KE 4MBQA 5AQVB 2CRBA 3KDSE 2R6GF 4WZXA 2CXLA 1MNDA 2CHOA 4OFZA 4DV3T 5F3JA 1XNQT 5KXJA 1YQ3A 2A3DA 2CCQA 3HKEE 4XAXB 1BR4A 2WZIA 4IDZA 3U78A 4OX9T 5LBQB 2V5CA 5HXCA 3ZSSA 4YHHT 3NZPA 3AE2A 2LKHA 3JCFA 4AKGA 3ZEFB 3AAEB 2VKJA 1HNXT 1E1HB 1V9DA 2KZ7B 3MKDA 5AQMB 3VRBA 3LK3B 3UU8A 3ONLC 3FZHB 4AQFA 3RC8A 2LHNA 2DLRA 3SRZA 5L3GB 2LRKA 2DWGA 3HKBE 2XAFB 4TV9E 5LP6E 4H9NC 3I0QA 2YN6A
chains in the Genus database with same CATH topology
4QXCB 2LM9A 1FIOA 4YJ2E 1ZV4X 2D5UA 2H3RA 4QWNB 5KX5E 3CMLA 4L9IA 1D0XA 3I1AA 2WWUA 3FBZA 4ANJA 5DQVA 3HKCE 1YD8G 2LHRA 4G2AA 5L3CB 3CQCB 1FMWA 3ZPOA 3RPUA 4UELA 1G8XA 1NAFA 5LGTB 2CMRA 2VASA 3C50A 3GWHA 3K8PC 3ZC1A 4ZI3D 3CWZB 2V1DB 2Q9QA 3MK7C 1WRDA 5JDFA 1YKEB 5JR9C 3DP7A 3V5UA 3F31A 3AAIA 1MMGA 3KV6A 3ONXA 4PW8A 3DJBA 5BMVE 3UT5E 2VL8A 4MLKA 4QXHB 4UV8B 3CQXC 4EZ4A 3I0OA 4KP3C 5CB4E 2YK0A 5JH7E 2YU2A 4DNDA 2EHOB 4CXWA 3UUNA 1LVFA 1MNEA 1KNZA 2XAHB 3W15B 3VKGA 1MIYA 1WLXA 5FY1A 2IW5B 3OJAA 3VHLA 4CI2B 3AVRA 1SHZC 3GN5A 5JQGE 5FYMA 2ZLYA 3KBUA 2V26A 3E08A 3M65A 2V7IA 3HA4A 4O2BE 3DTOA 2Y48B 4H9RC 1HF8A 3RRWA 2C5KT 4PJLA 2WMOA 4FI5A 4TX5A 4E7ZA 4H9OC 3ZN0B 3ZCIA 5LGNB 2LOSA 4NUUA 3L3PA 4AKLA 4GIWA 4DBRA 2LEHA 5LYJE 3IEEA 3F2EA 4UXNB 2Y8DA 4L5GA 2X0LB 3WAJA 2K5BB 3ETUA 4DBQA 4FJOA 2CLYB 3E0ZA 2N2NA 2VWAA 2CXDA 4U74A 4WNKA 1MIVA 5C8YE 2C0SA 2Q9QB 3UUMA 2K24A 4ZOLE 5A1LA 2DHRA 2C5JA 2NTXA 2E9XB 5HYAA 3CPZA 3HKDE 4TN7B 2JQQA 2W62A 4H9SE 3ETVA 5EZYE 2D0UA 5KDMC 3QUJA 2MOZA 2NP9A 1S94A 2W0GA 4QXBB 4PAGA 3UFEA 1YKHB 3PU3A 2E9XC 4ZS2A 4KBMB 3LBXA 3C4WA 4WW0A 3GMIA 4XZCA 5HXRA 4AKHA 5FY0A 3NBXX 2ZM0A 2K48A 4PK5A 1IZNB 2VB6A 3ZYMA 3LFMA 5L3EB 3N9OA 1MMAA 5JDQA 2MBGA 3J7Yq 3H37A 4ISSA 3ANWB 4UVCB 3VKHA 2P9BA 4OHFA 2CM0A 5ADXL 4IE0A 4N78D 2B1EA 3O1JA 2QGSA 3PDYA 3Q5XA 1Y64B 4Z8XA 5J1GA 1MIWA 5LXTE 5GONE 4IIJE 3PURA 2JRKA 5J2TE 4CXYA 5FP3A 4ZS3A 3CX8B 2X9YA 2ZM2A 4ASKA 3ESLA 1FEWA 2KWIB 1SA0E 4PJJA 2PG8A 4HGAA 5L3BB 2KMFA 4AQFC 1QSDA 4AI6A 2YU1A 3A5XA 2JPFA 4ZI3C 2ODUA 5E0OA 1O3XA 2BDEA 3H3AA 2V7MA 3LBXB 2DI4A 4EAHA 2W61A 2X68A 3ZC0A 5CA0E 2LE8A 4MALA 5L3FB 3EDVA 1Z0PA 2VKDA 2MYSA 3C4XA 3CQGB 3N9QA 4P0BA 2CXFA 2NOXA 4H63H 4ZI7E 1HFAA 1T98A 3SWHA 4HTEA 5LA6E 3ZLIA 5JDGA 2W63A 2Z6EA 3RH3A 1QUUA 2XAJB 3U3IA 4IHJE 1LKXA 2W00A 2KXPB 5DQWA 3JC6D 3N5LA 1ZHCA 2L8KA 2M67A 3IF8B 4MHCA 3ZMZB 5LHGB 5JR9A 2RA1A 1IJ5A 1MMDA 4WBOA 4HFVA 3CX7B 4A56A 3C64A 2N1GA 3N9LA 3QK6A 3RX6A 3OKQA 3HI2A 4PK6A 4X20E 4BA9A 4JUYA 2YINA 2D0TA 1NWMX 4O4JE 2WAUA 5J2UE 3AA6B 3AA0B 1HX8A 4IE5A 2H7OA 3RC3A 3ZJ2A 5L2LA 2EHOC 5FXWA 2G0UA 2XASB 3T8OA 3NRXA 3GN5B 3NRYA 4UEMA 2H7VC 4GK0E 2WBLA 4X1YE 4ERRA 1D0YA 1CUNA 2XUEA 3FB2A 4TUYE 1D1BA 4C91A 5JDMA 2KNDA 4YFSA 1US7B 3UUXB 1ZKEA 3O1HA 1WYCA 4UVBB 4GOUA 3ZMSB 2X9XA 4BJMA 2E8IA 3ZMUB 3N9MA 2L3LA 2XTLA 5LNKA 4O8SA 2E9XD 3KINB 2NW9A 3TKLB 4EB6E 4MFRA 2GK9A 3I9WA 3WI3A 3L09A 4WBNE 5AFUL 1BR1A 4DO0A 4BJNA 5LHIB 5H6RB 5EK2A 3E22E 2DWKA 5F8PA 2YEVC 2ZM8A 2ACXA 2HH7A 3CKDA 3N2OA 4F6RC 4YJ3E 3R84B 3RRCA 5HXEA 2PBIA 4OK0A 2KT9A 3UULA 4CQIA 2CEAA 2LJLA 2XQYA 1HG2A 2A72A 2DNXA 3MZKB 1BR2A 2Q9QD 3AVSA 4AXPA 1AJ3A 4NUVA 2EHOD 2ODVA 3AA7B 1IJ6A 3AA1B 3PU8A 4CXXA 4JLEA 2V7JA 4K0UA 1UCUA 5DJQC 4DMVA 5EK4A 2L9QA 2C5IT 3LK2B 3KV5A 3S4UA 3QC9A 4X1KE 3GA8A 2X9HA 2CWOA 3MACA 4O4IE 2LSYA 3AB3B 2IC9A 4EXTA 5HWYA 3P7IA 3RYIE 3FXEB 2WM9A 2SPCA 4EYYR 5JDHA 5FXZA 3OBVE 2V7KA 4PJNA 4EZHA 3C51A 4HKAA 4O4HE 2LSGA 1OXZA 3Q5WA 4UF0B 4PFPA 4ZI2D 1D0ZA 3B13A 4P09A 4CI3B 2J1DG 1H7CA 5JDNA 4IE7A 4UV9B 1S35A 2D2SA 5JRCB 4HEAA 3VU7H 5HWXA 4U72A 2Y6XA 3BQIA 4G63A 4O4LE 4B6XA 3JC6C 2Q9QC 3ZJ1A 5FMNA 2EHOA 3MJXA 2VKOA 5HXHA 4EYUA 4P0AA 5LCYA 3IBPA 4IGUA 2VKHA 4GYSA 1EZ3A 3N2GE 4QKNA 4L0RA 4PFOA 3CVRA 3IHRA 3PUAA 2QA7A 2I59A 2KWHA 4QHOA 3PUQA 3PE0A 3N9NA 5JDLA 3K3QC 4M1PA 3O1IA 2X51A 4J2CA 3SOLA 4YLHA 4DMWA 2X67A 5JVDE 2IC6A 1WYBA 1UX5A 2IAKA 3OYXA 4I4TE 5KMGP 4DVDA 4ISTA 4JEUB 4KUMB 2N9DA 3HL6A 3AAAB 1U5PA 5FXXA 5JRCA 1VOMA 2JMHA 3KVBA 4OYKA 4ILUA 3EVYA 1D1CA 3J9X1 2NWBA 4UF0A 2X9WA 3EUHA 3HR0A 2NW8A 3Q9DA 3P8CD 2LSJA 3CX6B 1VRBA 1G73A 4CI1B 1FMVA 3BQKA 5M4YA 3ZN1B 2CE7A 5JR9B 2BVLA 3PUSA 2LSKA 3UTKA 2RP4A 1MMNA 1D1AA 3F57A 5CA1E 5FY7A 3OYZA 4V1Av 3LJCA 2XHEB 5FNVE 5LJNA 2OA5A 3WAKA 3KBTA 3RYCE 1HTJF 4PNIA 2JMKA 3ZCJA 2BZBA 5HAXA 5IYZE 3ZMTB 4GK5E 3LG7A 3KV9A 5LBMA 2LT3A 1LRZA 3ANWA 2ES0A 4HE8A 2HPJA 3FHNA 3ZYLA 4ADZA 2WSSV 2CLYC 2A2FX 3ZYKA 2LSIA 4PJMA 3N9PA 4GYRA 2KLQA 3I9YA 4OYJA 4JEHB 1LVKA 2K9AA 3V5SA 3LK42 2KINB 1YW0A 2NW7A 2UXXB 3FXDB 2NTYA 4E7SA 5EK3A 4AQGA 1HCIA 3BK9A 5IHYA 2X66A 3KV4A 4PK4A 4UIGA 1HS7A 2BVMA 3C98B 4AKRB 4I55E 3C4ZA 3D0TA 3MXZA 4UVAB 4YHJA 3SS1A 5L3DB 2CA5A 2CWYA 3K3NA 4TZ4C 3RYHE 5LHHB 3PUGA 2E9XA 2JJ9A 2XAGB 5HXSA 3O4XE 5LOVE 1B7TA 4O2AE 4H9QC 5JREA 1ZEEA 1OWAA 4TV8E 1BR0A 4QX8B 4ZI2C 4EIWA 5LJMA 5LG4A 4AKIA 3RKOA 1KK7A 1UX4A 4EOZB 4H63V 3KVAA 5TAOA 4HN9A 2ZMAA 4I50E 3Q2MA 2DCFA 5ETWA 1WR6A 3K3OA 4IE4A 4ZHQE 5H6QB 4C90A 3B57A 3NZQA 1HG5A 3PTRB 3RYFE 4KMCA 2PJQA 2MTQA 2PFVA 2HPLA 2V7LA 3O9XA 3FBLA 4I43B 3R6NA 4BAYB 4QX7B 4CZZB 2XAQB 2VK9A 3KFWX 2WMNA 2LOPA 3EDUA 5FXVA 2UXNB 4IE6A 4H9PC 1IAPA 4XBFB 3ZMVB 1U4QA 1X79A 5DABA 3BQLA 3MA9A 5LGUB 4X1IE 3N2KE 4MBQA 3KDSE 2CXLA 1MNDA 4OFZA 5F3JA 2A3DA 2CCQA 3HKEE 4XAXB 1BR4A 4IDZA 3U78A 5LBQB 5HXCA 3NZPA 4AKGA 3ZEFB 3AAEB 2VKJA 1E1HB 1V9DA 2KZ7B 3MKDA 3LK3B 4AQFA 3RC8A 2LHNA 2DLRA 3SRZA 5L3GB 2DWGA 3HKBE 2XAFB 4TV9E 5LP6E 4H9NC 3I0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI2 C;  4ZI2 D;  2K9A A;  4ZI3 C;  4ZI3 D; 
#chains in the Genus database with same CATH topology
 4QXC B;  1R8I A;  2LM9 A;  1FIO A;  4YJ2 E;  1ZV4 X;  1OED E;  2D5U A;  2H3R A;  4QWN B;  2XQ8 A;  5KX5 E;  3CML A;  4L9I A;  1N36 T;  2XM1 A;  1D0X A;  3I1A A;  3RKG A;  2WWU A;  3FBZ A;  4ANJ A;  5JTG A;  5DQV A;  3OTO T;  3HKC E;  1YD8 G;  3JAD A;  2LHR A;  1Y01 A;  2XSB A;  4G2A A;  5L3C B;  3CQC B;  1FMW A;  2JQK A;  3ZPO A;  4B3R T;  3RPU A;  4UEL A;  2XY8 B;  1G8X A;  2X0H A;  1NAF A;  2M6B A;  5LGT B;  2CMR A;  2VAS A;  1T7S A;  3C50 A;  3GWH A;  3K8P C;  3Q5E A;  3ZC1 A;  3CWZ B;  2V1D B;  2Q9Q A;  3MK7 C;  4ZI3 D;  1WRD A;  5JDF A;  4DR5 T;  1YKE B;  5JR9 C;  3DP7 A;  3V5U A;  4Z91 A;  2XPK A;  2FJD A;  1MMG A;  3AAI A;  3F31 A;  3KV6 A;  3DJB A;  3LSV A;  3ONX A;  2WU2 A;  4PW8 A;  3OPC A;  5HEG A;  5BMV E;  3UT5 E;  5FKY A;  2VL8 A;  4MLK A;  4NIQ A;  4QXH B;  2QVA A;  2VVN A;  3CQX C;  4UV8 B;  4EZ4 A;  4YTP A;  4DR3 T;  3I0O A;  2YOE A;  2LKG A;  3AEG A;  2XM2 A;  3EAM A;  4KP3 C;  5FVL A;  2YK0 A;  5CB4 E;  5C3J A;  5JH7 E;  3TLT A;  2YU2 A;  3RIU A;  4DND A;  2EHO B;  4CXW A;  3UUN A;  2J47 A;  1LVF A;  1MNE A;  2VVS A;  3EHZ A;  4DID B;  1UGO A;  2VQE T;  1KNZ A;  2XAH B;  3W15 B;  1XMO T;  3VKG A;  1MIY A;  1WLX A;  2XJ7 A;  5FY1 A;  2IW5 B;  3PJA A;  3L39 A;  3OJA A;  3VHL A;  2ZM6 T;  4CI2 B;  3AVR A;  1KFY A;  1SHZ C;  3GN5 A;  5JQG E;  2B76 A;  3ABV A;  5FYM A;  2ZLY A;  4UR9 A;  3KBU A;  2WWV A;  2V26 A;  4YTM A;  1XDO A;  3E08 A;  5F5W A;  3M65 A;  4EGW A;  2V7I A;  2XZE A;  4DR7 T;  3HA4 A;  4O2B E;  3DTO A;  4IDP A;  2Y48 B;  4H9R C;  1HF8 A;  3RRW A;  2C5K T;  4PJL A;  2WMO A;  4FI5 A;  4TX5 A;  2OV9 A;  4H9O C;  3ZN0 B;  4E7Z A;  3ZCI A;  5LGN B;  2LOS A;  4NUU A;  2WDR A;  3H3M A;  3L3P A;  4AKL A;  4GIW A;  4DBR A;  2LEH A;  5LYJ E;  3IEE A;  4U7Y A;  3FZL B;  4NXM T;  3F2E A;  1N33 T;  2QRX A;  3QOF A;  4UXN B;  2Y8D A;  4L5G A;  2X0L B;  4TWF A;  2ACZ A;  3P4R A;  3WAJ A;  2K5B B;  3ETU A;  5LMU T;  4DBQ A;  4FJO A;  4TNV A;  4U7I A;  5ABG A;  2CLY B;  2XQ6 A;  3L8R A;  4JV5 T;  3E0Z A;  2N2N A;  3P4S A;  4F8H A;  2VWA A;  5L47 A;  2CXD A;  2JQ9 A;  4U74 A;  1MIV A;  4WNK A;  5C8Y E;  2XQ3 A;  3EAB A;  4GKJ T;  2C0S A;  2Q9Q B;  3UUM A;  2K24 A;  4ZOL E;  5A1L A;  4YTN A;  2DHR A;  2C5J A;  1OED C;  2IML A;  2NTX A;  2E9X B;  2WDV A;  5HYA A;  3CPZ A;  3HKD E;  4TN7 B;  4YXD A;  2JQQ A;  2W62 A;  4H9S E;  3ETV A;  2BS3 A;  2D0U A;  2JIW A;  3AEE A;  4KX6 A;  3QUJ A;  4U33 A;  5EZY E;  3UUB A;  5ABF B;  1HR0 T;  2MOZ A;  2YKS A;  2NP9 A;  2OLT A;  2XQ5 A;  1S94 A;  5AQN B;  3P4P A;  2W0G A;  4QXB B;  4PAG A;  3UFE A;  2V6Y A;  1QLB A;  1YKH B;  3PU3 A;  2E9X C;  4ZS2 A;  4LMJ A;  4KBM B;  3LBX A;  3C4W A;  4WW0 A;  4WYV A;  3GMI A;  4XZC A;  5HXR A;  4DV5 T;  4AKH A;  3RIU C;  5FY0 A;  4QH4 A;  3NBX X;  2ZM0 A;  1NEN A;  2K48 A;  1HNW T;  4U2Y A;  4PK5 A;  1IZN B;  2VB6 A;  3ZYM A;  2XQ4 A;  3LFM A;  5L3E B;  1NEK A;  3N9O A;  1MMA A;  5BR8 T;  4TWD A;  1VCS A;  2MBG A;  5FL1 A;  5JDQ A;  3H37 A;  4ISS A;  3ANW B;  4UVC B;  3J7Y q;  3VKH A;  3A8Y C;  2BKP A;  2P9B A;  4OHF A;  2CM0 A;  5ADX L;  4IE0 A;  2WQY A;  4N78 D;  2B1E A;  3FZK B;  3O1J A;  4DR1 T;  2QGS A;  3RLF F;  3PDY A;  3Q5X A;  1Y64 B;  1ZP0 A;  4Z8X A;  3VR9 A;  4JI1 T;  3ZKR A;  4JI0 T;  5J1G A;  1MIW A;  5LXT E;  5GON E;  4LF9 T;  2DL1 A;  1E2A A;  4IIJ E;  3UU6 A;  4HWF A;  3PUR A;  2JRK A;  5AQI B;  5ABE A;  4CXY A;  5FP3 A;  5J2T E;  2D9D A;  4ZS3 A;  5JRC B;  4DV1 T;  2BG9 E;  5IUX A;  4AQY T;  1N32 T;  3LDQ B;  3CX8 B;  2X9Y A;  2ZM2 A;  3AEB A;  4P1N A;  4ASK A;  2E5L T;  4B3S T;  3ESL A;  4DV0 T;  2AXD S;  4U2Z A;  1FEW A;  2KWI B;  1SA0 E;  2BS4 A;  4PJJ A;  1J5E T;  2PG8 A;  1JNZ A;  4HGA A;  3UQ4 A;  4YT0 A;  5L3B B;  1Z8U A;  4YSZ A;  2KMF A;  4AQF C;  2UUC T;  1QSD A;  4AI6 A;  2YU1 A;  3A5X A;  2JPF A;  4ZI3 C;  4JYA T;  2ODU A;  5E0O A;  1O3X A;  2BDE A;  3H3A A;  2V7M A;  3LBX B;  2DI4 A;  3P4Q A;  4CN6 A;  2W61 A;  4LFA T;  2X68 A;  3ZC0 A;  5CA0 E;  2LE8 A;  4MAL A;  4X62 T;  3FZM B;  5L3F B;  3EDV A;  4ILA A;  1Z0P A;  2VKD A;  1E7P A;  2MYS A;  1UK5 A;  2FJA A;  2YDS A;  3C4X A;  3CQG B;  2CXF A;  3N9Q A;  2H88 A;  2NOX A;  4H63 H;  4LML A;  4P0B A;  4ZI7 E;  4JI7 T;  1HFA A;  3UU3 A;  1T98 A;  4CN4 A;  2VQF T;  3SWH A;  4HTE A;  5LA6 E;  3ZLI A;  3RIA A;  2W63 A;  5JDG A;  2Z6E A;  3RH3 A;  2I0M A;  4A5X A;  1QUU A;  2XAJ B;  3U3I A;  4IHJ E;  4COF A;  1LKX A;  2W00 A;  5ABH A;  2KXP B;  1OED B;  5DQW A;  4GKK T;  1W0A A;  3JC6 D;  3N5L A;  3UU4 A;  2CBJ A;  1ZHC A;  2L8K A;  1KNP A;  2M67 A;  3IF8 B;  3AEF A;  4MHC A;  3ZMZ B;  5LHG B;  1YXR A;  4YSX A;  5LMN T;  5JR9 A;  2FUP A;  2RA1 A;  3M3Z B;  1IJ5 A;  1MMD A;  4HFE A;  4WBO A;  4DUY T;  4JI6 T;  4HFV A;  1FJG T;  3CX7 B;  5HEH A;  4A56 A;  3C64 A;  2N1G A;  3N9L A;  3QK6 A;  3RX6 A;  1CHU A;  3OKQ A;  2PTF A;  3HI2 A;  4PK6 A;  3ZT5 A;  5AQF B;  2V6X A;  4X64 T;  4X20 E;  4BA9 A;  2IIU A;  4JUY A;  4LMK A;  2YIN A;  5HEJ A;  2D0T A;  2V8S V;  1NWM X;  4O4J E;  2WAU A;  5J2U E;  3AA6 B;  3AA0 B;  1IBL T;  1HX8 A;  5AQH B;  2W67 A;  4IE5 A;  2H7O A;  5HEO A;  3RC3 A;  3ZJ2 A;  5L2L A;  2EHO C;  2IUB A;  1WR0 A;  1SE7 A;  2G0U A;  2XAS B;  5FXW A;  3NRX A;  3GN5 B;  3T8O A;  1IBK T;  3NRY A;  1T72 A;  2BBH A;  4UEM A;  2H7V C;  4GK0 E;  4ILC A;  2WBL A;  5AQQ B;  4EED A;  4X1Y E;  4EAH A;  4ERR A;  5ABF A;  1D0Y A;  1CUN A;  4ILB A;  3NWI A;  2XUE A;  3FB2 A;  4TUY E;  1D1B A;  4AIS A;  4C91 A;  5JDM A;  2E2A A;  2H89 A;  2VL0 A;  1W0B A;  2KND A;  4YFS A;  3RI5 A;  1US7 B;  2UXC T;  3UUX B;  1ZKE A;  3O1H A;  1WYC A;  4UVB B;  4GOU A;  3ZMS B;  2X9X A;  4BJM A;  2E8I A;  3ZMU B;  3N9M A;  2L3L A;  2XTL A;  2WCA A;  4O8S A;  3X1D A;  2E9X D;  3KIN B;  2NW9 A;  3TKL B;  5LNK A;  5AQU B;  4EB6 E;  4MFR A;  2GK9 A;  3I9W A;  3RF1 A;  4QH5 A;  3WI3 A;  3L09 A;  4WBN E;  5AFU L;  1BR1 A;  4DO0 A;  4BJN A;  2WB5 A;  3SFE A;  5H6R B;  5AQS B;  5EK2 A;  3E22 E;  5LHI B;  4ZZC A;  4X65 T;  1M7K A;  2DWK A;  3EI0 A;  2YEV C;  3CK6 A;  5F8P A;  2ZM8 A;  4IRE A;  5FL0 A;  2ACX A;  2HH7 A;  1HX1 B;  3CKD A;  3N2O A;  4HFB A;  4YJ3 E;  3R84 B;  3RQW A;  5LB7 B;  2PBI A;  4OK0 A;  5AQO B;  3RRC A;  2KT9 A;  3SFD A;  3UUL A;  4CQI A;  2CEA A;  2LJL A;  4IDQ A;  2XQY A;  1J1J A;  1HG2 A;  2A72 A;  2DNX A;  1BR2 A;  3MZK B;  1JNR A;  2Q9Q D;  3G06 A;  3AVS A;  3AE8 A;  5CGM A;  4AXP A;  1AJ3 A;  1J5W A;  4NUV A;  2EHO D;  2ODV A;  1ZOY A;  1VCT A;  3AA7 B;  1IJ6 A;  3AA1 B;  3ZT7 A;  4EV6 A;  2HHH T;  3PU8 A;  4CXX A;  4JLE A;  2V7J A;  2XQ9 A;  4K0U A;  1UCU A;  5DJQ C;  5AQL B;  4DMV A;  4TWH A;  5EK4 A;  2L9Q A;  5L4H A;  2C5I T;  3AE1 A;  2XQA A;  3LK2 B;  4F6R C;  3KV5 A;  3S4U A;  2WZH A;  3QC9 A;  4X1K E;  3GA8 A;  2VUR A;  3TLU A;  2X9H A;  4QH1 A;  4LF5 T;  4U3C A;  3VR8 A;  2CWO A;  2XSA A;  3RQU A;  3MAC A;  4O4I E;  3T1H T;  2LSY A;  4LF8 T;  3AB3 B;  2IC9 A;  4EXT A;  1IBM T;  5HWY A;  3P7I A;  3RYI E;  4HWI B;  3AED A;  2WDQ A;  2WM9 A;  3FXE B;  4DV7 T;  4B3T T;  2W4X A;  2SPC A;  5HCJ A;  4EYY R;  5FXZ A;  5JDH A;  3OBV E;  2V7K A;  2LM2 A;  3PJA J;  4PJN A;  1WFD A;  4X5T A;  3C51 A;  1T8B A;  4HKA A;  2IHR 1;  2LSG A;  1OXZ A;  2MPK A;  4O4H E;  4EZH A;  5J0Z A;  3B5M A;  3Q5W A;  4UF0 B;  2BKN A;  4PFP A;  4ZI2 D;  1D0Z A;  2KSR A;  3B13 A;  4HWC A;  4P09 A;  1I6Z A;  4AIU A;  4CI3 B;  2J1D G;  1H7C A;  5JDN A;  4IE7 A;  3AE6 A;  1S35 A;  2D2S A;  3NVO A;  2WY2 A;  2BS2 A;  3PV0 F;  4HEA A;  2W2U A;  4HFD A;  3VU7 H;  5C2T A;  5HWX A;  5HEU A;  4U72 A;  2Y6X A;  3BQI A;  4G63 A;  4O4L E;  4B6X A;  5CFB A;  2FJB A;  5AQJ B;  3JC6 C;  2Q9Q C;  3ZJ1 A;  4Z90 A;  1SUM B;  5FMN A;  1WCR A;  2EHO A;  4KHP T;  3MJX A;  1KEY A;  2VKO A;  3K1S A;  4JI4 T;  5HXH A;  4EYU A;  4P0A A;  5LCY A;  1XMQ T;  3PUV F;  1XDP A;  3IBP A;  4IGU A;  5AQP B;  2VKH A;  4GYS A;  1EZ3 A;  3N2G E;  4QKN A;  4L0R A;  4PFO A;  3CVR A;  2LLY A;  2MAW A;  2QA7 A;  3IHR A;  3PUA A;  2I59 A;  2KWH A;  4DV2 T;  4QHO A;  3PUQ A;  3PUZ F;  3PE0 A;  3N9N A;  4LF6 T;  5JDL A;  1XZY A;  4JI8 T;  2WU5 A;  3K3Q C;  4M1P A;  3AE5 A;  2X51 A;  2RPA A;  3O1I A;  4J2C A;  3SOL A;  5FVK A;  4HWH A;  4YLH A;  4DMW A;  2X67 A;  5JVD E;  3OVU A;  3JAE A;  3UQ7 A;  5HXE A;  2IC6 A;  2HN1 A;  4X66 T;  1WYB A;  1UX5 A;  2IAK A;  3OYX A;  4I4T E;  5KMG P;  4DVD A;  3Q5D A;  4IST A;  4JEU B;  4KUM B;  2N9D A;  3CIR A;  4ZXL A;  3HL6 A;  3AAA B;  1U5P A;  2WP9 A;  5FXX A;  1VOM A;  1XWM A;  2JMH A;  3KVB A;  4ILU A;  4OYK A;  4LFB T;  3EVY A;  3ONJ A;  4A98 A;  1D1C A;  3P4W A;  3J9X 1;  4LF4 T;  1W09 A;  4HWD A;  2NWB A;  4UV9 B;  4UF0 A;  2X9W A;  3EUH A;  4IDO A;  1UUS A;  2FBW A;  3HR0 A;  2NW8 A;  3Q9D A;  4KI0 F;  3P8C D;  2LSJ A;  3CX6 B;  5AQG B;  1VRB A;  2JQH A;  5HCM A;  4A97 A;  5CJ5 A;  1G73 A;  4CI1 B;  1FMV A;  1DU2 A;  2LRL A;  1W9R A;  3BQK A;  4NPP A;  5KDM C;  3ZN1 B;  5M4Y A;  2CE7 A;  5JR9 B;  2UUA T;  5AQR B;  2BVL A;  3PUS A;  2LSK A;  2J4G A;  3QB5 K;  3UTK A;  2RP4 A;  1MMN A;  1D1A A;  3F57 A;  3ZT6 A;  5CA1 E;  4DV4 T;  3VRA A;  1GQE A;  5AQK B;  5FY7 A;  3OYZ A;  4V1A v;  3LJC A;  2XHE B;  5FNV E;  5LJN A;  2OA5 A;  2WS3 A;  3WAK A;  3KBT A;  3RYC E;  1HTJ F;  4PNI A;  2JMK A;  3RHW A;  2BZB A;  4TNW A;  2A9U A;  5HAX A;  5IYZ E;  3ZCJ A;  4GK5 E;  3ZMT B;  3LG7 A;  3UFG A;  4JI5 T;  3KV9 A;  4IT4 A;  5LBM A;  3PUY F;  3AXJ B;  2LT3 A;  1LRZ A;  3ANW A;  2ES0 A;  3AEA A;  2YDR A;  4HE8 A;  2HPJ A;  3FHN A;  3ZYL A;  4ADZ A;  2WSS V;  2F4V T;  2BG9 C;  4KHZ F;  2CLY C;  2A2F X;  4Q25 A;  2LSI A;  4PJM A;  3ZYK A;  3N9P A;  4GYR A;  5JRC A;  2KLQ A;  3I9Y A;  4OYJ A;  4HFI A;  4JEH B;  1LVK A;  4DR4 T;  2K9A A;  3AE9 A;  3V5S A;  2CHN A;  3LK4 2;  2KIN B;  4HFH A;  1YW0 A;  2CPT A;  4ZZB A;  2I6H A;  2NW7 A;  2E5V A;  2FJE A;  2UXX B;  3FXD B;  2J62 A;  2NTY A;  4E7S A;  5EK3 A;  4AQG A;  5LG3 A;  5IWA T;  1HCI A;  3BK9 A;  4I0U A;  5IHY A;  4DUZ T;  4ZEY A;  2X66 A;  3KV4 A;  4PK4 A;  4UIG A;  1HS7 A;  2BVM A;  2YDQ A;  3C98 B;  4AKR B;  3AE4 A;  4I55 E;  3RGL A;  3C4Z A;  1UUR A;  3D0T A;  3MXZ A;  4UVA B;  4YHJ A;  3AXJ A;  3FZF B;  3P50 A;  2M6I A;  3AE3 A;  3SS1 A;  5L3D B;  3AE7 A;  4DR2 T;  2UXB T;  2UUB T;  2CA5 A;  2CWY A;  3K3N A;  4TZ4 C;  3RYH E;  5LHH B;  3IA3 A;  3PUG A;  2E9X A;  2JJ9 A;  2XAG B;  5HXS A;  2XQ7 A;  2AE9 A;  1N34 T;  1X9B A;  1KF6 A;  3O4X E;  5LOV E;  1B7T A;  4O2A E;  4H9Q C;  3TLS A;  1ZEE A;  5JRE A;  1OWA A;  4TV8 E;  1BR0 A;  1OED A;  4JBW F;  3QNU A;  4QX8 B;  4CN1 A;  4ZI2 C;  4EIW A;  5LJM A;  5LG4 A;  4DV6 T;  3RKO A;  4AKI A;  4HFC A;  1KK7 A;  1UX4 A;  4IL9 A;  4LFC T;  2UXD T;  4EOZ B;  4H63 V;  3TLV A;  4K0K T;  2K3W A;  3KVA A;  5TAO A;  3UU5 A;  4HN9 A;  2BKO A;  2ZMA A;  4I50 E;  2NR4 A;  5AQT B;  2UU9 T;  3Q2M A;  2BBJ A;  2BG9 A;  2DCF A;  5ETW A;  4YSY A;  1WR6 A;  3K3O A;  1I94 T;  3RIF A;  3T1Y T;  4IE4 A;  4ZHQ E;  5H6Q B;  4C90 A;  3AEC A;  2X0Y A;  3B57 A;  1M62 A;  3NZQ A;  1HG5 A;  1L0V A;  4JI2 T;  1HNZ T;  4YY3 T;  4EEB A;  1KNR A;  3PTR B;  3RYF E;  1YQ4 A;  2V5D A;  2PJQ A;  4KMC A;  2MTQ A;  3ZST A;  2PFV A;  3PUW F;  4U31 A;  2HPL A;  2IDO B;  5L4E A;  2V7L A;  3O9X A;  3FBL A;  4I43 B;  3R6N A;  4BAY B;  3A7M A;  4QX7 B;  4IL4 A;  2V6Y B;  3TLW A;  4JI3 T;  4CZZ B;  2QYW A;  2XAQ B;  2VK9 A;  3KFW X;  4LF7 T;  4B3M T;  2WMN A;  3NKZ A;  4DR6 T;  2LOP A;  2CBI A;  3EDU A;  5FXV A;  2BG9 B;  2UXN B;  4IDN A;  3QB5 A;  4IE6 A;  1XNR T;  4H9P C;  1IAP A;  3JAF A;  3PUX F;  3ZMV B;  2W66 A;  1U4Q A;  4XBF B;  2HN2 A;  1X79 A;  5DAB A;  4NXN T;  3BQL A;  3MA9 A;  5LGU B;  4X1I E;  3N2K E;  4MBQ A;  5AQV B;  2CRB A;  3KDS E;  2R6G F;  4WZX A;  2CXL A;  1MND A;  2CHO A;  4OFZ A;  4DV3 T;  5F3J A;  1XNQ T;  5KXJ A;  1YQ3 A;  2A3D A;  2CCQ A;  3HKE E;  4XAX B;  1BR4 A;  2WZI A;  4IDZ A;  3U78 A;  4OX9 T;  5LBQ B;  2V5C A;  5HXC A;  3ZSS A;  4YHH T;  3NZP A;  3AE2 A;  2LKH A;  3JCF A;  4AKG A;  3ZEF B;  3AAE B;  2VKJ A;  1HNX T;  1E1H B;  1V9D A;  2KZ7 B;  3MKD A;  5AQM B;  3VRB A;  3LK3 B;  3UU8 A;  3ONL C;  3FZH B;  4AQF A;  3RC8 A;  2LHN A;  2DLR A;  3SRZ A;  5L3G B;  2LRK A;  2DWG A;  3HKB E;  2XAF B;  4TV9 E;  5LP6 E;  4H9N C;  3I0Q A;  2YN6 A; 
#chains in the Genus database with same CATH homology
 4QXC B;  2LM9 A;  1FIO A;  4YJ2 E;  1ZV4 X;  2D5U A;  2H3R A;  4QWN B;  5KX5 E;  3CML A;  4L9I A;  1D0X A;  3I1A A;  2WWU A;  3FBZ A;  4ANJ A;  5DQV A;  3HKC E;  1YD8 G;  2LHR A;  4G2A A;  5L3C B;  3CQC B;  1FMW A;  3ZPO A;  3RPU A;  4UEL A;  1G8X A;  1NAF A;  5LGT B;  2CMR A;  2VAS A;  3C50 A;  3GWH A;  3K8P C;  3ZC1 A;  4ZI3 D;  3CWZ B;  2V1D B;  2Q9Q A;  3MK7 C;  1WRD A;  5JDF A;  1YKE B;  5JR9 C;  3DP7 A;  3V5U A;  3F31 A;  3AAI A;  1MMG A;  3KV6 A;  3ONX A;  4PW8 A;  3DJB A;  5BMV E;  3UT5 E;  2VL8 A;  4MLK A;  4QXH B;  4UV8 B;  3CQX C;  4EZ4 A;  3I0O A;  4KP3 C;  5CB4 E;  2YK0 A;  5JH7 E;  2YU2 A;  4DND A;  2EHO B;  4CXW A;  3UUN A;  1LVF A;  1MNE A;  1KNZ A;  2XAH B;  3W15 B;  3VKG A;  1MIY A;  1WLX A;  5FY1 A;  2IW5 B;  3OJA A;  3VHL A;  4CI2 B;  3AVR A;  1SHZ C;  3GN5 A;  5JQG E;  5FYM A;  2ZLY A;  3KBU A;  2V26 A;  3E08 A;  3M65 A;  2V7I A;  3HA4 A;  4O2B E;  3DTO A;  2Y48 B;  4H9R C;  1HF8 A;  3RRW A;  2C5K T;  4PJL A;  2WMO A;  4FI5 A;  4TX5 A;  4E7Z A;  4H9O C;  3ZN0 B;  3ZCI A;  5LGN B;  2LOS A;  4NUU A;  3L3P A;  4AKL A;  4GIW A;  4DBR A;  2LEH A;  5LYJ E;  3IEE A;  3F2E A;  4UXN B;  2Y8D A;  4L5G A;  2X0L B;  3WAJ A;  2K5B B;  3ETU A;  4DBQ A;  4FJO A;  2CLY B;  3E0Z A;  2N2N A;  2VWA A;  2CXD A;  4U74 A;  4WNK A;  1MIV A;  5C8Y E;  2C0S A;  2Q9Q B;  3UUM A;  2K24 A;  4ZOL E;  5A1L A;  2DHR A;  2C5J A;  2NTX A;  2E9X B;  5HYA A;  3CPZ A;  3HKD E;  4TN7 B;  2JQQ A;  2W62 A;  4H9S E;  3ETV A;  5EZY E;  2D0U A;  5KDM C;  3QUJ A;  2MOZ A;  2NP9 A;  1S94 A;  2W0G A;  4QXB B;  4PAG A;  3UFE A;  1YKH B;  3PU3 A;  2E9X C;  4ZS2 A;  4KBM B;  3LBX A;  3C4W A;  4WW0 A;  3GMI A;  4XZC A;  5HXR A;  4AKH A;  5FY0 A;  3NBX X;  2ZM0 A;  2K48 A;  4PK5 A;  1IZN B;  2VB6 A;  3ZYM A;  3LFM A;  5L3E B;  3N9O A;  1MMA A;  5JDQ A;  2MBG A;  3J7Y q;  3H37 A;  4ISS A;  3ANW B;  4UVC B;  3VKH A;  2P9B A;  4OHF A;  2CM0 A;  5ADX L;  4IE0 A;  4N78 D;  2B1E A;  3O1J A;  2QGS A;  3PDY A;  3Q5X A;  1Y64 B;  4Z8X A;  5J1G A;  1MIW A;  5LXT E;  5GON E;  4IIJ E;  3PUR A;  2JRK A;  5J2T E;  4CXY A;  5FP3 A;  4ZS3 A;  3CX8 B;  2X9Y A;  2ZM2 A;  4ASK A;  3ESL A;  1FEW A;  2KWI B;  1SA0 E;  4PJJ A;  2PG8 A;  4HGA A;  5L3B B;  2KMF A;  4AQF C;  1QSD A;  4AI6 A;  2YU1 A;  3A5X A;  2JPF A;  4ZI3 C;  2ODU A;  5E0O A;  1O3X A;  2BDE A;  3H3A A;  2V7M A;  3LBX B;  2DI4 A;  4EAH A;  2W61 A;  2X68 A;  3ZC0 A;  5CA0 E;  2LE8 A;  4MAL A;  5L3F B;  3EDV A;  1Z0P A;  2VKD A;  2MYS A;  3C4X A;  3CQG B;  3N9Q A;  4P0B A;  2CXF A;  2NOX A;  4H63 H;  4ZI7 E;  1HFA A;  1T98 A;  3SWH A;  4HTE A;  5LA6 E;  3ZLI A;  5JDG A;  2W63 A;  2Z6E A;  3RH3 A;  1QUU A;  2XAJ B;  3U3I A;  4IHJ E;  1LKX A;  2W00 A;  2KXP B;  5DQW A;  3JC6 D;  3N5L A;  1ZHC A;  2L8K A;  2M67 A;  3IF8 B;  4MHC A;  3ZMZ B;  5LHG B;  5JR9 A;  2RA1 A;  1IJ5 A;  1MMD A;  4WBO A;  4HFV A;  3CX7 B;  4A56 A;  3C64 A;  2N1G A;  3N9L A;  3QK6 A;  3RX6 A;  3OKQ A;  3HI2 A;  4PK6 A;  4X20 E;  4BA9 A;  4JUY A;  2YIN A;  2D0T A;  1NWM X;  4O4J E;  2WAU A;  5J2U E;  3AA6 B;  3AA0 B;  1HX8 A;  4IE5 A;  2H7O A;  3RC3 A;  3ZJ2 A;  5L2L A;  2EHO C;  5FXW A;  2G0U A;  2XAS B;  3T8O A;  3NRX A;  3GN5 B;  3NRY A;  4UEM A;  2H7V C;  4GK0 E;  2WBL A;  4X1Y E;  4ERR A;  1D0Y A;  1CUN A;  2XUE A;  3FB2 A;  4TUY E;  1D1B A;  4C91 A;  5JDM A;  2KND A;  4YFS A;  1US7 B;  3UUX B;  1ZKE A;  3O1H A;  1WYC A;  4UVB B;  4GOU A;  3ZMS B;  2X9X A;  4BJM A;  2E8I A;  3ZMU B;  3N9M A;  2L3L A;  2XTL A;  5LNK A;  4O8S A;  2E9X D;  3KIN B;  2NW9 A;  3TKL B;  4EB6 E;  4MFR A;  2GK9 A;  3I9W A;  3WI3 A;  3L09 A;  4WBN E;  5AFU L;  1BR1 A;  4DO0 A;  4BJN A;  5LHI B;  5H6R B;  5EK2 A;  3E22 E;  2DWK A;  5F8P A;  2YEV C;  2ZM8 A;  2ACX A;  2HH7 A;  3CKD A;  3N2O A;  4F6R C;  4YJ3 E;  3R84 B;  3RRC A;  5HXE A;  2PBI A;  4OK0 A;  2KT9 A;  3UUL A;  4CQI A;  2CEA A;  2LJL A;  2XQY A;  1HG2 A;  2A72 A;  2DNX A;  3MZK B;  1BR2 A;  2Q9Q D;  3AVS A;  4AXP A;  1AJ3 A;  4NUV A;  2EHO D;  2ODV A;  3AA7 B;  1IJ6 A;  3AA1 B;  3PU8 A;  4CXX A;  4JLE A;  2V7J A;  4K0U A;  1UCU A;  5DJQ C;  4DMV A;  5EK4 A;  2L9Q A;  2C5I T;  3LK2 B;  3KV5 A;  3S4U A;  3QC9 A;  4X1K E;  3GA8 A;  2X9H A;  2CWO A;  3MAC A;  4O4I E;  2LSY A;  3AB3 B;  2IC9 A;  4EXT A;  5HWY A;  3P7I A;  3RYI E;  3FXE B;  2WM9 A;  2SPC A;  4EYY R;  5JDH A;  5FXZ A;  3OBV E;  2V7K A;  4PJN A;  4EZH A;  3C51 A;  4HKA A;  4O4H E;  2LSG A;  1OXZ A;  3Q5W A;  4UF0 B;  4PFP A;  4ZI2 D;  1D0Z A;  3B13 A;  4P09 A;  4CI3 B;  2J1D G;  1H7C A;  5JDN A;  4IE7 A;  4UV9 B;  1S35 A;  2D2S A;  5JRC B;  4HEA A;  3VU7 H;  5HWX A;  4U72 A;  2Y6X A;  3BQI A;  4G63 A;  4O4L E;  4B6X A;  3JC6 C;  2Q9Q C;  3ZJ1 A;  5FMN A;  2EHO A;  3MJX A;  2VKO A;  5HXH A;  4EYU A;  4P0A A;  5LCY A;  3IBP A;  4IGU A;  2VKH A;  4GYS A;  1EZ3 A;  3N2G E;  4QKN A;  4L0R A;  4PFO A;  3CVR A;  3IHR A;  3PUA A;  2QA7 A;  2I59 A;  2KWH A;  4QHO A;  3PUQ A;  3PE0 A;  3N9N A;  5JDL A;  3K3Q C;  4M1P A;  3O1I A;  2X51 A;  4J2C A;  3SOL A;  4YLH A;  4DMW A;  2X67 A;  5JVD E;  2IC6 A;  1WYB A;  1UX5 A;  2IAK A;  3OYX A;  4I4T E;  5KMG P;  4DVD A;  4IST A;  4JEU B;  4KUM B;  2N9D A;  3HL6 A;  3AAA B;  1U5P A;  5FXX A;  5JRC A;  1VOM A;  2JMH A;  3KVB A;  4OYK A;  4ILU A;  3EVY A;  1D1C A;  3J9X 1;  2NWB A;  4UF0 A;  2X9W A;  3EUH A;  3HR0 A;  2NW8 A;  3Q9D A;  3P8C D;  2LSJ A;  3CX6 B;  1VRB A;  1G73 A;  4CI1 B;  1FMV A;  3BQK A;  5M4Y A;  3ZN1 B;  2CE7 A;  5JR9 B;  2BVL A;  3PUS A;  2LSK A;  3UTK A;  2RP4 A;  1MMN A;  1D1A A;  3F57 A;  5CA1 E;  5FY7 A;  3OYZ A;  4V1A v;  3LJC A;  2XHE B;  5FNV E;  5LJN A;  2OA5 A;  3WAK A;  3KBT A;  3RYC E;  1HTJ F;  4PNI A;  2JMK A;  3ZCJ A;  2BZB A;  5HAX A;  5IYZ E;  3ZMT B;  4GK5 E;  3LG7 A;  3KV9 A;  5LBM A;  2LT3 A;  1LRZ A;  3ANW A;  2ES0 A;  4HE8 A;  2HPJ A;  3FHN A;  3ZYL A;  4ADZ A;  2WSS V;  2CLY C;  2A2F X;  3ZYK A;  2LSI A;  4PJM A;  3N9P A;  4GYR A;  2KLQ A;  3I9Y A;  4OYJ A;  4JEH B;  1LVK A;  2K9A A;  3V5S A;  3LK4 2;  2KIN B;  1YW0 A;  2NW7 A;  2UXX B;  3FXD B;  2NTY A;  4E7S A;  5EK3 A;  4AQG A;  1HCI A;  3BK9 A;  5IHY A;  2X66 A;  3KV4 A;  4PK4 A;  4UIG A;  1HS7 A;  2BVM A;  3C98 B;  4AKR B;  4I55 E;  3C4Z A;  3D0T A;  3MXZ A;  4UVA B;  4YHJ A;  3SS1 A;  5L3D B;  2CA5 A;  2CWY A;  3K3N A;  4TZ4 C;  3RYH E;  5LHH B;  3PUG A;  2E9X A;  2JJ9 A;  2XAG B;  5HXS A;  3O4X E;  5LOV E;  1B7T A;  4O2A E;  4H9Q C;  5JRE A;  1ZEE A;  1OWA A;  4TV8 E;  1BR0 A;  4QX8 B;  4ZI2 C;  4EIW A;  5LJM A;  5LG4 A;  4AKI A;  3RKO A;  1KK7 A;  1UX4 A;  4EOZ B;  4H63 V;  3KVA A;  5TAO A;  4HN9 A;  2ZMA A;  4I50 E;  3Q2M A;  2DCF A;  5ETW A;  1WR6 A;  3K3O A;  4IE4 A;  4ZHQ E;  5H6Q B;  4C90 A;  3B57 A;  3NZQ A;  1HG5 A;  3PTR B;  3RYF E;  4KMC A;  2PJQ A;  2MTQ A;  2PFV A;  2HPL A;  2V7L A;  3O9X A;  3FBL A;  4I43 B;  3R6N A;  4BAY B;  4QX7 B;  4CZZ B;  2XAQ B;  2VK9 A;  3KFW X;  2WMN A;  2LOP A;  3EDU A;  5FXV A;  2UXN B;  4IE6 A;  4H9P C;  1IAP A;  4XBF B;  3ZMV B;  1U4Q A;  1X79 A;  5DAB A;  3BQL A;  3MA9 A;  5LGU B;  4X1I E;  3N2K E;  4MBQ A;  3KDS E;  2CXL A;  1MND A;  4OFZ A;  5F3J A;  2A3D A;  2CCQ A;  3HKE E;  4XAX B;  1BR4 A;  4IDZ A;  3U78 A;  5LBQ B;  5HXC A;  3NZP A;  4AKG A;  3ZEF B;  3AAE B;  2VKJ A;  1E1H B;  1V9D A;  2KZ7 B;  3MKD A;  3LK3 B;  4AQF A;  3RC8 A;  2LHN A;  2DLR A;  3SRZ A;  5L3G B;  2DWG A;  3HKB E;  2XAF B;  4TV9 E;  5LP6 E;  4H9N C;  3I0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...