4ZI3D

Bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
128
structure length
128
Chain Sequence
AEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
total genus 54
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi3D00
4ZI3C 2K9AA 4ZI3D 4ZI2C 4ZI2D
chains in the Genus database with same CATH superfamily
4HFHA 3RYCE 2DWGA 4H9RC 2ODUA 3L3PA 2CM0A 2FJDA 2W63A 3TLUA 5L2LA 1YD8G 2KNDA 3ZC0A 4KBMB 3RKOA 2DLRA 3I1AA 3CKDA 4WYVA 4ZZBA 4V1Av 5IHYA 3CQXC 4H9OC 4DV3T 1R8IA 4ILUA 4IHJE 2ZM6T 3BQIA 3HKEE 5AQOB 3T1YT 3G06A 2WB5A 2IMLA 2E2AA 3HA4A 4TWDA 1SA0E 1MMDA 2CE7A 2LEHA 5HWXA 5ABFA 3ETVA 4MALA 1UK5A 5IYZE 4IE4A 5LG4A 2IDOB 1IJ6A 3ZPOA 3C51A 4EZHA 1N36T 2BG9E 5HEOA 2XAQB 2UUAT 4UF0B 2XSAA 2FJAA 4AKGA 2IIUA 4ILBA 1LRZA 3SWHA 2WY2A 4ILAA 1HX8A 5AQMB 2QA7A 2RPAA 5FL1A 2X0HA 1B7TA 3RF1A 1YKHB 5L3BB 2SPCA 2WBLA 2VL0A 3E08A 5FXXA 5DABA 4YLHA 1Y64B 4KX6A 2YINA 4EV6A 2X0YA 3UUBA 4H9SE 2V7MA 2X9WA 2MBGA 1FEWA 2BS3A 4LFAT 3C98B 3MJXA 5ABEA 2WZIA 4AI6A 1D1AA 2B76A 2W61A 4C91A 3DJBA 3LK3B 2B1EA 2XJ7A 2W67A 3ZT5A 2UUCT 3SOLA 4IIJE 5FXWA 4EAHA 1I6ZA 4E7ZA 3HKCE 3KBUA 3K3OA 2E5LT 4UV9B 4JI5T 1MNEA 2XTLA 3IEEA 4KUMB 1SHZC 3GWHA 4KHPT 4BAYB 2JJ9A 4CI1B 4QXBB 2MYSA 5KDMC 3AA7B 2DI4A 5LBQB 4AKRB 2KINB 3OYXA 4DV2T 4EB6E 5EK4A 1Y01A 2CHNA 3RC8A 2JQHA 4DR1T 2W2UA 1J5ET 3O1HA 4JEUB 2CCQA 3P4PA 4ZEYA 2A9UA 3PJAA 3KV5A 1HF8A 1XDPA 1MIVA 1S94A 4ZI7E 1BR4A 2M6BA 4B3TT 2KZ7B 3L8RA 1CUNA 2AE9A 5AQPB 3TLTA 5L3GB 5FVKA 4HWFA 5DJQC 4K0KT 2KMFA 2EHOA 3AEDA 5FY0A 3Q5DA 5FY1A 3EVYA 3Q5WA 3PE0A 4DBQA 2CEAA 3AXJA 2J1DG 4GYRA 4PK6A 4TUYE 4ILCA 4DMWA 4DR4T 1I94T 2E9XD 3M3ZB 2N1GA 3P4QA 4JI4T 3CPZA 4ZOLE 5FXZA 2I59A 2C0SA 2H3RA 4WW0A 3A8YC 5L3FB 2N2NA 3ONJA 3AVSA 3RI5A 4TWFA 2ACZA 4JI2T 2OLTA 4TV9E 3DTOA 3SRZA 3ZYMA 3F57A 3RX6A 4DO0A 2WDRA 1HFAA 4JLEA 4Z90A 4LMLA 3NVOA 1SE7A 1NEKA 2YEVC 4JV5T 3I9WA 4X1IE 4CXWA 3CIRA 5HXSA 3ZN0B 1OEDB 3CX7B 4IREA 2CPTA 3RRWA 2XQ8A 2I6HA 3ZKRA 2CBIA 3UQ4A 3B5MA 2YDRA 3ZMUB 2G0UA 5CA1E 4DR5T 4DIDB 1US7B 1G8XA 3FZMB 4I50E 3JAFA 4K0UA 3IHRA 2EHOB 3AE1A 4P0AA 2WMNA 1FIOA 5JQGE 2LHNA 2ZMAA 2XSBA 3AXJB 3ZCJA 4PW8A 4QHOA 3OKQA 3AEGA 5E0OA 2XAFB 4TWHA 2X51A 1KNZA 2ZLYA 3CX8B 2CXDA 3HL6A 4PJNA 2UXCT 2C5JA 5EK3A 2NTXA 2I0MA 5AQUB 2VK9A 2YU2A 2NTYA 3RIFA 5FNVE 2WCAA 5ETWA 4CQIA 3B57A 5ABHA 3QB5K 3PUSA 3N5LA 3K1SA 5JR9C 4OK0A 2BZBA 3ANWA 3EHZA 1HNXT 3K3QC 4X5TA 1HX1B 2XUEA 3LK2B 4LF7T 4B3ST 3N9NA 2D0UA 1M7KA 1ZV4X 4XBFB 2V6YB 5HEJA 2V8SV 2LSIA 4LF4T 1XWMA 5CJ5A 3LJCA 3Q2MA 2F4VT 2CLYC 4UR9A 3MACA 1X9BA 2WWVA 4J2CA 3VKGA 3X1DA 4UIGA 4O8SA 5BMVE 3O4XE 4X1YE 5EZYE 4G63A 4B3RT 4H63V 2Y8DA 1BR0A 4PNIA 2JQKA 2D9DA 3RIUA 3BK9A 2L8KA 4P1NA 4JEHB 4CXXA 3N2KE 2M67A 3E22E 4HFBA 4TX5A 3RGLA 4C90A 1W0AA 3ANWB 2XQ3A 5H6RB 4HFCA 3AAAB 3AE3A 4I43B 3AE5A 3FXDB 4F6RC 2K24A 4U33A 2JMHA 3TLVA 2BVLA 4BJNA 5AQGB 2DNXA 3CWZB 1FJGT 4ZS3A 2DCFA 2Y48B 2Y6XA 3NRYA 1DU2A 1ZP0A 4YSYA 5LNKA 4NIQA 2GK9A 3SFEA 4IE0A 2VWAA 4PK4A 4A56A 2WMOA 4GOUA 1HTJF 2WDVA 4TNWA 3FZHB 3EI0A 3KFWX 4IE7A 3UU6A 4WBOA 3WI3A 2NWBA 4ZI2D 5CFBA 4LFCT 3PUVF 1NWMX 2ZM8A 4U7YA 2LRKA 2NW8A 2PFVA 1XMQT 4GKJT 4KP3C 4HFIA 4OHFA 3AEEA 5LA6E 5AQSB 1GQEA 4WNKA 2XY8B 4ZS2A 3JCFA 2BKNA 4CI3B 4X64T 3ONXA 2DHRA 2BVMA 2LRLA 5AQVB 2MTQA 2NP9A 1U5PA 4MLKA 1QSDA 4Z91A 1MIWA 5L4EA 2XQ5A 3H3MA 5FMNA 4HFDA 3PUZF 4UVBB 5AQRB 1KK7A 2XQ7A 1XZYA 5HEHA 4Q25A 5JTGA 2CXLA 4L9IA 4TZ4C 2V5DA 1MMNA 4IDPA 1E2AA 4LF5T 2KWIB 4JI8T 4IT4A 1FMWA 4NUUA 5LP6E 4PJJA 4U2YA 4OYJA 4O4JE 1Z0PA 4KI0F 3PU8A 3N2OA 2BKPA 4GIWA 4DR6T 2E9XC 2KXPB 4ASKA 2Q9QA 2JRKA 4PFOA 4CN4A 3RPUA 4DV5T 3VHLA 4JI1T 3FHNA 3N2GE 2WP9A 2FUPA 1WR6A 2Z6EA 1D0ZA 1KNRA 4EOZB 1X79A 3OBVE 1WYBA 2E8IA 3RIAA 3H3AA 3RYFE 4DV7T 1HNZT 3BQKA 5F3JA 5AQLB 1MMGA 4DV1T 4YHHT 5JREA 3AAEB 3P4SA 2C5KT 3FXEB 2PJQA 5LJMA 3N9OA 3AE7A 5LBMA 3FZLB 2CA5A 3OVUA 4OFZA 3KDSE 5L47A 4XZCA 3QNUA 5LHHB 2CWYA 3LK42 2YN6A 4AKLA 2KLQA 4PJMA 5L3EB 2H7VC 2L9QA 1M62A 5L4HA 3RLFF 2XASB 3C4WA 1AJ3A 3UFEA 4EGWA 4EYUA 3PUQA 4IL9A 4HWHA 1OEDE 2LSGA 4P0BA 4G2AA 3UU3A 3LBXA 3OTOT 2UUBT 5H6QB 2IHR1 3Q9DA 3MK7C 2BG9C 4H63H 2OV9A 5HXRA 4QXCB 4WBNE 5FL0A 2Q9QB 3KV4A 1N34T 5CB4E 2W00A 3I9YA 5AQHB 3VR8A 3P7IA 2XPKA 2CBJA 3GN5A 4WZXA 1OEDA 2UXDT 3RQUA 1J1JA 4AXPA 4QH5A 2IAKA 4PAGA 4A98A 2AXDS 2C5IT 3AE4A 4LMJA 1E1HB 1WRDA 2KT9A 2D5UA 4ZI3D 5ABGA 2J4GA 3RQWA 5HYAA 5AQQB 3QB5A 3PV0F 3AEFA 2JQQA 5LB7B 3AE9A 4UXNB 4AQGA 2X9XA 1T7SA 3WAKA 5LOVE 3N9QA 3LSVA 4IGUA 4YTNA 4GKKT 3OPCA 3NZQA 5LCYA 1WR0A 2VL8A 4X66T 3ZYKA 3O1JA 3L39A 2WU5A 5AFUL 5JDGA 4YY3T 2H88A 2KSRA 3LBXB 5JDLA 3U78A 2YDQA 2XQ9A 4FJOA 4AIUA 1CHUA 2X9YA 3LDQB 4AQFA 5AQNB 3C50A 2DWKA 5JDNA 4AQYT 3W15B 3ZEFB 4HTEA 3ZYLA 5KX5E 3GN5B 1MMAA 4F8HA 3ABVA 3F2EA 3AA0B 3FBZA 5DQWA 2EHOC 2WSSV 4YSZA 2V6YA 2WM9A 2V7IA 3AAIA 3PDYA 4GK0E 4YHJA 3PUGA 2HN2A 3EDVA 2LSKA 1JNZA 1YQ3A 3EABA 1L0VA 4LF8T 3UU4A 1UGOA 2VQET 1ZEEA 3RYIE 2PTFA 1ZHCA 4DR3T 4QH4A 5LYJE 2VURA 3C4XA 5IWAT 5HXHA 3UU5A 4JI3T 3ZSSA 5JDFA 1S35A 4CZZB 2W62A 2CRBA 3HR0A 2HPLA 1T98A 3R6NA 2BS4A 1VOMA 2IUBA 3ESLA 4LF6T 4HWDA 4IDOA 4NUVA 4ZI2C 2X9HA 3JAEA 3KV9A 2OA5A 2L3LA 4CN1A 4AKHA 5KXJA 4PFPA 3C64A 1HG5A 4QXHB 1XNQT 2WS3A 4JYAT 3UQ7A 1N33T 5FYMA 5LMUT 1HS7A 1W0BA 1T72A 5AQJB 2XQAA 4A97A 4YJ3E 2NR4A 2ZM2A 2A2FX 2JPFA 1FMVA 3J7Yq 5JR9B 2K5BB 1IBMT 1KNPA 2WDQA 2MOZA 1LVKA 3IBPA 2HN1A 1N32T 2XAGB 2JQ9A 4YSXA 5KMGP 2PBIA 2KWHA 2XM1A 3HI2A 3EAMA 2XAHB 4LMKA 2V1DB 3CX6B 4XAXB 1VCTA 3OYZA 4X65T 3AB3B 1T8BA 2R6GF 3JC6C 5C2TA 1ZKEA 3CQCB 4PK5A 5JVDE 2EHOD 4JI7T 5JDQA 4AISA 3KVAA 4KMCA 5F5WA 3PTRB 3VRAA 3F31A 2NW7A 4UELA 3LFMA 3RHWA 2P9BA 4EYYR 3TLWA 2XQYA 2YKSA 4OYKA 4UV8B 2V5CA 3ONLC 4YTPA 4ISSA 2V26A 2ZM0A 3AA1B 3ZJ2A 2BBJA 3JADA 1UUSA 4MFRA 5HEGA 5HWYA 2W66A 2IC6A 3FBLA 3BQLA 4X20E 1W9RA 5FY7A 1HR0T 4X62T 5ADXL 1WLXA 5LJNA 3MA9A 3CK6A 3FZFB 4L0RA 3VU7H 1YW0A 5IUXA 2VASA 4JBWF 3RIUC 3NWIA 4I0UA 3AA6B 2LLYA 3ZT6A 4DNDA 4DUZT 4O4LE 4I4TE 4DBRA 2X0LB 2LOSA 2K48A 5A1LA 3S4UA 4TV8E 4QX7B 5AQTB 2LHRA 3I0OA 2LE8A 3UULA 4ZHQE 5HXCA 2E9XA 3LG7A 4DVDA 3N9LA 1UCUA 2CXFA 4KHZF 3N9MA 2VKOA 4TN7B 2A3DA 2A72A 3DP7A 5LGUB 4IL4A 3L09A 4GK5E 3SS1A 5LXTE 2IC9A 4ZZCA 3CVRA 4JUYA 2X67A 4U74A 4HE8A 1KF6A 4U3CA 2XZEA 4ZI3C 3JC6D 2VKJA 4O4IE 1G73A 2X66A 4HWCA 1UX4A 3SFDA 3V5SA 1NAFA 2ES0A 2XQ6A 2MPKA 4P09A 4YJ2E 3PUWF 3RYHE 4JI6T 2VKDA 1LVFA 3GMIA 3K8PC 2NOXA 4H9QC 2H89A 4IDNA 3QK6A 3AEBA 3PURA 5AQIB 4YXDA 3P50A 4YT0A 1WFDA 5EK2A 2V7KA 1MNDA 3O1IA 5C8YE 5J0ZA 2V6XA 3ETUA 2LKHA 2LOPA 4MHCA 3AE8A 1XMOT 1XDOA 2XAJB 3P8CD 4YFSA 2BG9A 4HFVA 5HAXA 2CMRA 2E9XB 1D1CA 4PJLA 1HCIA 3CMLA 4Z8XA 4GYSA 4ZXLA 2YU1A 3PU3A 2WU2A 5JDMA 2MAWA 2ACXA 2HH7A 2VQFT 5GONE 3ZSTA 2LJLA 4QX8B 2UXBT 3NBXX 3R84B 4QKNA 5J1GA 3FB2A 3AVRA 3K3NA 2LT3A 2VVNA 3MZKB 2RA1A 3N9PA 2Q9QC 5ABFB 4U2ZA 2HPJA 3ZC1A 5LMNT 5L3CB 3KBTA 5LHGB 2VVSA 2VKHA 1IBKT 2FJEA 4IDQA 3EUHA 1VCSA 2CWOA 3HKBE 3OJAA 1IBLT 4QH1A 3RC3A 4BJMA 3Q5EA 4O2AE 3AE2A 4ERRA 1LKXA 4YTMA 4DV0T 2W4XA 5LG3A 1YKEB 3QUJA 2BG9B 5HCJA 3I0QA 5C3JA 1WYCA 4EXTA 3NZPA 4DR2T 4IE5A 4HEAA 1OXZA 1YXRA 4X1KE 2LSJA 4HWIB 4OX9T 2BDEA 3P4WA 5CGMA 1Z8UA 3NRXA 1U4QA 4QWNB 2QRXA 3WAJA 5HXEA 3PUAA 3M65A 4UVAB 2UXNB 3CQGB 4ANJA 2JMKA 3GA8A 3ZMVB 3A5XA 3VR9A 2WAUA 5LHIB 4HGAA 2V7LA 1OEDC 5HEUA 5L3DB 2QYWA 2YDSA 4UVCB 5DQVA 3UFGA 3RKGA 2UXXB 3UU8A 2QVAA 2LSYA 2K9AA 4BA9A 2V7JA 3HKDE 4LFBT 4NXNT 4DUYT 3UTKA 3VRBA 5LGNB 3PJAJ 5JRCA 1D1BA 4HFEA 2M6IA 4MBQA 2BBHA 4E7SA 3TLSA 5JDHA 3A7MA 2XHEB 1XNRT 3UT5E 1IJ5A 4IE6A 3FZKB 2XM2A 3AEAA 5CA0E 5JR9A 1IAPA 2IW5B 4JI0T 2E5VA 2RP4A 3QOFA 2Q9QD 1J5WA 4M1PA 1WCRA 3AE6A 3H37A 1HNWT 3ZT7A 4FI5A 1HG2A 4IDZA 3ZMTB 3KINB 1H7CA 4B3MT 5FVLA 2BKOA 4A5XA 2X68A 3RRCA 1ZOYA 3TKLB 4EIWA 4AQFC 3U3IA 5J2TE 3UUMA 4N78D 4NPPA 4NXMT 4O4HE 3E0ZA 2VB6A 3AECA 4H9PC 3J9X1 4EZ4A 1OWAA 1KFYA 5FP3A 2DL1A 1YQ4A 3ZLIA 3MXZA 3MKDA 4L5GA 2LM9A 5FXVA 3ZCIA 2K3WA 3VKHA 4COFA 2ODVA 5HCMA 3IA3A 4TNVA 3UUXB 5JRCB 2WQYA 2LM2A 3D0TA 2D0TA 3ZJ1A 1VRBA 2LKGA 1E7PA 5BR8T 4UEMA 2QGSA 2YOEA 2J47A 1MIYA 4ISTA 4H9NC 1IZNB 2WZHA 5J2UE 5AQFB 2J62A 2XQ4A 3T8OA 1D0YA 4EEDA 3B13A 2CHOA 1EZ3A 1NENA 4CN6A 3T1HT 4B6XA 4O2BE 3PUYF 4ADZA 3QC9A 3UUNA 3P4RA 4U31A 3ZN1B 4U72A 3O9XA 1QUUA 2CLYB 2D2SA 1JNRA 2UU9T 2BS2A 4EEBA 1W09A 4DV6T 3Q5XA 3ZMZB 3KVBA 4AKIA 3NKZA 4HKAA 1KEYA 2WWUA 1QLBA 4I55E 3C4ZA 4DV4T 4DMVA 1BR1A 1D0XA 4U7IA 2W0GA 3PUXF 3EDUA 2NW9A 5LGTB 3V5UA 5JH7E 1O3XA 5F8PA 4CXYA 4CI2B 2JIWA 1V9DA 1SUMB 2YK0A 2FJBA 3KV6A 1UURA 3RH3A 3IF8B 5AQKB 4DR7T 2H7OA 2N9DA 2FBWA 5FKYA 2PG8A 3ZMSB 2HHHT 4LF9T 1BR2A 4UF0A 1UX5A 5M4YA 5TAOA 4HN9A
chains in the Genus database with same CATH topology
2D0UA 5JDGA 3RYCE 4PJLA 1HCIA 3CMLA 4Z8XA 1ZV4X 4GYSA 3LBXB 4XBFB 2YU1A 3PU3A 5JDLA 5JDMA 3U78A 2ACXA 2DWGA 4FJOA 4H9RC 2HH7A 5GONE 2ODUA 3L3PA 2CM0A 2LJLA 2X9YA 2W63A 4AQFA 4QX8B 2LSIA 3C50A 2DWKA 3LJCA 3Q2MA 3NBXX 3R84B 5L2LA 4QKNA 5J1GA 5JDNA 2CLYC 3W15B 3ZEFB 3FB2A 3MACA 3AVRA 4HTEA 3K3NA 3ZYLA 5KX5E 4J2CA 2LT3A 3GN5B 3VKGA 1MMAA 3MZKB 4UIGA 1YD8G 2RA1A 3F2EA 4O8SA 3N9PA 3AA0B 2Q9QC 3FBZA 2KNDA 3ZC0A 5BMVE 4KBMB 3RKOA 5DQWA 2EHOC 2DLRA 3I1AA 3CKDA 3O4XE 2WSSV 4V1Av 5IHYA 4X1YE 2HPJA 3CQXC 2WM9A 2V7IA 4H9OC 3AAIA 3PDYA 5EZYE 3ZC1A 4GK0E 4YHJA 3PUGA 4ILUA 3EDVA 4G63A 5L3CB 3KBTA 5LHGB 2LSKA 4H63V 4IHJE 2Y8DA 2VKHA 1BR0A 4PNIA 3BQIA 3HKEE 1ZEEA 3BK9A 2L8KA 3RYIE 3EUHA 4JEHB 2CWOA 3HA4A 3HKBE 3OJAA 1SA0E 3RC3A 1MMDA 4BJMA 2CE7A 2LEHA 1ZHCA 5HWXA 4O2AE 4CXXA 5LYJE 3N2KE 3ETVA 3C4XA 4MALA 5HXHA 4ERRA 5IYZE 2M67A 3E22E 4IE4A 5JDFA 4TX5A 1S35A 4CZZB 2W62A 1LKXA 5LG4A 4C90A 1IJ6A 3HR0A 3ZPOA 3ANWB 2HPLA 3C51A 4EZHA 1T98A 5H6RB 1YKEB 2XAQB 3AAAB 3QUJA 4UF0B 4I43B 3R6NA 3FXDB 3I0QA 4F6RC 4AKGA 1VOMA 2K24A 1WYCA 4EXTA 3NZPA 3ESLA 4IE5A 2JMHA 4HEAA 1OXZA 1LRZA 3SWHA 2BVLA 4BJNA 4X1KE 2LSJA 2DNXA 3CWZB 4ZS3A 2DCFA 2Y48B 2Y6XA 4NUVA 3NRYA 4ZI2C 2BDEA 1HX8A 2QA7A 2X9HA 3NRXA 5LNKA 1U4QA 4QWNB 3WAJA 2GK9A 5HXEA 4IE0A 1B7TA 2VWAA 1YKHB 3KV9A 4PK4A 3PUAA 2OA5A 2L3LA 2SPCA 2WBLA 4A56A 5L3BB 2WMOA 4AKHA 4GOUA 1HTJF 3M65A 4PFPA 4UVAB 2UXNB 3E08A 3CQGB 3C64A 1HG5A 4QXHB 3KFWX 5FXXA 4ANJA 5DABA 5FYMA 4IE7A 4YLHA 2JMKA 1HS7A 3GA8A 4WBOA 1Y64B 3WI3A 2NWBA 4ZI2D 3ZMVB 2YINA 4YJ3E 3A5XA 2WAUA 5LHIB 4HGAA 2V7LA 5L3DB 1NWMX 2ZM2A 4H9SE 2ZM8A 2V7MA 4UVCB 2A2FX 2JPFA 2X9WA 5DQVA 2MBGA 1FMVA 1FEWA 2UXXB 3J7Yq 5JR9B 2K5BB 3C98B 3MJXA 2NW8A 2LSYA 2K9AA 2PFVA 4AI6A 4BA9A 1D1AA 2V7JA 3HKDE 4KP3C 2W61A 3UTKA 4OHFA 5LGNB 2MOZA 1LVKA 1D1BA 3IBPA 4C91A 5LA6E 5JRCA 4MBQA 3DJBA 2XAGB 4E7SA 3LK3B 5JDHA 2B1EA 4WNKA 5KMGP 2PBIA 2XHEB 2KWHA 3HI2A 3UT5E 4ZS2A 3SOLA 2XAHB 4CI3B 4IIJE 2V1DB 1IJ5A 4IE6A 3CX6B 5FXWA 4XAXB 4EAHA 4E7ZA 3ONXA 3HKCE 2DHRA 2BVMA 5CA0E 3KBUA 3OYZA 3K3OA 3AB3B 5JR9A 4UV9B 1IAPA 3JC6C 2IW5B 1MNEA 2XTLA 1ZKEA 3IEEA 4KUMB 1SHZC 2MTQA 3CQCB 2NP9A 2RP4A 1U5PA 2Q9QD 3GWHA 4MLKA 4PK5A 1QSDA 4M1PA 5JVDE 2EHOD 4BAYB 5JDQA 1MIWA 2JJ9A 4CI1B 4QXBB 2MYSA 5KDMC 5FMNA 3AA7B 2DI4A 3KVAA 5LBQB 4KMCA 4UVBB 3PTRB 4AKRB 1KK7A 3H37A 2KINB 3OYXA 4EB6E 5EK4A 3F31A 4FI5A 2CXLA 4L9IA 2NW7A 4TZ4C 1HG2A 4IDZA 4UELA 1MMNA 3LFMA 2P9BA 3RC8A 2KWIB 3ZMTB 3KINB 1H7CA 3O1HA 4JEUB 4EYYR 1FMWA 2CCQA 4NUUA 5LP6E 2X68A 2XQYA 4PJJA 3RRCA 4OYJA 4O4JE 3TKLB 4OYKA 4UV8B 4AQFC 4EIWA 1Z0PA 3U3IA 5J2TE 3PU8A 3UUMA 3KV5A 3N2OA 1HF8A 4N78D 4ISSA 2V26A 1MIVA 1S94A 4GIWA 4ZI7E 1BR4A 2ZM0A 2KZ7B 4O4HE 1CUNA 3E0ZA 5L3GB 2VB6A 3AA1B 4H9PC 2E9XC 2KXPB 3ZJ2A 4ASKA 2Q9QA 5DJQC 2KMFA 2JRKA 2EHOA 5FY0A 3J9X1 4EZ4A 4PFOA 1OWAA 4MFRA 5HWYA 5FP3A 3RPUA 3VHLA 3ZLIA 3MXZA 2IC6A 3MKDA 4L5GA 5FY1A 3FBLA 2LM9A 3BQLA 3EVYA 3FHNA 3N2GE 3Q5WA 4X20E 5FXVA 3PE0A 3ZCIA 3VKHA 4DBQA 5FY7A 1WR6A 2Z6EA 2ODVA 2CEAA 2J1DG 1D0ZA 5ADXL 4EOZB 1X79A 1WLXA 4GYRA 4PK6A 3OBVE 4TUYE 5LJNA 3UUXB 5JRCB 1WYBA 3MA9A 4DMWA 2E8IA 2E9XD 2N1GA 4L0RA 3VU7H 3H3AA 3D0TA 1YW0A 2VASA 2D0TA 3CPZA 3RYFE 4ZOLE 3ZJ1A 5FXZA 1VRBA 3AA6B 2I59A 3BQKA 5F3JA 4UEMA 2C0SA 2QGSA 1MMGA 2H3RA 4WW0A 5L3FB 2N2NA 5JREA 3AAEB 2C5KT 3FXEB 2PJQA 3AVSA 1MIYA 4DNDA 4ISTA 4H9NC 5LJMA 3N9OA 5LBMA 4O4LE 2CA5A 1IZNB 4OFZA 3KDSE 4XZCA 4TV9E 4I4TE 5LHHB 2CWYA 3LK42 4AKLA 3DTOA 2KLQA 5J2UE 3SRZA 3ZYMA 4PJMA 4DBRA 3F57A 5L3EB 2X0LB 3RX6A 2LOSA 2H7VC 4DO0A 3T8OA 2L9QA 2K48A 1D0YA 3B13A 3S4UA 1HFAA 4JLEA 4QX7B 4TV8E 5A1LA 1EZ3A 2LHRA 2XASB 3C4WA 3I0OA 2LE8A 3UULA 1AJ3A 4ZHQE 3UFEA 4EYUA 5HXCA 4B6XA 2YEVC 4O2BE 2E9XA 3I9WA 3PUQA 4X1IE 3LG7A 4CXWA 4ADZA 4DVDA 3QC9A 3N9LA 5HXSA 1UCUA 2LSGA 2CXFA 3UUNA 3ZN0B 4P0BA 3CX7B 3ZN1B 4U72A 3N9MA 2VKOA 3O9XA 4TN7B 3RRWA 2A3DA 4G2AA 2A72A 1QUUA 3LBXA 3DP7A 2CLYB 5LGUB 3L09A 4GK5E 2D2SA 5H6QB 3SS1A 3Q9DA 2IC9A 5LXTE 3CVRA 3MK7C 3ZMUB 2G0UA 4H63H 4JUYA 5CA1E 2X67A 4U74A 5HXRA 1US7B 4QXCB 1G8XA 4WBNE 4HE8A 4I50E 2Q9QB 4K0UA 3KV4A 3IHRA 2EHOB 5CB4E 3Q5XA 2W00A 3ZMZB 3KVBA 3I9YA 4ZI3C 3JC6D 4P0AA 3P7IA 2VKJA 3GN5A 4O4IE 2WMNA 4AKIA 1G73A 1FIOA 2X66A 5JQGE 2LHNA 1UX4A 2ZMAA 4HKAA 4AXPA 2WWUA 3V5SA 1NAFA 2ES0A 3ZCJA 4P09A 4PW8A 4QHOA 4YJ2E 3OKQA 3RYHE 4I55E 3C4ZA 2IAKA 5E0OA 4PAGA 4DMVA 1BR1A 2C5IT 2XAFB 1D0XA 1E1HB 1WRDA 2VKDA 2W0GA 1LVFA 2KT9A 2X51A 3GMIA 2ZLYA 3K8PC 1KNZA 3CX8B 3EDUA 2D5UA 2NOXA 4H9QC 4ZI3D 2CXDA 3HL6A 4PJNA 3QK6A 2NW9A 5HYAA 2C5JA 5EK3A 5LGTB 2NTXA 3V5UA 5JH7E 1O3XA 5F8PA 2VK9A 3PURA 4CXYA 2JQQA 4CI2B 4UXNB 4AQGA 2YU2A 2NTYA 1V9DA 2YK0A 5FNVE 2X9XA 3KV6A 3WAKA 5EK2A 3RH3A 3IF8B 2V7KA 5ETWA 5LOVE 1MNDA 3O1IA 5C8YE 2H7OA 4CQIA 3N9QA 2N9DA 3B57A 3ETUA 3PUSA 3N5LA 5JR9C 4OK0A 4IGUA 2BZBA 2LOPA 4MHCA 3ANWA 2PG8A 2XAJB 3ZMSB 3P8CD 3K3QC 4YFSA 3NZQA 5LCYA 1BR2A 4UF0A 2XUEA 4HFVA 3LK2B 1UX5A 5HAXA 2CMRA 2E9XB 2VL8A 5M4YA 5TAOA 3N9NA 1D1CA 3ZYKA 3O1JA 5AFUL 4HN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI3 C;  2K9A A;  4ZI3 D;  4ZI2 C;  4ZI2 D; 
#chains in the Genus database with same CATH topology
 4HFH A;  3RYC E;  2DWG A;  4H9R C;  2ODU A;  3L3P A;  2CM0 A;  2FJD A;  2W63 A;  3TLU A;  5L2L A;  1YD8 G;  2KND A;  3ZC0 A;  4KBM B;  3RKO A;  2DLR A;  3I1A A;  3CKD A;  4WYV A;  4ZZB A;  4V1A v;  5IHY A;  3CQX C;  4H9O C;  4DV3 T;  1R8I A;  4ILU A;  4IHJ E;  2ZM6 T;  3BQI A;  3HKE E;  5AQO B;  3T1Y T;  3G06 A;  2WB5 A;  2IML A;  2E2A A;  3HA4 A;  4TWD A;  1SA0 E;  1MMD A;  2CE7 A;  2LEH A;  5HWX A;  5ABF A;  3ETV A;  4MAL A;  1UK5 A;  5IYZ E;  4IE4 A;  5LG4 A;  2IDO B;  1IJ6 A;  3ZPO A;  3C51 A;  4EZH A;  1N36 T;  2BG9 E;  5HEO A;  2XAQ B;  2UUA T;  4UF0 B;  2XSA A;  2FJA A;  4AKG A;  2IIU A;  4ILB A;  1LRZ A;  3SWH A;  2WY2 A;  4ILA A;  1HX8 A;  5AQM B;  2QA7 A;  2RPA A;  5FL1 A;  2X0H A;  1B7T A;  3RF1 A;  1YKH B;  5L3B B;  2SPC A;  2WBL A;  2VL0 A;  3E08 A;  5FXX A;  5DAB A;  4YLH A;  1Y64 B;  4KX6 A;  2YIN A;  4EV6 A;  2X0Y A;  3UUB A;  4H9S E;  2V7M A;  2X9W A;  2MBG A;  1FEW A;  2BS3 A;  4LFA T;  3C98 B;  3MJX A;  5ABE A;  2WZI A;  4AI6 A;  1D1A A;  2B76 A;  2W61 A;  4C91 A;  3DJB A;  3LK3 B;  2B1E A;  2XJ7 A;  2W67 A;  3ZT5 A;  2UUC T;  3SOL A;  4IIJ E;  5FXW A;  4EAH A;  1I6Z A;  4E7Z A;  3HKC E;  3KBU A;  3K3O A;  2E5L T;  4UV9 B;  4JI5 T;  1MNE A;  2XTL A;  3IEE A;  4KUM B;  1SHZ C;  3GWH A;  4KHP T;  4BAY B;  2JJ9 A;  4CI1 B;  4QXB B;  2MYS A;  5KDM C;  3AA7 B;  2DI4 A;  5LBQ B;  4AKR B;  2KIN B;  3OYX A;  4DV2 T;  4EB6 E;  5EK4 A;  1Y01 A;  2CHN A;  3RC8 A;  2JQH A;  4DR1 T;  2W2U A;  1J5E T;  3O1H A;  4JEU B;  2CCQ A;  3P4P A;  4ZEY A;  2A9U A;  3PJA A;  3KV5 A;  1HF8 A;  1XDP A;  1MIV A;  1S94 A;  4ZI7 E;  1BR4 A;  2M6B A;  4B3T T;  2KZ7 B;  3L8R A;  1CUN A;  2AE9 A;  5AQP B;  3TLT A;  5L3G B;  5FVK A;  4HWF A;  5DJQ C;  4K0K T;  2KMF A;  2EHO A;  3AED A;  5FY0 A;  3Q5D A;  5FY1 A;  3EVY A;  3Q5W A;  3PE0 A;  4DBQ A;  2CEA A;  3AXJ A;  2J1D G;  4GYR A;  4PK6 A;  4TUY E;  4ILC A;  4DMW A;  4DR4 T;  1I94 T;  2E9X D;  3M3Z B;  2N1G A;  3P4Q A;  4JI4 T;  3CPZ A;  4ZOL E;  5FXZ A;  2I59 A;  2C0S A;  2H3R A;  4WW0 A;  3A8Y C;  5L3F B;  2N2N A;  3ONJ A;  3AVS A;  3RI5 A;  4TWF A;  2ACZ A;  4JI2 T;  2OLT A;  4TV9 E;  3DTO A;  3SRZ A;  3ZYM A;  3F57 A;  3RX6 A;  4DO0 A;  2WDR A;  1HFA A;  4JLE A;  4Z90 A;  4LML A;  3NVO A;  1SE7 A;  1NEK A;  2YEV C;  4JV5 T;  3I9W A;  4X1I E;  4CXW A;  3CIR A;  5HXS A;  3ZN0 B;  1OED B;  3CX7 B;  4IRE A;  2CPT A;  3RRW A;  2XQ8 A;  2I6H A;  3ZKR A;  2CBI A;  3UQ4 A;  3B5M A;  2YDR A;  3ZMU B;  2G0U A;  5CA1 E;  4DR5 T;  4DID B;  1US7 B;  1G8X A;  3FZM B;  4I50 E;  3JAF A;  4K0U A;  3IHR A;  2EHO B;  3AE1 A;  4P0A A;  2WMN A;  1FIO A;  5JQG E;  2LHN A;  2ZMA A;  2XSB A;  3AXJ B;  3ZCJ A;  4PW8 A;  4QHO A;  3OKQ A;  3AEG A;  5E0O A;  2XAF B;  4TWH A;  2X51 A;  1KNZ A;  2ZLY A;  3CX8 B;  2CXD A;  3HL6 A;  4PJN A;  2UXC T;  2C5J A;  5EK3 A;  2NTX A;  2I0M A;  5AQU B;  2VK9 A;  2YU2 A;  2NTY A;  3RIF A;  5FNV E;  2WCA A;  5ETW A;  4CQI A;  3B57 A;  5ABH A;  3QB5 K;  3PUS A;  3N5L A;  3K1S A;  5JR9 C;  4OK0 A;  2BZB A;  3ANW A;  3EHZ A;  1HNX T;  3K3Q C;  4X5T A;  1HX1 B;  2XUE A;  3LK2 B;  4LF7 T;  4B3S T;  3N9N A;  2D0U A;  1M7K A;  1ZV4 X;  4XBF B;  2V6Y B;  5HEJ A;  2V8S V;  2LSI A;  4LF4 T;  1XWM A;  5CJ5 A;  3LJC A;  3Q2M A;  2F4V T;  2CLY C;  4UR9 A;  3MAC A;  1X9B A;  2WWV A;  4J2C A;  3VKG A;  3X1D A;  4UIG A;  4O8S A;  5BMV E;  3O4X E;  4X1Y E;  5EZY E;  4G63 A;  4B3R T;  4H63 V;  2Y8D A;  1BR0 A;  4PNI A;  2JQK A;  2D9D A;  3RIU A;  3BK9 A;  2L8K A;  4P1N A;  4JEH B;  4CXX A;  3N2K E;  2M67 A;  3E22 E;  4HFB A;  4TX5 A;  3RGL A;  4C90 A;  1W0A A;  3ANW B;  2XQ3 A;  5H6R B;  4HFC A;  3AAA B;  3AE3 A;  4I43 B;  3AE5 A;  3FXD B;  4F6R C;  2K24 A;  4U33 A;  2JMH A;  3TLV A;  2BVL A;  4BJN A;  5AQG B;  2DNX A;  3CWZ B;  1FJG T;  4ZS3 A;  2DCF A;  2Y48 B;  2Y6X A;  3NRY A;  1DU2 A;  1ZP0 A;  4YSY A;  5LNK A;  4NIQ A;  2GK9 A;  3SFE A;  4IE0 A;  2VWA A;  4PK4 A;  4A56 A;  2WMO A;  4GOU A;  1HTJ F;  2WDV A;  4TNW A;  3FZH B;  3EI0 A;  3KFW X;  4IE7 A;  3UU6 A;  4WBO A;  3WI3 A;  2NWB A;  4ZI2 D;  5CFB A;  4LFC T;  3PUV F;  1NWM X;  2ZM8 A;  4U7Y A;  2LRK A;  2NW8 A;  2PFV A;  1XMQ T;  4GKJ T;  4KP3 C;  4HFI A;  4OHF A;  3AEE A;  5LA6 E;  5AQS B;  1GQE A;  4WNK A;  2XY8 B;  4ZS2 A;  3JCF A;  2BKN A;  4CI3 B;  4X64 T;  3ONX A;  2DHR A;  2BVM A;  2LRL A;  5AQV B;  2MTQ A;  2NP9 A;  1U5P A;  4MLK A;  1QSD A;  4Z91 A;  1MIW A;  5L4E A;  2XQ5 A;  3H3M A;  5FMN A;  4HFD A;  3PUZ F;  4UVB B;  5AQR B;  1KK7 A;  2XQ7 A;  1XZY A;  5HEH A;  4Q25 A;  5JTG A;  2CXL A;  4L9I A;  4TZ4 C;  2V5D A;  1MMN A;  4IDP A;  1E2A A;  4LF5 T;  2KWI B;  4JI8 T;  4IT4 A;  1FMW A;  4NUU A;  5LP6 E;  4PJJ A;  4U2Y A;  4OYJ A;  4O4J E;  1Z0P A;  4KI0 F;  3PU8 A;  3N2O A;  2BKP A;  4GIW A;  4DR6 T;  2E9X C;  2KXP B;  4ASK A;  2Q9Q A;  2JRK A;  4PFO A;  4CN4 A;  3RPU A;  4DV5 T;  3VHL A;  4JI1 T;  3FHN A;  3N2G E;  2WP9 A;  2FUP A;  1WR6 A;  2Z6E A;  1D0Z A;  1KNR A;  4EOZ B;  1X79 A;  3OBV E;  1WYB A;  2E8I A;  3RIA A;  3H3A A;  3RYF E;  4DV7 T;  1HNZ T;  3BQK A;  5F3J A;  5AQL B;  1MMG A;  4DV1 T;  4YHH T;  5JRE A;  3AAE B;  3P4S A;  2C5K T;  3FXE B;  2PJQ A;  5LJM A;  3N9O A;  3AE7 A;  5LBM A;  3FZL B;  2CA5 A;  3OVU A;  4OFZ A;  3KDS E;  5L47 A;  4XZC A;  3QNU A;  5LHH B;  2CWY A;  3LK4 2;  2YN6 A;  4AKL A;  2KLQ A;  4PJM A;  5L3E B;  2H7V C;  2L9Q A;  1M62 A;  5L4H A;  3RLF F;  2XAS B;  3C4W A;  1AJ3 A;  3UFE A;  4EGW A;  4EYU A;  3PUQ A;  4IL9 A;  4HWH A;  1OED E;  2LSG A;  4P0B A;  4G2A A;  3UU3 A;  3LBX A;  3OTO T;  2UUB T;  5H6Q B;  2IHR 1;  3Q9D A;  3MK7 C;  2BG9 C;  4H63 H;  2OV9 A;  5HXR A;  4QXC B;  4WBN E;  5FL0 A;  2Q9Q B;  3KV4 A;  1N34 T;  5CB4 E;  2W00 A;  3I9Y A;  5AQH B;  3VR8 A;  3P7I A;  2XPK A;  2CBJ A;  3GN5 A;  4WZX A;  1OED A;  2UXD T;  3RQU A;  1J1J A;  4AXP A;  4QH5 A;  2IAK A;  4PAG A;  4A98 A;  2AXD S;  2C5I T;  3AE4 A;  4LMJ A;  1E1H B;  1WRD A;  2KT9 A;  2D5U A;  4ZI3 D;  5ABG A;  2J4G A;  3RQW A;  5HYA A;  5AQQ B;  3QB5 A;  3PV0 F;  3AEF A;  2JQQ A;  5LB7 B;  3AE9 A;  4UXN B;  4AQG A;  2X9X A;  1T7S A;  3WAK A;  5LOV E;  3N9Q A;  3LSV A;  4IGU A;  4YTN A;  4GKK T;  3OPC A;  3NZQ A;  5LCY A;  1WR0 A;  2VL8 A;  4X66 T;  3ZYK A;  3O1J A;  3L39 A;  2WU5 A;  5AFU L;  5JDG A;  4YY3 T;  2H88 A;  2KSR A;  3LBX B;  5JDL A;  3U78 A;  2YDQ A;  2XQ9 A;  4FJO A;  4AIU A;  1CHU A;  2X9Y A;  3LDQ B;  4AQF A;  5AQN B;  3C50 A;  2DWK A;  5JDN A;  4AQY T;  3W15 B;  3ZEF B;  4HTE A;  3ZYL A;  5KX5 E;  3GN5 B;  1MMA A;  4F8H A;  3ABV A;  3F2E A;  3AA0 B;  3FBZ A;  5DQW A;  2EHO C;  2WSS V;  4YSZ A;  2V6Y A;  2WM9 A;  2V7I A;  3AAI A;  3PDY A;  4GK0 E;  4YHJ A;  3PUG A;  2HN2 A;  3EDV A;  2LSK A;  1JNZ A;  1YQ3 A;  3EAB A;  1L0V A;  4LF8 T;  3UU4 A;  1UGO A;  2VQE T;  1ZEE A;  3RYI E;  2PTF A;  1ZHC A;  4DR3 T;  4QH4 A;  5LYJ E;  2VUR A;  3C4X A;  5IWA T;  5HXH A;  3UU5 A;  4JI3 T;  3ZSS A;  5JDF A;  1S35 A;  4CZZ B;  2W62 A;  2CRB A;  3HR0 A;  2HPL A;  1T98 A;  3R6N A;  2BS4 A;  1VOM A;  2IUB A;  3ESL A;  4LF6 T;  4HWD A;  4IDO A;  4NUV A;  4ZI2 C;  2X9H A;  3JAE A;  3KV9 A;  2OA5 A;  2L3L A;  4CN1 A;  4AKH A;  5KXJ A;  4PFP A;  3C64 A;  1HG5 A;  4QXH B;  1XNQ T;  2WS3 A;  4JYA T;  3UQ7 A;  1N33 T;  5FYM A;  5LMU T;  1HS7 A;  1W0B A;  1T72 A;  5AQJ B;  2XQA A;  4A97 A;  4YJ3 E;  2NR4 A;  2ZM2 A;  2A2F X;  2JPF A;  1FMV A;  3J7Y q;  5JR9 B;  2K5B B;  1IBM T;  1KNP A;  2WDQ A;  2MOZ A;  1LVK A;  3IBP A;  2HN1 A;  1N32 T;  2XAG B;  2JQ9 A;  4YSX A;  5KMG P;  2PBI A;  2KWH A;  2XM1 A;  3HI2 A;  3EAM A;  2XAH B;  4LMK A;  2V1D B;  3CX6 B;  4XAX B;  1VCT A;  3OYZ A;  4X65 T;  3AB3 B;  1T8B A;  2R6G F;  3JC6 C;  5C2T A;  1ZKE A;  3CQC B;  4PK5 A;  5JVD E;  2EHO D;  4JI7 T;  5JDQ A;  4AIS A;  3KVA A;  4KMC A;  5F5W A;  3PTR B;  3VRA A;  3F31 A;  2NW7 A;  4UEL A;  3LFM A;  3RHW A;  2P9B A;  4EYY R;  3TLW A;  2XQY A;  2YKS A;  4OYK A;  4UV8 B;  2V5C A;  3ONL C;  4YTP A;  4ISS A;  2V26 A;  2ZM0 A;  3AA1 B;  3ZJ2 A;  2BBJ A;  3JAD A;  1UUS A;  4MFR A;  5HEG A;  5HWY A;  2W66 A;  2IC6 A;  3FBL A;  3BQL A;  4X20 E;  1W9R A;  5FY7 A;  1HR0 T;  4X62 T;  5ADX L;  1WLX A;  5LJN A;  3MA9 A;  3CK6 A;  3FZF B;  4L0R A;  3VU7 H;  1YW0 A;  5IUX A;  2VAS A;  4JBW F;  3RIU C;  3NWI A;  4I0U A;  3AA6 B;  2LLY A;  3ZT6 A;  4DND A;  4DUZ T;  4O4L E;  4I4T E;  4DBR A;  2X0L B;  2LOS A;  2K48 A;  5A1L A;  3S4U A;  4TV8 E;  4QX7 B;  5AQT B;  2LHR A;  3I0O A;  2LE8 A;  3UUL A;  4ZHQ E;  5HXC A;  2E9X A;  3LG7 A;  4DVD A;  3N9L A;  1UCU A;  2CXF A;  4KHZ F;  3N9M A;  2VKO A;  4TN7 B;  2A3D A;  2A72 A;  3DP7 A;  5LGU B;  4IL4 A;  3L09 A;  4GK5 E;  3SS1 A;  5LXT E;  2IC9 A;  4ZZC A;  3CVR A;  4JUY A;  2X67 A;  4U74 A;  4HE8 A;  1KF6 A;  4U3C A;  2XZE A;  4ZI3 C;  3JC6 D;  2VKJ A;  4O4I E;  1G73 A;  2X66 A;  4HWC A;  1UX4 A;  3SFD A;  3V5S A;  1NAF A;  2ES0 A;  2XQ6 A;  2MPK A;  4P09 A;  4YJ2 E;  3PUW F;  3RYH E;  4JI6 T;  2VKD A;  1LVF A;  3GMI A;  3K8P C;  2NOX A;  4H9Q C;  2H89 A;  4IDN A;  3QK6 A;  3AEB A;  3PUR A;  5AQI B;  4YXD A;  3P50 A;  4YT0 A;  1WFD A;  5EK2 A;  2V7K A;  1MND A;  3O1I A;  5C8Y E;  5J0Z A;  2V6X A;  3ETU A;  2LKH A;  2LOP A;  4MHC A;  3AE8 A;  1XMO T;  1XDO A;  2XAJ B;  3P8C D;  4YFS A;  2BG9 A;  4HFV A;  5HAX A;  2CMR A;  2E9X B;  1D1C A;  4PJL A;  1HCI A;  3CML A;  4Z8X A;  4GYS A;  4ZXL A;  2YU1 A;  3PU3 A;  2WU2 A;  5JDM A;  2MAW A;  2ACX A;  2HH7 A;  2VQF T;  5GON E;  3ZST A;  2LJL A;  4QX8 B;  2UXB T;  3NBX X;  3R84 B;  4QKN A;  5J1G A;  3FB2 A;  3AVR A;  3K3N A;  2LT3 A;  2VVN A;  3MZK B;  2RA1 A;  3N9P A;  2Q9Q C;  5ABF B;  4U2Z A;  2HPJ A;  3ZC1 A;  5LMN T;  5L3C B;  3KBT A;  5LHG B;  2VVS A;  2VKH A;  1IBK T;  2FJE A;  4IDQ A;  3EUH A;  1VCS A;  2CWO A;  3HKB E;  3OJA A;  1IBL T;  4QH1 A;  3RC3 A;  4BJM A;  3Q5E A;  4O2A E;  3AE2 A;  4ERR A;  1LKX A;  4YTM A;  4DV0 T;  2W4X A;  5LG3 A;  1YKE B;  3QUJ A;  2BG9 B;  5HCJ A;  3I0Q A;  5C3J A;  1WYC A;  4EXT A;  3NZP A;  4DR2 T;  4IE5 A;  4HEA A;  1OXZ A;  1YXR A;  4X1K E;  2LSJ A;  4HWI B;  4OX9 T;  2BDE A;  3P4W A;  5CGM A;  1Z8U A;  3NRX A;  1U4Q A;  4QWN B;  2QRX A;  3WAJ A;  5HXE A;  3PUA A;  3M65 A;  4UVA B;  2UXN B;  3CQG B;  4ANJ A;  2JMK A;  3GA8 A;  3ZMV B;  3A5X A;  3VR9 A;  2WAU A;  5LHI B;  4HGA A;  2V7L A;  1OED C;  5HEU A;  5L3D B;  2QYW A;  2YDS A;  4UVC B;  5DQV A;  3UFG A;  3RKG A;  2UXX B;  3UU8 A;  2QVA A;  2LSY A;  2K9A A;  4BA9 A;  2V7J A;  3HKD E;  4LFB T;  4NXN T;  4DUY T;  3UTK A;  3VRB A;  5LGN B;  3PJA J;  5JRC A;  1D1B A;  4HFE A;  2M6I A;  4MBQ A;  2BBH A;  4E7S A;  3TLS A;  5JDH A;  3A7M A;  2XHE B;  1XNR T;  3UT5 E;  1IJ5 A;  4IE6 A;  3FZK B;  2XM2 A;  3AEA A;  5CA0 E;  5JR9 A;  1IAP A;  2IW5 B;  4JI0 T;  2E5V A;  2RP4 A;  3QOF A;  2Q9Q D;  1J5W A;  4M1P A;  1WCR A;  3AE6 A;  3H37 A;  1HNW T;  3ZT7 A;  4FI5 A;  1HG2 A;  4IDZ A;  3ZMT B;  3KIN B;  1H7C A;  4B3M T;  5FVL A;  2BKO A;  4A5X A;  2X68 A;  3RRC A;  1ZOY A;  3TKL B;  4EIW A;  4AQF C;  3U3I A;  5J2T E;  3UUM A;  4N78 D;  4NPP A;  4NXM T;  4O4H E;  3E0Z A;  2VB6 A;  3AEC A;  4H9P C;  3J9X 1;  4EZ4 A;  1OWA A;  1KFY A;  5FP3 A;  2DL1 A;  1YQ4 A;  3ZLI A;  3MXZ A;  3MKD A;  4L5G A;  2LM9 A;  5FXV A;  3ZCI A;  2K3W A;  3VKH A;  4COF A;  2ODV A;  5HCM A;  3IA3 A;  4TNV A;  3UUX B;  5JRC B;  2WQY A;  2LM2 A;  3D0T A;  2D0T A;  3ZJ1 A;  1VRB A;  2LKG A;  1E7P A;  5BR8 T;  4UEM A;  2QGS A;  2YOE A;  2J47 A;  1MIY A;  4IST A;  4H9N C;  1IZN B;  2WZH A;  5J2U E;  5AQF B;  2J62 A;  2XQ4 A;  3T8O A;  1D0Y A;  4EED A;  3B13 A;  2CHO A;  1EZ3 A;  1NEN A;  4CN6 A;  3T1H T;  4B6X A;  4O2B E;  3PUY F;  4ADZ A;  3QC9 A;  3UUN A;  3P4R A;  4U31 A;  3ZN1 B;  4U72 A;  3O9X A;  1QUU A;  2CLY B;  2D2S A;  1JNR A;  2UU9 T;  2BS2 A;  4EEB A;  1W09 A;  4DV6 T;  3Q5X A;  3ZMZ B;  3KVB A;  4AKI A;  3NKZ A;  4HKA A;  1KEY A;  2WWU A;  1QLB A;  4I55 E;  3C4Z A;  4DV4 T;  4DMV A;  1BR1 A;  1D0X A;  4U7I A;  2W0G A;  3PUX F;  3EDU A;  2NW9 A;  5LGT B;  3V5U A;  5JH7 E;  1O3X A;  5F8P A;  4CXY A;  4CI2 B;  2JIW A;  1V9D A;  1SUM B;  2YK0 A;  2FJB A;  3KV6 A;  1UUR A;  3RH3 A;  3IF8 B;  5AQK B;  4DR7 T;  2H7O A;  2N9D A;  2FBW A;  5FKY A;  2PG8 A;  3ZMS B;  2HHH T;  4LF9 T;  1BR2 A;  4UF0 A;  1UX5 A;  5M4Y A;  5TAO A;  4HN9 A; 
#chains in the Genus database with same CATH homology
 2D0U A;  5JDG A;  3RYC E;  4PJL A;  1HCI A;  3CML A;  4Z8X A;  1ZV4 X;  4GYS A;  3LBX B;  4XBF B;  2YU1 A;  3PU3 A;  5JDL A;  5JDM A;  3U78 A;  2ACX A;  2DWG A;  4FJO A;  4H9R C;  2HH7 A;  5GON E;  2ODU A;  3L3P A;  2CM0 A;  2LJL A;  2X9Y A;  2W63 A;  4AQF A;  4QX8 B;  2LSI A;  3C50 A;  2DWK A;  3LJC A;  3Q2M A;  3NBX X;  3R84 B;  5L2L A;  4QKN A;  5J1G A;  5JDN A;  2CLY C;  3W15 B;  3ZEF B;  3FB2 A;  3MAC A;  3AVR A;  4HTE A;  3K3N A;  3ZYL A;  5KX5 E;  4J2C A;  2LT3 A;  3GN5 B;  3VKG A;  1MMA A;  3MZK B;  4UIG A;  1YD8 G;  2RA1 A;  3F2E A;  4O8S A;  3N9P A;  3AA0 B;  2Q9Q C;  3FBZ A;  2KND A;  3ZC0 A;  5BMV E;  4KBM B;  3RKO A;  5DQW A;  2EHO C;  2DLR A;  3I1A A;  3CKD A;  3O4X E;  2WSS V;  4V1A v;  5IHY A;  4X1Y E;  2HPJ A;  3CQX C;  2WM9 A;  2V7I A;  4H9O C;  3AAI A;  3PDY A;  5EZY E;  3ZC1 A;  4GK0 E;  4YHJ A;  3PUG A;  4ILU A;  3EDV A;  4G63 A;  5L3C B;  3KBT A;  5LHG B;  2LSK A;  4H63 V;  4IHJ E;  2Y8D A;  2VKH A;  1BR0 A;  4PNI A;  3BQI A;  3HKE E;  1ZEE A;  3BK9 A;  2L8K A;  3RYI E;  3EUH A;  4JEH B;  2CWO A;  3HA4 A;  3HKB E;  3OJA A;  1SA0 E;  3RC3 A;  1MMD A;  4BJM A;  2CE7 A;  2LEH A;  1ZHC A;  5HWX A;  4O2A E;  4CXX A;  5LYJ E;  3N2K E;  3ETV A;  3C4X A;  4MAL A;  5HXH A;  4ERR A;  5IYZ E;  2M67 A;  3E22 E;  4IE4 A;  5JDF A;  4TX5 A;  1S35 A;  4CZZ B;  2W62 A;  1LKX A;  5LG4 A;  4C90 A;  1IJ6 A;  3HR0 A;  3ZPO A;  3ANW B;  2HPL A;  3C51 A;  4EZH A;  1T98 A;  5H6R B;  1YKE B;  2XAQ B;  3AAA B;  3QUJ A;  4UF0 B;  4I43 B;  3R6N A;  3FXD B;  3I0Q A;  4F6R C;  4AKG A;  1VOM A;  2K24 A;  1WYC A;  4EXT A;  3NZP A;  3ESL A;  4IE5 A;  2JMH A;  4HEA A;  1OXZ A;  1LRZ A;  3SWH A;  2BVL A;  4BJN A;  4X1K E;  2LSJ A;  2DNX A;  3CWZ B;  4ZS3 A;  2DCF A;  2Y48 B;  2Y6X A;  4NUV A;  3NRY A;  4ZI2 C;  2BDE A;  1HX8 A;  2QA7 A;  2X9H A;  3NRX A;  5LNK A;  1U4Q A;  4QWN B;  3WAJ A;  2GK9 A;  5HXE A;  4IE0 A;  1B7T A;  2VWA A;  1YKH B;  3KV9 A;  4PK4 A;  3PUA A;  2OA5 A;  2L3L A;  2SPC A;  2WBL A;  4A56 A;  5L3B B;  2WMO A;  4AKH A;  4GOU A;  1HTJ F;  3M65 A;  4PFP A;  4UVA B;  2UXN B;  3E08 A;  3CQG B;  3C64 A;  1HG5 A;  4QXH B;  3KFW X;  5FXX A;  4ANJ A;  5DAB A;  5FYM A;  4IE7 A;  4YLH A;  2JMK A;  1HS7 A;  3GA8 A;  4WBO A;  1Y64 B;  3WI3 A;  2NWB A;  4ZI2 D;  3ZMV B;  2YIN A;  4YJ3 E;  3A5X A;  2WAU A;  5LHI B;  4HGA A;  2V7L A;  5L3D B;  1NWM X;  2ZM2 A;  4H9S E;  2ZM8 A;  2V7M A;  4UVC B;  2A2F X;  2JPF A;  2X9W A;  5DQV A;  2MBG A;  1FMV A;  1FEW A;  2UXX B;  3J7Y q;  5JR9 B;  2K5B B;  3C98 B;  3MJX A;  2NW8 A;  2LSY A;  2K9A A;  2PFV A;  4AI6 A;  4BA9 A;  1D1A A;  2V7J A;  3HKD E;  4KP3 C;  2W61 A;  3UTK A;  4OHF A;  5LGN B;  2MOZ A;  1LVK A;  1D1B A;  3IBP A;  4C91 A;  5LA6 E;  5JRC A;  4MBQ A;  3DJB A;  2XAG B;  4E7S A;  3LK3 B;  5JDH A;  2B1E A;  4WNK A;  5KMG P;  2PBI A;  2XHE B;  2KWH A;  3HI2 A;  3UT5 E;  4ZS2 A;  3SOL A;  2XAH B;  4CI3 B;  4IIJ E;  2V1D B;  1IJ5 A;  4IE6 A;  3CX6 B;  5FXW A;  4XAX B;  4EAH A;  4E7Z A;  3ONX A;  3HKC E;  2DHR A;  2BVM A;  5CA0 E;  3KBU A;  3OYZ A;  3K3O A;  3AB3 B;  5JR9 A;  4UV9 B;  1IAP A;  3JC6 C;  2IW5 B;  1MNE A;  2XTL A;  1ZKE A;  3IEE A;  4KUM B;  1SHZ C;  2MTQ A;  3CQC B;  2NP9 A;  2RP4 A;  1U5P A;  2Q9Q D;  3GWH A;  4MLK A;  4PK5 A;  1QSD A;  4M1P A;  5JVD E;  2EHO D;  4BAY B;  5JDQ A;  1MIW A;  2JJ9 A;  4CI1 B;  4QXB B;  2MYS A;  5KDM C;  5FMN A;  3AA7 B;  2DI4 A;  3KVA A;  5LBQ B;  4KMC A;  4UVB B;  3PTR B;  4AKR B;  1KK7 A;  3H37 A;  2KIN B;  3OYX A;  4EB6 E;  5EK4 A;  3F31 A;  4FI5 A;  2CXL A;  4L9I A;  2NW7 A;  4TZ4 C;  1HG2 A;  4IDZ A;  4UEL A;  1MMN A;  3LFM A;  2P9B A;  3RC8 A;  2KWI B;  3ZMT B;  3KIN B;  1H7C A;  3O1H A;  4JEU B;  4EYY R;  1FMW A;  2CCQ A;  4NUU A;  5LP6 E;  2X68 A;  2XQY A;  4PJJ A;  3RRC A;  4OYJ A;  4O4J E;  3TKL B;  4OYK A;  4UV8 B;  4AQF C;  4EIW A;  1Z0P A;  3U3I A;  5J2T E;  3PU8 A;  3UUM A;  3KV5 A;  3N2O A;  1HF8 A;  4N78 D;  4ISS A;  2V26 A;  1MIV A;  1S94 A;  4GIW A;  4ZI7 E;  1BR4 A;  2ZM0 A;  2KZ7 B;  4O4H E;  1CUN A;  3E0Z A;  5L3G B;  2VB6 A;  3AA1 B;  4H9P C;  2E9X C;  2KXP B;  3ZJ2 A;  4ASK A;  2Q9Q A;  5DJQ C;  2KMF A;  2JRK A;  2EHO A;  5FY0 A;  3J9X 1;  4EZ4 A;  4PFO A;  1OWA A;  4MFR A;  5HWY A;  5FP3 A;  3RPU A;  3VHL A;  3ZLI A;  3MXZ A;  2IC6 A;  3MKD A;  4L5G A;  5FY1 A;  3FBL A;  2LM9 A;  3BQL A;  3EVY A;  3FHN A;  3N2G E;  3Q5W A;  4X20 E;  5FXV A;  3PE0 A;  3ZCI A;  3VKH A;  4DBQ A;  5FY7 A;  1WR6 A;  2Z6E A;  2ODV A;  2CEA A;  2J1D G;  1D0Z A;  5ADX L;  4EOZ B;  1X79 A;  1WLX A;  4GYR A;  4PK6 A;  3OBV E;  4TUY E;  5LJN A;  3UUX B;  5JRC B;  1WYB A;  3MA9 A;  4DMW A;  2E8I A;  2E9X D;  2N1G A;  4L0R A;  3VU7 H;  3H3A A;  3D0T A;  1YW0 A;  2VAS A;  2D0T A;  3CPZ A;  3RYF E;  4ZOL E;  3ZJ1 A;  5FXZ A;  1VRB A;  3AA6 B;  2I59 A;  3BQK A;  5F3J A;  4UEM A;  2C0S A;  2QGS A;  1MMG A;  2H3R A;  4WW0 A;  5L3F B;  2N2N A;  5JRE A;  3AAE B;  2C5K T;  3FXE B;  2PJQ A;  3AVS A;  1MIY A;  4DND A;  4IST A;  4H9N C;  5LJM A;  3N9O A;  5LBM A;  4O4L E;  2CA5 A;  1IZN B;  4OFZ A;  3KDS E;  4XZC A;  4TV9 E;  4I4T E;  5LHH B;  2CWY A;  3LK4 2;  4AKL A;  3DTO A;  2KLQ A;  5J2U E;  3SRZ A;  3ZYM A;  4PJM A;  4DBR A;  3F57 A;  5L3E B;  2X0L B;  3RX6 A;  2LOS A;  2H7V C;  4DO0 A;  3T8O A;  2L9Q A;  2K48 A;  1D0Y A;  3B13 A;  3S4U A;  1HFA A;  4JLE A;  4QX7 B;  4TV8 E;  5A1L A;  1EZ3 A;  2LHR A;  2XAS B;  3C4W A;  3I0O A;  2LE8 A;  3UUL A;  1AJ3 A;  4ZHQ E;  3UFE A;  4EYU A;  5HXC A;  4B6X A;  2YEV C;  4O2B E;  2E9X A;  3I9W A;  3PUQ A;  4X1I E;  3LG7 A;  4CXW A;  4ADZ A;  4DVD A;  3QC9 A;  3N9L A;  5HXS A;  1UCU A;  2LSG A;  2CXF A;  3UUN A;  3ZN0 B;  4P0B A;  3CX7 B;  3ZN1 B;  4U72 A;  3N9M A;  2VKO A;  3O9X A;  4TN7 B;  3RRW A;  2A3D A;  4G2A A;  2A72 A;  1QUU A;  3LBX A;  3DP7 A;  2CLY B;  5LGU B;  3L09 A;  4GK5 E;  2D2S A;  5H6Q B;  3SS1 A;  3Q9D A;  2IC9 A;  5LXT E;  3CVR A;  3MK7 C;  3ZMU B;  2G0U A;  4H63 H;  4JUY A;  5CA1 E;  2X67 A;  4U74 A;  5HXR A;  1US7 B;  4QXC B;  1G8X A;  4WBN E;  4HE8 A;  4I50 E;  2Q9Q B;  4K0U A;  3KV4 A;  3IHR A;  2EHO B;  5CB4 E;  3Q5X A;  2W00 A;  3ZMZ B;  3KVB A;  3I9Y A;  4ZI3 C;  3JC6 D;  4P0A A;  3P7I A;  2VKJ A;  3GN5 A;  4O4I E;  2WMN A;  4AKI A;  1G73 A;  1FIO A;  2X66 A;  5JQG E;  2LHN A;  1UX4 A;  2ZMA A;  4HKA A;  4AXP A;  2WWU A;  3V5S A;  1NAF A;  2ES0 A;  3ZCJ A;  4P09 A;  4PW8 A;  4QHO A;  4YJ2 E;  3OKQ A;  3RYH E;  4I55 E;  3C4Z A;  2IAK A;  5E0O A;  4PAG A;  4DMV A;  1BR1 A;  2C5I T;  2XAF B;  1D0X A;  1E1H B;  1WRD A;  2VKD A;  2W0G A;  1LVF A;  2KT9 A;  2X51 A;  3GMI A;  2ZLY A;  3K8P C;  1KNZ A;  3CX8 B;  3EDU A;  2D5U A;  2NOX A;  4H9Q C;  4ZI3 D;  2CXD A;  3HL6 A;  4PJN A;  3QK6 A;  2NW9 A;  5HYA A;  2C5J A;  5EK3 A;  5LGT B;  2NTX A;  3V5U A;  5JH7 E;  1O3X A;  5F8P A;  2VK9 A;  3PUR A;  4CXY A;  2JQQ A;  4CI2 B;  4UXN B;  4AQG A;  2YU2 A;  2NTY A;  1V9D A;  2YK0 A;  5FNV E;  2X9X A;  3KV6 A;  3WAK A;  5EK2 A;  3RH3 A;  3IF8 B;  2V7K A;  5ETW A;  5LOV E;  1MND A;  3O1I A;  5C8Y E;  2H7O A;  4CQI A;  3N9Q A;  2N9D A;  3B57 A;  3ETU A;  3PUS A;  3N5L A;  5JR9 C;  4OK0 A;  4IGU A;  2BZB A;  2LOP A;  4MHC A;  3ANW A;  2PG8 A;  2XAJ B;  3ZMS B;  3P8C D;  3K3Q C;  4YFS A;  3NZQ A;  5LCY A;  1BR2 A;  4UF0 A;  2XUE A;  4HFV A;  3LK2 B;  1UX5 A;  5HAX A;  2CMR A;  2E9X B;  2VL8 A;  5M4Y A;  5TAO A;  3N9N A;  1D1C A;  3ZYK A;  3O1J A;  5AFU L;  4HN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...