4ZJ3A

Crystal structure of cephalexin bound acyl-enzyme intermediate of val216acrf mutant tem1 beta-lactamase from escherichia coli: e166n and v216acrf mutant.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
265
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWNPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Exploring the potential impact of an expanded genetic code on protein function.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 263
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zj3A00
3HUNA 2VGKA 2WGIA 1M40A 3B3XA 3MBZA 5DVAA 1EI5A 1K6SA 3OCLA 1JTGA 2ZM8A 3NY4A 4ID4A 3O87A 3FKVA 1I5QA 2XFTA 4OQHA 4DKIA 1ALQA 5DTTA 4BL2A 5CEDA 4KG5A 1AXBA 2Y2PA 1KDWA 3EQVA 1FR6A 1W79A 3CG5A 5GHXA 1IEMA 2UWXA 1NYMA 2QMIA 4WM9A 5GLCA 3IF6C 3ZG0A 3IF6A 3IXGA 5E2GA 4WMCD 4R4RA 5TFQA 3UE0A 3M6HA 4BD1A 4U3TA 5HAIA 4HESA 3G34A 4BLMA 2Y2KA 5I94A 1WYBA 1BZAA 3JYIA 2ZC7A 2XDMA 3NDEA 4OONA 2WKEA 2XLNA 4B4ZA 2R9WA 5AQBA 5FAOA 1Y54A 2JBFA 1XGIA 2CC1A 1PZPA 3LEZA 1NYYA 5EUAA 5HX9A 3O88A 4BENA 2XK1A 4MNRA 5L2FA 2Y2JA 4OLGA 1MXOA 1BLSA 3UNWA 3IF6B 3WRTA 3EQUA 3N8RA 3LO7A 5EOOA 2J8YA 2EFUA 2H10A 3ZHHA 1YQSA 4KQOA 3RJUA 3QNBA 1QMEA 3IXDA 2DNSA 5DF7A 2GDNA 4DXCA 1TVFA 2V1ZA 4N1HA 1XA1A 4OPQA 2XFSA 4OOMA 5GLAA 3PBOA 3G35A 1PYYA 4DDSA 4GZBA 4DF6A 2ZQ7A 1K55C 4L0LA 1K55A 4LV1A 4QJGA 2JC7A 5CGSA 4PPRA 1DY6A 4YFMA 1PW8A 2P9VA 4N92A 4LCMA 4QHCA 2EFXA 5E2HA 3MKFA 3ZVWA 3ZNTA 4E3LA 1SCWA 4E3OA 1GHPA 3A3IA 3VP3A 4O7DA 5GHYA 2EXAA 5TGFA 1BTLA 3S4XA 4EV4A 2ZLYA 2X01A 1K38A 3GTCA 3QNCA 1K4FA 4FH2A 2V20A 3ZDJA 3BM6A 1KE4A 1IELA 1QMFA 3MZEA 3AGEA 4JXVA 3A3DA 1NZUA 5KSCA 1E3UA 4P87A 2Y2LA 3OPRA 4ZAMA 2HPBA 3UPPA 1L0FA 3V39A 1ES5A 2P9VB 1N4OA 2A3UA 4KZ7A 1FSWA 4MLLA 4S2PA 5HARA 3N8LA 1IKGA 4RVAA 5KSHA 3ZGAB 1ESUA 3D4FA 1EROA 1NJ4A 2OSUA 5AQ9A 3A3EA 3HLWA 3M6BA 5HL1A 3NCKA 4KG6A 2XF3A 5DF9A 1FCMA 5FQIA 2WAFA 4RX2A 2C6WB 4YINA 2Y55A 5F1GA 3VSLA 3WRZA 1LLBA 4OP8A 2E8IA 1FR1A 4KQQA 3A3JA 3GMWA 3OC2A 4DE0A 4PM8A 4CJNA 3LCEA 4OP5A 4ZJ1A 2J9OA 3N4IA 1LI9A 1CEFA 4UA6A 3NIAA 1DJBA 4C75A 3Q81A 5G18A 2ZQ8A 4P0MA 2WK0A 1LL5A 4S2OA 5CEBA 4LCLA 4EBPA 4K91A 4N9LA 1WYCA 1NY0A 2HDSA 4PMAA 5FDHA 5A90A 2H0YA 4E3KA 3IWQA 4S2KA 3UE3A 1SDNA 3HLDA 1Q2QA 2IWDA 2H5SA 1Z6FA 1J9MA 2Y2HA 3GQZA 3PBSA 2PU4A 4QD4A 4OH0A 3VOYA 3TOIA 4ZJ2A 3IHBA 5CGWA 1YLJA 4WYYA 4WZ5C 4KQRA 4WZ5A 3PBNA 3ZG9B 2WADA 4R1GA 4RX3A 5FAQA 3ZCZA 4R0QA 5CGXA 5EVIC 5EVIA 5FQJA 4MBFA 2BLSA 5EVLA 3SS3A 1YM1A 1PW1A 4JF4A 1DJAA 2WKHA 1RCJA 4WEJA 4LENA 5FA7A 4Y0TA 1KGGA 4S2MA 1MWSA 3QHYA 5FI2A 4R3BA 1ES3A 1ZKJA 4OPZA 3VMAA 3M2KA 4Q8IA 2Y59A 1L0DA 3OPLA 3ZNYA 5U47A 4OQIA 2G2UA 2XGNA 3W4PA 1K6RA 1E4DA 1S6RA 1L0EA 1IYPA 3AGDA 5EVIB 5J8XA 3VOZA 4LV3A 1YLYA 4GB7A 2Y4AA 3SH7A 3ZG7B 1K56D 2HDQA 3LY4A 5E2FA 1BLPA 5EPHA 4JXSA 4QU3A 2Z2MB 3OZHA 2Y2NA 1HD8A 3IH9A 4P85A 4E3MA 5F83A 4D2OA 4PM5A 3HUOA 3IF5A 3IWIA 4OQ0A 2EX8A 3GR2A 2JCHA 3WWXA 5EE8A 1ES4A 4GNUA 5DTSA 4WELA 4UAAA 1VQQA 4NETA 3MZFA 3C4OA 3MFDA 1S0WA 2R9XA 3V50A 1JWVA 3VP2A 2FFFB 4WMCA 3WS5A 1MWRA 1LL9A 1M6KA 3CZDA 3CMZA 4PM6A 3BFCA 4QY5A 3BEBA 2VGJA 5A93A 1JVJA 3PBRA 4OLDA 2BG1A 4PM9A 2QZ6A 4DXBA 3VP0A 3G4PA 3ITAA 2HP5A 4KZ5A 5M19A 4KZ4A 4Y0OA 1O07A 3DWKA 4ZBEA 3SOIA 4X56A 1ZC2A 1I2SA 2B5RA 3VSKA 4GN2A 2Q9NA 3G30A 1OMEA 4GDNA 4XXRA 3SH8A 1SHVA 3ZFZA 3C7VA 1GHIA 1PZOA 1E25A 5JYOA 4HEFA 3C4PA 3HREA 5A91A 4DDYA 2XQZA 3UY6A 1E3UD 2Q9MA 4X69A 3W8KA 1PI4A 1YLTA 4JPMA 3NC8A 3MXSA 3ISGA 1W8YA 3AGFA 1BLHA 4U0TA 1IYSA 1W8QA 3VFHA 5HW3A 5KMWA 2ZM2A 5GLBA 2ZJ9A 1G68A 4FCFA 1YMXA 1BT5A 4OOYA 3G31A 3TG9A 2WAEA 4QY6A 1XX2A 2ZQ9A 2XD1A 3HUMA 1HTZA 4GD6A 5FQMA 4IBXA 4EUZA 3PAGA 5BOHA 3FWLA 2ZC5B 1CI9A 4KZ6A 1CI8A 1FCNA 3M2JA 1K25A 2ZC6B 3PAEA 4MBHA 5AQAA 3UN7A 4A5RA 4JBFA 3WS2A 2HDRA 4XUZA 4KZ8A 3HL9A 1RGYA 4M3KA 2WZZA 3Q7VA 3V3SA 3UPNA 1SKFA 1ERMA 1WE4A 1YLZA 5CHMA 2PU2A 3E2KA 3MXRA 1G6AA 1MY8A 2FFYA 2DCFA 5CTMA 2RL3A 4DE3A 5CXWA 1XKZA 1IKIA 4H8RA 3HBRA 4KZBA 4OKPA 1MKIA 1XA7A 5CHUA 3GV9A 1ONHA 5GHZA 2I72A 5AQ7A 3CJMA 4HBTA 1H8ZA 3HLBA 3Q7VB 1ZG6A 3P98A 3C5AA 2XR0A 3Q1FA 5TR7A 4BL3A 4KG2A 3WS4A 1EWZA 1W7FA 4RA7A 5E43A 1N9BA 3OPHA 5D3OA 5EVID 3RXXA 1KVMA 1PWGA 4B88A 4DRTA 3GSGA 4S2LA 4DE1A 5DF8A 1TEMA 3HLGA 1JWPA 2ZMAA 3BFEA 3BECA 3BLSA 3DWZA 2G2WA 1H8YA 1HVBA 3IWOA 3E2LA 4E3IA 4K0WA 4S2NC 2C5WB 4S2NA 2OV5A 4JF5A 5HFOA 3WS0A 1NRFA 4LV0A 3SH9A 4IVIA 1KE3A 1CK3A 3BRMA 3HLEA 3OCNA 3GVBA 4OVDA 3IXBA 3ZVTA 3G32A 4WZ4A 2Y2IA 5GL9A 3G2ZA 5CTNA 2J9PA 1KE0A 4QB8A 3C7UA 4GDBA 4GKUA 2OLVA 1FCOA 4R23A 3O3VA 2IWBA 4KZAA 2Y2QA 2Y2GA 4K0XA 4E6XA 1NXYA 1BLCA 1GCEA 2DRWA 2EXBA 5HAPA 4FH4A 3GRJA 3RXWA 5FAPA 3Q82A 1IYQA 4WBGA 2X02A 4ZDXA 1K57C 1KGFA 4GOGA 1K57A 2HP9A 5FATA 3W4QA 5FASA 1YLWA 5EECA 3N7WA 3NDGA 3OPPA 1XP4A 4KZ3A 3ZG8B 2XH9A 3IH8A 5HAQA 4IVKA 3UE1A 3O86A 4E6WA 2Y2MA 4E3NA 2P74A 2EX9A 1GHMA 3S1YA 1RP5A 4P6BA 1K56A 3HVFA 2XEPA 2H0TA 1I2WA 1KDSA 4EBLA 1MWTA 5FI7A 1U60A 4BJPA 1BULA 2IWCA 2ZC4B 3IXHA 1GA0A 1Q2PA 2RCXA 4MBKA 4N1XA 4LV2A 5IHVA 1ESIA 1IYOA 4OPYA 4R4SA 1XGJA 3VFFA 4Y0UA 4Y7PA 4BD0A 5JYPA 1CEGA 3MZDA 3BYDA 5EOEA 3BLMA 3UDIA 3VP1A 1JWZA 1LI0A 2Y2OA 5CECA 3UPOA 3N8SA 1HZOA 3N6IA 3W4OA 2PBYA 4C6YA 5FQ9A 2ZC3B 3BFGA 5F1FA 2X71A 5KZHA 3V3RA 4CPKA 4N9KA 5FQKA 3I7JA 1PWCA 3DTMA 3Q7ZA 4GD8A 4RYEA 1SDEA 4F94A 3PTEA 1KVLA 2A49A 1L2SA 3P09A 5M1AA 4X53A 4U0XA 5F82A 1XXMA 1ZG4A 1TDGA 1YT4A 1LHYA 4EQIA 3HLFA 2ZD8A 1W5DA 2QPNA 3VP4A 1MPLA 4JLFA 4S2JA 4EWFA 3ITBA 3MKEA 2WGWA 5A92A 4JXWA 1XPBA 1BSGA 1VM1A 3IT9A 1L0GA 3WS1A 3SS4A 4UA9A 3BFFA 4ZJ3A 4Z9QA 3Q07A 1NZOA 2ZQCA 2JE5A 5CRFA 4KZ9A 5E2EA 2WUQA 1MBLA 1K54C 1ES2A 1K54A 2ZQDA 2HDUA 4R3JA 3UO9A 1PWDA 2HP6A 2WGWB 4DE2A 2WKIA 4E3JA 1MWUA 3IHAA 5CHJA 4HBUA 4OQGA 4BQMA 2EX2A 4JKTA 1KGEA 2WYXA 3FYZA 4UA7A 1O7EA 3SS5A 3UDFA 5DTKA 1YMSA 1ONGA 4X68A 2J7VA 2Y91A 2WGVA 2OLUA 3HLCA 4MEZA 4FD8A 4S2IA 3G2YA 4FSFA 1K4EA 3S22A 5GLDA 4OPRA 5FQQA 4NK3A 4JF6A 1RGZA 1C3BA 1TDLA 4IBRA 4XUXA 3FZCA 3IQAA 1GA9A 1JTDA 4X55A 3V5MA 2XD5A 1PIOA 2ZM0A 3FV7A 3FKWA 1ERQA 4OOLA 3A3FA 1PI5A 4JXGA 3NI9A 3TSGA 1YLPA 3BFDA 3NBLA 1DJCA 4WEKA 5FSRA 4EBNA 5FI6A 3PBQA 2EX6A 3LY3A 1H5XA 4IEDA 5CERA 1FQGA 5M18A 3PBTA 2ZQAA 3DW0A 3ZG5A 4B4XA 4C3QA 1FOFA 4PM7A 4ZTKA 2WZXA 1BUEA 3UDXA 4UHUA 4X6TA 2V2FF 2Z2LB 1FSYA 4KENB
chains in the Genus database with same CATH superfamily
2WGIA 1M40A 5EV0A 1EI5A 1K6SA 3OCLA 4ID4A 2ZL1B 2XFTA 4B9OA 4DKIA 4BL2A 1AXBA 4HHDA 3EEHA 1SKOA 4O0PA 5HDDA 5CX7A 5GHXA 3IF6C 3M6HA 5I94A 2BTFP 4HESA 3G34A 3LUQA 3SW1A 3JYIA 4OONA 2WKEA 2XLNA 4Q0JA 2R9WA 5FDSA 5FAOA 1Y54A 1XGIA 1PZPA 4MNRA 2J8YA 3EGXC 3IX3A 4KQOA 3BQ8A 3QNBA 4GS9B 4DXCA 2GDNA 2WKPA 2V1ZA 4N1HA 2XFSA 1S1ZA 5GLAA 2J80A 4DDSA 4R6LA 4DF6A 1K55C 4LV1A 5CGSA 5E2HA 4YFMA 4N92A 1P9RA 4LCMA 2EFXA 4QHCA 4E3LA 1GHPA 3A3IA 4O7DA 2EXAA 3H9WA 1ZTUA 3KYZA 2B02A 1NZUA 1E3UA 1S67L 2Y2LA 3OPRA 2HPBA 4ZAMA 1D7EA 3S7PA 1N4OA 3B33A 4KZ7A 2V8CA 5KSHA 5AQ9A 5HL1A 3DTKA 4KG6A 2XF3A 2VV8A 2PBDP 5FQIA 4HP4A 2XA7M 1LLBA 5DFYA 4CLCB 3MXQA 2W3DA 4OP5A 3JPUA 1CEFA 4C75A 3A0VA 4N9LA 2ZOIA 2H5SA 3C2WA 1J9MA 4ARZA 4OH0A 4ZJ2A 4NKPA 2QYBA 2ZMVA 4WZ5A 2WADA 1D06A 2GJ3A 4R1GA 1S66L 4AFIA 5EVIC 4MBFA 4ETXA 4IUHA 2W3EA 3SS3A 4FOFA 3H82A 3M2KA 4Q8IA 2OAQ1 2Y59A 3DTEA 5C5KA 4GB7A 4RQ9A 3S7QA 5DJTA 2W27A 5E2FA 3R7WB 4D60A 2Z2MB 3OZHA 3IH9A 5F83A 3HUOA 3IF5A 3IWIA 5G4YA 2JCHA 2KLIA 3WWXA 5DTSA 4GNUA 4UAAA 3MZFA 3VP2A 4Y17A 4QY5A 2PR5A 4HQAA 2V1AA 4PM9A 3C8CA 3G4PA 4KZ5A 1O07A 3DWKA 3SOIA 4WLAA 2P7JA 1I2SA 1AWIA 2VGLM 4GN2A 2Q9NA 3G30A 2VX8A 4GDNA 1E25A 3T4TA 3PXPA 1OT9A 2V0UA 2Q9MA 2W1RA 3W8KA 3BY9A 1YLTA 5F68A 1DP9A 1YKDA 3P01A 1W8YA 3KYEA 1W63Q 1W8QA 3TG9A 4MDZA 3F1PB 3TRCA 4IBXA 4EUZA 1XJ4A 2ZC5B 4GJ4A 3F1OB 1OTDA 4A5RA 1TS8A 5J3WA 3K3CA 2WZZA 1ACFA 3Q7VA 3E98A 1WE4A 2V8FA 3MQQA 2PU2A 4EEUA 1G6AA 4DE3A 4I5SA 5CXWA 4OKPA 5CHUA 1XA7A 1ONHA 3V67A 3CJMA 5HWTA 3HLBA 4KQDA 1GSWA 2FZ0A 4WF0A 3WS4A 1N9BA 3OPHA 5EVID 3OBFA 1PWGA 4S2LA 4X1LA 5DF8A 3HLGA 2ZMAA 1CJFA 1HVBA 3E2LA 3LIEA 3SZTA 1T1AA 4JF5A 3FC7A 3A0RA 1CK3A 3GVBA 3G32A 2Y2IA 4QB8A 4GKUA 1FCOA 4Y5FA 4BMWA 4E6XA 4L9GA 3MJQA 1NXYA 2DRWA 2EXBA 3PYPA 3GRJA 2X02A 5EM1A 1K57C 1KGFA 4GOGA 5FASA 5FATA 1LSWA 5HWVA 3OPPA 5TBMA 4L9EA 5HAQA 3T4JA 4EETB 2P74A 2W3GA 1GSXA 1U60A 4OPYA 4R4SA 1H3QA 4BD0A 3RH8B 2P08A 3BYDA 3BLMA 3UDIA 3W2ZA 3L7HA 2Y2OA 5CECA 1HZOA 2PBYA 3BFGA 5F1FA 2X71A 3T50A 5KZHA 1F9IA 5FQKA 3DTMA 1SDEA 1DP8A 1NWZA 3PTEA 4E04A 4LRXC 3P09A 2HF6A 5M1AA 3BQAA 5F82A 1XXMA 1ZG4A 1TDGA 4EQIA 1K0KA 1LT0A 4JLFA 4EWFA 4S2JA 2WGWA 4JXWA 4CQHA 3SS4A 3BFFA 2A24B 3Q07A 4IUKA 3OLOA 3IS2A 5E2EA 1NLYA 1K54C 1ES2A 2ZQDA 3CWFA 3UO9A 4DMZA 1MWUA 3QP4A 1T18A 1O7EA 2P04A 5DTKA 1OJGA 4DJ3A 5FQQA 4JF6A 3FZCA 2Y8HA 5FEGA 5IT5A 1PI5A 4JXGA 3TSGA 2NUTC 2PT7A 2ZL1A 3BFDA 4WEKA 4F3LB 2EX6A 2ZQAA 3GECA 1FOFA 4ZTKA 3UDXA 2Z2LB 4KENB 2VGKA 1T19A 3T1SA 3B3XA 5DVAA 1JTGA 2ZM8A 3O87A 1ALQA 2L1MA 2Y2PA 1KDWA 3UB8A 5HZHA 2GX5A 4WM9A 3ZG0A 1NRJA 5TFQA 3BW6A 4BD1A 4U3TA 2Y2KA 4K08A 1WYBA 1KOUA 4B4ZA 3C38A 4LFUA 4GS9A 4R70A 3MQOA 5HX9A 3O88A 4BENA 4DJ2A 3KX0X 1VB6A 3UNWA 2NUPC 4NG2A 3IF6B 3N8RA 3RJUA 2DNSA 2FH5A 2JN7A 1TVFA 4OPQA 4OOMA 1PYYA 4L0LA 1P97A 1TD5A 2JC7A 4PPRA 4ZRRA 2K31A 3ZNTA 3U2AA 3UMDA 3VP3A 5GHYA 3EEAA 4EV4A 2ZLYA 2X01A 1K38A 2Z6DA 2PD7A 3T1QB 2V20A 3BM6A 3MZEA 4MCWA 3AGEA 4JXVA 3S7OA 3UB5P 4P87A 3V39A 4CLCA 2A3UA 1FSWA 5HARA 4UQIM 1IKGA 3LI9A 1ESUA 1EROA 1NJ4A 2OSUA 2HV1A 3HLWA 1H8MA 4RX2A 5F1GA 2VGLS 2E8IA 1FR1A 4KQQA 2M7VA 3OC2A 5DJUA 2W1TB 4CJNA 3LCEA 2XROA 4HY8A 2OWJA 2JKRM 3Q81A 2W0NA 4P0MA 2WK0A 4I39A 1LL5A 4L9FA 5CEBA 3LI8A 1NY0A 2HDSA 4E3KA 3KYQA 4I38A 1SDNA 3PBSA 3K3DA 3PBNA 3ZG9B 2K7SA 5CGXA 3KSFA 2BLSA 2DMWA 4BBUA 1PW1A 1DJAA 3IX8A 4WEJA 1OTEA 4S2MA 3QHYA 3R7WA 3KSHA 3NECA 1E4DA 3AGDA 5EVIB 4LV3A 1YLYA 2Y4AA 3UB7A 3LY4A 1BLPA 3R4KA 4QU3A 4OQ0A 3GR2A 2VK3A 1VQQA 3QP1A 2PYRA 3MFDA 2R9XA 1JWVA 2FFFB 3NOUC 3WS5A 1ZHHB 4PM6A 2PHYA 4MMNA 5A93A 4OLDA 4Q0HA 3T4OA 3ITAA 4ME4A 5AVFA 5M19A 1CF0A 3VSKA 4NXFA 2W3HA 1OT6A 1GHIA 3IBRA 1PZOA 3F1PA 3CPTB 3C4PA 3HREA 5A91A 4DDYA 2XQZA 3E0YA 3F1OA 4WN5A 2JKFA 3ISGA 1BLHA 4U0TA 1W63M 5HW3A 1VEUB 4FCFA 1BT5A 3CHWP 5HPFA 1PNEA 1XX2A 4GD6A 4QY6A 3HUMA 1HTZA 3PAGA 2O9BA 5BOHA 3FWLA 1CI9A 1FCNA 3LIFA 3RFBA 1K25A 2ZC6B 5AQAA 3UN7A 4KZ8A 1Z09A 1RGYA 3V3SA 3UPNA 1ERMA 4Y2FA 1MY8A 5CTMA 2RL3A 3HBRA 4HJ3A 3GV9A 1OTIA 4HBTA 1PFLA 4NXBA 3NOTC 3C5AA 1EWZA 5E43A 2AVXA 4DRTA 4DE1A 4P6ZM 2ZOHA 3BFEA 3BLSA 2G2WA 1H8YA 4S2NA 3QP6A 3WS0A 1NRFA 4CLCE 1OPXA 2R78A 3SH9A 5HSQA 4IVIA 1KE3A 3BRMA 3OCNA 1TS6A 3P7NA 4WZ4A 1VHMA 3G2ZA 1KE0A 3LR3A 4PAUA 3O3VA 2Y2QA 5IS1A 4K0XA 3T4KA 3C30A 3LR5A 4WBGA 4ZDXA 5EECA 3NDGA 1XP4A 4ETZA 2ZBBA 4IVKA 2O99A 5L09A 5AJGA 4E3NA 2QKPA 2EX9A 1GHMA 1OTAA 1RP5A 4EESA 2YKFA 4P6BA 2INWA 2XEPA 1I2WA 5FI7A 2ZC4B 3JVVA 5F5YA 5IHVA 1ESIA 1IYOA 1XGJA 3VP1A 1JWZA 3DAVA 3FPWA 2O9AA 3N6IA 3W4OA 4C6YA 2ZC3B 1F2KA 4I3AA 4N9KA 3CI6A 1PWCA 4RYEA 2A24A 1KVLA 4U0XA 2QPNA 3MKEA 1BSGA 3LR4A 4UA9A 3BWLA 4Z9QA 1NZOA 4GW9A 4O01A 2HDUA 2HP6A 1F5MA 3QP2A 1UGUA 5CHJA 1FIKA 4HBUA 4BQMA 1KGEA 4UA7A 1YMSA 4F3LA 2VJWA 3UMEA 3HLCA 4FSFA 1K4EA 2VLGA 5GLDA 4OPRA 2LB5A 1C3BA 1TDLA 4IBRA 1GA9A 4X55A 3V5MA 3FKWA 3D9YA 4BBVA 1YLPA 4XT2B 4UQIS 1DJCA 5FSRA 4EBNA 3MF0A 3PBQA 5FI6A 3LY3A 1H5XA 5CERA 5M18A 3PBTA 5G4ZA 2OWHA 4B4XA 1BYWA 2WZXA 1BUEA 4X6TA 2H28A 2V2FF 1FSYA 4NEED 3HUNA 3MBZA 4UEYA 3NY4A 4Y3IA 1PRQA 1I5QA 4OQHA 5CEDA 4EEPA 4WUJA 5HL6A 3EQVA 2KDKA 3CG5A 2UWXA 2QMIA 1LL8A 3IF6A 3IXGA 4WMCD 2JKGA 4R4RA 5EVEA 5IU1A 5HAIA 1IFQA 2VV6A 1BZAA 2XDMA 3BY8A 2CC1A 1NYYA 5EUAA 2VEAA 2XK1A 5L2FA 2O0YA 2Y2JA 4OLGA 1MXOA 4YOFA 3LO7A 5EOOA 2O9CA 4GCZA 3ZHHA 1YQSA 1D1JA 1P9WA 5DKLA 3IXDA 5DF7A 5HWWA 3PBOA 3G35A 1YPRA 4GZBA 1K55A 4QJGA 3ZVWA 1PW8A 1T1BA 3MKFA 3RTYA 4GLQA 5DFXA 2D02A 4E3OA 4Y0TA 5TGFA 3S4XA 5HDCA 3GTCA 3QNCA 4I3IA 3T1RA 4FH2A 1KE4A 1J3WA 1TF1A 1IELA 3A3DA 4PKYA 1L0FA 2P9VB 3KSIA 4MLLA 4S2PA 3G6OA 4HH2A 2PR6A 2W1TA 3HCYA 2I9VA 3A3EA 1GSVA 3M6BA 3NCKA 1FCMA 4JGQA 2C6WB 2Y55A 2A2LA 3WRZA 3ICYA 1LSVA 4DE0A 3GMWA 4PM8A 3N4IA 1LI9A 2PYPA 3NIAA 4DN0A 5G18A 2ZQ8A 2ACGA 1WYCA 4PMAA 4IHQA 5FDHA 5A90A 4H6JB 2H0YA 3IWQA 3UE3A 2Y2HA 3SH7A 1Z6FA 3GQZA 4YWZA 3VOYA 2PU4A 3IHBA 5CGWA 1YLJA 4WYYA 4WZ5C 4KQRA 4RX3A 3CUEC 4X25A 5FAQA 3ZCZA 4R0QA 5MC7A 2XA7S 5EVIA 4Q0IA 5EVLA 4JF4A 1DP6A 1KGGA 5FI2A 1ZKJA 4HP9A 4WL9A 1L0DA 3LIDA 3ZNYA 3TJZC 4OQIA 1L0EA 1IYPA 5J8XA 3VOZA 3ZG7B 1K56D 2HDQA 4JXSA 5AVEA 2Y2NA 2M1CA 1SZVA 4NETA 3B42A 1S0WA 5F69A 1ODVA 4LLOB 4WMCA 1LL9A 1M6KA 3CMZA 3BFCA 3CPTA 3BEBA 2HZ5A 2VGJA 2BG1A 2QZ6A 4DXBA 3VP0A 2HP5A 1VETB 4KZ4A 4Y0OA 3FPVA 4PKYG 2PD8A 2D01A 3LICA 1EW0A 1VEUA 1OMEA 4XXRA 3ZFZA 3C7VA 5JYOA 1G28A 2PRFA 4IJGA 1E3UD 1PI4A 5K5BA 3MXSA 1IYSA 2HJ9C 2ZMFA 3F1NB 5KMWA 2ZM2A 5FL3A 2ZJ9A 1YMXA 4OOYA 2PAVP 1DRMA 2XD1A 3MFXA 3E4PA 2JKRI 3WS2A 3T4QA 4XUZA 5EM0A 1SKFA 1YLZA 3QP8A 3IBJA 3MXRA 2FFYA 2J3TC 2DCFA 3D3OA 4H8RA 1MKIA 1S4RA 2XRNA 5GHZA 5AQ7A 5HDSA 3MSHA 3P98A 2XR0A 4BL3A 4O8GA 2GNXA 5D3OA 1KVMA 4B88A 3GSGA 1TEMA 3T1XA 3D72A 1MC0A 3DWZA 3BECA 3IWOA 1H0MA 1NLZA 3NULA 3E4QA 5HFOA 4LV0A 2L4RA 3PR6A 3FG8A 4OVDA 4QWOA 3IXBA 1WA9A 5GL9A 2J9PA 2G7UA 5J4EA 4GDBA 4R23A 3CLOA 5L10A 2IWBA 4KZAA 1JNUA 1G5UA 3H7WB 4FH4A 3RXWA 5FAPA 3Q82A 2J3WA 1K57A 1STZA 1YLWA 2B18A 3ZG8B 5TJJA 1X0OA 3IH8A 3UE1A 4E6WA 3VE4A 1K56A 3HVFA 3O5YA 2OOLA 4PHTA 1G6OA 1MWTA 1BULA 1GA0A 2RCXA 4MBKA 4N1XA 4LV2A 5F6AA 4Y7PA 1CEGA 3MZDA 4LRZE 5EOEA 3UPOA 3E4OA 2XSSA 3MR0A 4BBTA 4CPKA 2JHEA 3I7JA 4MN7A 4F94A 1L2SA 1YT4A 4X1MA 5I5LA 3HLFA 2ZD8A 4G3WA 3ITBA 1VM1A 3IT9A 4ESPA 3UB9A 2EWVA 2ZQCA 2JE5A 2KOIA 4FTXA 1MBLA 4Y13A 2J3TD 4R3JA 1K54A 1PWDA 3T4LA 4E3JA 2WKIA 3KSGA 5HD3A 3ULFA 4OQGA 2EX2A 2WYXA 3UDFA 4XT2A 2QJ7A 1ONGA 4I3JA 5EFWA 2Y91A 3NJAA 2OLUA 4FD8A 1HLUP 1RGZA 3OOVA 4XUXA 1Y28A 2Q0OA 1PIOA 2XD5A 2ZM0A 4OOLA 3A3FA 3NI9A 3NBLA 3CAXA 4IEDA 1A0KA 3ZG5A 5L8MA 4UHUA 3CUEA 5HPIA 3IQAA 4GHIB 1XFNA 2V1BA 3FKVA 5DTTA 2QHKA 2K2NA 4KG5A 3BJNA 1FR6A 1W79A 1IEMA 1NYMA 5GLCA 2KX6A 5E2GA 4BLMA 3UE0A 2Z6CA 2ZC7A 3NDEA 1FILA 5AQBA 2JBFA 4MN6A 3LEZA 1SKOB 4EQ1A 4LPZA 5LBRA 2BASA 1BLSA 1OTBA 3WRTA 4G3KA 2E8JA 3EQUA 1XJ6A 2V9AA 2EFUA 1XJ3A 2H10A 2VKSA 1QMEA 1XA1A 3LIAA 3PHYA 1V9YA 2ZQ7A 2EWWA 2Y79A 1DY6A 2P9VA 1TS0A 1SCWA 1MZUA 1BTLA 4MN5A 4HOIA 1K4FA 3ZDJA 1YSPA 2VZWA 1QMFA 3K2NA 5KSCA 3IX4A 3UPPA 1ES5A 4CLCC 4QPRA 4R38A 3N8LA 4RVAA 3ZGAB 2GZAA 3D4FA 5KIZA 2WKQA 2EA9A 5DF9A 1IOUA 3EOIA 2WAFA 4YINA 3VSLA 4H6JA 4HH3A 3UB6A 4OP8A 3A3JA 3HJIA 4ZJ1A 2J9OA 3QP5A 1F98A 2L0WA 4UA6A 1DJBA 1CQAA 4S2OA 4LCLA 4EBPA 4K91A 3L9KA 4S2KA 4HNBA 3HLDA 1Q2QA 2IWDA 3VV4A 1S1YA 4QD4A 3TOIA 1L3LA 2B95A 5FQJA 4EERA 2OAP1 1YM1A 2WKHA 1RCJA 4LENA 5FA7A 4ARZB 1MWSA 4R3BA 1ES3A 4OPZA 3VMAA 3B47A 3OPLA 5U47A 2G2UA 2XGNA 3W4PA 1K6RA 1S6RA 5EPHA 3LR0A 4EUVA 3H82B 1HD8A 2HGVA 4P85A 4E3MA 4D2OA 4PM5A 2EX8A 5L07A 1VETA 5EE8A 1ES4A 4WELA 4II7A 3C4OA 3V50A 4LGWA 4BWIA 3U4LP 1MWRA 3CZDA 2VA0A 1JVJA 3PBRA 3MS6A 3T12B 3TW8A 4ZBEA 4HI4A 1ZC2A 4X56A 2B5RA 3F1NA 3SH8A 1SHVA 3VOLA 3LGOA 1YSQA 4HEFA 2VV7A 4KUOA 3NHQA 3UY6A 4X69A 4JPMA 4CLCD 3NC8A 3AGFA 3CITA 3LIBA 3VFHA 5GLBA 1G68A 3G31A 5DKKA 2WAEA 2ZQ9A 4HIAA 2V0WA 5FQMA 3VE3A 1S4SA 4KZ6A 1T1CA 1CI8A 3M2JA 3PAEA 4MBHA 4JBFA 2HDRA 3HL9A 4M3KA 5CHMA 4JGPA 3E2KA 3LYXA 1XKZA 1IKIA 4KZBA 3T4SA 3MMHA 2I72A 2PDRA 4FUWA 1H8ZA 3Q7VB 3DBAA 1ZG6A 3Q1FA 5TR7A 4KG2A 4NXGA 1W7FA 2LB9A 3DTIA 1UWNX 4RA7A 4HJ4A 2W3FA 3EWKA 3RXXA 3UE6A 3LEQA 4R3AA 1JWPA 4E3IA 4K0WA 4S2NC 2C5WB 3LFVA 4JGOA 2OV5A 4EXOA 3H7WA 2UV0E 3HLEA 3JVUA 3ZVTA 1LSXA 1V9ZA 5CTNA 4G3VA 3C7UA 2OLVA 4EW7A 3NOPC 1YAXA 2Y2GA 3A0SA 1BLCA 1GCEA 5HAPA 1IYQA 4LRYC 3TE8A 3W4QA 2HP9A 4P6ZS 3N7WA 4KZ3A 2XH9A 3O86A 2Y2MA 4NXEA 3HJKA 1TS7A 3S1YA 2HJEA 2M7UA 2H0TA 1KDSA 3GDIA 4EBLA 4BJPA 1XFQA 2IWCA 4YNRA 3IXHA 1Q2PA 1N9NA 4EU0A 3VFFA 5TBMB 4Y0UA 5JYPA 1LI0A 5FEFA 5HD5A 2MJ6A 5A8BA 3N8SA 5FQ9A 3V3RA 4HJ6A 3Q7ZA 4GD8A 2QJ5A 2A49A 2JKTI 4X53A 4B93A 1LHYA 1W5DA 4JGRA 3VP4A 1MPLA 3ZYTA 5A92A 2JKTM 1XPBA 2QWSA 3EGDC 1L0GA 3WS1A 1N9LA 4ZJ3A 1UWPX 1P0ZA 4Z1WA 5CRFA 4KZ9A 2WUQA 2WGWB 4DE2A 3S7NA 3IHAA 2CMNA 3ZQ5A 4JKTA 3FYZA 3SS5A 1OJ5A 3IS2B 4X68A 2J7VA 2YKHA 2WGVA 4MEZA 4S2IA 3S22A 3G2YA 4NK3A 4Y15A 1JTDA 3FV7A 4GHIA 4M4XA 1ERQA 2IA2A 3MQ0A 2WKRA 1FQGA 3KO6A 3DW0A 4C3QA 4PM7A 4KUKA 1N9OA 5J7EA 1XJ2A 1Y4OA 1MKMA
chains in the Genus database with same CATH topology
3HUNA 2VGKA 2WGIA 1M40A 3B3XA 3MBZA 5DVAA 1EI5A 1K6SA 3OCLA 1JTGA 2ZM8A 3NY4A 4ID4A 3O87A 3FKVA 1I5QA 2XFTA 4OQHA 4DKIA 1ALQA 5DTTA 4BL2A 5CEDA 4KG5A 1AXBA 2Y2PA 1KDWA 3EQVA 1FR6A 1W79A 3CG5A 5GHXA 1IEMA 2UWXA 1NYMA 2QMIA 4WM9A 5GLCA 3IF6C 3ZG0A 3IF6A 3IXGA 5E2GA 4WMCD 4R4RA 5TFQA 3UE0A 3M6HA 4BD1A 4U3TA 5HAIA 4HESA 3G34A 4BLMA 2Y2KA 5I94A 1WYBA 1BZAA 3JYIA 2ZC7A 2XDMA 3NDEA 4OONA 2WKEA 2XLNA 4B4ZA 2R9WA 5AQBA 5FAOA 1Y54A 2JBFA 1XGIA 2CC1A 1PZPA 3LEZA 1NYYA 5EUAA 5HX9A 3O88A 4BENA 2XK1A 4MNRA 5L2FA 2Y2JA 4OLGA 1MXOA 1BLSA 3UNWA 3IF6B 3WRTA 3EQUA 3N8RA 3LO7A 5EOOA 2J8YA 2EFUA 2H10A 3ZHHA 1YQSA 4KQOA 3RJUA 3QNBA 1QMEA 3IXDA 2DNSA 5DF7A 2GDNA 4DXCA 1TVFA 2V1ZA 4N1HA 1XA1A 4OPQA 2XFSA 4OOMA 5GLAA 3PBOA 3G35A 1PYYA 4DDSA 4GZBA 4DF6A 2ZQ7A 1K55C 4L0LA 1K55A 4LV1A 4QJGA 2JC7A 5CGSA 4PPRA 1DY6A 4YFMA 1PW8A 2P9VA 4N92A 4LCMA 4QHCA 2EFXA 5E2HA 3MKFA 3ZVWA 3ZNTA 4E3LA 1SCWA 4E3OA 1GHPA 3A3IA 3VP3A 4O7DA 5GHYA 2EXAA 5TGFA 1BTLA 3S4XA 4EV4A 2ZLYA 2X01A 1K38A 3GTCA 3QNCA 1K4FA 4FH2A 2V20A 3ZDJA 3BM6A 1KE4A 1IELA 1QMFA 3MZEA 3AGEA 4JXVA 3A3DA 1NZUA 5KSCA 1E3UA 4P87A 2Y2LA 3OPRA 4ZAMA 2HPBA 3UPPA 1L0FA 3V39A 1ES5A 2P9VB 1N4OA 2A3UA 4KZ7A 1FSWA 4MLLA 4S2PA 5HARA 3N8LA 1IKGA 4RVAA 5KSHA 3ZGAB 1ESUA 3D4FA 1EROA 1NJ4A 2OSUA 5AQ9A 3A3EA 3HLWA 3M6BA 5HL1A 3NCKA 4KG6A 2XF3A 5DF9A 1FCMA 5FQIA 2WAFA 4RX2A 2C6WB 4YINA 2Y55A 5F1GA 3VSLA 3WRZA 1LLBA 4OP8A 2E8IA 1FR1A 4KQQA 3A3JA 3GMWA 3OC2A 4DE0A 4PM8A 4CJNA 3LCEA 4OP5A 4ZJ1A 2J9OA 3N4IA 1LI9A 1CEFA 4UA6A 3NIAA 1DJBA 4C75A 3Q81A 5G18A 2ZQ8A 4P0MA 2WK0A 1LL5A 4S2OA 5CEBA 4LCLA 4EBPA 4K91A 4N9LA 1WYCA 1NY0A 2HDSA 4PMAA 5FDHA 5A90A 2H0YA 4E3KA 3IWQA 4S2KA 3UE3A 1SDNA 3HLDA 1Q2QA 2IWDA 2H5SA 1Z6FA 1J9MA 2Y2HA 3GQZA 3PBSA 2PU4A 4QD4A 4OH0A 3VOYA 3TOIA 4ZJ2A 3IHBA 5CGWA 1YLJA 4WYYA 4WZ5C 4KQRA 4WZ5A 3PBNA 3ZG9B 2WADA 4R1GA 4RX3A 5FAQA 3ZCZA 4R0QA 5CGXA 5EVIC 5EVIA 5FQJA 4MBFA 2BLSA 5EVLA 3SS3A 1YM1A 1PW1A 4JF4A 1DJAA 2WKHA 1RCJA 4WEJA 4LENA 5FA7A 4Y0TA 1KGGA 4S2MA 1MWSA 3QHYA 5FI2A 4R3BA 1ES3A 1ZKJA 4OPZA 3VMAA 3M2KA 4Q8IA 2Y59A 1L0DA 3OPLA 3ZNYA 5U47A 4OQIA 2G2UA 2XGNA 3W4PA 1K6RA 1E4DA 1S6RA 1L0EA 1IYPA 3AGDA 5EVIB 5J8XA 3VOZA 4LV3A 1YLYA 4GB7A 2Y4AA 3SH7A 3ZG7B 1K56D 2HDQA 3LY4A 5E2FA 1BLPA 5EPHA 4JXSA 4QU3A 2Z2MB 3OZHA 2Y2NA 1HD8A 3IH9A 4P85A 4E3MA 5F83A 4D2OA 4PM5A 3HUOA 3IF5A 3IWIA 4OQ0A 2EX8A 3GR2A 2JCHA 3WWXA 5EE8A 1ES4A 4GNUA 5DTSA 4WELA 4UAAA 1VQQA 4NETA 3MZFA 3C4OA 3MFDA 1S0WA 2R9XA 3V50A 1JWVA 3VP2A 2FFFB 4WMCA 3WS5A 1MWRA 1LL9A 1M6KA 3CZDA 3CMZA 4PM6A 3BFCA 4QY5A 3BEBA 2VGJA 5A93A 1JVJA 3PBRA 4OLDA 2BG1A 4PM9A 2QZ6A 4DXBA 3VP0A 3G4PA 3ITAA 2HP5A 4KZ5A 5M19A 4KZ4A 4Y0OA 1O07A 3DWKA 4ZBEA 3SOIA 4X56A 1ZC2A 1I2SA 2B5RA 3VSKA 4GN2A 2Q9NA 3G30A 1OMEA 4GDNA 4XXRA 3SH8A 1SHVA 3ZFZA 3C7VA 1GHIA 1PZOA 1E25A 5JYOA 4HEFA 3C4PA 3HREA 5A91A 4DDYA 2XQZA 3UY6A 1E3UD 2Q9MA 4X69A 3W8KA 1PI4A 1YLTA 4JPMA 3NC8A 3MXSA 3ISGA 1W8YA 3AGFA 1BLHA 4U0TA 1IYSA 1W8QA 3VFHA 5HW3A 5KMWA 2ZM2A 5GLBA 2ZJ9A 1G68A 4FCFA 1YMXA 1BT5A 4OOYA 3G31A 3TG9A 2WAEA 4QY6A 1XX2A 2ZQ9A 2XD1A 3HUMA 1HTZA 4GD6A 5FQMA 4IBXA 4EUZA 3PAGA 5BOHA 3FWLA 2ZC5B 1CI9A 4KZ6A 1CI8A 1FCNA 3M2JA 1K25A 2ZC6B 3PAEA 4MBHA 5AQAA 3UN7A 4A5RA 4JBFA 3WS2A 2HDRA 4XUZA 4KZ8A 3HL9A 1RGYA 4M3KA 2WZZA 3Q7VA 3V3SA 3UPNA 1SKFA 1ERMA 1WE4A 1YLZA 5CHMA 2PU2A 3E2KA 3MXRA 1G6AA 1MY8A 2FFYA 2DCFA 5CTMA 2RL3A 4DE3A 5CXWA 1XKZA 1IKIA 4H8RA 3HBRA 4KZBA 4OKPA 1MKIA 1XA7A 5CHUA 3GV9A 1ONHA 5GHZA 2I72A 5AQ7A 3CJMA 4HBTA 1H8ZA 3HLBA 3Q7VB 1ZG6A 3P98A 3C5AA 2XR0A 3Q1FA 5TR7A 4BL3A 4KG2A 3WS4A 1EWZA 1W7FA 4RA7A 5E43A 1N9BA 3OPHA 5D3OA 5EVID 3RXXA 1KVMA 1PWGA 4B88A 4DRTA 3GSGA 4S2LA 4DE1A 5DF8A 1TEMA 3HLGA 1JWPA 2ZMAA 3BFEA 3BECA 3BLSA 3DWZA 2G2WA 1H8YA 1HVBA 3IWOA 3E2LA 4E3IA 4K0WA 4S2NC 2C5WB 4S2NA 2OV5A 4JF5A 5HFOA 3WS0A 1NRFA 4LV0A 3SH9A 4IVIA 1KE3A 1CK3A 3BRMA 3HLEA 3OCNA 3GVBA 4OVDA 3IXBA 3ZVTA 3G32A 4WZ4A 2Y2IA 5GL9A 3G2ZA 5CTNA 2J9PA 1KE0A 4QB8A 3C7UA 4GDBA 4GKUA 2OLVA 1FCOA 4R23A 3O3VA 2IWBA 4KZAA 2Y2QA 2Y2GA 4K0XA 4E6XA 1NXYA 1BLCA 1GCEA 2DRWA 2EXBA 5HAPA 4FH4A 3GRJA 3RXWA 5FAPA 3Q82A 1IYQA 4WBGA 2X02A 4ZDXA 1K57C 1KGFA 4GOGA 1K57A 2HP9A 5FATA 3W4QA 5FASA 1YLWA 5EECA 3N7WA 3NDGA 3OPPA 1XP4A 4KZ3A 3ZG8B 2XH9A 3IH8A 5HAQA 4IVKA 3UE1A 3O86A 4E6WA 2Y2MA 4E3NA 2P74A 2EX9A 1GHMA 3S1YA 1RP5A 4P6BA 1K56A 3HVFA 2XEPA 2H0TA 1I2WA 1KDSA 4EBLA 1MWTA 5FI7A 1U60A 4BJPA 1BULA 2IWCA 2ZC4B 3IXHA 1GA0A 1Q2PA 2RCXA 4MBKA 4N1XA 4LV2A 5IHVA 1ESIA 1IYOA 4OPYA 4R4SA 1XGJA 3VFFA 4Y0UA 4Y7PA 4BD0A 5JYPA 1CEGA 3MZDA 3BYDA 5EOEA 3BLMA 3UDIA 3VP1A 1JWZA 1LI0A 2Y2OA 5CECA 3UPOA 3N8SA 1HZOA 3N6IA 3W4OA 2PBYA 4C6YA 5FQ9A 2ZC3B 3BFGA 5F1FA 2X71A 5KZHA 3V3RA 4CPKA 4N9KA 5FQKA 3I7JA 1PWCA 3DTMA 3Q7ZA 4GD8A 4RYEA 1SDEA 4F94A 3PTEA 1KVLA 2A49A 1L2SA 3P09A 5M1AA 4X53A 4U0XA 5F82A 1XXMA 1ZG4A 1TDGA 1YT4A 1LHYA 4EQIA 3HLFA 2ZD8A 1W5DA 2QPNA 3VP4A 1MPLA 4JLFA 4S2JA 4EWFA 3ITBA 3MKEA 2WGWA 5A92A 4JXWA 1XPBA 1BSGA 1VM1A 3IT9A 1L0GA 3WS1A 3SS4A 4UA9A 3BFFA 4ZJ3A 4Z9QA 3Q07A 1NZOA 2ZQCA 2JE5A 5CRFA 4KZ9A 5E2EA 2WUQA 1MBLA 1K54C 1ES2A 1K54A 2ZQDA 2HDUA 4R3JA 3UO9A 1PWDA 2HP6A 2WGWB 4DE2A 2WKIA 4E3JA 1MWUA 3IHAA 5CHJA 4HBUA 4OQGA 4BQMA 2EX2A 4JKTA 1KGEA 2WYXA 3FYZA 4UA7A 1O7EA 3SS5A 3UDFA 5DTKA 1YMSA 1ONGA 4X68A 2J7VA 2Y91A 2WGVA 2OLUA 3HLCA 4MEZA 4FD8A 4S2IA 3G2YA 4FSFA 1K4EA 3S22A 5GLDA 4OPRA 5FQQA 4NK3A 4JF6A 1RGZA 1C3BA 1TDLA 4IBRA 4XUXA 3FZCA 3IQAA 1GA9A 1JTDA 4X55A 3V5MA 2XD5A 1PIOA 2ZM0A 3FV7A 3FKWA 1ERQA 4OOLA 3A3FA 1PI5A 4JXGA 3NI9A 3TSGA 1YLPA 3BFDA 3NBLA 1DJCA 4WEKA 5FSRA 4EBNA 5FI6A 3PBQA 2EX6A 3LY3A 1H5XA 4IEDA 5CERA 1FQGA 5M18A 3PBTA 2ZQAA 3DW0A 3ZG5A 4B4XA 4C3QA 1FOFA 4PM7A 4ZTKA 2WZXA 1BUEA 3UDXA 4UHUA 4X6TA 2V2FF 2Z2LB 1FSYA 4KENB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUN A;  2VGK A;  2WGI A;  1M40 A;  3B3X A;  3MBZ A;  5DVA A;  1EI5 A;  1K6S A;  3OCL A;  1JTG A;  2ZM8 A;  3NY4 A;  4ID4 A;  3O87 A;  3FKV A;  1I5Q A;  2XFT A;  4OQH A;  4DKI A;  1ALQ A;  5DTT A;  4BL2 A;  5CED A;  4KG5 A;  1AXB A;  2Y2P A;  1KDW A;  3EQV A;  1FR6 A;  1W79 A;  3CG5 A;  5GHX A;  1IEM A;  2UWX A;  1NYM A;  2QMI A;  4WM9 A;  5GLC A;  3IF6 C;  3ZG0 A;  3IF6 A;  3IXG A;  5E2G A;  4WMC D;  4R4R A;  5TFQ A;  3UE0 A;  3M6H A;  4BD1 A;  4U3T A;  5HAI A;  4HES A;  3G34 A;  4BLM A;  2Y2K A;  5I94 A;  1WYB A;  1BZA A;  3JYI A;  2ZC7 A;  2XDM A;  3NDE A;  4OON A;  2WKE A;  2XLN A;  4B4Z A;  2R9W A;  5AQB A;  5FAO A;  1Y54 A;  2JBF A;  1XGI A;  2CC1 A;  1PZP A;  3LEZ A;  1NYY A;  5EUA A;  5HX9 A;  3O88 A;  4BEN A;  2XK1 A;  4MNR A;  5L2F A;  2Y2J A;  4OLG A;  1MXO A;  1BLS A;  3UNW A;  3IF6 B;  3WRT A;  3EQU A;  3N8R A;  3LO7 A;  5EOO A;  2J8Y A;  2EFU A;  2H10 A;  3ZHH A;  1YQS A;  4KQO A;  3RJU A;  3QNB A;  1QME A;  3IXD A;  2DNS A;  5DF7 A;  2GDN A;  4DXC A;  1TVF A;  2V1Z A;  4N1H A;  1XA1 A;  4OPQ A;  2XFS A;  4OOM A;  5GLA A;  3PBO A;  3G35 A;  1PYY A;  4DDS A;  4GZB A;  4DF6 A;  2ZQ7 A;  1K55 C;  4L0L A;  1K55 A;  4LV1 A;  4QJG A;  2JC7 A;  5CGS A;  4PPR A;  1DY6 A;  4YFM A;  1PW8 A;  2P9V A;  4N92 A;  4LCM A;  4QHC A;  2EFX A;  5E2H A;  3MKF A;  3ZVW A;  3ZNT A;  4E3L A;  1SCW A;  4E3O A;  1GHP A;  3A3I A;  3VP3 A;  4O7D A;  5GHY A;  2EXA A;  5TGF A;  1BTL A;  3S4X A;  4EV4 A;  2ZLY A;  2X01 A;  1K38 A;  3GTC A;  3QNC A;  1K4F A;  4FH2 A;  2V20 A;  3ZDJ A;  3BM6 A;  1KE4 A;  1IEL A;  1QMF A;  3MZE A;  3AGE A;  4JXV A;  3A3D A;  1NZU A;  5KSC A;  1E3U A;  4P87 A;  2Y2L A;  3OPR A;  4ZAM A;  2HPB A;  3UPP A;  1L0F A;  3V39 A;  1ES5 A;  2P9V B;  1N4O A;  2A3U A;  4KZ7 A;  1FSW A;  4MLL A;  4S2P A;  5HAR A;  3N8L A;  1IKG A;  4RVA A;  5KSH A;  3ZGA B;  1ESU A;  3D4F A;  1ERO A;  1NJ4 A;  2OSU A;  5AQ9 A;  3A3E A;  3HLW A;  3M6B A;  5HL1 A;  3NCK A;  4KG6 A;  2XF3 A;  5DF9 A;  1FCM A;  5FQI A;  2WAF A;  4RX2 A;  2C6W B;  4YIN A;  2Y55 A;  5F1G A;  3VSL A;  3WRZ A;  1LLB A;  4OP8 A;  2E8I A;  1FR1 A;  4KQQ A;  3A3J A;  3GMW A;  3OC2 A;  4DE0 A;  4PM8 A;  4CJN A;  3LCE A;  4OP5 A;  4ZJ1 A;  2J9O A;  3N4I A;  1LI9 A;  1CEF A;  4UA6 A;  3NIA A;  1DJB A;  4C75 A;  3Q81 A;  5G18 A;  2ZQ8 A;  4P0M A;  2WK0 A;  1LL5 A;  4S2O A;  5CEB A;  4LCL A;  4EBP A;  4K91 A;  4N9L A;  1WYC A;  1NY0 A;  2HDS A;  4PMA A;  5FDH A;  5A90 A;  2H0Y A;  4E3K A;  3IWQ A;  4S2K A;  3UE3 A;  1SDN A;  3HLD A;  1Q2Q A;  2IWD A;  2H5S A;  1Z6F A;  1J9M A;  2Y2H A;  3GQZ A;  3PBS A;  2PU4 A;  4QD4 A;  4OH0 A;  3VOY A;  3TOI A;  4ZJ2 A;  3IHB A;  5CGW A;  1YLJ A;  4WYY A;  4WZ5 C;  4KQR A;  4WZ5 A;  3PBN A;  3ZG9 B;  2WAD A;  4R1G A;  4RX3 A;  5FAQ A;  3ZCZ A;  4R0Q A;  5CGX A;  5EVI C;  5EVI A;  5FQJ A;  4MBF A;  2BLS A;  5EVL A;  3SS3 A;  1YM1 A;  1PW1 A;  4JF4 A;  1DJA A;  2WKH A;  1RCJ A;  4WEJ A;  4LEN A;  5FA7 A;  4Y0T A;  1KGG A;  4S2M A;  1MWS A;  3QHY A;  5FI2 A;  4R3B A;  1ES3 A;  1ZKJ A;  4OPZ A;  3VMA A;  3M2K A;  4Q8I A;  2Y59 A;  1L0D A;  3OPL A;  3ZNY A;  5U47 A;  4OQI A;  2G2U A;  2XGN A;  3W4P A;  1K6R A;  1E4D A;  1S6R A;  1L0E A;  1IYP A;  3AGD A;  5EVI B;  5J8X A;  3VOZ A;  4LV3 A;  1YLY A;  4GB7 A;  2Y4A A;  3SH7 A;  3ZG7 B;  1K56 D;  2HDQ A;  3LY4 A;  5E2F A;  1BLP A;  5EPH A;  4JXS A;  4QU3 A;  2Z2M B;  3OZH A;  2Y2N A;  1HD8 A;  3IH9 A;  4P85 A;  4E3M A;  5F83 A;  4D2O A;  4PM5 A;  3HUO A;  3IF5 A;  3IWI A;  4OQ0 A;  2EX8 A;  3GR2 A;  2JCH A;  3WWX A;  5EE8 A;  1ES4 A;  4GNU A;  5DTS A;  4WEL A;  4UAA A;  1VQQ A;  4NET A;  3MZF A;  3C4O A;  3MFD A;  1S0W A;  2R9X A;  3V50 A;  1JWV A;  3VP2 A;  2FFF B;  4WMC A;  3WS5 A;  1MWR A;  1LL9 A;  1M6K A;  3CZD A;  3CMZ A;  4PM6 A;  3BFC A;  4QY5 A;  3BEB A;  2VGJ A;  5A93 A;  1JVJ A;  3PBR A;  4OLD A;  2BG1 A;  4PM9 A;  2QZ6 A;  4DXB A;  3VP0 A;  3G4P A;  3ITA A;  2HP5 A;  4KZ5 A;  5M19 A;  4KZ4 A;  4Y0O A;  1O07 A;  3DWK A;  4ZBE A;  3SOI A;  4X56 A;  1ZC2 A;  1I2S A;  2B5R A;  3VSK A;  4GN2 A;  2Q9N A;  3G30 A;  1OME A;  4GDN A;  4XXR A;  3SH8 A;  1SHV A;  3ZFZ A;  3C7V A;  1GHI A;  1PZO A;  1E25 A;  5JYO A;  4HEF A;  3C4P A;  3HRE A;  5A91 A;  4DDY A;  2XQZ A;  3UY6 A;  1E3U D;  2Q9M A;  4X69 A;  3W8K A;  1PI4 A;  1YLT A;  4JPM A;  3NC8 A;  3MXS A;  3ISG A;  1W8Y A;  3AGF A;  1BLH A;  4U0T A;  1IYS A;  1W8Q A;  3VFH A;  5HW3 A;  5KMW A;  2ZM2 A;  5GLB A;  2ZJ9 A;  1G68 A;  4FCF A;  1YMX A;  1BT5 A;  4OOY A;  3G31 A;  3TG9 A;  2WAE A;  4QY6 A;  1XX2 A;  2ZQ9 A;  2XD1 A;  3HUM A;  1HTZ A;  4GD6 A;  5FQM A;  4IBX A;  4EUZ A;  3PAG A;  5BOH A;  3FWL A;  2ZC5 B;  1CI9 A;  4KZ6 A;  1CI8 A;  1FCN A;  3M2J A;  1K25 A;  2ZC6 B;  3PAE A;  4MBH A;  5AQA A;  3UN7 A;  4A5R A;  4JBF A;  3WS2 A;  2HDR A;  4XUZ A;  4KZ8 A;  3HL9 A;  1RGY A;  4M3K A;  2WZZ A;  3Q7V A;  3V3S A;  3UPN A;  1SKF A;  1ERM A;  1WE4 A;  1YLZ A;  5CHM A;  2PU2 A;  3E2K A;  3MXR A;  1G6A A;  1MY8 A;  2FFY A;  2DCF A;  5CTM A;  2RL3 A;  4DE3 A;  5CXW A;  1XKZ A;  1IKI A;  4H8R A;  3HBR A;  4KZB A;  4OKP A;  1MKI A;  1XA7 A;  5CHU A;  3GV9 A;  1ONH A;  5GHZ A;  2I72 A;  5AQ7 A;  3CJM A;  4HBT A;  1H8Z A;  3HLB A;  3Q7V B;  1ZG6 A;  3P98 A;  3C5A A;  2XR0 A;  3Q1F A;  5TR7 A;  4BL3 A;  4KG2 A;  3WS4 A;  1EWZ A;  1W7F A;  4RA7 A;  5E43 A;  1N9B A;  3OPH A;  5D3O A;  5EVI D;  3RXX A;  1KVM A;  1PWG A;  4B88 A;  4DRT A;  3GSG A;  4S2L A;  4DE1 A;  5DF8 A;  1TEM A;  3HLG A;  1JWP A;  2ZMA A;  3BFE A;  3BEC A;  3BLS A;  3DWZ A;  2G2W A;  1H8Y A;  1HVB A;  3IWO A;  3E2L A;  4E3I A;  4K0W A;  4S2N C;  2C5W B;  4S2N A;  2OV5 A;  4JF5 A;  5HFO A;  3WS0 A;  1NRF A;  4LV0 A;  3SH9 A;  4IVI A;  1KE3 A;  1CK3 A;  3BRM A;  3HLE A;  3OCN A;  3GVB A;  4OVD A;  3IXB A;  3ZVT A;  3G32 A;  4WZ4 A;  2Y2I A;  5GL9 A;  3G2Z A;  5CTN A;  2J9P A;  1KE0 A;  4QB8 A;  3C7U A;  4GDB A;  4GKU A;  2OLV A;  1FCO A;  4R23 A;  3O3V A;  2IWB A;  4KZA A;  2Y2Q A;  2Y2G A;  4K0X A;  4E6X A;  1NXY A;  1BLC A;  1GCE A;  2DRW A;  2EXB A;  5HAP A;  4FH4 A;  3GRJ A;  3RXW A;  5FAP A;  3Q82 A;  1IYQ A;  4WBG A;  2X02 A;  4ZDX A;  1K57 C;  1KGF A;  4GOG A;  1K57 A;  2HP9 A;  5FAT A;  3W4Q A;  5FAS A;  1YLW A;  5EEC A;  3N7W A;  3NDG A;  3OPP A;  1XP4 A;  4KZ3 A;  3ZG8 B;  2XH9 A;  3IH8 A;  5HAQ A;  4IVK A;  3UE1 A;  3O86 A;  4E6W A;  2Y2M A;  4E3N A;  2P74 A;  2EX9 A;  1GHM A;  3S1Y A;  1RP5 A;  4P6B A;  1K56 A;  3HVF A;  2XEP A;  2H0T A;  1I2W A;  1KDS A;  4EBL A;  1MWT A;  5FI7 A;  1U60 A;  4BJP A;  1BUL A;  2IWC A;  2ZC4 B;  3IXH A;  1GA0 A;  1Q2P A;  2RCX A;  4MBK A;  4N1X A;  4LV2 A;  5IHV A;  1ESI A;  1IYO A;  4OPY A;  4R4S A;  1XGJ A;  3VFF A;  4Y0U A;  4Y7P A;  4BD0 A;  5JYP A;  1CEG A;  3MZD A;  3BYD A;  5EOE A;  3BLM A;  3UDI A;  3VP1 A;  1JWZ A;  1LI0 A;  2Y2O A;  5CEC A;  3UPO A;  3N8S A;  1HZO A;  3N6I A;  3W4O A;  2PBY A;  4C6Y A;  5FQ9 A;  2ZC3 B;  3BFG A;  5F1F A;  2X71 A;  5KZH A;  3V3R A;  4CPK A;  4N9K A;  5FQK A;  3I7J A;  1PWC A;  3DTM A;  3Q7Z A;  4GD8 A;  4RYE A;  1SDE A;  4F94 A;  3PTE A;  1KVL A;  2A49 A;  1L2S A;  3P09 A;  5M1A A;  4X53 A;  4U0X A;  5F82 A;  1XXM A;  1ZG4 A;  1TDG A;  1YT4 A;  1LHY A;  4EQI A;  3HLF A;  2ZD8 A;  1W5D A;  2QPN A;  3VP4 A;  1MPL A;  4JLF A;  4S2J A;  4EWF A;  3ITB A;  3MKE A;  2WGW A;  5A92 A;  4JXW A;  1XPB A;  1BSG A;  1VM1 A;  3IT9 A;  1L0G A;  3WS1 A;  3SS4 A;  4UA9 A;  3BFF A;  4ZJ3 A;  4Z9Q A;  3Q07 A;  1NZO A;  2ZQC A;  2JE5 A;  5CRF A;  4KZ9 A;  5E2E A;  2WUQ A;  1MBL A;  1K54 C;  1ES2 A;  1K54 A;  2ZQD A;  2HDU A;  4R3J A;  3UO9 A;  1PWD A;  2HP6 A;  2WGW B;  4DE2 A;  2WKI A;  4E3J A;  1MWU A;  3IHA A;  5CHJ A;  4HBU A;  4OQG A;  4BQM A;  2EX2 A;  4JKT A;  1KGE A;  2WYX A;  3FYZ A;  4UA7 A;  1O7E A;  3SS5 A;  3UDF A;  5DTK A;  1YMS A;  1ONG A;  4X68 A;  2J7V A;  2Y91 A;  2WGV A;  2OLU A;  3HLC A;  4MEZ A;  4FD8 A;  4S2I A;  3G2Y A;  4FSF A;  1K4E A;  3S22 A;  5GLD A;  4OPR A;  5FQQ A;  4NK3 A;  4JF6 A;  1RGZ A;  1C3B A;  1TDL A;  4IBR A;  4XUX A;  3FZC A;  3IQA A;  1GA9 A;  1JTD A;  4X55 A;  3V5M A;  2XD5 A;  1PIO A;  2ZM0 A;  3FV7 A;  3FKW A;  1ERQ A;  4OOL A;  3A3F A;  1PI5 A;  4JXG A;  3NI9 A;  3TSG A;  1YLP A;  3BFD A;  3NBL A;  1DJC A;  4WEK A;  5FSR A;  4EBN A;  5FI6 A;  3PBQ A;  2EX6 A;  3LY3 A;  1H5X A;  4IED A;  5CER A;  1FQG A;  5M18 A;  3PBT A;  2ZQA A;  3DW0 A;  3ZG5 A;  4B4X A;  4C3Q A;  1FOF A;  4PM7 A;  4ZTK A;  2WZX A;  1BUE A;  3UDX A;  4UHU A;  4X6T A;  2V2F F;  2Z2L B;  1FSY A;  4KEN B; 
#chains in the Genus database with same CATH topology
 2WGI A;  1M40 A;  5EV0 A;  1EI5 A;  1K6S A;  3OCL A;  4ID4 A;  2ZL1 B;  2XFT A;  4B9O A;  4DKI A;  4BL2 A;  1AXB A;  4HHD A;  3EEH A;  1SKO A;  4O0P A;  5HDD A;  5CX7 A;  5GHX A;  3IF6 C;  3M6H A;  5I94 A;  2BTF P;  4HES A;  3G34 A;  3LUQ A;  3SW1 A;  3JYI A;  4OON A;  2WKE A;  2XLN A;  4Q0J A;  2R9W A;  5FDS A;  5FAO A;  1Y54 A;  1XGI A;  1PZP A;  4MNR A;  2J8Y A;  3EGX C;  3IX3 A;  4KQO A;  3BQ8 A;  3QNB A;  4GS9 B;  4DXC A;  2GDN A;  2WKP A;  2V1Z A;  4N1H A;  2XFS A;  1S1Z A;  5GLA A;  2J80 A;  4DDS A;  4R6L A;  4DF6 A;  1K55 C;  4LV1 A;  5CGS A;  5E2H A;  4YFM A;  4N92 A;  1P9R A;  4LCM A;  2EFX A;  4QHC A;  4E3L A;  1GHP A;  3A3I A;  4O7D A;  2EXA A;  3H9W A;  1ZTU A;  3KYZ A;  2B02 A;  1NZU A;  1E3U A;  1S67 L;  2Y2L A;  3OPR A;  2HPB A;  4ZAM A;  1D7E A;  3S7P A;  1N4O A;  3B33 A;  4KZ7 A;  2V8C A;  5KSH A;  5AQ9 A;  5HL1 A;  3DTK A;  4KG6 A;  2XF3 A;  2VV8 A;  2PBD P;  5FQI A;  4HP4 A;  2XA7 M;  1LLB A;  5DFY A;  4CLC B;  3MXQ A;  2W3D A;  4OP5 A;  3JPU A;  1CEF A;  4C75 A;  3A0V A;  4N9L A;  2ZOI A;  2H5S A;  3C2W A;  1J9M A;  4ARZ A;  4OH0 A;  4ZJ2 A;  4NKP A;  2QYB A;  2ZMV A;  4WZ5 A;  2WAD A;  1D06 A;  2GJ3 A;  4R1G A;  1S66 L;  4AFI A;  5EVI C;  4MBF A;  4ETX A;  4IUH A;  2W3E A;  3SS3 A;  4FOF A;  3H82 A;  3M2K A;  4Q8I A;  2OAQ 1;  2Y59 A;  3DTE A;  5C5K A;  4GB7 A;  4RQ9 A;  3S7Q A;  5DJT A;  2W27 A;  5E2F A;  3R7W B;  4D60 A;  2Z2M B;  3OZH A;  3IH9 A;  5F83 A;  3HUO A;  3IF5 A;  3IWI A;  5G4Y A;  2JCH A;  2KLI A;  3WWX A;  5DTS A;  4GNU A;  4UAA A;  3MZF A;  3VP2 A;  4Y17 A;  4QY5 A;  2PR5 A;  4HQA A;  2V1A A;  4PM9 A;  3C8C A;  3G4P A;  4KZ5 A;  1O07 A;  3DWK A;  3SOI A;  4WLA A;  2P7J A;  1I2S A;  1AWI A;  2VGL M;  4GN2 A;  2Q9N A;  3G30 A;  2VX8 A;  4GDN A;  1E25 A;  3T4T A;  3PXP A;  1OT9 A;  2V0U A;  2Q9M A;  2W1R A;  3W8K A;  3BY9 A;  1YLT A;  5F68 A;  1DP9 A;  1YKD A;  3P01 A;  1W8Y A;  3KYE A;  1W63 Q;  1W8Q A;  3TG9 A;  4MDZ A;  3F1P B;  3TRC A;  4IBX A;  4EUZ A;  1XJ4 A;  2ZC5 B;  4GJ4 A;  3F1O B;  1OTD A;  4A5R A;  1TS8 A;  5J3W A;  3K3C A;  2WZZ A;  1ACF A;  3Q7V A;  3E98 A;  1WE4 A;  2V8F A;  3MQQ A;  2PU2 A;  4EEU A;  1G6A A;  4DE3 A;  4I5S A;  5CXW A;  4OKP A;  5CHU A;  1XA7 A;  1ONH A;  3V67 A;  3CJM A;  5HWT A;  3HLB A;  4KQD A;  1GSW A;  2FZ0 A;  4WF0 A;  3WS4 A;  1N9B A;  3OPH A;  5EVI D;  3OBF A;  1PWG A;  4S2L A;  4X1L A;  5DF8 A;  3HLG A;  2ZMA A;  1CJF A;  1HVB A;  3E2L A;  3LIE A;  3SZT A;  1T1A A;  4JF5 A;  3FC7 A;  3A0R A;  1CK3 A;  3GVB A;  3G32 A;  2Y2I A;  4QB8 A;  4GKU A;  1FCO A;  4Y5F A;  4BMW A;  4E6X A;  4L9G A;  3MJQ A;  1NXY A;  2DRW A;  2EXB A;  3PYP A;  3GRJ A;  2X02 A;  5EM1 A;  1K57 C;  1KGF A;  4GOG A;  5FAS A;  5FAT A;  1LSW A;  5HWV A;  3OPP A;  5TBM A;  4L9E A;  5HAQ A;  3T4J A;  4EET B;  2P74 A;  2W3G A;  1GSX A;  1U60 A;  4OPY A;  4R4S A;  1H3Q A;  4BD0 A;  3RH8 B;  2P08 A;  3BYD A;  3BLM A;  3UDI A;  3W2Z A;  3L7H A;  2Y2O A;  5CEC A;  1HZO A;  2PBY A;  3BFG A;  5F1F A;  2X71 A;  3T50 A;  5KZH A;  1F9I A;  5FQK A;  3DTM A;  1SDE A;  1DP8 A;  1NWZ A;  3PTE A;  4E04 A;  4LRX C;  3P09 A;  2HF6 A;  5M1A A;  3BQA A;  5F82 A;  1XXM A;  1ZG4 A;  1TDG A;  4EQI A;  1K0K A;  1LT0 A;  4JLF A;  4EWF A;  4S2J A;  2WGW A;  4JXW A;  4CQH A;  3SS4 A;  3BFF A;  2A24 B;  3Q07 A;  4IUK A;  3OLO A;  3IS2 A;  5E2E A;  1NLY A;  1K54 C;  1ES2 A;  2ZQD A;  3CWF A;  3UO9 A;  4DMZ A;  1MWU A;  3QP4 A;  1T18 A;  1O7E A;  2P04 A;  5DTK A;  1OJG A;  4DJ3 A;  5FQQ A;  4JF6 A;  3FZC A;  2Y8H A;  5FEG A;  5IT5 A;  1PI5 A;  4JXG A;  3TSG A;  2NUT C;  2PT7 A;  2ZL1 A;  3BFD A;  4WEK A;  4F3L B;  2EX6 A;  2ZQA A;  3GEC A;  1FOF A;  4ZTK A;  3UDX A;  2Z2L B;  4KEN B;  2VGK A;  1T19 A;  3T1S A;  3B3X A;  5DVA A;  1JTG A;  2ZM8 A;  3O87 A;  1ALQ A;  2L1M A;  2Y2P A;  1KDW A;  3UB8 A;  5HZH A;  2GX5 A;  4WM9 A;  3ZG0 A;  1NRJ A;  5TFQ A;  3BW6 A;  4BD1 A;  4U3T A;  2Y2K A;  4K08 A;  1WYB A;  1KOU A;  4B4Z A;  3C38 A;  4LFU A;  4GS9 A;  4R70 A;  3MQO A;  5HX9 A;  3O88 A;  4BEN A;  4DJ2 A;  3KX0 X;  1VB6 A;  3UNW A;  2NUP C;  4NG2 A;  3IF6 B;  3N8R A;  3RJU A;  2DNS A;  2FH5 A;  2JN7 A;  1TVF A;  4OPQ A;  4OOM A;  1PYY A;  4L0L A;  1P97 A;  1TD5 A;  2JC7 A;  4PPR A;  4ZRR A;  2K31 A;  3ZNT A;  3U2A A;  3UMD A;  3VP3 A;  5GHY A;  3EEA A;  4EV4 A;  2ZLY A;  2X01 A;  1K38 A;  2Z6D A;  2PD7 A;  3T1Q B;  2V20 A;  3BM6 A;  3MZE A;  4MCW A;  3AGE A;  4JXV A;  3S7O A;  3UB5 P;  4P87 A;  3V39 A;  4CLC A;  2A3U A;  1FSW A;  5HAR A;  4UQI M;  1IKG A;  3LI9 A;  1ESU A;  1ERO A;  1NJ4 A;  2OSU A;  2HV1 A;  3HLW A;  1H8M A;  4RX2 A;  5F1G A;  2VGL S;  2E8I A;  1FR1 A;  4KQQ A;  2M7V A;  3OC2 A;  5DJU A;  2W1T B;  4CJN A;  3LCE A;  2XRO A;  4HY8 A;  2OWJ A;  2JKR M;  3Q81 A;  2W0N A;  4P0M A;  2WK0 A;  4I39 A;  1LL5 A;  4L9F A;  5CEB A;  3LI8 A;  1NY0 A;  2HDS A;  4E3K A;  3KYQ A;  4I38 A;  1SDN A;  3PBS A;  3K3D A;  3PBN A;  3ZG9 B;  2K7S A;  5CGX A;  3KSF A;  2BLS A;  2DMW A;  4BBU A;  1PW1 A;  1DJA A;  3IX8 A;  4WEJ A;  1OTE A;  4S2M A;  3QHY A;  3R7W A;  3KSH A;  3NEC A;  1E4D A;  3AGD A;  5EVI B;  4LV3 A;  1YLY A;  2Y4A A;  3UB7 A;  3LY4 A;  1BLP A;  3R4K A;  4QU3 A;  4OQ0 A;  3GR2 A;  2VK3 A;  1VQQ A;  3QP1 A;  2PYR A;  3MFD A;  2R9X A;  1JWV A;  2FFF B;  3NOU C;  3WS5 A;  1ZHH B;  4PM6 A;  2PHY A;  4MMN A;  5A93 A;  4OLD A;  4Q0H A;  3T4O A;  3ITA A;  4ME4 A;  5AVF A;  5M19 A;  1CF0 A;  3VSK A;  4NXF A;  2W3H A;  1OT6 A;  1GHI A;  3IBR A;  1PZO A;  3F1P A;  3CPT B;  3C4P A;  3HRE A;  5A91 A;  4DDY A;  2XQZ A;  3E0Y A;  3F1O A;  4WN5 A;  2JKF A;  3ISG A;  1BLH A;  4U0T A;  1W63 M;  5HW3 A;  1VEU B;  4FCF A;  1BT5 A;  3CHW P;  5HPF A;  1PNE A;  1XX2 A;  4GD6 A;  4QY6 A;  3HUM A;  1HTZ A;  3PAG A;  2O9B A;  5BOH A;  3FWL A;  1CI9 A;  1FCN A;  3LIF A;  3RFB A;  1K25 A;  2ZC6 B;  5AQA A;  3UN7 A;  4KZ8 A;  1Z09 A;  1RGY A;  3V3S A;  3UPN A;  1ERM A;  4Y2F A;  1MY8 A;  5CTM A;  2RL3 A;  3HBR A;  4HJ3 A;  3GV9 A;  1OTI A;  4HBT A;  1PFL A;  4NXB A;  3NOT C;  3C5A A;  1EWZ A;  5E43 A;  2AVX A;  4DRT A;  4DE1 A;  4P6Z M;  2ZOH A;  3BFE A;  3BLS A;  2G2W A;  1H8Y A;  4S2N A;  3QP6 A;  3WS0 A;  1NRF A;  4CLC E;  1OPX A;  2R78 A;  3SH9 A;  5HSQ A;  4IVI A;  1KE3 A;  3BRM A;  3OCN A;  1TS6 A;  3P7N A;  4WZ4 A;  1VHM A;  3G2Z A;  1KE0 A;  3LR3 A;  4PAU A;  3O3V A;  2Y2Q A;  5IS1 A;  4K0X A;  3T4K A;  3C30 A;  3LR5 A;  4WBG A;  4ZDX A;  5EEC A;  3NDG A;  1XP4 A;  4ETZ A;  2ZBB A;  4IVK A;  2O99 A;  5L09 A;  5AJG A;  4E3N A;  2QKP A;  2EX9 A;  1GHM A;  1OTA A;  1RP5 A;  4EES A;  2YKF A;  4P6B A;  2INW A;  2XEP A;  1I2W A;  5FI7 A;  2ZC4 B;  3JVV A;  5F5Y A;  5IHV A;  1ESI A;  1IYO A;  1XGJ A;  3VP1 A;  1JWZ A;  3DAV A;  3FPW A;  2O9A A;  3N6I A;  3W4O A;  4C6Y A;  2ZC3 B;  1F2K A;  4I3A A;  4N9K A;  3CI6 A;  1PWC A;  4RYE A;  2A24 A;  1KVL A;  4U0X A;  2QPN A;  3MKE A;  1BSG A;  3LR4 A;  4UA9 A;  3BWL A;  4Z9Q A;  1NZO A;  4GW9 A;  4O01 A;  2HDU A;  2HP6 A;  1F5M A;  3QP2 A;  1UGU A;  5CHJ A;  1FIK A;  4HBU A;  4BQM A;  1KGE A;  4UA7 A;  1YMS A;  4F3L A;  2VJW A;  3UME A;  3HLC A;  4FSF A;  1K4E A;  2VLG A;  5GLD A;  4OPR A;  2LB5 A;  1C3B A;  1TDL A;  4IBR A;  1GA9 A;  4X55 A;  3V5M A;  3FKW A;  3D9Y A;  4BBV A;  1YLP A;  4XT2 B;  4UQI S;  1DJC A;  5FSR A;  4EBN A;  3MF0 A;  3PBQ A;  5FI6 A;  3LY3 A;  1H5X A;  5CER A;  5M18 A;  3PBT A;  5G4Z A;  2OWH A;  4B4X A;  1BYW A;  2WZX A;  1BUE A;  4X6T A;  2H28 A;  2V2F F;  1FSY A;  4NEE D;  3HUN A;  3MBZ A;  4UEY A;  3NY4 A;  4Y3I A;  1PRQ A;  1I5Q A;  4OQH A;  5CED A;  4EEP A;  4WUJ A;  5HL6 A;  3EQV A;  2KDK A;  3CG5 A;  2UWX A;  2QMI A;  1LL8 A;  3IF6 A;  3IXG A;  4WMC D;  2JKG A;  4R4R A;  5EVE A;  5IU1 A;  5HAI A;  1IFQ A;  2VV6 A;  1BZA A;  2XDM A;  3BY8 A;  2CC1 A;  1NYY A;  5EUA A;  2VEA A;  2XK1 A;  5L2F A;  2O0Y A;  2Y2J A;  4OLG A;  1MXO A;  4YOF A;  3LO7 A;  5EOO A;  2O9C A;  4GCZ A;  3ZHH A;  1YQS A;  1D1J A;  1P9W A;  5DKL A;  3IXD A;  5DF7 A;  5HWW A;  3PBO A;  3G35 A;  1YPR A;  4GZB A;  1K55 A;  4QJG A;  3ZVW A;  1PW8 A;  1T1B A;  3MKF A;  3RTY A;  4GLQ A;  5DFX A;  2D02 A;  4E3O A;  4Y0T A;  5TGF A;  3S4X A;  5HDC A;  3GTC A;  3QNC A;  4I3I A;  3T1R A;  4FH2 A;  1KE4 A;  1J3W A;  1TF1 A;  1IEL A;  3A3D A;  4PKY A;  1L0F A;  2P9V B;  3KSI A;  4MLL A;  4S2P A;  3G6O A;  4HH2 A;  2PR6 A;  2W1T A;  3HCY A;  2I9V A;  3A3E A;  1GSV A;  3M6B A;  3NCK A;  1FCM A;  4JGQ A;  2C6W B;  2Y55 A;  2A2L A;  3WRZ A;  3ICY A;  1LSV A;  4DE0 A;  3GMW A;  4PM8 A;  3N4I A;  1LI9 A;  2PYP A;  3NIA A;  4DN0 A;  5G18 A;  2ZQ8 A;  2ACG A;  1WYC A;  4PMA A;  4IHQ A;  5FDH A;  5A90 A;  4H6J B;  2H0Y A;  3IWQ A;  3UE3 A;  2Y2H A;  3SH7 A;  1Z6F A;  3GQZ A;  4YWZ A;  3VOY A;  2PU4 A;  3IHB A;  5CGW A;  1YLJ A;  4WYY A;  4WZ5 C;  4KQR A;  4RX3 A;  3CUE C;  4X25 A;  5FAQ A;  3ZCZ A;  4R0Q A;  5MC7 A;  2XA7 S;  5EVI A;  4Q0I A;  5EVL A;  4JF4 A;  1DP6 A;  1KGG A;  5FI2 A;  1ZKJ A;  4HP9 A;  4WL9 A;  1L0D A;  3LID A;  3ZNY A;  3TJZ C;  4OQI A;  1L0E A;  1IYP A;  5J8X A;  3VOZ A;  3ZG7 B;  1K56 D;  2HDQ A;  4JXS A;  5AVE A;  2Y2N A;  2M1C A;  1SZV A;  4NET A;  3B42 A;  1S0W A;  5F69 A;  1ODV A;  4LLO B;  4WMC A;  1LL9 A;  1M6K A;  3CMZ A;  3BFC A;  3CPT A;  3BEB A;  2HZ5 A;  2VGJ A;  2BG1 A;  2QZ6 A;  4DXB A;  3VP0 A;  2HP5 A;  1VET B;  4KZ4 A;  4Y0O A;  3FPV A;  4PKY G;  2PD8 A;  2D01 A;  3LIC A;  1EW0 A;  1VEU A;  1OME A;  4XXR A;  3ZFZ A;  3C7V A;  5JYO A;  1G28 A;  2PRF A;  4IJG A;  1E3U D;  1PI4 A;  5K5B A;  3MXS A;  1IYS A;  2HJ9 C;  2ZMF A;  3F1N B;  5KMW A;  2ZM2 A;  5FL3 A;  2ZJ9 A;  1YMX A;  4OOY A;  2PAV P;  1DRM A;  2XD1 A;  3MFX A;  3E4P A;  2JKR I;  3WS2 A;  3T4Q A;  4XUZ A;  5EM0 A;  1SKF A;  1YLZ A;  3QP8 A;  3IBJ A;  3MXR A;  2FFY A;  2J3T C;  2DCF A;  3D3O A;  4H8R A;  1MKI A;  1S4R A;  2XRN A;  5GHZ A;  5AQ7 A;  5HDS A;  3MSH A;  3P98 A;  2XR0 A;  4BL3 A;  4O8G A;  2GNX A;  5D3O A;  1KVM A;  4B88 A;  3GSG A;  1TEM A;  3T1X A;  3D72 A;  1MC0 A;  3DWZ A;  3BEC A;  3IWO A;  1H0M A;  1NLZ A;  3NUL A;  3E4Q A;  5HFO A;  4LV0 A;  2L4R A;  3PR6 A;  3FG8 A;  4OVD A;  4QWO A;  3IXB A;  1WA9 A;  5GL9 A;  2J9P A;  2G7U A;  5J4E A;  4GDB A;  4R23 A;  3CLO A;  5L10 A;  2IWB A;  4KZA A;  1JNU A;  1G5U A;  3H7W B;  4FH4 A;  3RXW A;  5FAP A;  3Q82 A;  2J3W A;  1K57 A;  1STZ A;  1YLW A;  2B18 A;  3ZG8 B;  5TJJ A;  1X0O A;  3IH8 A;  3UE1 A;  4E6W A;  3VE4 A;  1K56 A;  3HVF A;  3O5Y A;  2OOL A;  4PHT A;  1G6O A;  1MWT A;  1BUL A;  1GA0 A;  2RCX A;  4MBK A;  4N1X A;  4LV2 A;  5F6A A;  4Y7P A;  1CEG A;  3MZD A;  4LRZ E;  5EOE A;  3UPO A;  3E4O A;  2XSS A;  3MR0 A;  4BBT A;  4CPK A;  2JHE A;  3I7J A;  4MN7 A;  4F94 A;  1L2S A;  1YT4 A;  4X1M A;  5I5L A;  3HLF A;  2ZD8 A;  4G3W A;  3ITB A;  1VM1 A;  3IT9 A;  4ESP A;  3UB9 A;  2EWV A;  2ZQC A;  2JE5 A;  2KOI A;  4FTX A;  1MBL A;  4Y13 A;  2J3T D;  4R3J A;  1K54 A;  1PWD A;  3T4L A;  4E3J A;  2WKI A;  3KSG A;  5HD3 A;  3ULF A;  4OQG A;  2EX2 A;  2WYX A;  3UDF A;  4XT2 A;  2QJ7 A;  1ONG A;  4I3J A;  5EFW A;  2Y91 A;  3NJA A;  2OLU A;  4FD8 A;  1HLU P;  1RGZ A;  3OOV A;  4XUX A;  1Y28 A;  2Q0O A;  1PIO A;  2XD5 A;  2ZM0 A;  4OOL A;  3A3F A;  3NI9 A;  3NBL A;  3CAX A;  4IED A;  1A0K A;  3ZG5 A;  5L8M A;  4UHU A;  3CUE A;  5HPI A;  3IQA A;  4GHI B;  1XFN A;  2V1B A;  3FKV A;  5DTT A;  2QHK A;  2K2N A;  4KG5 A;  3BJN A;  1FR6 A;  1W79 A;  1IEM A;  1NYM A;  5GLC A;  2KX6 A;  5E2G A;  4BLM A;  3UE0 A;  2Z6C A;  2ZC7 A;  3NDE A;  1FIL A;  5AQB A;  2JBF A;  4MN6 A;  3LEZ A;  1SKO B;  4EQ1 A;  4LPZ A;  5LBR A;  2BAS A;  1BLS A;  1OTB A;  3WRT A;  4G3K A;  2E8J A;  3EQU A;  1XJ6 A;  2V9A A;  2EFU A;  1XJ3 A;  2H10 A;  2VKS A;  1QME A;  1XA1 A;  3LIA A;  3PHY A;  1V9Y A;  2ZQ7 A;  2EWW A;  2Y79 A;  1DY6 A;  2P9V A;  1TS0 A;  1SCW A;  1MZU A;  1BTL A;  4MN5 A;  4HOI A;  1K4F A;  3ZDJ A;  1YSP A;  2VZW A;  1QMF A;  3K2N A;  5KSC A;  3IX4 A;  3UPP A;  1ES5 A;  4CLC C;  4QPR A;  4R38 A;  3N8L A;  4RVA A;  3ZGA B;  2GZA A;  3D4F A;  5KIZ A;  2WKQ A;  2EA9 A;  5DF9 A;  1IOU A;  3EOI A;  2WAF A;  4YIN A;  3VSL A;  4H6J A;  4HH3 A;  3UB6 A;  4OP8 A;  3A3J A;  3HJI A;  4ZJ1 A;  2J9O A;  3QP5 A;  1F98 A;  2L0W A;  4UA6 A;  1DJB A;  1CQA A;  4S2O A;  4LCL A;  4EBP A;  4K91 A;  3L9K A;  4S2K A;  4HNB A;  3HLD A;  1Q2Q A;  2IWD A;  3VV4 A;  1S1Y A;  4QD4 A;  3TOI A;  1L3L A;  2B95 A;  5FQJ A;  4EER A;  2OAP 1;  1YM1 A;  2WKH A;  1RCJ A;  4LEN A;  5FA7 A;  4ARZ B;  1MWS A;  4R3B A;  1ES3 A;  4OPZ A;  3VMA A;  3B47 A;  3OPL A;  5U47 A;  2G2U A;  2XGN A;  3W4P A;  1K6R A;  1S6R A;  5EPH A;  3LR0 A;  4EUV A;  3H82 B;  1HD8 A;  2HGV A;  4P85 A;  4E3M A;  4D2O A;  4PM5 A;  2EX8 A;  5L07 A;  1VET A;  5EE8 A;  1ES4 A;  4WEL A;  4II7 A;  3C4O A;  3V50 A;  4LGW A;  4BWI A;  3U4L P;  1MWR A;  3CZD A;  2VA0 A;  1JVJ A;  3PBR A;  3MS6 A;  3T12 B;  3TW8 A;  4ZBE A;  4HI4 A;  1ZC2 A;  4X56 A;  2B5R A;  3F1N A;  3SH8 A;  1SHV A;  3VOL A;  3LGO A;  1YSQ A;  4HEF A;  2VV7 A;  4KUO A;  3NHQ A;  3UY6 A;  4X69 A;  4JPM A;  4CLC D;  3NC8 A;  3AGF A;  3CIT A;  3LIB A;  3VFH A;  5GLB A;  1G68 A;  3G31 A;  5DKK A;  2WAE A;  2ZQ9 A;  4HIA A;  2V0W A;  5FQM A;  3VE3 A;  1S4S A;  4KZ6 A;  1T1C A;  1CI8 A;  3M2J A;  3PAE A;  4MBH A;  4JBF A;  2HDR A;  3HL9 A;  4M3K A;  5CHM A;  4JGP A;  3E2K A;  3LYX A;  1XKZ A;  1IKI A;  4KZB A;  3T4S A;  3MMH A;  2I72 A;  2PDR A;  4FUW A;  1H8Z A;  3Q7V B;  3DBA A;  1ZG6 A;  3Q1F A;  5TR7 A;  4KG2 A;  4NXG A;  1W7F A;  2LB9 A;  3DTI A;  1UWN X;  4RA7 A;  4HJ4 A;  2W3F A;  3EWK A;  3RXX A;  3UE6 A;  3LEQ A;  4R3A A;  1JWP A;  4E3I A;  4K0W A;  4S2N C;  2C5W B;  3LFV A;  4JGO A;  2OV5 A;  4EXO A;  3H7W A;  2UV0 E;  3HLE A;  3JVU A;  3ZVT A;  1LSX A;  1V9Z A;  5CTN A;  4G3V A;  3C7U A;  2OLV A;  4EW7 A;  3NOP C;  1YAX A;  2Y2G A;  3A0S A;  1BLC A;  1GCE A;  5HAP A;  1IYQ A;  4LRY C;  3TE8 A;  3W4Q A;  2HP9 A;  4P6Z S;  3N7W A;  4KZ3 A;  2XH9 A;  3O86 A;  2Y2M A;  4NXE A;  3HJK A;  1TS7 A;  3S1Y A;  2HJE A;  2M7U A;  2H0T A;  1KDS A;  3GDI A;  4EBL A;  4BJP A;  1XFQ A;  2IWC A;  4YNR A;  3IXH A;  1Q2P A;  1N9N A;  4EU0 A;  3VFF A;  5TBM B;  4Y0U A;  5JYP A;  1LI0 A;  5FEF A;  5HD5 A;  2MJ6 A;  5A8B A;  3N8S A;  5FQ9 A;  3V3R A;  4HJ6 A;  3Q7Z A;  4GD8 A;  2QJ5 A;  2A49 A;  2JKT I;  4X53 A;  4B93 A;  1LHY A;  1W5D A;  4JGR A;  3VP4 A;  1MPL A;  3ZYT A;  5A92 A;  2JKT M;  1XPB A;  2QWS A;  3EGD C;  1L0G A;  3WS1 A;  1N9L A;  4ZJ3 A;  1UWP X;  1P0Z A;  4Z1W A;  5CRF A;  4KZ9 A;  2WUQ A;  2WGW B;  4DE2 A;  3S7N A;  3IHA A;  2CMN A;  3ZQ5 A;  4JKT A;  3FYZ A;  3SS5 A;  1OJ5 A;  3IS2 B;  4X68 A;  2J7V A;  2YKH A;  2WGV A;  4MEZ A;  4S2I A;  3S22 A;  3G2Y A;  4NK3 A;  4Y15 A;  1JTD A;  3FV7 A;  4GHI A;  4M4X A;  1ERQ A;  2IA2 A;  3MQ0 A;  2WKR A;  1FQG A;  3KO6 A;  3DW0 A;  4C3Q A;  4PM7 A;  4KUK A;  1N9O A;  5J7E A;  1XJ2 A;  1Y4O A;  1MKM A; 
#chains in the Genus database with same CATH homology
 3HUN A;  2VGK A;  2WGI A;  1M40 A;  3B3X A;  3MBZ A;  5DVA A;  1EI5 A;  1K6S A;  3OCL A;  1JTG A;  2ZM8 A;  3NY4 A;  4ID4 A;  3O87 A;  3FKV A;  1I5Q A;  2XFT A;  4OQH A;  4DKI A;  1ALQ A;  5DTT A;  4BL2 A;  5CED A;  4KG5 A;  1AXB A;  2Y2P A;  1KDW A;  3EQV A;  1FR6 A;  1W79 A;  3CG5 A;  5GHX A;  1IEM A;  2UWX A;  1NYM A;  2QMI A;  4WM9 A;  5GLC A;  3IF6 C;  3ZG0 A;  3IF6 A;  3IXG A;  5E2G A;  4WMC D;  4R4R A;  5TFQ A;  3UE0 A;  3M6H A;  4BD1 A;  4U3T A;  5HAI A;  4HES A;  3G34 A;  4BLM A;  2Y2K A;  5I94 A;  1WYB A;  1BZA A;  3JYI A;  2ZC7 A;  2XDM A;  3NDE A;  4OON A;  2WKE A;  2XLN A;  4B4Z A;  2R9W A;  5AQB A;  5FAO A;  1Y54 A;  2JBF A;  1XGI A;  2CC1 A;  1PZP A;  3LEZ A;  1NYY A;  5EUA A;  5HX9 A;  3O88 A;  4BEN A;  2XK1 A;  4MNR A;  5L2F A;  2Y2J A;  4OLG A;  1MXO A;  1BLS A;  3UNW A;  3IF6 B;  3WRT A;  3EQU A;  3N8R A;  3LO7 A;  5EOO A;  2J8Y A;  2EFU A;  2H10 A;  3ZHH A;  1YQS A;  4KQO A;  3RJU A;  3QNB A;  1QME A;  3IXD A;  2DNS A;  5DF7 A;  2GDN A;  4DXC A;  1TVF A;  2V1Z A;  4N1H A;  1XA1 A;  4OPQ A;  2XFS A;  4OOM A;  5GLA A;  3PBO A;  3G35 A;  1PYY A;  4DDS A;  4GZB A;  4DF6 A;  2ZQ7 A;  1K55 C;  4L0L A;  1K55 A;  4LV1 A;  4QJG A;  2JC7 A;  5CGS A;  4PPR A;  1DY6 A;  4YFM A;  1PW8 A;  2P9V A;  4N92 A;  4LCM A;  4QHC A;  2EFX A;  5E2H A;  3MKF A;  3ZVW A;  3ZNT A;  4E3L A;  1SCW A;  4E3O A;  1GHP A;  3A3I A;  3VP3 A;  4O7D A;  5GHY A;  2EXA A;  5TGF A;  1BTL A;  3S4X A;  4EV4 A;  2ZLY A;  2X01 A;  1K38 A;  3GTC A;  3QNC A;  1K4F A;  4FH2 A;  2V20 A;  3ZDJ A;  3BM6 A;  1KE4 A;  1IEL A;  1QMF A;  3MZE A;  3AGE A;  4JXV A;  3A3D A;  1NZU A;  5KSC A;  1E3U A;  4P87 A;  2Y2L A;  3OPR A;  4ZAM A;  2HPB A;  3UPP A;  1L0F A;  3V39 A;  1ES5 A;  2P9V B;  1N4O A;  2A3U A;  4KZ7 A;  1FSW A;  4MLL A;  4S2P A;  5HAR A;  3N8L A;  1IKG A;  4RVA A;  5KSH A;  3ZGA B;  1ESU A;  3D4F A;  1ERO A;  1NJ4 A;  2OSU A;  5AQ9 A;  3A3E A;  3HLW A;  3M6B A;  5HL1 A;  3NCK A;  4KG6 A;  2XF3 A;  5DF9 A;  1FCM A;  5FQI A;  2WAF A;  4RX2 A;  2C6W B;  4YIN A;  2Y55 A;  5F1G A;  3VSL A;  3WRZ A;  1LLB A;  4OP8 A;  2E8I A;  1FR1 A;  4KQQ A;  3A3J A;  3GMW A;  3OC2 A;  4DE0 A;  4PM8 A;  4CJN A;  3LCE A;  4OP5 A;  4ZJ1 A;  2J9O A;  3N4I A;  1LI9 A;  1CEF A;  4UA6 A;  3NIA A;  1DJB A;  4C75 A;  3Q81 A;  5G18 A;  2ZQ8 A;  4P0M A;  2WK0 A;  1LL5 A;  4S2O A;  5CEB A;  4LCL A;  4EBP A;  4K91 A;  4N9L A;  1WYC A;  1NY0 A;  2HDS A;  4PMA A;  5FDH A;  5A90 A;  2H0Y A;  4E3K A;  3IWQ A;  4S2K A;  3UE3 A;  1SDN A;  3HLD A;  1Q2Q A;  2IWD A;  2H5S A;  1Z6F A;  1J9M A;  2Y2H A;  3GQZ A;  3PBS A;  2PU4 A;  4QD4 A;  4OH0 A;  3VOY A;  3TOI A;  4ZJ2 A;  3IHB A;  5CGW A;  1YLJ A;  4WYY A;  4WZ5 C;  4KQR A;  4WZ5 A;  3PBN A;  3ZG9 B;  2WAD A;  4R1G A;  4RX3 A;  5FAQ A;  3ZCZ A;  4R0Q A;  5CGX A;  5EVI C;  5EVI A;  5FQJ A;  4MBF A;  2BLS A;  5EVL A;  3SS3 A;  1YM1 A;  1PW1 A;  4JF4 A;  1DJA A;  2WKH A;  1RCJ A;  4WEJ A;  4LEN A;  5FA7 A;  4Y0T A;  1KGG A;  4S2M A;  1MWS A;  3QHY A;  5FI2 A;  4R3B A;  1ES3 A;  1ZKJ A;  4OPZ A;  3VMA A;  3M2K A;  4Q8I A;  2Y59 A;  1L0D A;  3OPL A;  3ZNY A;  5U47 A;  4OQI A;  2G2U A;  2XGN A;  3W4P A;  1K6R A;  1E4D A;  1S6R A;  1L0E A;  1IYP A;  3AGD A;  5EVI B;  5J8X A;  3VOZ A;  4LV3 A;  1YLY A;  4GB7 A;  2Y4A A;  3SH7 A;  3ZG7 B;  1K56 D;  2HDQ A;  3LY4 A;  5E2F A;  1BLP A;  5EPH A;  4JXS A;  4QU3 A;  2Z2M B;  3OZH A;  2Y2N A;  1HD8 A;  3IH9 A;  4P85 A;  4E3M A;  5F83 A;  4D2O A;  4PM5 A;  3HUO A;  3IF5 A;  3IWI A;  4OQ0 A;  2EX8 A;  3GR2 A;  2JCH A;  3WWX A;  5EE8 A;  1ES4 A;  4GNU A;  5DTS A;  4WEL A;  4UAA A;  1VQQ A;  4NET A;  3MZF A;  3C4O A;  3MFD A;  1S0W A;  2R9X A;  3V50 A;  1JWV A;  3VP2 A;  2FFF B;  4WMC A;  3WS5 A;  1MWR A;  1LL9 A;  1M6K A;  3CZD A;  3CMZ A;  4PM6 A;  3BFC A;  4QY5 A;  3BEB A;  2VGJ A;  5A93 A;  1JVJ A;  3PBR A;  4OLD A;  2BG1 A;  4PM9 A;  2QZ6 A;  4DXB A;  3VP0 A;  3G4P A;  3ITA A;  2HP5 A;  4KZ5 A;  5M19 A;  4KZ4 A;  4Y0O A;  1O07 A;  3DWK A;  4ZBE A;  3SOI A;  4X56 A;  1ZC2 A;  1I2S A;  2B5R A;  3VSK A;  4GN2 A;  2Q9N A;  3G30 A;  1OME A;  4GDN A;  4XXR A;  3SH8 A;  1SHV A;  3ZFZ A;  3C7V A;  1GHI A;  1PZO A;  1E25 A;  5JYO A;  4HEF A;  3C4P A;  3HRE A;  5A91 A;  4DDY A;  2XQZ A;  3UY6 A;  1E3U D;  2Q9M A;  4X69 A;  3W8K A;  1PI4 A;  1YLT A;  4JPM A;  3NC8 A;  3MXS A;  3ISG A;  1W8Y A;  3AGF A;  1BLH A;  4U0T A;  1IYS A;  1W8Q A;  3VFH A;  5HW3 A;  5KMW A;  2ZM2 A;  5GLB A;  2ZJ9 A;  1G68 A;  4FCF A;  1YMX A;  1BT5 A;  4OOY A;  3G31 A;  3TG9 A;  2WAE A;  4QY6 A;  1XX2 A;  2ZQ9 A;  2XD1 A;  3HUM A;  1HTZ A;  4GD6 A;  5FQM A;  4IBX A;  4EUZ A;  3PAG A;  5BOH A;  3FWL A;  2ZC5 B;  1CI9 A;  4KZ6 A;  1CI8 A;  1FCN A;  3M2J A;  1K25 A;  2ZC6 B;  3PAE A;  4MBH A;  5AQA A;  3UN7 A;  4A5R A;  4JBF A;  3WS2 A;  2HDR A;  4XUZ A;  4KZ8 A;  3HL9 A;  1RGY A;  4M3K A;  2WZZ A;  3Q7V A;  3V3S A;  3UPN A;  1SKF A;  1ERM A;  1WE4 A;  1YLZ A;  5CHM A;  2PU2 A;  3E2K A;  3MXR A;  1G6A A;  1MY8 A;  2FFY A;  2DCF A;  5CTM A;  2RL3 A;  4DE3 A;  5CXW A;  1XKZ A;  1IKI A;  4H8R A;  3HBR A;  4KZB A;  4OKP A;  1MKI A;  1XA7 A;  5CHU A;  3GV9 A;  1ONH A;  5GHZ A;  2I72 A;  5AQ7 A;  3CJM A;  4HBT A;  1H8Z A;  3HLB A;  3Q7V B;  1ZG6 A;  3P98 A;  3C5A A;  2XR0 A;  3Q1F A;  5TR7 A;  4BL3 A;  4KG2 A;  3WS4 A;  1EWZ A;  1W7F A;  4RA7 A;  5E43 A;  1N9B A;  3OPH A;  5D3O A;  5EVI D;  3RXX A;  1KVM A;  1PWG A;  4B88 A;  4DRT A;  3GSG A;  4S2L A;  4DE1 A;  5DF8 A;  1TEM A;  3HLG A;  1JWP A;  2ZMA A;  3BFE A;  3BEC A;  3BLS A;  3DWZ A;  2G2W A;  1H8Y A;  1HVB A;  3IWO A;  3E2L A;  4E3I A;  4K0W A;  4S2N C;  2C5W B;  4S2N A;  2OV5 A;  4JF5 A;  5HFO A;  3WS0 A;  1NRF A;  4LV0 A;  3SH9 A;  4IVI A;  1KE3 A;  1CK3 A;  3BRM A;  3HLE A;  3OCN A;  3GVB A;  4OVD A;  3IXB A;  3ZVT A;  3G32 A;  4WZ4 A;  2Y2I A;  5GL9 A;  3G2Z A;  5CTN A;  2J9P A;  1KE0 A;  4QB8 A;  3C7U A;  4GDB A;  4GKU A;  2OLV A;  1FCO A;  4R23 A;  3O3V A;  2IWB A;  4KZA A;  2Y2Q A;  2Y2G A;  4K0X A;  4E6X A;  1NXY A;  1BLC A;  1GCE A;  2DRW A;  2EXB A;  5HAP A;  4FH4 A;  3GRJ A;  3RXW A;  5FAP A;  3Q82 A;  1IYQ A;  4WBG A;  2X02 A;  4ZDX A;  1K57 C;  1KGF A;  4GOG A;  1K57 A;  2HP9 A;  5FAT A;  3W4Q A;  5FAS A;  1YLW A;  5EEC A;  3N7W A;  3NDG A;  3OPP A;  1XP4 A;  4KZ3 A;  3ZG8 B;  2XH9 A;  3IH8 A;  5HAQ A;  4IVK A;  3UE1 A;  3O86 A;  4E6W A;  2Y2M A;  4E3N A;  2P74 A;  2EX9 A;  1GHM A;  3S1Y A;  1RP5 A;  4P6B A;  1K56 A;  3HVF A;  2XEP A;  2H0T A;  1I2W A;  1KDS A;  4EBL A;  1MWT A;  5FI7 A;  1U60 A;  4BJP A;  1BUL A;  2IWC A;  2ZC4 B;  3IXH A;  1GA0 A;  1Q2P A;  2RCX A;  4MBK A;  4N1X A;  4LV2 A;  5IHV A;  1ESI A;  1IYO A;  4OPY A;  4R4S A;  1XGJ A;  3VFF A;  4Y0U A;  4Y7P A;  4BD0 A;  5JYP A;  1CEG A;  3MZD A;  3BYD A;  5EOE A;  3BLM A;  3UDI A;  3VP1 A;  1JWZ A;  1LI0 A;  2Y2O A;  5CEC A;  3UPO A;  3N8S A;  1HZO A;  3N6I A;  3W4O A;  2PBY A;  4C6Y A;  5FQ9 A;  2ZC3 B;  3BFG A;  5F1F A;  2X71 A;  5KZH A;  3V3R A;  4CPK A;  4N9K A;  5FQK A;  3I7J A;  1PWC A;  3DTM A;  3Q7Z A;  4GD8 A;  4RYE A;  1SDE A;  4F94 A;  3PTE A;  1KVL A;  2A49 A;  1L2S A;  3P09 A;  5M1A A;  4X53 A;  4U0X A;  5F82 A;  1XXM A;  1ZG4 A;  1TDG A;  1YT4 A;  1LHY A;  4EQI A;  3HLF A;  2ZD8 A;  1W5D A;  2QPN A;  3VP4 A;  1MPL A;  4JLF A;  4S2J A;  4EWF A;  3ITB A;  3MKE A;  2WGW A;  5A92 A;  4JXW A;  1XPB A;  1BSG A;  1VM1 A;  3IT9 A;  1L0G A;  3WS1 A;  3SS4 A;  4UA9 A;  3BFF A;  4ZJ3 A;  4Z9Q A;  3Q07 A;  1NZO A;  2ZQC A;  2JE5 A;  5CRF A;  4KZ9 A;  5E2E A;  2WUQ A;  1MBL A;  1K54 C;  1ES2 A;  1K54 A;  2ZQD A;  2HDU A;  4R3J A;  3UO9 A;  1PWD A;  2HP6 A;  2WGW B;  4DE2 A;  2WKI A;  4E3J A;  1MWU A;  3IHA A;  5CHJ A;  4HBU A;  4OQG A;  4BQM A;  2EX2 A;  4JKT A;  1KGE A;  2WYX A;  3FYZ A;  4UA7 A;  1O7E A;  3SS5 A;  3UDF A;  5DTK A;  1YMS A;  1ONG A;  4X68 A;  2J7V A;  2Y91 A;  2WGV A;  2OLU A;  3HLC A;  4MEZ A;  4FD8 A;  4S2I A;  3G2Y A;  4FSF A;  1K4E A;  3S22 A;  5GLD A;  4OPR A;  5FQQ A;  4NK3 A;  4JF6 A;  1RGZ A;  1C3B A;  1TDL A;  4IBR A;  4XUX A;  3FZC A;  3IQA A;  1GA9 A;  1JTD A;  4X55 A;  3V5M A;  2XD5 A;  1PIO A;  2ZM0 A;  3FV7 A;  3FKW A;  1ERQ A;  4OOL A;  3A3F A;  1PI5 A;  4JXG A;  3NI9 A;  3TSG A;  1YLP A;  3BFD A;  3NBL A;  1DJC A;  4WEK A;  5FSR A;  4EBN A;  5FI6 A;  3PBQ A;  2EX6 A;  3LY3 A;  1H5X A;  4IED A;  5CER A;  1FQG A;  5M18 A;  3PBT A;  2ZQA A;  3DW0 A;  3ZG5 A;  4B4X A;  4C3Q A;  1FOF A;  4PM7 A;  4ZTK A;  2WZX A;  1BUE A;  3UDX A;  4UHU A;  4X6T A;  2V2F F;  2Z2L B;  1FSY A;  4KEN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...