4ZI3D

Bart-like domain of bartl1/ccdc104 aa1-133 in complex with arl3fl bound to gppnhp in p1 21 1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
128
structure length
128
Chain Sequence
AEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQLQAIRIIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 54
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF11527 ARL2_Bind_BART The ARF-like 2 binding protein BART
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4zi3D00
4ZI2D 2K9AA 4ZI3D 4ZI2C 4ZI3C
chains in the Genus database with same CATH superfamily
3QB5K 3PU3A 2WY2A 1T72A 4EZ4A 2VKDA 4JI2T 3FZHB 2D0UA 1BR2A 2R6GF 5FXVA 5LHHB 2RP4A 2V6YA 3I9WA 4DV2T 2NW7A 4OK0A 3RH3A 2WMNA 4UR9A 2XAHB 2LRLA 5KDMC 4B3RT 2PJQA 4P0AA 3GMIA 3P4WA 1HF8A 3HI2A 3CX8B 2N9DA 3L3PA 5AQSB 2I59A 4I4TE 2YEVC 4OYJA 5LCYA 3LDQB 2WS3A 3PUQA 4E7SA 3ZMSB 5HWXA 2X0YA 4ZOLE 3A5XA 2BG9A 2HPJA 1OEDC 4ILAA 1BR1A 2KMFA 3LBXA 3IBPA 1N36T 3N2OA 2ZLYA 4YFSA 2LSJA 3RIUA 3C51A 2CCQA 3PU8A 4C91A 3AAEB 2HN1A 1X79A 2H88A 2XPKA 5L3CB 4BAYB 3BK9A 4GK5E 2UU9T 2XAGB 4IDNA 5FP3A 3IA3A 5CJ5A 3LK2B 5AQTB 2Y8DA 2LEHA 4JI8T 2V5CA 3M3ZB 3CPZA 2FBWA 1VCSA 5L2LA 1CUNA 3MZKB 5L4HA 2BKNA 4YTMA 3RLFF 2ODUA 3CX6B 4YSXA 3TLVA 2DCFA 5HXHA 4M1PA 2Q9QD 4CI3B 3I0QA 5AQLB 3B5MA 2NW8A 2DHRA 3UUXB 2FJAA 3B13A 1ZKEA 2IUBA 2H89A 3P4PA 1YD8G 4PK5A 3AAIA 2Q9QB 3M65A 4JBWF 4IDQA 2KZ7B 2VL8A 4DR2T 1IBMT 4L9IA 4Z8XA 2AXDS 1OEDA 4YTPA 5JDMA 5L3DB 5JDLA 2PBIA 4TN7B 3ANWB 4DV0T 3EDUA 1Y01A 4MALA 3N9QA 3J7Yq 5DABA 3C98B 4ZEYA 2X9YA 1UURA 3N5LA 3KV9A 3CQCB 2YINA 3O4XE 5CA1E 5JTGA 2WU2A 4WW0A 3MK7C 2CMRA 1B7TA 2M6BA 3ZCJA 2WDRA 3RQWA 1WRDA 3AAAB 5J1GA 1SUMB 3VU7H 5IWAT 4ZS3A 3B57A 2B76A 5HWYA 1HCIA 4I50E 1QUUA 4MBQA 4AKHA 3BQKA 4K0KT 1XZYA 4HFCA 2IIUA 3PUZF 2W62A 3ZPOA 2D5UA 2XAJB 5HXSA 3TLWA 2VK9A 5ABHA 3ZC0A 4HTEA 4NUUA 3FBLA 4HFVA 3RC3A 3UFEA 4AKGA 3C64A 4UELA 3NZPA 4CN1A 5C8YE 2F4VT 3O9XA 2W61A 2V6YB 3OVUA 4TWFA 4NPPA 4O4JE 2YDRA 5ABGA 2XASB 2XM2A 2KNDA 2UUBT 3QB5A 5LA6E 3MJXA 4GK0E 4AQGA 4WBNE 4EEDA 2H7VC 3JADA 4X1YE 4E7ZA 3SFDA 2CLYC 2VKJA 2QRXA 2WZHA 4DO0A 4DR3T 5IYZE 2IC6A 5HCMA 1MMDA 3SWHA 1N34T 1FIOA 3AEAA 4ISTA 3UU5A 2XQ3A 4U31A 2XY8B 3LBXB 2X9HA 4J2CA 3L39A 4HE8A 2E9XC 2ES0A 2CXLA 4QXHB 1HX8A 1YQ4A 3JC6C 4OHFA 3FZMB 1Z8UA 5LBQB 5AQRB 1WYBA 3O1HA 1NEKA 5LXTE 3NWIA 1J5WA 2BBJA 3V5UA 4JI4T 5JDGA 2WWUA 3W15B 3HL6A 3AA1B 5LJNA 3AE1A 3SOLA 3Q5EA 2A3DA 2CBIA 3Q5WA 5JDQA 4DR7T 2VL0A 3NBXX 5AQGB 4EOZB 3HA4A 2A72A 2J47A 1YW0A 4WZXA 3FXDB 3H37A 2L9QA 1GQEA 4ISSA 2NOXA 3PE0A 2G0UA 1D1AA 2BZBA 1FMWA 1T8BA 4QX8B 3ETUA 5GONE 3R6NA 4DR4T 3WAKA 4HFIA 3AE7A 1V9DA 3WI3A 4JI5T 4GYSA 3RYCE 1LKXA 2W67A 1G8XA 1UCUA 4IIJE 4QXCB 5LB7B 4PW8A 4EAHA 5JRCA 1W09A 4O4LE 2P9BA 4JLEA 4WYVA 4F6RC 4X62T 3CX7B 1HR0T 5FY7A 1LRZA 2E2AA 1LVKA 3AE3A 4G2AA 2W63A 3Q9DA 3SRZA 4CI2B 2C5IT 4Z90A 4A97A 5JQGE 5LHGB 1UUSA 1HFAA 3F31A 1WLXA 3VRBA 1X9BA 3ANWA 5F8PA 1WYCA 3KVAA 4IT4A 4ASKA 1IJ6A 4IHJE 4DIDB 2JMKA 3CWZB 3ZN1B 2HHHT 4YJ3E 3N9PA 2FUPA 1D0XA 3RPUA 4PJLA 2CRBA 2NTYA 4MFRA 1UGOA 1ZEEA 3TKLB 2K48A 3AECA 4C90A 4PFOA 3P7IA 4I0UA 3JAEA 4UV9B 1YQ3A 4A98A 1R8IA 3UT5E 1U4QA 1O3XA 2UXXB 3TLUA 5LGTB 5JDNA 3Q5XA 3OTOT 3ZKRA 5FY0A 2J4GA 2WB5A 2JMHA 1D0YA 3C4ZA 2RA1A 3UU6A 2WDVA 4O4IE 2X0HA 3UTKA 3HKBE 3RC8A 4X5TA 2WSSV 5A1LA 2YU2A 2XAQB 3CQGB 3VRAA 1QLBA 2KSRA 3KVBA 1E7PA 3IEEA 2YDSA 1MIVA 3KV4A 5AQMB 5CA0E 5FXZA 3KFWX 3AEBA 4EV6A 4A56A 5FVLA 5LGNB 4JEUB 2BS2A 1UX5A 3UULA 4ZI7E 2LKGA 3CK6A 4ZI3C 2KWIB 2PG8A 4PAGA 4IGUA 2VVNA 2W4XA 4QX7B 5C3JA 2AE9A 3AEFA 4NXNT 2QA7A 4HWFA 3C4WA 3KV5A 3N9NA 2YK0A 3RYHE 4IL9A 3T1YT 5JR9C 5L3BB 3OPCA 4H9QC 4LFBT 3RRCA 5ABEA 4UIGA 5LHIB 1KF6A 3OKQA 5HXEA 3PUVF 1IBLT 5LMNT 4U7YA 4B3ST 3GWHA 3F57A 4CXXA 5EK2A 2IDOB 5M4YA 2NW9A 2KXPB 5LGUB 1XDOA 4JI6T 1H7CA 1FJGT 1IJ5A 1OWAA 2LRKA 3ZJ2A 4KUMB 4AQYT 2MAWA 5LMUT 5E0OA 1S35A 4GIWA 3PUWF 4PNIA 3S4UA 4YSYA 3IF8B 1VOMA 3ZJ1A 2LE8A 3E08A 3HR0A 2D0TA 1US7B 2WAUA 1FMVA 3AA6B 2LOPA 1XWMA 2CLYB 1EZ3A 3U3IA 2Y6XA 4EGWA 4BJMA 5FL1A 5ETWA 2E5VA 4WBOA 3AE4A 2E9XD 5JRCB 3LK42 1ZP0A 2ACZA 3JC6D 2XQ4A 5AQJB 4ZXLA 4H9RC 2WQYA 5J0ZA 5KX5E 2E9XB 1S94A 5JR9A 3ZN0B 4ANJA 4GKJT 1MMGA 2JJ9A 3I1AA 3V5SA 4BJNA 5LG4A 2ODVA 3VKHA 5LOVE 3NRYA 4XBFB 4I55E 5FMNA 1XDPA 4TNVA 2XZEA 2RPAA 5FNVE 1NENA 4EIWA 1M62A 3AVRA 4DV5T 4B3MT 3HKEE 3L8RA 3RI5A 1WCRA 3FZLB 2K9AA 5AQVB 3J9X1 1W0BA 3RF1A 2I6HA 2IW5B 2K5BB 4LF5T 3LFMA 1HTJF 4UEMA 1MNEA 4PK6A 4ILBA 2WWVA 5HEUA 3QOFA 2CXFA 4KMCA 1MMNA 3MACA 2VKOA 4H63V 4O2BE 3OYXA 5FKYA 3H3AA 2JRKA 5AQUB 3P8CD 2BDEA 1UK5A 4TZ4C 3VR9A 3ZMTB 4ZZBA 2LM9A 3CQXC 4WNKA 3N9MA 3QUJA 4HWIB 3RYIE 3BQLA 2FJDA 5AQNB 5ADXL 4N78D 4MLKA 3ZC1A 4HFEA 2XSAA 3PUYF 2HN2A 2DNXA 2UXBT 3RIFA 2D9DA 4H9SE 3KBUA 3ZEFB 4JI3T 3HKCE 4COFA 3FXEB 1BR4A 4AKRB 3R84B 2FJBA 2X68A 2XM1A 1SE7A 4YHHT 3FB2A 2WZIA 4DMWA 2E5LT 2EHOC 4LMJA 2QVAA 3ZYMA 4HFDA 4ILCA 2PFVA 5IHYA 4QH4A 3MXZA 5LNKA 4HFHA 3AE5A 4EZHA 4GYRA 4UVBB 5CFBA 5HYAA 3GN5B 5CB4E 2XQAA 4TNWA 5HXCA 2GK9A 5HAXA 2IC9A 4PJNA 4IDPA 3UQ7A 2WBLA 3K8PC 2LJLA 3EHZA 2XQYA 5F3JA 2Z6EA 2VQET 4ZI3D 4MHCA 3KDSE 4GOUA 2LOSA 4IDZA 2MYSA 4YT0A 5L47A 3GA8A 5LJMA 1MNDA 4UF0A 5AQQB 2A2FX 4H63H 3H3MA 1AJ3A 3SS1A 4QH5A 2I0MA 2VWAA 3CMLA 5FL0A 4KP3C 5TAOA 4NXMT 3ZT7A 4UVAB 3AXJA 4AQFC 5ABFA 3FZFB 1T98A 3BQIA 3O1JA 3I0OA 3CIRA 3PURA 3QK6A 4ZI2C 5JR9B 3E22E 4V1Av 4GKKT 4TV8E 2BG9E 2ACXA 3ABVA 3G06A 3ZMVB 4DV1T 2D2SA 2EHOA 5L3GB 5F5WA 4KX6A 4XZCA 4U2YA 2E9XA 5EZYE 1L0VA 5HEJA 3PV0F 3RKOA 2OV9A 3LK3B 2V7MA 1HNXT 3C4XA 3I9YA 2CEAA 2VVSA 4IE0A 2W00A 1ZOYA 2MTQA 4IE6A 2K3WA 2ZM0A 2V7KA 4LFAT 2X0LB 4FI5A 5KXJA 3D0TA 4HKAA 3PTRB 2XUEA 1HX1B 3AEDA 1OXZA 3NVOA 2MBGA 4CXYA 3DTOA 5AQFB 2BG9C 2JIWA 2LT3A 2CM0A 2H3RA 2PTFA 5LP6E 2NR4A 2BBHA 5J2TE 2KLQA 2K24A 3PJAA 2N2NA 3TLSA 2WP9A 2BS4A 1G73A 4X20E 3EVYA 5JREA 3OBVE 5L4EA 5FXXA 4YY3T 4AXPA 2CWYA 2LM2A 2H7OA 2LHRA 4AQFA 3O1IA 2A9UA 3AA0B 3RQUA 4O8SA 3VR8A 5FVKA 1IAPA 3ZYLA 2UXDT 2XHEB 2WU5A 3P4RA 4PFPA 4A5XA 4X65T 3RIAA 2YOEA 5HEGA 3ETVA 1W9RA 1OEDE 3AE9A 3DJBA 2YU1A 4DV4T 2BVMA 2JQHA 4EXTA 5HEOA 1J1JA 3CVRA 1SA0E 4NIQA 4CXWA 1XMOT 3PUAA 3AE8A 4U33A 3U78A 2MOZA 1U5PA 1XNRT 1HNWT 3TLTA 2KWHA 4JYAT 2YN6A 2YDQA 5LG3A 3N9LA 3EDVA 4DR6T 4LF9T 3K3OA 3PJAJ 3AA7B 4LMLA 3IHRA 5LYJE 2XQ8A 4EB6E 4H9OC 1E2AA 4DBRA 2JQQA 1N32T 2V26A 2CHOA 4KHZF 1VRBA 5JH7E 3AE2A 1HS7A 2W2UA 4BA9A 3ONXA 1HG2A 5HXRA 4YTNA 2BS3A 4KI0F 3GN5A 4JEHB 2CE7A 4CN6A 4UV8B 3WAJA 1YXRA 4ERRA 4HWCA 5HEHA 3A7MA 4H9NC 2J1DG 2KT9A 1M7KA 1WR6A 4LF6T 4AIUA 3KINB 1E1HB 4O2AE 3AVSA 5EK3A 4HN9A 4CN4A 3UU4A 1ZHCA 2UUCT 3RRWA 3FHNA 4U74A 2DL1A 4DMVA 4IREA 4YLHA 2JQKA 2IMLA 4UF0B 3OJAA 2LLYA 4L5GA 3VHLA 1NAFA 2C5JA 3JCFA 2VQFT 4U3CA 4I43B 5AQHB 2EHOD 3AXJB 5ABFB 5H6QB 2XQ6A 3PDYA 3NKZA 4DR5T 2X9XA 2JQ9A 5JVDE 5JDHA 4HWDA 3C50A 3FZKB 4X1KE 4OX9T 4P09A 5LBMA 3T8OA 3OYZA 4X64T 3K1SA 1MIYA 2EHOB 1MMAA 4HFBA 4CZZB 4P0BA 2DWGA 3FBZA 4JI0T 1YKEB 4CI1B 1DU2A 5AFUL 2BVLA 3DP7A 2M6IA 2UUAT 5AQPB 2JPFA 3F2EA 4B3TT 4DR1T 2NP9A 3LG7A 1JNZA 1J5ET 3RYFE 5JDFA 2XSBA 4QXBB 2V5DA 4U72A 2UXCT 1XMQT 1Z0PA 4TWHA 3ZT6A 4YSZA 3UFGA 2E8IA 2KINB 3ZMZB 2OLTA 1I6ZA 4LFCT 3SFEA 2HH7A 3ZMUB 2L3LA 2V1DB 4AKLA 3RGLA 1T7SA 4TWDA 3KV6A 2CBJA 1IBKT 4KBMB 5DQWA 2XAFB 2YKSA 4HEAA 2LHNA 3A8YC 3PUSA 2W0GA 2NWBA 3Q5DA 2OA5A 4ZI2D 3X1DA 4DV6T 2SPCA 3ZSSA 1LVFA 1N33T 4L0RA 3N9OA 3RHWA 4H9PC 3PUXF 2L8KA 3CKDA 5EK4A 4TV9E 3EABA 5KMGP 2VKHA 4QWNB 3QNUA 2LKHA 3AEGA 4EYUA 3L09A 4QH1A 4ZHQE 2XQ5A 4JV5T 3MA9A 2V7IA 4PJJA 1HG5A 4UXNB 4K0UA 5J2UE 4EEBA 5IUXA 2BKOA 4AISA 3HKDE 1XNQT 2C0SA 2FJEA 3JAFA 3N2GE 5AQKB 1MIWA 2ZM6T 4F8HA 3EI0A 3P4QA 4CQIA 2XJ7A 5HCJA 2WMOA 3UQ4A 3LJCA 5AQOB 3NRXA 2IAKA 4OFZA 1WFDA 3Q2MA 1KFYA 4IE7A 3NZQA 2BG9B 2QGSA 1D0ZA 3AEEA 5AQIB 2V7LA 2Q9QC 2XQ7A 4LF8T 5L3FB 2UXNB 3ONJA 2CHNA 1YKHB 3EUHA 3MKDA 4HGAA 4DVDA 4IE5A 3UU8A 1QSDA 5DJQC 4JUYA 1KNRA 5BR8T 3T1HT 4AI6A 4P1NA 4IDOA 3ZSTA 4FJOA 4KHPT 2VB6A 5FY1A 1NWMX 4UVCB 1IZNB 2X51A 3K3NA 4PK4A 3ESLA 4TX5A 4X66T 4QKNA 3ZYKA 1D1CA 3UU3A 2XQ9A 1UX4A 3ZCIA 2X66A 5DQVA 1CHUA 3N2KE 2Y48B 2WM9A 1BR0A 4ILUA 4YHJA 2V7JA 2M67A 3QC9A 1KNZA 4ADZA 1KNPA 3ZT5A 2CXDA 4Z91A 4LF4T 2W66A 2V6XA 1KEYA 1Y64B 5CGMA 4LMKA 1JNRA 2ZM2A 4AKIA 3UUNA 4B6XA 4HWHA 2CA5A 4ZS2A 2NTXA 3AE6A 2ZMAA 3P4SA 2CPTA 4ZZCA 3PUGA 2LSKA 4TUYE 4YXDA 2MPKA 5BMVE 4DUZT 2IHR1 5C2TA 4IL4A 3RKGA 5L3EB 2X67A 2QYWA 3ZLIA 4PJMA 2Q9QA 3KBTA 4X1IE 1OEDB 2VURA 1FEWA 3E0ZA 4YJ2E 2ZM8A 2XTLA 4JI7T 4U2ZA 2CWOA 2BKPA 2HPLA 3VKGA 2B1EA 3RX6A 2J62A 4IE4A 2X9WA 5H6RB 4O4HE 3ONLC 1ZV4X 3LSVA 1VCTA 4DNDA 4NUVA 2DI4A 2C5KT 2WDQA 4U7IA 2DLRA 1SHZC 2DWKA 4XAXB 1KK7A 3P50A 2N1GA 4DV7T 2WCAA 4QHOA 3EAMA 2LSGA 1I94T 1W0AA 3RIUC 2LSIA 1WR0A 5FYMA 4OYKA 4G63A 4DV3T 3UUMA 4Q25A 4DBQA 1HNZT 1D1BA 3K3QC 3UUBA 3AB3B 5FXWA 4EYYR 4DUYT 4LF7T 4JI1T 2V8SV 2VASA 2LSYA
chains in the Genus database with same CATH topology
2BZBA 1FMWA 2EHOD 3PU3A 3RYIE 3BQLA 5H6QB 4QX8B 5ADXL 4EZ4A 2VKDA 3PDYA 3ETUA 2X9XA 4N78D 5GONE 3R6NA 3WAKA 2D0UA 4MLKA 1BR2A 5JVDE 3ZC1A 5JDHA 3C50A 5FXVA 5LHHB 2RP4A 4X1KE 4P09A 5LBMA 3T8OA 1V9DA 2DNXA 3WI3A 3I9WA 3OYZA 2NW7A 4OK0A 3RH3A 4GYSA 3RYCE 1MIYA 1LKXA 4H9SE 2EHOB 1MMAA 1G8XA 4CZZB 1UCUA 4IIJE 4P0BA 4QXCB 2DWGA 2WMNA 3KBUA 3ZEFB 4PW8A 3FBZA 4EAHA 5JRCA 4O4LE 2XAHB 3HKCE 5KDMC 2P9BA 4JLEA 3FXEB 2PJQA 4P0AA 1BR4A 3GMIA 4AKRB 3R84B 2X68A 1YKEB 1HF8A 4CI1B 3HI2A 4F6RC 3CX8B 2N9DA 5AFUL 3CX7B 2BVLA 3L3PA 3DP7A 5FY7A 2I59A 1LRZA 3FB2A 1LVKA 4G2AA 2JPFA 2W63A 3F2EA 3Q9DA 4I4TE 2YEVC 3SRZA 4DMWA 4OYJA 4CI2B 2NP9A 2C5IT 5LCYA 2EHOC 3LG7A 5JQGE 5LHGB 3PUQA 3F31A 1HFAA 3RYFE 1WLXA 4E7SA 5JDFA 3ZYMA 3ZMSB 4QXBB 3ANWA 4U72A 5F8PA 5HWXA 4ZOLE 1WYCA 3A5XA 3KVAA 2PFVA 2HPJA 4ASKA 1IJ6A 1Z0PA 4IHJE 5IHYA 3MXZA 2JMKA 3CWZB 5LNKA 3ZN1B 4EZHA 2E8IA 2KINB 1BR1A 2KMFA 3LBXA 4YJ3E 3ZMZB 4GYRA 4UVBB 3IBPA 5HYAA 3N9PA 1D0XA 3GN5B 3RPUA 4PJLA 2NTYA 3N2OA 5CB4E 2ZLYA 4MFRA 4YFSA 5HXCA 2GK9A 2HH7A 3ZMUB 2L3LA 2V1DB 5HAXA 2IC9A 2LSJA 1ZEEA 3TKLB 2K48A 4AKLA 3C51A 2CCQA 4PJNA 3PU8A 4PFOA 3KV6A 3P7IA 4C90A 4C91A 3AAEB 2WBLA 4UV9B 3K8PC 1X79A 2LJLA 4KBMB 2XQYA 5DQWA 3UT5E 5F3JA 5L3CB 2XAFB 1U4QA 4BAYB 2UXXB 1O3XA 4HEAA 3BK9A 4GK5E 5LGTB 2LHNA 2Z6EA 5JDNA 3PUSA 2W0GA 2NWBA 2XAGB 2OA5A 3Q5XA 5FP3A 5FY0A 4ZI2D 2JMHA 1D0YA 3C4ZA 4MHCA 4ZI3D 2RA1A 2SPCA 1LVFA 3KDSE 3LK2B 2Y8DA 2LEHA 4GOUA 4O4IE 4L0RA 3N9OA 2LOSA 3CPZA 4H9PC 4IDZA 2MYSA 2L8KA 3CKDA 5EK4A 3UTKA 3HKBE 4TV9E 3RC8A 3GA8A 5KMGP 2VKHA 2WSSV 5L2LA 5LJMA 1CUNA 5A1LA 2YU2A 1MNDA 3MZKB 4QWNB 4UF0A 2XAQB 2A2FX 3CQGB 4H63H 4EYUA 3L09A 3KVBA 3SS1A 1AJ3A 2ODUA 3IEEA 3CX6B 4ZHQE 2VWAA 3CMLA 2DCFA 1MIVA 3KV4A 5HXHA 4M1PA 4KP3C 5TAOA 2Q9QD 4CI3B 3I0QA 3MA9A 5CA0E 2V7IA 4PJJA 1HG5A 2NW8A 5FXZA 2DHRA 4UXNB 3UUXB 4UVAB 3KFWX 4K0UA 4AQFC 1T98A 3BQIA 4A56A 5LGNB 3O1JA 4JEUB 3I0OA 5J2UE 3B13A 1UX5A 1ZKEA 3UULA 3PURA 4ZI7E 3QK6A 4ZI2C 5JR9B 3HKDE 1YD8G 3E22E 4ZI3C 2KWIB 4PK5A 2C0SA 4V1Av 2PG8A 3AAIA 4TV8E 3N2GE 2ACXA 2Q9QB 4IGUA 4PAGA 3ZMVB 3M65A 1MIWA 4QX7B 2D2SA 2EHOA 5L3GB 4XZCA 2KZ7B 2E9XA 4CQIA 2VL8A 5EZYE 4L9IA 4Z8XA 2QA7A 2WMOA 3LJCA 3RKOA 3C4WA 3LK3B 2IAKA 2V7MA 3KV5A 3N9NA 2YK0A 3NRXA 3RYHE 5JDLA 5JDMA 5L3DB 2PBIA 3C4XA 4OFZA 3I9YA 3ANWB 4TN7B 2CEAA 5JR9C 5L3BB 4IE0A 3Q2MA 4H9QC 4IE7A 2W00A 3EDUA 3NZQA 4MALA 3RRCA 2QGSA 1D0ZA 2V7LA 2Q9QC 3N9QA 2MTQA 4IE6A 5L3FB 3J7Yq 5DABA 2UXNB 2ZM0A 4UIGA 5LHIB 2V7KA 1YKHB 3OKQA 3C98B 2X9YA 3EUHA 3MKDA 4HGAA 4DVDA 4IE5A 5HXEA 2X0LB 1QSDA 5DJQC 4FI5A 4JUYA 3D0TA 3N5LA 3KV9A 4HKAA 3CQCB 2XUEA 3PTRB 2YINA 3O4XE 5CA1E 4AI6A 4FJOA 4WW0A 2VB6A 3GWHA 3F57A 5FY1A 4CXXA 1NWMX 1OXZA 2MBGA 3MK7C 2CMRA 4UVCB 1B7TA 1IZNB 4CXYA 2X51A 5EK2A 3K3NA 3DTOA 5M4YA 4PK4A 3ESLA 4TX5A 2NW9A 3ZCJA 4QKNA 3ZYKA 2KXPB 2LT3A 5LGUB 1D1CA 1WRDA 2CM0A 3AAAB 2H3RA 5J1GA 5LP6E 1UX4A 3ZCIA 2X66A 5DQVA 5J2TE 1H7CA 3VU7H 1IJ5A 2KLQA 3B57A 3N2KE 4ZS3A 5HWYA 2Y48B 1OWAA 1HCIA 4I50E 1QUUA 4MBQA 4AKHA 2K24A 2WM9A 1BR0A 3BQKA 3ZJ2A 4KUMB 5E0OA 4ILUA 1S35A 4YHJA 2N2NA 4GIWA 2V7JA 4PNIA 2W62A 2M67A 3ZPOA 2D5UA 1G73A 2XAJB 3S4UA 4X20E 3EVYA 3QC9A 5JREA 1KNZA 5HXSA 4ADZA 3IF8B 3OBVE 2CXDA 1VOMA 2VK9A 3ZJ1A 5FXXA 4AXPA 2CWYA 2LE8A 2H7OA 3ZC0A 4HTEA 4NUUA 3FBLA 3E08A 3HR0A 4HFVA 1Y64B 3RC3A 2D0TA 3UFEA 4AKGA 1US7B 2WAUA 3C64A 4UELA 1FMVA 2LHRA 3NZPA 2ZM2A 3O1IA 4AQFA 4AKIA 3AA0B 5C8YE 3AA6B 3O9XA 3UUNA 2LOPA 2W61A 4O8SA 4B6XA 2CLYB 1EZ3A 3U3IA 2Y6XA 2CA5A 4ZS2A 1IAPA 4BJMA 5ETWA 2NTXA 4O4JE 3ZYLA 2XHEB 4PFPA 2XASB 4WBOA 2KNDA 2E9XD 3ETVA 2ZMAA 3PUGA 5LA6E 3DJBA 2YU1A 2BVMA 3MJXA 2LSKA 4GK0E 4EXTA 5JRCB 3LK42 4TUYE 3CVRA 4AQGA 1SA0E 4WBNE 4CXWA 3JC6D 3PUAA 2H7VC 3U78A 5BMVE 2MOZA 4X1YE 4E7ZA 1U5PA 4H9RC 2CLYC 2KWHA 2VKJA 5KX5E 2E9XB 1S94A 5JR9A 3ZN0B 5L3EB 3N9LA 4ANJA 2X67A 3EDVA 3ZLIA 1MMGA 3K3OA 4PJMA 2Q9QA 1D1AA 2JJ9A 3KBTA 4X1IE 3I1AA 3AA7B 3V5SA 4BJNA 4DO0A 5LG4A 2ODVA 5IYZE 3IHRA 5LYJE 3VKHA 1FEWA 3E0ZA 5LOVE 2IC6A 4YJ2E 2ZM8A 2XTLA 4EB6E 3NRYA 4XBFB 4H9OC 4I55E 1MMDA 4DBRA 5FMNA 2CWOA 2JQQA 3SWHA 2V26A 1FIOA 4ISTA 5FNVE 1VRBA 2HPLA 3VKGA 4EIWA 3LBXB 2X9HA 2B1EA 4J2CA 3RX6A 4HE8A 2E9XC 4IE4A 5JH7E 2ES0A 2X9WA 2CXLA 5H6RB 4QXHB 1HS7A 4O4HE 3AVRA 1HX8A 3HKEE 3JC6C 1ZV4X 3ONXA 4OHFA 1HG2A 5HXRA 4BA9A 2K9AA 5LBQB 4DNDA 3J9X1 3GN5A 4JEHB 2CE7A 4NUVA 2DI4A 4UV8B 3WAJA 2C5KT 1WYBA 3O1HA 5LXTE 2IW5B 2K5BB 4ERRA 3LFMA 3V5UA 4H9NC 2J1DG 1HTJF 2DLRA 4UEMA 2KT9A 1SHZC 2DWKA 1MNEA 4XAXB 1WR6A 5JDGA 2WWUA 1KK7A 3W15B 4PK6A 2N1GA 3HL6A 3AA1B 4QHOA 2CXFA 3KINB 4KMCA 1MMNA 3MACA 5LJNA 2VKOA 3SOLA 4H63V 2LSGA 1E1HB 2A3DA 4O2BE 3AVSA 4O2AE 5EK3A 3Q5WA 2LSIA 3OYXA 4HN9A 5JDQA 3H3AA 3NBXX 2JRKA 4EOZB 1ZHCA 3RRWA 5FYMA 3HA4A 3FHNA 3P8CD 4OYKA 2BDEA 4U74A 4DMVA 4G63A 2A72A 3UUMA 1YW0A 4YLHA 4UF0B 3OJAA 4TZ4C 4L5GA 3ZMTB 4DBQA 1D1BA 3FXDB 3H37A 3K3QC 2L9QA 3AB3B 5FXWA 3VHLA 2LM9A 4ISSA 2NOXA 1NAFA 3CQXC 4EYYR 2C5JA 3PE0A 2VASA 4WNKA 3N9MA 2G0UA 4I43B 2LSYA 3QUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI2 D;  2K9A A;  4ZI3 D;  4ZI2 C;  4ZI3 C; 
#chains in the Genus database with same CATH topology
 3QB5 K;  3PU3 A;  2WY2 A;  1T72 A;  4EZ4 A;  2VKD A;  4JI2 T;  3FZH B;  2D0U A;  1BR2 A;  2R6G F;  5FXV A;  5LHH B;  2RP4 A;  2V6Y A;  3I9W A;  4DV2 T;  2NW7 A;  4OK0 A;  3RH3 A;  2WMN A;  4UR9 A;  2XAH B;  2LRL A;  5KDM C;  4B3R T;  2PJQ A;  4P0A A;  3GMI A;  3P4W A;  1HF8 A;  3HI2 A;  3CX8 B;  2N9D A;  3L3P A;  5AQS B;  2I59 A;  4I4T E;  2YEV C;  4OYJ A;  5LCY A;  3LDQ B;  2WS3 A;  3PUQ A;  4E7S A;  3ZMS B;  5HWX A;  2X0Y A;  4ZOL E;  3A5X A;  2BG9 A;  2HPJ A;  1OED C;  4ILA A;  1BR1 A;  2KMF A;  3LBX A;  3IBP A;  1N36 T;  3N2O A;  2ZLY A;  4YFS A;  2LSJ A;  3RIU A;  3C51 A;  2CCQ A;  3PU8 A;  4C91 A;  3AAE B;  2HN1 A;  1X79 A;  2H88 A;  2XPK A;  5L3C B;  4BAY B;  3BK9 A;  4GK5 E;  2UU9 T;  2XAG B;  4IDN A;  5FP3 A;  3IA3 A;  5CJ5 A;  3LK2 B;  5AQT B;  2Y8D A;  2LEH A;  4JI8 T;  2V5C A;  3M3Z B;  3CPZ A;  2FBW A;  1VCS A;  5L2L A;  1CUN A;  3MZK B;  5L4H A;  2BKN A;  4YTM A;  3RLF F;  2ODU A;  3CX6 B;  4YSX A;  3TLV A;  2DCF A;  5HXH A;  4M1P A;  2Q9Q D;  4CI3 B;  3I0Q A;  5AQL B;  3B5M A;  2NW8 A;  2DHR A;  3UUX B;  2FJA A;  3B13 A;  1ZKE A;  2IUB A;  2H89 A;  3P4P A;  1YD8 G;  4PK5 A;  3AAI A;  2Q9Q B;  3M65 A;  4JBW F;  4IDQ A;  2KZ7 B;  2VL8 A;  4DR2 T;  1IBM T;  4L9I A;  4Z8X A;  2AXD S;  1OED A;  4YTP A;  5JDM A;  5L3D B;  5JDL A;  2PBI A;  4TN7 B;  3ANW B;  4DV0 T;  3EDU A;  1Y01 A;  4MAL A;  3N9Q A;  3J7Y q;  5DAB A;  3C98 B;  4ZEY A;  2X9Y A;  1UUR A;  3N5L A;  3KV9 A;  3CQC B;  2YIN A;  3O4X E;  5CA1 E;  5JTG A;  2WU2 A;  4WW0 A;  3MK7 C;  2CMR A;  1B7T A;  2M6B A;  3ZCJ A;  2WDR A;  3RQW A;  1WRD A;  3AAA B;  5J1G A;  1SUM B;  3VU7 H;  5IWA T;  4ZS3 A;  3B57 A;  2B76 A;  5HWY A;  1HCI A;  4I50 E;  1QUU A;  4MBQ A;  4AKH A;  3BQK A;  4K0K T;  1XZY A;  4HFC A;  2IIU A;  3PUZ F;  2W62 A;  3ZPO A;  2D5U A;  2XAJ B;  5HXS A;  3TLW A;  2VK9 A;  5ABH A;  3ZC0 A;  4HTE A;  4NUU A;  3FBL A;  4HFV A;  3RC3 A;  3UFE A;  4AKG A;  3C64 A;  4UEL A;  3NZP A;  4CN1 A;  5C8Y E;  2F4V T;  3O9X A;  2W61 A;  2V6Y B;  3OVU A;  4TWF A;  4NPP A;  4O4J E;  2YDR A;  5ABG A;  2XAS B;  2XM2 A;  2KND A;  2UUB T;  3QB5 A;  5LA6 E;  3MJX A;  4GK0 E;  4AQG A;  4WBN E;  4EED A;  2H7V C;  3JAD A;  4X1Y E;  4E7Z A;  3SFD A;  2CLY C;  2VKJ A;  2QRX A;  2WZH A;  4DO0 A;  4DR3 T;  5IYZ E;  2IC6 A;  5HCM A;  1MMD A;  3SWH A;  1N34 T;  1FIO A;  3AEA A;  4IST A;  3UU5 A;  2XQ3 A;  4U31 A;  2XY8 B;  3LBX B;  2X9H A;  4J2C A;  3L39 A;  4HE8 A;  2E9X C;  2ES0 A;  2CXL A;  4QXH B;  1HX8 A;  1YQ4 A;  3JC6 C;  4OHF A;  3FZM B;  1Z8U A;  5LBQ B;  5AQR B;  1WYB A;  3O1H A;  1NEK A;  5LXT E;  3NWI A;  1J5W A;  2BBJ A;  3V5U A;  4JI4 T;  5JDG A;  2WWU A;  3W15 B;  3HL6 A;  3AA1 B;  5LJN A;  3AE1 A;  3SOL A;  3Q5E A;  2A3D A;  2CBI A;  3Q5W A;  5JDQ A;  4DR7 T;  2VL0 A;  3NBX X;  5AQG B;  4EOZ B;  3HA4 A;  2A72 A;  2J47 A;  1YW0 A;  4WZX A;  3FXD B;  3H37 A;  2L9Q A;  1GQE A;  4ISS A;  2NOX A;  3PE0 A;  2G0U A;  1D1A A;  2BZB A;  1FMW A;  1T8B A;  4QX8 B;  3ETU A;  5GON E;  3R6N A;  4DR4 T;  3WAK A;  4HFI A;  3AE7 A;  1V9D A;  3WI3 A;  4JI5 T;  4GYS A;  3RYC E;  1LKX A;  2W67 A;  1G8X A;  1UCU A;  4IIJ E;  4QXC B;  5LB7 B;  4PW8 A;  4EAH A;  5JRC A;  1W09 A;  4O4L E;  2P9B A;  4JLE A;  4WYV A;  4F6R C;  4X62 T;  3CX7 B;  1HR0 T;  5FY7 A;  1LRZ A;  2E2A A;  1LVK A;  3AE3 A;  4G2A A;  2W63 A;  3Q9D A;  3SRZ A;  4CI2 B;  2C5I T;  4Z90 A;  4A97 A;  5JQG E;  5LHG B;  1UUS A;  1HFA A;  3F31 A;  1WLX A;  3VRB A;  1X9B A;  3ANW A;  5F8P A;  1WYC A;  3KVA A;  4IT4 A;  4ASK A;  1IJ6 A;  4IHJ E;  4DID B;  2JMK A;  3CWZ B;  3ZN1 B;  2HHH T;  4YJ3 E;  3N9P A;  2FUP A;  1D0X A;  3RPU A;  4PJL A;  2CRB A;  2NTY A;  4MFR A;  1UGO A;  1ZEE A;  3TKL B;  2K48 A;  3AEC A;  4C90 A;  4PFO A;  3P7I A;  4I0U A;  3JAE A;  4UV9 B;  1YQ3 A;  4A98 A;  1R8I A;  3UT5 E;  1U4Q A;  1O3X A;  2UXX B;  3TLU A;  5LGT B;  5JDN A;  3Q5X A;  3OTO T;  3ZKR A;  5FY0 A;  2J4G A;  2WB5 A;  2JMH A;  1D0Y A;  3C4Z A;  2RA1 A;  3UU6 A;  2WDV A;  4O4I E;  2X0H A;  3UTK A;  3HKB E;  3RC8 A;  4X5T A;  2WSS V;  5A1L A;  2YU2 A;  2XAQ B;  3CQG B;  3VRA A;  1QLB A;  2KSR A;  3KVB A;  1E7P A;  3IEE A;  2YDS A;  1MIV A;  3KV4 A;  5AQM B;  5CA0 E;  5FXZ A;  3KFW X;  3AEB A;  4EV6 A;  4A56 A;  5FVL A;  5LGN B;  4JEU B;  2BS2 A;  1UX5 A;  3UUL A;  4ZI7 E;  2LKG A;  3CK6 A;  4ZI3 C;  2KWI B;  2PG8 A;  4PAG A;  4IGU A;  2VVN A;  2W4X A;  4QX7 B;  5C3J A;  2AE9 A;  3AEF A;  4NXN T;  2QA7 A;  4HWF A;  3C4W A;  3KV5 A;  3N9N A;  2YK0 A;  3RYH E;  4IL9 A;  3T1Y T;  5JR9 C;  5L3B B;  3OPC A;  4H9Q C;  4LFB T;  3RRC A;  5ABE A;  4UIG A;  5LHI B;  1KF6 A;  3OKQ A;  5HXE A;  3PUV F;  1IBL T;  5LMN T;  4U7Y A;  4B3S T;  3GWH A;  3F57 A;  4CXX A;  5EK2 A;  2IDO B;  5M4Y A;  2NW9 A;  2KXP B;  5LGU B;  1XDO A;  4JI6 T;  1H7C A;  1FJG T;  1IJ5 A;  1OWA A;  2LRK A;  3ZJ2 A;  4KUM B;  4AQY T;  2MAW A;  5LMU T;  5E0O A;  1S35 A;  4GIW A;  3PUW F;  4PNI A;  3S4U A;  4YSY A;  3IF8 B;  1VOM A;  3ZJ1 A;  2LE8 A;  3E08 A;  3HR0 A;  2D0T A;  1US7 B;  2WAU A;  1FMV A;  3AA6 B;  2LOP A;  1XWM A;  2CLY B;  1EZ3 A;  3U3I A;  2Y6X A;  4EGW A;  4BJM A;  5FL1 A;  5ETW A;  2E5V A;  4WBO A;  3AE4 A;  2E9X D;  5JRC B;  3LK4 2;  1ZP0 A;  2ACZ A;  3JC6 D;  2XQ4 A;  5AQJ B;  4ZXL A;  4H9R C;  2WQY A;  5J0Z A;  5KX5 E;  2E9X B;  1S94 A;  5JR9 A;  3ZN0 B;  4ANJ A;  4GKJ T;  1MMG A;  2JJ9 A;  3I1A A;  3V5S A;  4BJN A;  5LG4 A;  2ODV A;  3VKH A;  5LOV E;  3NRY A;  4XBF B;  4I55 E;  5FMN A;  1XDP A;  4TNV A;  2XZE A;  2RPA A;  5FNV E;  1NEN A;  4EIW A;  1M62 A;  3AVR A;  4DV5 T;  4B3M T;  3HKE E;  3L8R A;  3RI5 A;  1WCR A;  3FZL B;  2K9A A;  5AQV B;  3J9X 1;  1W0B A;  3RF1 A;  2I6H A;  2IW5 B;  2K5B B;  4LF5 T;  3LFM A;  1HTJ F;  4UEM A;  1MNE A;  4PK6 A;  4ILB A;  2WWV A;  5HEU A;  3QOF A;  2CXF A;  4KMC A;  1MMN A;  3MAC A;  2VKO A;  4H63 V;  4O2B E;  3OYX A;  5FKY A;  3H3A A;  2JRK A;  5AQU B;  3P8C D;  2BDE A;  1UK5 A;  4TZ4 C;  3VR9 A;  3ZMT B;  4ZZB A;  2LM9 A;  3CQX C;  4WNK A;  3N9M A;  3QUJ A;  4HWI B;  3RYI E;  3BQL A;  2FJD A;  5AQN B;  5ADX L;  4N78 D;  4MLK A;  3ZC1 A;  4HFE A;  2XSA A;  3PUY F;  2HN2 A;  2DNX A;  2UXB T;  3RIF A;  2D9D A;  4H9S E;  3KBU A;  3ZEF B;  4JI3 T;  3HKC E;  4COF A;  3FXE B;  1BR4 A;  4AKR B;  3R84 B;  2FJB A;  2X68 A;  2XM1 A;  1SE7 A;  4YHH T;  3FB2 A;  2WZI A;  4DMW A;  2E5L T;  2EHO C;  4LMJ A;  2QVA A;  3ZYM A;  4HFD A;  4ILC A;  2PFV A;  5IHY A;  4QH4 A;  3MXZ A;  5LNK A;  4HFH A;  3AE5 A;  4EZH A;  4GYR A;  4UVB B;  5CFB A;  5HYA A;  3GN5 B;  5CB4 E;  2XQA A;  4TNW A;  5HXC A;  2GK9 A;  5HAX A;  2IC9 A;  4PJN A;  4IDP A;  3UQ7 A;  2WBL A;  3K8P C;  2LJL A;  3EHZ A;  2XQY A;  5F3J A;  2Z6E A;  2VQE T;  4ZI3 D;  4MHC A;  3KDS E;  4GOU A;  2LOS A;  4IDZ A;  2MYS A;  4YT0 A;  5L47 A;  3GA8 A;  5LJM A;  1MND A;  4UF0 A;  5AQQ B;  2A2F X;  4H63 H;  3H3M A;  1AJ3 A;  3SS1 A;  4QH5 A;  2I0M A;  2VWA A;  3CML A;  5FL0 A;  4KP3 C;  5TAO A;  4NXM T;  3ZT7 A;  4UVA B;  3AXJ A;  4AQF C;  5ABF A;  3FZF B;  1T98 A;  3BQI A;  3O1J A;  3I0O A;  3CIR A;  3PUR A;  3QK6 A;  4ZI2 C;  5JR9 B;  3E22 E;  4V1A v;  4GKK T;  4TV8 E;  2BG9 E;  2ACX A;  3ABV A;  3G06 A;  3ZMV B;  4DV1 T;  2D2S A;  2EHO A;  5L3G B;  5F5W A;  4KX6 A;  4XZC A;  4U2Y A;  2E9X A;  5EZY E;  1L0V A;  5HEJ A;  3PV0 F;  3RKO A;  2OV9 A;  3LK3 B;  2V7M A;  1HNX T;  3C4X A;  3I9Y A;  2CEA A;  2VVS A;  4IE0 A;  2W00 A;  1ZOY A;  2MTQ A;  4IE6 A;  2K3W A;  2ZM0 A;  2V7K A;  4LFA T;  2X0L B;  4FI5 A;  5KXJ A;  3D0T A;  4HKA A;  3PTR B;  2XUE A;  1HX1 B;  3AED A;  1OXZ A;  3NVO A;  2MBG A;  4CXY A;  3DTO A;  5AQF B;  2BG9 C;  2JIW A;  2LT3 A;  2CM0 A;  2H3R A;  2PTF A;  5LP6 E;  2NR4 A;  2BBH A;  5J2T E;  2KLQ A;  2K24 A;  3PJA A;  2N2N A;  3TLS A;  2WP9 A;  2BS4 A;  1G73 A;  4X20 E;  3EVY A;  5JRE A;  3OBV E;  5L4E A;  5FXX A;  4YY3 T;  4AXP A;  2CWY A;  2LM2 A;  2H7O A;  2LHR A;  4AQF A;  3O1I A;  2A9U A;  3AA0 B;  3RQU A;  4O8S A;  3VR8 A;  5FVK A;  1IAP A;  3ZYL A;  2UXD T;  2XHE B;  2WU5 A;  3P4R A;  4PFP A;  4A5X A;  4X65 T;  3RIA A;  2YOE A;  5HEG A;  3ETV A;  1W9R A;  1OED E;  3AE9 A;  3DJB A;  2YU1 A;  4DV4 T;  2BVM A;  2JQH A;  4EXT A;  5HEO A;  1J1J A;  3CVR A;  1SA0 E;  4NIQ A;  4CXW A;  1XMO T;  3PUA A;  3AE8 A;  4U33 A;  3U78 A;  2MOZ A;  1U5P A;  1XNR T;  1HNW T;  3TLT A;  2KWH A;  4JYA T;  2YN6 A;  2YDQ A;  5LG3 A;  3N9L A;  3EDV A;  4DR6 T;  4LF9 T;  3K3O A;  3PJA J;  3AA7 B;  4LML A;  3IHR A;  5LYJ E;  2XQ8 A;  4EB6 E;  4H9O C;  1E2A A;  4DBR A;  2JQQ A;  1N32 T;  2V26 A;  2CHO A;  4KHZ F;  1VRB A;  5JH7 E;  3AE2 A;  1HS7 A;  2W2U A;  4BA9 A;  3ONX A;  1HG2 A;  5HXR A;  4YTN A;  2BS3 A;  4KI0 F;  3GN5 A;  4JEH B;  2CE7 A;  4CN6 A;  4UV8 B;  3WAJ A;  1YXR A;  4ERR A;  4HWC A;  5HEH A;  3A7M A;  4H9N C;  2J1D G;  2KT9 A;  1M7K A;  1WR6 A;  4LF6 T;  4AIU A;  3KIN B;  1E1H B;  4O2A E;  3AVS A;  5EK3 A;  4HN9 A;  4CN4 A;  3UU4 A;  1ZHC A;  2UUC T;  3RRW A;  3FHN A;  4U74 A;  2DL1 A;  4DMV A;  4IRE A;  4YLH A;  2JQK A;  2IML A;  4UF0 B;  3OJA A;  2LLY A;  4L5G A;  3VHL A;  1NAF A;  2C5J A;  3JCF A;  2VQF T;  4U3C A;  4I43 B;  5AQH B;  2EHO D;  3AXJ B;  5ABF B;  5H6Q B;  2XQ6 A;  3PDY A;  3NKZ A;  4DR5 T;  2X9X A;  2JQ9 A;  5JVD E;  5JDH A;  4HWD A;  3C50 A;  3FZK B;  4X1K E;  4OX9 T;  4P09 A;  5LBM A;  3T8O A;  3OYZ A;  4X64 T;  3K1S A;  1MIY A;  2EHO B;  1MMA A;  4HFB A;  4CZZ B;  4P0B A;  2DWG A;  3FBZ A;  4JI0 T;  1YKE B;  4CI1 B;  1DU2 A;  5AFU L;  2BVL A;  3DP7 A;  2M6I A;  2UUA T;  5AQP B;  2JPF A;  3F2E A;  4B3T T;  4DR1 T;  2NP9 A;  3LG7 A;  1JNZ A;  1J5E T;  3RYF E;  5JDF A;  2XSB A;  4QXB B;  2V5D A;  4U72 A;  2UXC T;  1XMQ T;  1Z0P A;  4TWH A;  3ZT6 A;  4YSZ A;  3UFG A;  2E8I A;  2KIN B;  3ZMZ B;  2OLT A;  1I6Z A;  4LFC T;  3SFE A;  2HH7 A;  3ZMU B;  2L3L A;  2V1D B;  4AKL A;  3RGL A;  1T7S A;  4TWD A;  3KV6 A;  2CBJ A;  1IBK T;  4KBM B;  5DQW A;  2XAF B;  2YKS A;  4HEA A;  2LHN A;  3A8Y C;  3PUS A;  2W0G A;  2NWB A;  3Q5D A;  2OA5 A;  4ZI2 D;  3X1D A;  4DV6 T;  2SPC A;  3ZSS A;  1LVF A;  1N33 T;  4L0R A;  3N9O A;  3RHW A;  4H9P C;  3PUX F;  2L8K A;  3CKD A;  5EK4 A;  4TV9 E;  3EAB A;  5KMG P;  2VKH A;  4QWN B;  3QNU A;  2LKH A;  3AEG A;  4EYU A;  3L09 A;  4QH1 A;  4ZHQ E;  2XQ5 A;  4JV5 T;  3MA9 A;  2V7I A;  4PJJ A;  1HG5 A;  4UXN B;  4K0U A;  5J2U E;  4EEB A;  5IUX A;  2BKO A;  4AIS A;  3HKD E;  1XNQ T;  2C0S A;  2FJE A;  3JAF A;  3N2G E;  5AQK B;  1MIW A;  2ZM6 T;  4F8H A;  3EI0 A;  3P4Q A;  4CQI A;  2XJ7 A;  5HCJ A;  2WMO A;  3UQ4 A;  3LJC A;  5AQO B;  3NRX A;  2IAK A;  4OFZ A;  1WFD A;  3Q2M A;  1KFY A;  4IE7 A;  3NZQ A;  2BG9 B;  2QGS A;  1D0Z A;  3AEE A;  5AQI B;  2V7L A;  2Q9Q C;  2XQ7 A;  4LF8 T;  5L3F B;  2UXN B;  3ONJ A;  2CHN A;  1YKH B;  3EUH A;  3MKD A;  4HGA A;  4DVD A;  4IE5 A;  3UU8 A;  1QSD A;  5DJQ C;  4JUY A;  1KNR A;  5BR8 T;  3T1H T;  4AI6 A;  4P1N A;  4IDO A;  3ZST A;  4FJO A;  4KHP T;  2VB6 A;  5FY1 A;  1NWM X;  4UVC B;  1IZN B;  2X51 A;  3K3N A;  4PK4 A;  3ESL A;  4TX5 A;  4X66 T;  4QKN A;  3ZYK A;  1D1C A;  3UU3 A;  2XQ9 A;  1UX4 A;  3ZCI A;  2X66 A;  5DQV A;  1CHU A;  3N2K E;  2Y48 B;  2WM9 A;  1BR0 A;  4ILU A;  4YHJ A;  2V7J A;  2M67 A;  3QC9 A;  1KNZ A;  4ADZ A;  1KNP A;  3ZT5 A;  2CXD A;  4Z91 A;  4LF4 T;  2W66 A;  2V6X A;  1KEY A;  1Y64 B;  5CGM A;  4LMK A;  1JNR A;  2ZM2 A;  4AKI A;  3UUN A;  4B6X A;  4HWH A;  2CA5 A;  4ZS2 A;  2NTX A;  3AE6 A;  2ZMA A;  3P4S A;  2CPT A;  4ZZC A;  3PUG A;  2LSK A;  4TUY E;  4YXD A;  2MPK A;  5BMV E;  4DUZ T;  2IHR 1;  5C2T A;  4IL4 A;  3RKG A;  5L3E B;  2X67 A;  2QYW A;  3ZLI A;  4PJM A;  2Q9Q A;  3KBT A;  4X1I E;  1OED B;  2VUR A;  1FEW A;  3E0Z A;  4YJ2 E;  2ZM8 A;  2XTL A;  4JI7 T;  4U2Z A;  2CWO A;  2BKP A;  2HPL A;  3VKG A;  2B1E A;  3RX6 A;  2J62 A;  4IE4 A;  2X9W A;  5H6R B;  4O4H E;  3ONL C;  1ZV4 X;  3LSV A;  1VCT A;  4DND A;  4NUV A;  2DI4 A;  2C5K T;  2WDQ A;  4U7I A;  2DLR A;  1SHZ C;  2DWK A;  4XAX B;  1KK7 A;  3P50 A;  2N1G A;  4DV7 T;  2WCA A;  4QHO A;  3EAM A;  2LSG A;  1I94 T;  1W0A A;  3RIU C;  2LSI A;  1WR0 A;  5FYM A;  4OYK A;  4G63 A;  4DV3 T;  3UUM A;  4Q25 A;  4DBQ A;  1HNZ T;  1D1B A;  3K3Q C;  3UUB A;  3AB3 B;  5FXW A;  4EYY R;  4DUY T;  4LF7 T;  4JI1 T;  2V8S V;  2VAS A;  2LSY A; 
#chains in the Genus database with same CATH homology
 2BZB A;  1FMW A;  2EHO D;  3PU3 A;  3RYI E;  3BQL A;  5H6Q B;  4QX8 B;  5ADX L;  4EZ4 A;  2VKD A;  3PDY A;  3ETU A;  2X9X A;  4N78 D;  5GON E;  3R6N A;  3WAK A;  2D0U A;  4MLK A;  1BR2 A;  5JVD E;  3ZC1 A;  5JDH A;  3C50 A;  5FXV A;  5LHH B;  2RP4 A;  4X1K E;  4P09 A;  5LBM A;  3T8O A;  1V9D A;  2DNX A;  3WI3 A;  3I9W A;  3OYZ A;  2NW7 A;  4OK0 A;  3RH3 A;  4GYS A;  3RYC E;  1MIY A;  1LKX A;  4H9S E;  2EHO B;  1MMA A;  1G8X A;  4CZZ B;  1UCU A;  4IIJ E;  4P0B A;  4QXC B;  2DWG A;  2WMN A;  3KBU A;  3ZEF B;  4PW8 A;  3FBZ A;  4EAH A;  5JRC A;  4O4L E;  2XAH B;  3HKC E;  5KDM C;  2P9B A;  4JLE A;  3FXE B;  2PJQ A;  4P0A A;  1BR4 A;  3GMI A;  4AKR B;  3R84 B;  2X68 A;  1YKE B;  1HF8 A;  4CI1 B;  3HI2 A;  4F6R C;  3CX8 B;  2N9D A;  5AFU L;  3CX7 B;  2BVL A;  3L3P A;  3DP7 A;  5FY7 A;  2I59 A;  1LRZ A;  3FB2 A;  1LVK A;  4G2A A;  2JPF A;  2W63 A;  3F2E A;  3Q9D A;  4I4T E;  2YEV C;  3SRZ A;  4DMW A;  4OYJ A;  4CI2 B;  2NP9 A;  2C5I T;  5LCY A;  2EHO C;  3LG7 A;  5JQG E;  5LHG B;  3PUQ A;  3F31 A;  1HFA A;  3RYF E;  1WLX A;  4E7S A;  5JDF A;  3ZYM A;  3ZMS B;  4QXB B;  3ANW A;  4U72 A;  5F8P A;  5HWX A;  4ZOL E;  1WYC A;  3A5X A;  3KVA A;  2PFV A;  2HPJ A;  4ASK A;  1IJ6 A;  1Z0P A;  4IHJ E;  5IHY A;  3MXZ A;  2JMK A;  3CWZ B;  5LNK A;  3ZN1 B;  4EZH A;  2E8I A;  2KIN B;  1BR1 A;  2KMF A;  3LBX A;  4YJ3 E;  3ZMZ B;  4GYR A;  4UVB B;  3IBP A;  5HYA A;  3N9P A;  1D0X A;  3GN5 B;  3RPU A;  4PJL A;  2NTY A;  3N2O A;  5CB4 E;  2ZLY A;  4MFR A;  4YFS A;  5HXC A;  2GK9 A;  2HH7 A;  3ZMU B;  2L3L A;  2V1D B;  5HAX A;  2IC9 A;  2LSJ A;  1ZEE A;  3TKL B;  2K48 A;  4AKL A;  3C51 A;  2CCQ A;  4PJN A;  3PU8 A;  4PFO A;  3KV6 A;  3P7I A;  4C90 A;  4C91 A;  3AAE B;  2WBL A;  4UV9 B;  3K8P C;  1X79 A;  2LJL A;  4KBM B;  2XQY A;  5DQW A;  3UT5 E;  5F3J A;  5L3C B;  2XAF B;  1U4Q A;  4BAY B;  2UXX B;  1O3X A;  4HEA A;  3BK9 A;  4GK5 E;  5LGT B;  2LHN A;  2Z6E A;  5JDN A;  3PUS A;  2W0G A;  2NWB A;  2XAG B;  2OA5 A;  3Q5X A;  5FP3 A;  5FY0 A;  4ZI2 D;  2JMH A;  1D0Y A;  3C4Z A;  4MHC A;  4ZI3 D;  2RA1 A;  2SPC A;  1LVF A;  3KDS E;  3LK2 B;  2Y8D A;  2LEH A;  4GOU A;  4O4I E;  4L0R A;  3N9O A;  2LOS A;  3CPZ A;  4H9P C;  4IDZ A;  2MYS A;  2L8K A;  3CKD A;  5EK4 A;  3UTK A;  3HKB E;  4TV9 E;  3RC8 A;  3GA8 A;  5KMG P;  2VKH A;  2WSS V;  5L2L A;  5LJM A;  1CUN A;  5A1L A;  2YU2 A;  1MND A;  3MZK B;  4QWN B;  4UF0 A;  2XAQ B;  2A2F X;  3CQG B;  4H63 H;  4EYU A;  3L09 A;  3KVB A;  3SS1 A;  1AJ3 A;  2ODU A;  3IEE A;  3CX6 B;  4ZHQ E;  2VWA A;  3CML A;  2DCF A;  1MIV A;  3KV4 A;  5HXH A;  4M1P A;  4KP3 C;  5TAO A;  2Q9Q D;  4CI3 B;  3I0Q A;  3MA9 A;  5CA0 E;  2V7I A;  4PJJ A;  1HG5 A;  2NW8 A;  5FXZ A;  2DHR A;  4UXN B;  3UUX B;  4UVA B;  3KFW X;  4K0U A;  4AQF C;  1T98 A;  3BQI A;  4A56 A;  5LGN B;  3O1J A;  4JEU B;  3I0O A;  5J2U E;  3B13 A;  1UX5 A;  1ZKE A;  3UUL A;  3PUR A;  4ZI7 E;  3QK6 A;  4ZI2 C;  5JR9 B;  3HKD E;  1YD8 G;  3E22 E;  4ZI3 C;  2KWI B;  4PK5 A;  2C0S A;  4V1A v;  2PG8 A;  3AAI A;  4TV8 E;  3N2G E;  2ACX A;  2Q9Q B;  4IGU A;  4PAG A;  3ZMV B;  3M65 A;  1MIW A;  4QX7 B;  2D2S A;  2EHO A;  5L3G B;  4XZC A;  2KZ7 B;  2E9X A;  4CQI A;  2VL8 A;  5EZY E;  4L9I A;  4Z8X A;  2QA7 A;  2WMO A;  3LJC A;  3RKO A;  3C4W A;  3LK3 B;  2IAK A;  2V7M A;  3KV5 A;  3N9N A;  2YK0 A;  3NRX A;  3RYH E;  5JDL A;  5JDM A;  5L3D B;  2PBI A;  3C4X A;  4OFZ A;  3I9Y A;  3ANW B;  4TN7 B;  2CEA A;  5JR9 C;  5L3B B;  4IE0 A;  3Q2M A;  4H9Q C;  4IE7 A;  2W00 A;  3EDU A;  3NZQ A;  4MAL A;  3RRC A;  2QGS A;  1D0Z A;  2V7L A;  2Q9Q C;  3N9Q A;  2MTQ A;  4IE6 A;  5L3F B;  3J7Y q;  5DAB A;  2UXN B;  2ZM0 A;  4UIG A;  5LHI B;  2V7K A;  1YKH B;  3OKQ A;  3C98 B;  2X9Y A;  3EUH A;  3MKD A;  4HGA A;  4DVD A;  4IE5 A;  5HXE A;  2X0L B;  1QSD A;  5DJQ C;  4FI5 A;  4JUY A;  3D0T A;  3N5L A;  3KV9 A;  4HKA A;  3CQC B;  2XUE A;  3PTR B;  2YIN A;  3O4X E;  5CA1 E;  4AI6 A;  4FJO A;  4WW0 A;  2VB6 A;  3GWH A;  3F57 A;  5FY1 A;  4CXX A;  1NWM X;  1OXZ A;  2MBG A;  3MK7 C;  2CMR A;  4UVC B;  1B7T A;  1IZN B;  4CXY A;  2X51 A;  5EK2 A;  3K3N A;  3DTO A;  5M4Y A;  4PK4 A;  3ESL A;  4TX5 A;  2NW9 A;  3ZCJ A;  4QKN A;  3ZYK A;  2KXP B;  2LT3 A;  5LGU B;  1D1C A;  1WRD A;  2CM0 A;  3AAA B;  2H3R A;  5J1G A;  5LP6 E;  1UX4 A;  3ZCI A;  2X66 A;  5DQV A;  5J2T E;  1H7C A;  3VU7 H;  1IJ5 A;  2KLQ A;  3B57 A;  3N2K E;  4ZS3 A;  5HWY A;  2Y48 B;  1OWA A;  1HCI A;  4I50 E;  1QUU A;  4MBQ A;  4AKH A;  2K24 A;  2WM9 A;  1BR0 A;  3BQK A;  3ZJ2 A;  4KUM B;  5E0O A;  4ILU A;  1S35 A;  4YHJ A;  2N2N A;  4GIW A;  2V7J A;  4PNI A;  2W62 A;  2M67 A;  3ZPO A;  2D5U A;  1G73 A;  2XAJ B;  3S4U A;  4X20 E;  3EVY A;  3QC9 A;  5JRE A;  1KNZ A;  5HXS A;  4ADZ A;  3IF8 B;  3OBV E;  2CXD A;  1VOM A;  2VK9 A;  3ZJ1 A;  5FXX A;  4AXP A;  2CWY A;  2LE8 A;  2H7O A;  3ZC0 A;  4HTE A;  4NUU A;  3FBL A;  3E08 A;  3HR0 A;  4HFV A;  1Y64 B;  3RC3 A;  2D0T A;  3UFE A;  4AKG A;  1US7 B;  2WAU A;  3C64 A;  4UEL A;  1FMV A;  2LHR A;  3NZP A;  2ZM2 A;  3O1I A;  4AQF A;  4AKI A;  3AA0 B;  5C8Y E;  3AA6 B;  3O9X A;  3UUN A;  2LOP A;  2W61 A;  4O8S A;  4B6X A;  2CLY B;  1EZ3 A;  3U3I A;  2Y6X A;  2CA5 A;  4ZS2 A;  1IAP A;  4BJM A;  5ETW A;  2NTX A;  4O4J E;  3ZYL A;  2XHE B;  4PFP A;  2XAS B;  4WBO A;  2KND A;  2E9X D;  3ETV A;  2ZMA A;  3PUG A;  5LA6 E;  3DJB A;  2YU1 A;  2BVM A;  3MJX A;  2LSK A;  4GK0 E;  4EXT A;  5JRC B;  3LK4 2;  4TUY E;  3CVR A;  4AQG A;  1SA0 E;  4WBN E;  4CXW A;  3JC6 D;  3PUA A;  2H7V C;  3U78 A;  5BMV E;  2MOZ A;  4X1Y E;  4E7Z A;  1U5P A;  4H9R C;  2CLY C;  2KWH A;  2VKJ A;  5KX5 E;  2E9X B;  1S94 A;  5JR9 A;  3ZN0 B;  5L3E B;  3N9L A;  4ANJ A;  2X67 A;  3EDV A;  3ZLI A;  1MMG A;  3K3O A;  4PJM A;  2Q9Q A;  1D1A A;  2JJ9 A;  3KBT A;  4X1I E;  3I1A A;  3AA7 B;  3V5S A;  4BJN A;  4DO0 A;  5LG4 A;  2ODV A;  5IYZ E;  3IHR A;  5LYJ E;  3VKH A;  1FEW A;  3E0Z A;  5LOV E;  2IC6 A;  4YJ2 E;  2ZM8 A;  2XTL A;  4EB6 E;  3NRY A;  4XBF B;  4H9O C;  4I55 E;  1MMD A;  4DBR A;  5FMN A;  2CWO A;  2JQQ A;  3SWH A;  2V26 A;  1FIO A;  4IST A;  5FNV E;  1VRB A;  2HPL A;  3VKG A;  4EIW A;  3LBX B;  2X9H A;  2B1E A;  4J2C A;  3RX6 A;  4HE8 A;  2E9X C;  4IE4 A;  5JH7 E;  2ES0 A;  2X9W A;  2CXL A;  5H6R B;  4QXH B;  1HS7 A;  4O4H E;  3AVR A;  1HX8 A;  3HKE E;  3JC6 C;  1ZV4 X;  3ONX A;  4OHF A;  1HG2 A;  5HXR A;  4BA9 A;  2K9A A;  5LBQ B;  4DND A;  3J9X 1;  3GN5 A;  4JEH B;  2CE7 A;  4NUV A;  2DI4 A;  4UV8 B;  3WAJ A;  2C5K T;  1WYB A;  3O1H A;  5LXT E;  2IW5 B;  2K5B B;  4ERR A;  3LFM A;  3V5U A;  4H9N C;  2J1D G;  1HTJ F;  2DLR A;  4UEM A;  2KT9 A;  1SHZ C;  2DWK A;  1MNE A;  4XAX B;  1WR6 A;  5JDG A;  2WWU A;  1KK7 A;  3W15 B;  4PK6 A;  2N1G A;  3HL6 A;  3AA1 B;  4QHO A;  2CXF A;  3KIN B;  4KMC A;  1MMN A;  3MAC A;  5LJN A;  2VKO A;  3SOL A;  4H63 V;  2LSG A;  1E1H B;  2A3D A;  4O2B E;  3AVS A;  4O2A E;  5EK3 A;  3Q5W A;  2LSI A;  3OYX A;  4HN9 A;  5JDQ A;  3H3A A;  3NBX X;  2JRK A;  4EOZ B;  1ZHC A;  3RRW A;  5FYM A;  3HA4 A;  3FHN A;  3P8C D;  4OYK A;  2BDE A;  4U74 A;  4DMV A;  4G63 A;  2A72 A;  3UUM A;  1YW0 A;  4YLH A;  4UF0 B;  3OJA A;  4TZ4 C;  4L5G A;  3ZMT B;  4DBQ A;  1D1B A;  3FXD B;  3H37 A;  3K3Q C;  2L9Q A;  3AB3 B;  5FXW A;  3VHL A;  2LM9 A;  4ISS A;  2NOX A;  1NAF A;  3CQX C;  4EYY R;  2C5J A;  3PE0 A;  2VAS A;  4WNK A;  3N9M A;  2G0U A;  4I43 B;  2LSY A;  3QUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...