4ZJ3A

Crystal structure of cephalexin bound acyl-enzyme intermediate of val216acrf mutant tem1 beta-lactamase from escherichia coli: e166n and v216acrf mutant.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
265
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWNPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Exploring the potential impact of an expanded genetic code on protein function.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 263
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zj3A00
1BLSA 2Y4AA 4QD4A 1DJAA 3VFFA 4Y0TA 4KZ4A 4WM9A 5FQ9A 3V3RA 5DTKA 5FAPA 3HLEA 2XH9A 2ZQCA 3WS4A 3P09A 3UDIA 1FSWA 5EUAA 1BT5A 3A3EA 3BM6A 2ZD8A 1O07A 2ZC7A 3DW0A 2VGKA 2WGVA 2DNSA 4KZ9A 3QHYA 5FQJA 5CTNA 3TOIA 4DKIA 5DTSA 3OCLA 3FWLA 1K56A 1Q2QA 4DE0A 2XK1A 1JTGA 3W8KA 5FATA 1G6AA 4WZ5A 1MXOA 4OLGA 3E2LA 5TGFA 4KENB 4OLDA 3SH9A 3DWKA 3G4PA 4FCFA 3O87A 4UA9A 3VP2A 3PBQA 4ID4A 3D4FA 4IBRA 2EFUA 2WUQA 1GA9A 2IWDA 1ERQA 4OQGA 1XKZA 3IT9A 5KZHA 3PBNA 2WGWA 3NBLA 5IHVA 1K57A 4IVIA 3N4IA 3OC2A 1IYSA 3ISGA 3SS5A 3TSGA 2XD1A 4BL3A 4QU3A 4N92A 2QPNA 3LO7A 5HAQA 3Q81A 3Q82A 3Q1FA 2XFSA 1RP5A 1K54C 3QNBA 4Q8IA 2Q9MA 5I94A 3UPPA 4FH4A 5EVIC 3MZDA 4X53A 3MXSA 4MLLA 4RVAA 1XA7A 4ZJ1A 2Y2IA 3ZG7B 4E3NA 1RGZA 3ZG8B 2C6WB 4A5RA 2XGNA 4P87A 4R3JA 2HDQA 1TEMA 1HD8A 5E2FA 4HBTA 2OSUA 1FSYA 3BECA 4DDYA 5EVLA 1S6RA 3UY6A 1ONGA 1KE0A 4GD6A 4P6BA 1GA0A 2H5SA 3DTMA 1KVLA 3WRZA 3UPNA 1YM1A 4R1GA 2WGWB 3W4QA 2J9PA 4EWFA 1JWPA 3NC8A 1FQGA 1ZKJA 4OH0A 5HARA 2CC1A 4EV4A 4LCMA 3MZEA 1I2WA 4S2KA 3S22A 5AQ7A 4S2LA 5U47A 4YINA 2EFXA 1TDLA 1YLWA 2QMIA 5DF9A 1TDGA 3ZGAB 3WS2A 3ZNTA 1KDSA 3IH8A 2ZC5B 3N6IA 4R0QA 1O7EA 5A92A 4WZ5C 3NIAA 3UE0A 3IXGA 4WMCD 3GMWA 2ZC3B 5TR7A 2XDMA 2I72A 1IYOA 2Y91A 1MWSA 1NJ4A 2IWCA 3G32A 1KGGA 4CJNA 4NETA 4D2OA 4KG2A 4E6WA 5HL1A 4BL2A 2B5RA 3Q7ZA 4PPRA 5KSCA 4JBFA 3GR2A 1JWVA 1PI5A 1KE3A 2Y2LA 1NRFA 1KGEA 1AXBA 4UHUA 4ZAMA 1QMEA 5GLBA 3WS1A 4E3JA 5HW3A 4X6TA 4GB7A 4GDBA 5TFQA 2JBFA 4DE1A 1PWDA 1PW8A 4M3KA 1PZOA 3JYIA 1LLBA 1N9BA 5CERA 4OQHA 3GV9A 4S2PA 1EWZA 1VM1A 4KQRA 4S2NC 3PBSA 5F1FA 5KSHA 3N7WA 3UE1A 2JCHA 3MKFA 1IEMA 3IXBA 1K54A 3VP1A 3M2KA 5M18A 5CHUA 2ZQDA 3O3VA 5EVIA 1XGJA 4IVKA 1WE4A 3C7VA 3WWXA 3LY3A 1L2SA 4E3OA 1PWCA 4L0LA 1ZG6A 2ZLYA 3IWIA 1K4EA 4OONA 3TG9A 3MBZA 1NZOA 4EBPA 4EQIA 2Y59A 1W7FA 1FCNA 2Y2MA 1YT4A 3G31A 4WMCA 4E3LA 3LCEA 1YLTA 1TVFA 3IXHA 3M6HA 5GLDA 2ZM2A 3W4PA 5L2FA 2G2WA 4JPMA 3SS3A 3G34A 2R9WA 5FQKA 4C75A 5A93A 4FSFA 5EECA 3HUOA 4JF5A 2HP5A 4GDNA 1K4FA 3VOYA 2Y2PA 4JXGA 2P74A 3OPHA 4XXRA 2J8YA 5DTTA 2WYXA 4LV3A 4WYYA 1SDNA 2PU2A 2BG1A 2WKIA 3SOIA 4DRTA 2HP6A 2RL3A 5FDHA 1N4OA 3NDEA 5EVIB 4IEDA 3SH7A 1VQQA 4KZ7A 2H0YA 1PW1A 3Q7VA 4R4SA 1L0GA 4XUXA 3SH8A 4PM5A 5EE8A 4KG5A 3A3FA 2X01A 4GOGA 4ZJ2A 3ZG9B 2EX9A 2DRWA 3IWOA 4S2IA 4UA6A 3HLCA 3HL9A 3EQVA 3ZG0A 3N8LA 1XP4A 1YLPA 3BFEA 5GHXA 5AQBA 4WBGA 2X02A 3MXRA 2Y2HA 2H0TA 2WZXA 2OLVA 3EQUA 4HBUA 3UPOA 3G30A 4LV2A 5EOEA 4YFMA 2WKHA 1K6SA 1CK3A 3OPPA 2Y2QA 4KG6A 4S2MA 1KDWA 2Q9NA 4S2NA 4Z9QA 1Q2PA 2XQZA 2JE5A 2H10A 2OV5A 1BLPA 4BD1A 1RCJA 1K55A 1EI5A 3E2KA 3FKWA 2V2FF 5M1AA 2ZQAA 5DF7A 4QY5A 1XX2A 5F82A 3ZCZA 1FOFA 5E2GA 1ESIA 3BLSA 1BULA 3I7JA 3OZHA 2HPBA 3S1YA 2WAFA 1JWZA 4ZJ3A 1W8YA 4KQOA 3FKVA 3G2ZA 3OPLA 3HLGA 3CMZA 2Y2NA 4Y0UA 2IWBA 3GSGA 1ALQA 1GHPA 1GCEA 1YQSA 3BEBA 3ZNYA 4U3TA 3QNCA 4R3BA 5FI2A 3M6BA 1L0EA 2EX6A 4OPRA 5FA7A 3RXXA 1BLCA 1XXMA 4E6XA 1ONHA 1BTLA 4MBKA 2Y2OA 5AQ9A 5F1GA 3AGEA 3MFDA 3PBOA 3IF6A 5FAOA 5CGXA 4GD8A 4JKTA 1KVMA 4N9LA 3UO9A 5E43A 1KGFA 4O7DA 4X68A 4C3QA 1ES3A 3IHBA 3P98A 3O86A 5DF8A 1K38A 4RX3A 3VOZA 3BFFA 4BJPA 1FR1A 4KZ3A 4RYEA 4DE2A 5HFOA 3A3JA 2EX2A 2G2UA 4LCLA 4HEFA 4N1XA 3SS4A 2UWXA 1H8ZA 5FASA 4X56A 1NY0A 2XFTA 2ZM0A 4N1HA 2HDSA 5GLCA 4JXSA 1ERMA 4ZBEA 4OOMA 3V3SA 3HVFA 2WGIA 3CJMA 2FFYA 5GHZA 4QJGA 4XUZA 2EX8A 5GL9A 3ZHHA 3Q07A 1PZPA 2ZMAA 1JTDA 1K55C 4GN2A 1RGYA 3OCNA 3O88A 4JF6A 4B4XA 2J7VA 4DF6A 3ZFZA 1ES5A 1YMXA 4KZBA 5KMWA 5JYPA 3MKEA 3WS5A 4FH2A 1MWTA 1SCWA 3IHAA 1U60A 1PWGA 4CPKA 1YLZA 5CXWA 3IXDA 3IH9A 4OPZA 5EPHA 1M6KA 4OQIA 4OKPA 1W5DA 2BLSA 3NDGA 3FV7A 5GHYA 4DXBA 3IQAA 1G68A 4QY6A 1HZOA 3HUMA 4KQQA 4MBFA 1Z6FA 1YLJA 1DY6A 1IELA 1SHVA 1BUEA 2Y2KA 4LV1A 5CTMA 5FAQA 3WRTA 4EUZA 4OP5A 1ZG4A 5GLAA 3FYZA 1PI4A 4QHCA 1FCOA 1KE4A 2XR0A 1IKIA 2C5WB 3DWZA 4FD8A 3GVBA 5J8XA 3NY4A 4OOLA 4LENA 3IWQA 3ZG5A 4PM7A 3AGFA 3C5AA 3IF6C 1LL9A 2R9XA 3UE3A 2FFFB 3VP4A 1J9MA 1XPBA 1MWRA 2XEPA 3VMAA 1BLHA 1E3UD 1ZC2A 4GKUA 1M40A 4Y0OA 1E25A 1ES2A 2GDNA 2ZQ8A 4OP8A 4P0MA 4R4RA 4C6YA 3G2YA 2J9OA 1WYBA 1YLYA 3HREA 1PIOA 1MKIA 1ES4A 1H5XA 4X69A 1HVBA 1MPLA 1EROA 3ZVWA 1CI8A 4X55A 4PM6A 4S2JA 4B4ZA 3VFHA 4E3IA 3S4XA 2EXAA 5F83A 4LV0A 3UN7A 2ZQ9A 4MNRA 2ZC4B 3C7UA 5CEDA 3NCKA 5BOHA 5HAIA 2XD5A 1LL5A 2WAEA 5E2HA 1GHIA 4UAAA 2HP9A 1NYYA 1CEFA 1S0WA 4KZ6A 5FQQA 4RX2A 4F94A 1DJCA 1Y54A 3HLFA 2V1ZA 3PAEA 5G18A 1I5QA 5FQMA 3BLMA 2X71A 3BFCA 1GHMA 3ZDJA 3UNWA 1IKGA 1HTZA 3Q7VB 3WS0A 4OQ0A 1QMFA 2A49A 3A3DA 4ZTKA 1NZUA 2EXBA 4K0WA 1CI9A 1XGIA 4MEZA 4K91A 2WZZA 3ITBA 5EOOA 5FI7A 5JYOA 5E2EA 3PBTA 1IYPA 5DVAA 1W8QA 1NXYA 2PU4A 2WK0A 2VGJA 4PM8A 1E3UA 3AGDA 3RXWA 4JXWA 4K0XA 1CEGA 1YMSA 2XLNA 4WEJA 5HAPA 1ESUA 3VP3A 3A3IA 5FSRA 3UDXA 3VSLA 3OPRA 1L0FA 4MBHA 3NI9A 5A91A 3GTCA 4HESA 2JC7A 3W4OA 1JVJA 1E4DA 1I2SA 3CZDA 3BYDA 2DCFA 2P9VA 3CG5A 1IYQA 4BLMA 1SKFA 2Z2LB 1BZAA 3V39A 1NYMA 3M2JA 5M19A 4WEKA 3UDFA 3ZVTA 5HX9A 1SDEA 3HLBA 5EVID 4OVDA 4P85A 4GNUA 2Z2MB 4U0TA 4WZ4A 2ZC6B 3LEZA 4JLFA 2A3UA 5FQIA 4E3KA 2RCXA 1PYYA 3C4OA 4EBNA 1K6RA 2ZQ7A 2Y2JA 3LY4A 5A90A 2XF3A 1MY8A 1LI9A 3VSKA 4DDSA 1K25A 4N9KA 1H8YA 5D3OA 4WELA 3V5MA 3RJUA 4JF4A 4OPYA 3GRJA 4KZ5A 1XA1A 4UA7A 2Y2GA 2OLUA 2ZJ9A 4DE3A 4BQMA 1W79A 4RA7A 3HLWA 1DJBA 3G35A 5CGWA 1K57C 1MBLA 2P9VB 4E3MA 4B88A 1LI0A 4ZDXA 2PBYA 4IBXA 1FCMA 2E8IA 3PAGA 4DXCA 5CHJA 3HLDA 4H8RA 3C4PA 3FZCA 3HUNA 2HDUA 3IF6B 4PM9A 3VP0A 4EBLA 1K56D 3PTEA 2QZ6A 4U0XA 5CEBA 2WKEA 1OMEA 4KZAA 4NK3A 4R23A 4PMAA 3HBRA 5AQAA 3BFGA 3V50A 4OOYA 3BRMA 2ZM8A 4OPQA 4BENA 4JXVA 1FR6A 1L0DA 2V20A 3MZFA 4Y7PA 3ITAA 3N8SA 4S2OA 4GZBA 4KZ8A 5CHMA 3N8RA 4BD0A 3GQZA 3BFDA 5CGSA 2Y55A 1BSGA 2WADA 1C3BA 3IF5A 3PBRA 5CECA 1LHYA 5FI6A 3B3XA 4QB8A 2HDRA 5CRFA 1WYCA 1MWUA
chains in the Genus database with same CATH superfamily
2Y4AA 1DJAA 3MQOA 3VFFA 4KZ4A 3KO6A 3MQQA 3V3RA 5FAPA 3P09A 2QWSA 2L1MA 4HQAA 4HH2A 2Z6CA 2ZD8A 3K2NA 3E4OA 2O99A 5DTSA 1D7EA 3OCLA 4I38A 3FWLA 2G7UA 4DE0A 1JTGA 2A24B 2KLIA 1G6AA 1MXOA 4FCFA 2NUTC 3PBQA 4EEUA 5HZHA 2GZAA 5KZHA 3PBNA 4Y2FA 2VKSA 3Q82A 3Q1FA 2VV6A 2Q9MA 5I94A 3UPPA 4FH4A 3B42A 5EVIC 4X53A 1XA7A 2Y2IA 1VEUA 1VHMA 2HDQA 1SKOB 1TEMA 2XRNA 3ICYA 2OSUA 4DDYA 4BBUA 1ONGA 1GA0A 3DTMA 1H0MA 1MKMA 3D72A 1YM1A 2WGWB 1JWPA 1FQGA 3E4PA 5HARA 1NWZA 3MZEA 1TD5A 5U47A 1TDLA 3T1XA 2FH5A 3ZNTA 4WZ5C 1G28A 1TF1A 3E0YA 1P9WA 4D2OA 4KG2A 3LR5A 2VGLM 2KOIA 2B5RA 3GR2A 4Y5FA 1PI5A 2HJEA 3WS1A 2W27A 4QWOA 4GB7A 2W1RA 2JBFA 1PW8A 3VV4A 3JYIA 1N9BA 2PR5A 4OQHA 3GV9A 4EXOA 3JVVA 4S2NC 5F1FA 3PBSA 3N7WA 2JCHA 4GW9A 3VP1A 3GECA 4CLCE 4IVKA 1WE4A 2KDKA 1PFLA 1PWCA 1CJFA 3IWIA 4Q0JA 3G31A 1FCNA 4E3LA 5L09A 1YLTA 1TVFA 3IXHA 2ZM2A 4LFUA 4HI4A 2R9WA 5FQKA 2V1BA 4FSFA 1K4FA 3VOYA 1Z09A 4II7A 4MCWA 1SDNA 4DMZA 2RL3A 3KSGA 1UWPX 3NDEA 4NXEA 2PHYA 2D02A 3SH7A 1VQQA 4KZ7A 2H0YA 3A0VA 4HY8A 4XUXA 3A3FA 4JGQA 5HWWA 4O8GA 4UA6A 3HL9A 3EQVA 3H9WA 2WKRA 5AQBA 2Y2HA 3UPOA 4UQIM 4I3JA 4LV2A 1XJ6A 4KG6A 1KDWA 2Q9NA 4X1MA 1Q2PA 2JE5A 1BLPA 4BD1A 2VV8A 3E2KA 5L10A 4QY5A 1FOFA 1ESIA 3BLSA 2HPBA 3S1YA 4ZJ3A 1W8YA 4R38A 3FKVA 3CMZA 2Y2NA 2IWBA 2EWWA 1UGUA 4H6JA 3ZNYA 4E6XA 4CLCA 5AQ9A 4GD8A 1OT9A 1KVMA 3UO9A 1KGFA 5I5LA 1ES3A 3IHBA 4NKPA 5DFXA 4DE2A 3BFFA 4Q0HA 4KZ3A 2OAQ1 4Y17A 3A3JA 2EX2A 2G2UA 2UWXA 2HDSA 3CJMA 5GHZA 4I39A 1D06A 2ZMAA 3PHYA 1ES5A 1YMXA 1G5UA 3UB8A 4JGOA 3IH9A 1F98A 1DP6A 1M6KA 3VOLA 1W5DA 3NDGA 4G3WA 1G68A 4MBFA 2HJ9C 1BUEA 4LV1A 2P7JA 5GLAA 1FCOA 1XJ3A 1YKDA 1G6OA 3NJAA 3IS2B 3IWQA 3AGFA 1GSVA 1T1BA 3IF6C 2W3FA 4DJ3A 1BYWA 1XPBA 1E3UD 1ZC2A 4Y0OA 2ZQ8A 1PIOA 1MKIA 1ES4A 4X55A 3QP6A 3S4XA 2QJ5A 2EXAA 5F83A 3MS6A 2ZOHA 1IOUA 2XD5A 1GHIA 4UAAA 1CEFA 1Y54A 4L9FA 3PAEA 4HP9A 3BLMA 2VEAA 2X71A 1GHMA 2PRFA 1YAXA 5HDDA 3A3DA 1TS8A 1XGIA 1S4RA 5E2EA 3PBTA 1IYPA 1W8QA 2PU4A 3RXWA 4K0XA 2XLNA 4WEJA 1P9RA 3UDXA 1L0FA 3GTCA 3W4OA 3CZDA 2VK3A 3O5YA 5HDCA 4LGWA 1BZAA 1ZHHB 3LFVA 3R4KA 4WEKA 3ZVTA 5HX9A 3HLBA 4U0TA 4WZ4A 4JLFA 3C4OA 1K6RA 3JVUA 4X25A 5C5KA 3V5MA 1XA1A 2Y2GA 2ZJ9A 4BQMA 1W79A 3G35A 1MC0A 2P9VB 4CLCB 2E8IA 4DXCA 1ZTUA 4ARZA 3HUNA 2HDUA 2Z6DA 3PTEA 4KZAA 2K7SA 1UWNX 1XJ2A 3HBRA 3BFGA 1T18A 3LIDA 4OPQA 1T1CA 3T4SA 3MZFA 3ITAA 4KZ8A 5CHMA 3BY8A 2A24A 2FZ0A 3PBRA 4PAUA 5FI6A 5CRFA 1Y28A 2XH9A 4ETXA 5EUAA 1BT5A 2VGKA 4KZ9A 1IFQA 3QHYA 5FQJA 3TOIA 3VE4A 2V8FA 5FATA 4WZ5A 4OLGA 3E2LA 5TGFA 5HSQA 2WUQA 1GA9A 2IWDA 1ERQA 3IT9A 3BJNA 2WGWA 5IHVA 1K57A 3N4IA 3GDIA 3ISGA 2XD1A 4BL3A 1K54C 4MN6A 4ZJ1A 3ZG7B 4E3NA 3LI9A 2IA2A 4HH3A 4A5RA 2XGNA 4P87A 3L9KA 4EQ1A 3IX3A 1KE0A 2H5SA 1KVLA 3K3CA 4R1GA 2J9PA 3NC8A 4EV4A 1I2WA 2CMNA 3T4KA 5AQ7A 4MN5A 2QMIA 4NXFA 5DJTA 3ZGAB 3WS2A 3N6IA 5A92A 3D9YA 3NIAA 3IXGA 2ZC3B 3H7WB 3PR6A 1IYOA 2IWCA 3G32A 4CJNA 1KGGA 3A0RA 4PPRA 1S4SA 2JHEA 3NOTC 5FL3A 1AXBA 5GLBA 2VX8A 4GDBA 2W0NA 5TFQA 1PWDA 4M3KA 1FILA 1N9OA 1LLBA 5CERA 1ACFA 4GCZA 1TS0A 3MKFA 1IEMA 5CHUA 2ZQDA 3SZTA 4L0LA 4PKYA 1K4EA 3MBZA 4EBPA 3NULA 2Y59A 5L07A 4ARZB 5GLDA 3W4PA 4C75A 2Y2PA 2ZL1A 5DTTA 2WYXA 4LV3A 4WYYA 3RTYA 4DRTA 3G6OA 5FDHA 2JKRI 3T4OA 5EVIB 4IEDA 2E8JA 5L8MA 1L0GA 3ZQ5A 3E98A 1EW0A 3MF0A 4PM5A 4LRYC 2X01A 3LIBA 2K31A 3L7HA 1OPXA 4CLCD 1YLPA 3FG8A 5GHXA 4WBGA 2X02A 3EQUA 4HBUA 3OOVA 3G30A 5TBMB 3OPPA 2Y2QA 1P0ZA 4S2MA 2XQZA 2YKFA 1OTAA 1EI5A 4WL9A 3FKWA 4XT2A 2XSSA 5LBRA 4ESPA 3S7OA 4BBTA 5F82A 3BQ8A 3OZHA 1JWZA 3QP2A 3HLGA 3T4JA 1GHPA 1GCEA 1OTDA 3FPVA 4YWZA 4U3TA 3QNCA 5FI2A 1S1ZA 3MR0A 5DKLA 3RXXA 3LI8A 1BLCA 1XXMA 2QJ7A 4FOFA 2Y2OA 3MFDA 3IF6A 3KYZA 5CGXA 3LICA 4WN5A 4X68A 4C3QA 4DN0A 2O9AA 3O86A 5DF8A 4RX3A 3VOZA 4GS9B 4LCLA 3T1QB 2DMWA 4HEFA 4N1XA 5FASA 1H8ZA 4PKYG 4WF0A 2XFTA 2ZM0A 5GLCA 4ZBEA 3U2AA 4OOMA 1TS7A 3HVFA 3PXPA 2FFYA 3IS2A 4XUZA 4L9EA 5GL9A 3P7NA 3ZHHA 1K55C 4GN2A 1RGYA 2XA7S 3O88A 4FH2A 1MWTA 1SCWA 3IHAA 1U60A 4CPKA 2ZMFA 3IBJA 5EPHA 1LL8A 4OQIA 2BLSA 2L4RA 3IQAA 3HUMA 1N9NA 1SHVA 4EUZA 2Y2KA 5FAQA 2JKRM 4QHCA 3FPWA 3DWZA 4FD8A 5J8XA 4OOLA 4LENA 2V0WA 1F5MA 2HV1A 2R9XA 3UE3A 2LB5A 5K5BA 2GDNA 4C6YA 4PHTA 2QHKA 1OTIA 2Q0OA 1H5XA 4X69A 1EROA 1CI8A 4S2JA 3BQAA 2VA0A 4MNRA 1Y4OA 2ZC4B 3C7UA 3HCYA 5CEDA 1S66L 5BOHA 3S7QA 4DJ2A 2ZL1B 4Q0IA 5E2HA 2HP9A 2L0WA 4RX2A 4F94A 5G18A 1IKGA 3WS0A 2PR6A 4KUKA 4GLQA 1QMFA 1NRJA 2OWHA 3TJZC 3LUQA 2EXBA 1W63M 4MEZA 3CUEC 2W3EA 1OJ5A 5HD5A 5DVAA 2WK0A 2HF6A 4G3KA 3DTEA 4E04A 1YMSA 3VP3A 2W3GA 3A3IA 3OPRA 5A91A 4MBHA 1E4DA 3BYDA 2DCFA 2P9VA 1IYQA 2PAVP 3E4QA 1T1AA 2M1CA 3M2JA 5M19A 4XT2B 1W63Q 5EVID 4OVDA 2ZC6B 4Y13A 2A3UA 4EBNA 1P97A 4I5SA 1K25A 1H8YA 4JGPA 3RJUA 3UB5P 2OLUA 1N9LA 4RA7A 3HLWA 3LR4A 1LI0A 4ZDXA 1FCMA 4H8RA 3FZCA 2JKTI 3IF6B 3VP0A 1K0KA 1OJGA 5CEBA 2QZ6A 2WKEA 2V1AA 3QP4A 2M7VA 1OMEA 4NK3A 4WUJA 4R23A 5F69A 4OOYA 1CQAA 4NEED 2V20A 4Y7PA 3N8SA 1MZUA 3NECA 1BSGA 5CECA 3IF5A 3TRCA 2KX6A 2GX5A 5FDSA 1WYCA 1BLSA 4YOFA 2H28A 4WM9A 3LYXA 3WS4A 3MJQA 3A3EA 2ZC7A 3DW0A 5CTNA 5J3WA 1Q2QA 3VE3A 4KENB 4OLDA 3DWKA 3G4PA 4HJ6A 4UA9A 3O87A 1NLYA 5AVEA 4ID4A 4IBRA 1L3LA 4OQGA 1VETB 3NBLA 4IVIA 1H8MA 3OC2A 1IYSA 3V67A 4EERA 4QU3A 4N92A 3F1PB 3LO7A 1RP5A 3QNBA 4Q8IA 4O0PA 3MZDA 3MXSA 4MLLA 4RVAA 3ZG8B 3H7WA 2C6WB 3CPTB 1HD8A 4LPZA 5J4EA 1FSYA 1S6RA 5EM1A 4R6LA 4P6BA 3WRZA 3UPNA 3W4QA 1ZKJA 4OH0A 3UMDA 2CC1A 4LCMA 4S2KA 4YINA 2EFXA 1X0OA 3QP1A 1KDSA 1O7EA 2OAP1 2WKQA 3HJKA 3UE0A 3GMWA 3MMHA 2EWVA 2I72A 3UB7A 2J3TD 2Y91A 1NJ4A 2JKTM 2VGLS 3MXQA 4E6WA 4BL2A 5KSCA 4JBFA 1JWVA 2Y2LA 1NRFA 4UHUA 4ZAMA 3CLOA 1D1JA 1QMEA 2QKPA 5HW3A 3BWLA 4DE1A 1ODVA 1PZOA 1VM1A 5KSHA 4KQRA 4EEPA 2VZWA 4FUWA 4EETB 3EWKA 3QP5A 3CHWP 3M2KA 2XA7M 3O3VA 5EVIA 1XGJA 2LB9A 3C7VA 5IT5A 3LY3A 1L2SA 2PBDP 2ZLYA 4KUOA 2ACGA 2XROA 4WMCA 5HD3A 2AVXA 1YT4A 3UB6A 1T19A 3LCEA 4O01A 5L2FA 4JPMA 5A93A 5HPFA 3IX8A 4JF5A 2VV7A 3JPUA 4GDNA 4RQ9A 3OPHA 4XXRA 4Z1WA 2J8YA 5TBMA 3KX0X 3NOPC 1LT0A 4LLOB 1F2KA 1OT6A 4IUKA 3Q7VA 4R4SA 3SH8A 2V8CA 1TS6A 4GOGA 4ZJ2A 3ZG9B 2EX9A 2DRWA 3IWOA 4S2IA 3ZG0A 3H82B 3MXRA 2H0TA 2WZXA 2OLVA 4X1LA 4YFMA 2WKHA 1K6SA 1CK3A 4G3VA 4M4XA 4S2NA 2H10A 1K55A 4P6ZS 2V0UA 5M1AA 2ZQAA 5DF7A 2ZOIA 1XX2A 3F1NA 5E2GA 2Y8HA 5DKKA 5FEFA 3I7JA 3T4TA 4GS9A 2WAFA 5AVFA 4KQOA 3OPLA 3GSGA 1ALQA 4CQHA 5A8BA 1PRQA 4R3BA 2NUPC 2EX6A 3A0SA 4OPRA 4MDZA 1STZA 1ONHA 4MBKA 5IS1A 1J3WA 4HOIA 4BMWA 4NXBA 2B18A 3P98A 2UV0E 4BJPA 1FR1A 5HFOA 4X56A 4N1HA 4JXSA 2WGIA 4QJGA 1JTDA 3S7NA 4JF6A 5HPIA 4B4XA 2J7VA 3R7WB 3ZFZA 5JYPA 2QYBA 3MKEA 3WS5A 1PWGA 3KSIA 4LRZE 3IXDA 3UMEA 2B95A 2INWA 4OKPA 1SZVA 1HZOA 1Z6FA 1YLJA 5HWTA 1IELA 4I3AA 1PI4A 1KE4A 1S67L 4HIAA 4PM7A 3C5AA 4L9GA 1BLHA 3IX4A 2PD7A 1M40A 4UEYA 4JGRA 1ES2A 3LGOA 4R4RA 3G2YA 2J9OA 3HREA 4HJ3A 4PM6A 4WLAA 4B4ZA 3VFHA 1V9ZA 4E3IA 4LV0A 3UN7A 1HLUP 1F9IA 3NCKA 1LL5A 4KZ6A 5FQQA 1DJCA 3HLFA 5DFYA 2OOLA 1I5QA 3NOUC 3ZDJA 4NG2A 3Q7VB 3UNWA 1YPRA 4OQ0A 3T50A 3P01A 2A49A 4EESA 4ZTKA 1NZUA 3KSHA 1CI9A 3B47A 2WZZA 5EOOA 5JYOA 3RFBA 4LRXC 2W3HA 4PM8A 1CEGA 5FSRA 4HESA 2JC7A 4EU0A 4B93A 3CG5A 4BLMA 1FIKA 5IU1A 1LSVA 1SDEA 1V9YA 4GNUA 5CX7A 5DJUA 2W1TA 2RCXA 3F1NB 1PNEA 1PYYA 2ZQ7A 3C38A 5A90A 2XF3A 1MY8A 4DDSA 5TJJA 5D3OA 4JF4A 4OPYA 3GRJA 4KZ5A 5KIZA 4UA7A 3MSHA 4DE3A 1DJBA 1K57C 4HJ4A 1WA9A 3PAGA 2D01A 3C4PA 4EBLA 5HWVA 4PMAA 2ZM8A 3DTIA 4JXVA 1FR6A 1L0DA 4GZBA 4MN7A 3N8RA 3BFDA 3W2ZA 2Y55A 2WADA 1C3BA 3B3XA 4QB8A 2HDRA 3CWFA 5MC7A 4QD4A 3U4LP 2ZMVA 2MJ6A 3BY9A 4Y0TA 5FQ9A 1VETA 5DTKA 3F1OB 4IHQA 3HLEA 2ZQCA 2K2NA 3UDIA 1FSWA 5F68A 5EVEA 3BM6A 1O07A 3F1PA 3KYEA 2WGVA 3SW1A 2DNSA 3IBRA 4DKIA 4B9OA 3EEAA 1K56A 2PYRA 2XK1A 3W8KA 4HHDA 3CPTA 3SH9A 3CITA 3VP2A 4KQDA 3D4FA 2EFUA 1XKZA 5HDSA 3UB9A 3MQ0A 3SS5A 3TSGA 5AJGA 1GSXA 4BWIA 2QPNA 5HAQA 3Q81A 1XJ4A 2XFSA 2VJWA 4R70A 4AFIA 1AWIA 1RGZA 4R3JA 5E2FA 3T4QA 4HBTA 3BECA 5EVLA 3T12B 4GHIA 3UY6A 4P6ZM 4GD6A 5G4YA 2J3TC 2GNXA 4EWFA 3S22A 3NHQA 4S2LA 1YLWA 5DF9A 1TDGA 3IH8A 4R0QA 2ZC5B 4WMCD 3MFXA 1VEUB 5TR7A 2XDMA 1OTEA 1KOUA 2P04A 1MWSA 4NETA 4YNRA 2I9VA 5HL1A 3Q7ZA 4HP4A 1KE3A 3CAXA 1KGEA 2R78A 4GJ4A 4E3JA 2JKGA 1DP9A 4X6TA 3LIEA 1H3QA 4Y3IA 2W1TB 2BASA 3TE8A 4S2PA 1EWZA 3D3OA 3UE1A 3IXBA 1LSWA 1K54A 5M18A 3WWXA 1JNUA 3ZYTA 4E3OA 1ZG6A 2O9CA 2P08A 4OONA 3TG9A 1NZOA 4EQIA 4R3AA 1W7FA 2Y2MA 5EM0A 2ZBBA 4I3IA 3M6HA 3LR0A 2G2WA 3SS3A 3G34A 4ETZA 5EECA 3HUOA 3EGXC 2HP5A 3H82A 3DBAA 3KSFA 4JXGA 2P74A 1NLZA 2PU2A 2BG1A 2WKIA 3SOIA 2HP6A 4IJGA 1N4OA 5EV0A 2PDRA 1A0KA 1PW1A 2HGVA 5EE8A 2YKHA 3C2WA 4KG5A 3DTKA 1XFQA 3T4LA 2Y79A 3FC7A 3HLCA 5HL6A 3N8LA 1XP4A 3BFEA 4K08A 3UE6A 3HJIA 5EOEA 4Z9QA 2OV5A 3LR3A 1S1YA 1RCJA 3LIAA 5G4ZA 2V2FF 3QP8A 3RH8B 1CF0A 3ZCZA 2VLGA 1BULA 2PT7A 3G2ZA 4Y0UA 5F5YA 4F3LA 1YQSA 3BEBA 3LEQA 4ZRRA 4EW7A 3M6BA 1L0EA 5FA7A 3R7WA 1BTLA 3EGDC 5F1GA 3AGEA 5FAOA 3PBOA 4JKTA 4N9LA 3LIFA 4GHIB 5E43A 4O7DA 3T1SA 4ME4A 3OLOA 1K38A 4RYEA 4FTXA 2GJ3A 2O0YA 3SS4A 4EUVA 1NY0A 1ERMA 3V3SA 4H6JB 1YSQA 2EX8A 3Q07A 1PZPA 5J7EA 3OCNA 2B02A 4DF6A 4KZBA 5KMWA 3C8CA 3TW8A 1YLZA 5CXWA 4OPZA 1OTBA 3FV7A 5GHYA 4DXBA 4QY6A 4KQQA 5FEGA 2A2LA 1DY6A 3WRTA 5CTMA 4OP5A 1ZG4A 2PD8A 3FYZA 2W3DA 2XR0A 1IKIA 2C5WB 3GVBA 4CLCC 3NY4A 4D60A 3ZG5A 2WKPA 2O9BA 1LL9A 2FFFB 3VP4A 1J9MA 1MWRA 2XEPA 3VMAA 4GKUA 1E25A 4OP8A 2BTFP 4P0MA 1WYBA 1YLYA 1HVBA 1MPLA 3ZVWA 2EA9A 2ZQ9A 5HAIA 3B33A 4UQIS 2WAEA 3OBFA 2M7UA 1SKOA 1NYYA 2HZ5A 2JN7A 1S0WA 5F6AA 1GSWA 4NXGA 2V1ZA 5FQMA 3BFCA 2V9AA 1HTZA 4Y15A 2OWJA 4K0WA 4K91A 3ITBA 5FI7A 2J3WA 3ULFA 1NXYA 3EEHA 3S7PA 2VGJA 1DP8A 1E3UA 3AGDA 4JXWA 5HAPA 1ESUA 3VSLA 3NI9A 1JVJA 1I2SA 1VB6A 1SKFA 2Z2LB 3V39A 1NYMA 3UDFA 2J80A 2JKFA 3T1RA 4P85A 2Z2MB 1DRMA 5FQIA 4E3KA 3LEZA 4MMNA 4BBVA 2Y2JA 3LY4A 1LI9A 3VSKA 3KYQA 4N9KA 4WELA 3K3DA 4F3LB 4QPRA 3EOIA 5CGWA 1YSPA 1MBLA 4E3MA 4B88A 2PBYA 4IBXA 3CI6A 5CHJA 3HLDA 4PM9A 3F1OA 3DAVA 1K56D 4IUHA 4U0XA 5EFWA 3PYPA 3C30A 5AQAA 3V50A 4HNBA 1LSXA 3BRMA 4BENA 1XFNA 3CUEA 4S2OA 3BW6A 2PYPA 4BD0A 3GQZA 5CGSA 1LHYA 1MWUA
chains in the Genus database with same CATH topology
1BLSA 2Y4AA 4QD4A 1DJAA 3VFFA 4Y0TA 4KZ4A 4WM9A 5FQ9A 3V3RA 5DTKA 5FAPA 3HLEA 2XH9A 2ZQCA 3WS4A 3P09A 3UDIA 1FSWA 5EUAA 1BT5A 3A3EA 3BM6A 2ZD8A 1O07A 2ZC7A 3DW0A 2VGKA 2WGVA 2DNSA 4KZ9A 3QHYA 5FQJA 5CTNA 3TOIA 4DKIA 5DTSA 3OCLA 3FWLA 1K56A 1Q2QA 4DE0A 2XK1A 1JTGA 3W8KA 5FATA 1G6AA 4WZ5A 1MXOA 4OLGA 3E2LA 5TGFA 4KENB 4OLDA 3SH9A 3DWKA 3G4PA 4FCFA 3O87A 4UA9A 3VP2A 3PBQA 4ID4A 3D4FA 4IBRA 2EFUA 2WUQA 1GA9A 2IWDA 1ERQA 4OQGA 1XKZA 3IT9A 5KZHA 3PBNA 2WGWA 3NBLA 5IHVA 1K57A 4IVIA 3N4IA 3OC2A 1IYSA 3ISGA 3SS5A 3TSGA 2XD1A 4BL3A 4QU3A 4N92A 2QPNA 3LO7A 5HAQA 3Q81A 3Q82A 3Q1FA 2XFSA 1RP5A 1K54C 3QNBA 4Q8IA 2Q9MA 5I94A 3UPPA 4FH4A 5EVIC 3MZDA 4X53A 3MXSA 4MLLA 4RVAA 1XA7A 4ZJ1A 2Y2IA 3ZG7B 4E3NA 1RGZA 3ZG8B 2C6WB 4A5RA 2XGNA 4P87A 4R3JA 2HDQA 1TEMA 1HD8A 5E2FA 4HBTA 2OSUA 1FSYA 3BECA 4DDYA 5EVLA 1S6RA 3UY6A 1ONGA 1KE0A 4GD6A 4P6BA 1GA0A 2H5SA 3DTMA 1KVLA 3WRZA 3UPNA 1YM1A 4R1GA 2WGWB 3W4QA 2J9PA 4EWFA 1JWPA 3NC8A 1FQGA 1ZKJA 4OH0A 5HARA 2CC1A 4EV4A 4LCMA 3MZEA 1I2WA 4S2KA 3S22A 5AQ7A 4S2LA 5U47A 4YINA 2EFXA 1TDLA 1YLWA 2QMIA 5DF9A 1TDGA 3ZGAB 3WS2A 3ZNTA 1KDSA 3IH8A 2ZC5B 3N6IA 4R0QA 1O7EA 5A92A 4WZ5C 3NIAA 3UE0A 3IXGA 4WMCD 3GMWA 2ZC3B 5TR7A 2XDMA 2I72A 1IYOA 2Y91A 1MWSA 1NJ4A 2IWCA 3G32A 1KGGA 4CJNA 4NETA 4D2OA 4KG2A 4E6WA 5HL1A 4BL2A 2B5RA 3Q7ZA 4PPRA 5KSCA 4JBFA 3GR2A 1JWVA 1PI5A 1KE3A 2Y2LA 1NRFA 1KGEA 1AXBA 4UHUA 4ZAMA 1QMEA 5GLBA 3WS1A 4E3JA 5HW3A 4X6TA 4GB7A 4GDBA 5TFQA 2JBFA 4DE1A 1PWDA 1PW8A 4M3KA 1PZOA 3JYIA 1LLBA 1N9BA 5CERA 4OQHA 3GV9A 4S2PA 1EWZA 1VM1A 4KQRA 4S2NC 3PBSA 5F1FA 5KSHA 3N7WA 3UE1A 2JCHA 3MKFA 1IEMA 3IXBA 1K54A 3VP1A 3M2KA 5M18A 5CHUA 2ZQDA 3O3VA 5EVIA 1XGJA 4IVKA 1WE4A 3C7VA 3WWXA 3LY3A 1L2SA 4E3OA 1PWCA 4L0LA 1ZG6A 2ZLYA 3IWIA 1K4EA 4OONA 3TG9A 3MBZA 1NZOA 4EBPA 4EQIA 2Y59A 1W7FA 1FCNA 2Y2MA 1YT4A 3G31A 4WMCA 4E3LA 3LCEA 1YLTA 1TVFA 3IXHA 3M6HA 5GLDA 2ZM2A 3W4PA 5L2FA 2G2WA 4JPMA 3SS3A 3G34A 2R9WA 5FQKA 4C75A 5A93A 4FSFA 5EECA 3HUOA 4JF5A 2HP5A 4GDNA 1K4FA 3VOYA 2Y2PA 4JXGA 2P74A 3OPHA 4XXRA 2J8YA 5DTTA 2WYXA 4LV3A 4WYYA 1SDNA 2PU2A 2BG1A 2WKIA 3SOIA 4DRTA 2HP6A 2RL3A 5FDHA 1N4OA 3NDEA 5EVIB 4IEDA 3SH7A 1VQQA 4KZ7A 2H0YA 1PW1A 3Q7VA 4R4SA 1L0GA 4XUXA 3SH8A 4PM5A 5EE8A 4KG5A 3A3FA 2X01A 4GOGA 4ZJ2A 3ZG9B 2EX9A 2DRWA 3IWOA 4S2IA 4UA6A 3HLCA 3HL9A 3EQVA 3ZG0A 3N8LA 1XP4A 1YLPA 3BFEA 5GHXA 5AQBA 4WBGA 2X02A 3MXRA 2Y2HA 2H0TA 2WZXA 2OLVA 3EQUA 4HBUA 3UPOA 3G30A 4LV2A 5EOEA 4YFMA 2WKHA 1K6SA 1CK3A 3OPPA 2Y2QA 4KG6A 4S2MA 1KDWA 2Q9NA 4S2NA 4Z9QA 1Q2PA 2XQZA 2JE5A 2H10A 2OV5A 1BLPA 4BD1A 1RCJA 1K55A 1EI5A 3E2KA 3FKWA 2V2FF 5M1AA 2ZQAA 5DF7A 4QY5A 1XX2A 5F82A 3ZCZA 1FOFA 5E2GA 1ESIA 3BLSA 1BULA 3I7JA 3OZHA 2HPBA 3S1YA 2WAFA 1JWZA 4ZJ3A 1W8YA 4KQOA 3FKVA 3G2ZA 3OPLA 3HLGA 3CMZA 2Y2NA 4Y0UA 2IWBA 3GSGA 1ALQA 1GHPA 1GCEA 1YQSA 3BEBA 3ZNYA 4U3TA 3QNCA 4R3BA 5FI2A 3M6BA 1L0EA 2EX6A 4OPRA 5FA7A 3RXXA 1BLCA 1XXMA 4E6XA 1ONHA 1BTLA 4MBKA 2Y2OA 5AQ9A 5F1GA 3AGEA 3MFDA 3PBOA 3IF6A 5FAOA 5CGXA 4GD8A 4JKTA 1KVMA 4N9LA 3UO9A 5E43A 1KGFA 4O7DA 4X68A 4C3QA 1ES3A 3IHBA 3P98A 3O86A 5DF8A 1K38A 4RX3A 3VOZA 3BFFA 4BJPA 1FR1A 4KZ3A 4RYEA 4DE2A 5HFOA 3A3JA 2EX2A 2G2UA 4LCLA 4HEFA 4N1XA 3SS4A 2UWXA 1H8ZA 5FASA 4X56A 1NY0A 2XFTA 2ZM0A 4N1HA 2HDSA 5GLCA 4JXSA 1ERMA 4ZBEA 4OOMA 3V3SA 3HVFA 2WGIA 3CJMA 2FFYA 5GHZA 4QJGA 4XUZA 2EX8A 5GL9A 3ZHHA 3Q07A 1PZPA 2ZMAA 1JTDA 1K55C 4GN2A 1RGYA 3OCNA 3O88A 4JF6A 4B4XA 2J7VA 4DF6A 3ZFZA 1ES5A 1YMXA 4KZBA 5KMWA 5JYPA 3MKEA 3WS5A 4FH2A 1MWTA 1SCWA 3IHAA 1U60A 1PWGA 4CPKA 1YLZA 5CXWA 3IXDA 3IH9A 4OPZA 5EPHA 1M6KA 4OQIA 4OKPA 1W5DA 2BLSA 3NDGA 3FV7A 5GHYA 4DXBA 3IQAA 1G68A 4QY6A 1HZOA 3HUMA 4KQQA 4MBFA 1Z6FA 1YLJA 1DY6A 1IELA 1SHVA 1BUEA 2Y2KA 4LV1A 5CTMA 5FAQA 3WRTA 4EUZA 4OP5A 1ZG4A 5GLAA 3FYZA 1PI4A 4QHCA 1FCOA 1KE4A 2XR0A 1IKIA 2C5WB 3DWZA 4FD8A 3GVBA 5J8XA 3NY4A 4OOLA 4LENA 3IWQA 3ZG5A 4PM7A 3AGFA 3C5AA 3IF6C 1LL9A 2R9XA 3UE3A 2FFFB 3VP4A 1J9MA 1XPBA 1MWRA 2XEPA 3VMAA 1BLHA 1E3UD 1ZC2A 4GKUA 1M40A 4Y0OA 1E25A 1ES2A 2GDNA 2ZQ8A 4OP8A 4P0MA 4R4RA 4C6YA 3G2YA 2J9OA 1WYBA 1YLYA 3HREA 1PIOA 1MKIA 1ES4A 1H5XA 4X69A 1HVBA 1MPLA 1EROA 3ZVWA 1CI8A 4X55A 4PM6A 4S2JA 4B4ZA 3VFHA 4E3IA 3S4XA 2EXAA 5F83A 4LV0A 3UN7A 2ZQ9A 4MNRA 2ZC4B 3C7UA 5CEDA 3NCKA 5BOHA 5HAIA 2XD5A 1LL5A 2WAEA 5E2HA 1GHIA 4UAAA 2HP9A 1NYYA 1CEFA 1S0WA 4KZ6A 5FQQA 4RX2A 4F94A 1DJCA 1Y54A 3HLFA 2V1ZA 3PAEA 5G18A 1I5QA 5FQMA 3BLMA 2X71A 3BFCA 1GHMA 3ZDJA 3UNWA 1IKGA 1HTZA 3Q7VB 3WS0A 4OQ0A 1QMFA 2A49A 3A3DA 4ZTKA 1NZUA 2EXBA 4K0WA 1CI9A 1XGIA 4MEZA 4K91A 2WZZA 3ITBA 5EOOA 5FI7A 5JYOA 5E2EA 3PBTA 1IYPA 5DVAA 1W8QA 1NXYA 2PU4A 2WK0A 2VGJA 4PM8A 1E3UA 3AGDA 3RXWA 4JXWA 4K0XA 1CEGA 1YMSA 2XLNA 4WEJA 5HAPA 1ESUA 3VP3A 3A3IA 5FSRA 3UDXA 3VSLA 3OPRA 1L0FA 4MBHA 3NI9A 5A91A 3GTCA 4HESA 2JC7A 3W4OA 1JVJA 1E4DA 1I2SA 3CZDA 3BYDA 2DCFA 2P9VA 3CG5A 1IYQA 4BLMA 1SKFA 2Z2LB 1BZAA 3V39A 1NYMA 3M2JA 5M19A 4WEKA 3UDFA 3ZVTA 5HX9A 1SDEA 3HLBA 5EVID 4OVDA 4P85A 4GNUA 2Z2MB 4U0TA 4WZ4A 2ZC6B 3LEZA 4JLFA 2A3UA 5FQIA 4E3KA 2RCXA 1PYYA 3C4OA 4EBNA 1K6RA 2ZQ7A 2Y2JA 3LY4A 5A90A 2XF3A 1MY8A 1LI9A 3VSKA 4DDSA 1K25A 4N9KA 1H8YA 5D3OA 4WELA 3V5MA 3RJUA 4JF4A 4OPYA 3GRJA 4KZ5A 1XA1A 4UA7A 2Y2GA 2OLUA 2ZJ9A 4DE3A 4BQMA 1W79A 4RA7A 3HLWA 1DJBA 3G35A 5CGWA 1K57C 1MBLA 2P9VB 4E3MA 4B88A 1LI0A 4ZDXA 2PBYA 4IBXA 1FCMA 2E8IA 3PAGA 4DXCA 5CHJA 3HLDA 4H8RA 3C4PA 3FZCA 3HUNA 2HDUA 3IF6B 4PM9A 3VP0A 4EBLA 1K56D 3PTEA 2QZ6A 4U0XA 5CEBA 2WKEA 1OMEA 4KZAA 4NK3A 4R23A 4PMAA 3HBRA 5AQAA 3BFGA 3V50A 4OOYA 3BRMA 2ZM8A 4OPQA 4BENA 4JXVA 1FR6A 1L0DA 2V20A 3MZFA 4Y7PA 3ITAA 3N8SA 4S2OA 4GZBA 4KZ8A 5CHMA 3N8RA 4BD0A 3GQZA 3BFDA 5CGSA 2Y55A 1BSGA 2WADA 1C3BA 3IF5A 3PBRA 5CECA 1LHYA 5FI6A 3B3XA 4QB8A 2HDRA 5CRFA 1WYCA 1MWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLS A;  2Y4A A;  4QD4 A;  1DJA A;  3VFF A;  4Y0T A;  4KZ4 A;  4WM9 A;  5FQ9 A;  3V3R A;  5DTK A;  5FAP A;  3HLE A;  2XH9 A;  2ZQC A;  3WS4 A;  3P09 A;  3UDI A;  1FSW A;  5EUA A;  1BT5 A;  3A3E A;  3BM6 A;  2ZD8 A;  1O07 A;  2ZC7 A;  3DW0 A;  2VGK A;  2WGV A;  2DNS A;  4KZ9 A;  3QHY A;  5FQJ A;  5CTN A;  3TOI A;  4DKI A;  5DTS A;  3OCL A;  3FWL A;  1K56 A;  1Q2Q A;  4DE0 A;  2XK1 A;  1JTG A;  3W8K A;  5FAT A;  1G6A A;  4WZ5 A;  1MXO A;  4OLG A;  3E2L A;  5TGF A;  4KEN B;  4OLD A;  3SH9 A;  3DWK A;  3G4P A;  4FCF A;  3O87 A;  4UA9 A;  3VP2 A;  3PBQ A;  4ID4 A;  3D4F A;  4IBR A;  2EFU A;  2WUQ A;  1GA9 A;  2IWD A;  1ERQ A;  4OQG A;  1XKZ A;  3IT9 A;  5KZH A;  3PBN A;  2WGW A;  3NBL A;  5IHV A;  1K57 A;  4IVI A;  3N4I A;  3OC2 A;  1IYS A;  3ISG A;  3SS5 A;  3TSG A;  2XD1 A;  4BL3 A;  4QU3 A;  4N92 A;  2QPN A;  3LO7 A;  5HAQ A;  3Q81 A;  3Q82 A;  3Q1F A;  2XFS A;  1RP5 A;  1K54 C;  3QNB A;  4Q8I A;  2Q9M A;  5I94 A;  3UPP A;  4FH4 A;  5EVI C;  3MZD A;  4X53 A;  3MXS A;  4MLL A;  4RVA A;  1XA7 A;  4ZJ1 A;  2Y2I A;  3ZG7 B;  4E3N A;  1RGZ A;  3ZG8 B;  2C6W B;  4A5R A;  2XGN A;  4P87 A;  4R3J A;  2HDQ A;  1TEM A;  1HD8 A;  5E2F A;  4HBT A;  2OSU A;  1FSY A;  3BEC A;  4DDY A;  5EVL A;  1S6R A;  3UY6 A;  1ONG A;  1KE0 A;  4GD6 A;  4P6B A;  1GA0 A;  2H5S A;  3DTM A;  1KVL A;  3WRZ A;  3UPN A;  1YM1 A;  4R1G A;  2WGW B;  3W4Q A;  2J9P A;  4EWF A;  1JWP A;  3NC8 A;  1FQG A;  1ZKJ A;  4OH0 A;  5HAR A;  2CC1 A;  4EV4 A;  4LCM A;  3MZE A;  1I2W A;  4S2K A;  3S22 A;  5AQ7 A;  4S2L A;  5U47 A;  4YIN A;  2EFX A;  1TDL A;  1YLW A;  2QMI A;  5DF9 A;  1TDG A;  3ZGA B;  3WS2 A;  3ZNT A;  1KDS A;  3IH8 A;  2ZC5 B;  3N6I A;  4R0Q A;  1O7E A;  5A92 A;  4WZ5 C;  3NIA A;  3UE0 A;  3IXG A;  4WMC D;  3GMW A;  2ZC3 B;  5TR7 A;  2XDM A;  2I72 A;  1IYO A;  2Y91 A;  1MWS A;  1NJ4 A;  2IWC A;  3G32 A;  1KGG A;  4CJN A;  4NET A;  4D2O A;  4KG2 A;  4E6W A;  5HL1 A;  4BL2 A;  2B5R A;  3Q7Z A;  4PPR A;  5KSC A;  4JBF A;  3GR2 A;  1JWV A;  1PI5 A;  1KE3 A;  2Y2L A;  1NRF A;  1KGE A;  1AXB A;  4UHU A;  4ZAM A;  1QME A;  5GLB A;  3WS1 A;  4E3J A;  5HW3 A;  4X6T A;  4GB7 A;  4GDB A;  5TFQ A;  2JBF A;  4DE1 A;  1PWD A;  1PW8 A;  4M3K A;  1PZO A;  3JYI A;  1LLB A;  1N9B A;  5CER A;  4OQH A;  3GV9 A;  4S2P A;  1EWZ A;  1VM1 A;  4KQR A;  4S2N C;  3PBS A;  5F1F A;  5KSH A;  3N7W A;  3UE1 A;  2JCH A;  3MKF A;  1IEM A;  3IXB A;  1K54 A;  3VP1 A;  3M2K A;  5M18 A;  5CHU A;  2ZQD A;  3O3V A;  5EVI A;  1XGJ A;  4IVK A;  1WE4 A;  3C7V A;  3WWX A;  3LY3 A;  1L2S A;  4E3O A;  1PWC A;  4L0L A;  1ZG6 A;  2ZLY A;  3IWI A;  1K4E A;  4OON A;  3TG9 A;  3MBZ A;  1NZO A;  4EBP A;  4EQI A;  2Y59 A;  1W7F A;  1FCN A;  2Y2M A;  1YT4 A;  3G31 A;  4WMC A;  4E3L A;  3LCE A;  1YLT A;  1TVF A;  3IXH A;  3M6H A;  5GLD A;  2ZM2 A;  3W4P A;  5L2F A;  2G2W A;  4JPM A;  3SS3 A;  3G34 A;  2R9W A;  5FQK A;  4C75 A;  5A93 A;  4FSF A;  5EEC A;  3HUO A;  4JF5 A;  2HP5 A;  4GDN A;  1K4F A;  3VOY A;  2Y2P A;  4JXG A;  2P74 A;  3OPH A;  4XXR A;  2J8Y A;  5DTT A;  2WYX A;  4LV3 A;  4WYY A;  1SDN A;  2PU2 A;  2BG1 A;  2WKI A;  3SOI A;  4DRT A;  2HP6 A;  2RL3 A;  5FDH A;  1N4O A;  3NDE A;  5EVI B;  4IED A;  3SH7 A;  1VQQ A;  4KZ7 A;  2H0Y A;  1PW1 A;  3Q7V A;  4R4S A;  1L0G A;  4XUX A;  3SH8 A;  4PM5 A;  5EE8 A;  4KG5 A;  3A3F A;  2X01 A;  4GOG A;  4ZJ2 A;  3ZG9 B;  2EX9 A;  2DRW A;  3IWO A;  4S2I A;  4UA6 A;  3HLC A;  3HL9 A;  3EQV A;  3ZG0 A;  3N8L A;  1XP4 A;  1YLP A;  3BFE A;  5GHX A;  5AQB A;  4WBG A;  2X02 A;  3MXR A;  2Y2H A;  2H0T A;  2WZX A;  2OLV A;  3EQU A;  4HBU A;  3UPO A;  3G30 A;  4LV2 A;  5EOE A;  4YFM A;  2WKH A;  1K6S A;  1CK3 A;  3OPP A;  2Y2Q A;  4KG6 A;  4S2M A;  1KDW A;  2Q9N A;  4S2N A;  4Z9Q A;  1Q2P A;  2XQZ A;  2JE5 A;  2H10 A;  2OV5 A;  1BLP A;  4BD1 A;  1RCJ A;  1K55 A;  1EI5 A;  3E2K A;  3FKW A;  2V2F F;  5M1A A;  2ZQA A;  5DF7 A;  4QY5 A;  1XX2 A;  5F82 A;  3ZCZ A;  1FOF A;  5E2G A;  1ESI A;  3BLS A;  1BUL A;  3I7J A;  3OZH A;  2HPB A;  3S1Y A;  2WAF A;  1JWZ A;  4ZJ3 A;  1W8Y A;  4KQO A;  3FKV A;  3G2Z A;  3OPL A;  3HLG A;  3CMZ A;  2Y2N A;  4Y0U A;  2IWB A;  3GSG A;  1ALQ A;  1GHP A;  1GCE A;  1YQS A;  3BEB A;  3ZNY A;  4U3T A;  3QNC A;  4R3B A;  5FI2 A;  3M6B A;  1L0E A;  2EX6 A;  4OPR A;  5FA7 A;  3RXX A;  1BLC A;  1XXM A;  4E6X A;  1ONH A;  1BTL A;  4MBK A;  2Y2O A;  5AQ9 A;  5F1G A;  3AGE A;  3MFD A;  3PBO A;  3IF6 A;  5FAO A;  5CGX A;  4GD8 A;  4JKT A;  1KVM A;  4N9L A;  3UO9 A;  5E43 A;  1KGF A;  4O7D A;  4X68 A;  4C3Q A;  1ES3 A;  3IHB A;  3P98 A;  3O86 A;  5DF8 A;  1K38 A;  4RX3 A;  3VOZ A;  3BFF A;  4BJP A;  1FR1 A;  4KZ3 A;  4RYE A;  4DE2 A;  5HFO A;  3A3J A;  2EX2 A;  2G2U A;  4LCL A;  4HEF A;  4N1X A;  3SS4 A;  2UWX A;  1H8Z A;  5FAS A;  4X56 A;  1NY0 A;  2XFT A;  2ZM0 A;  4N1H A;  2HDS A;  5GLC A;  4JXS A;  1ERM A;  4ZBE A;  4OOM A;  3V3S A;  3HVF A;  2WGI A;  3CJM A;  2FFY A;  5GHZ A;  4QJG A;  4XUZ A;  2EX8 A;  5GL9 A;  3ZHH A;  3Q07 A;  1PZP A;  2ZMA A;  1JTD A;  1K55 C;  4GN2 A;  1RGY A;  3OCN A;  3O88 A;  4JF6 A;  4B4X A;  2J7V A;  4DF6 A;  3ZFZ A;  1ES5 A;  1YMX A;  4KZB A;  5KMW A;  5JYP A;  3MKE A;  3WS5 A;  4FH2 A;  1MWT A;  1SCW A;  3IHA A;  1U60 A;  1PWG A;  4CPK A;  1YLZ A;  5CXW A;  3IXD A;  3IH9 A;  4OPZ A;  5EPH A;  1M6K A;  4OQI A;  4OKP A;  1W5D A;  2BLS A;  3NDG A;  3FV7 A;  5GHY A;  4DXB A;  3IQA A;  1G68 A;  4QY6 A;  1HZO A;  3HUM A;  4KQQ A;  4MBF A;  1Z6F A;  1YLJ A;  1DY6 A;  1IEL A;  1SHV A;  1BUE A;  2Y2K A;  4LV1 A;  5CTM A;  5FAQ A;  3WRT A;  4EUZ A;  4OP5 A;  1ZG4 A;  5GLA A;  3FYZ A;  1PI4 A;  4QHC A;  1FCO A;  1KE4 A;  2XR0 A;  1IKI A;  2C5W B;  3DWZ A;  4FD8 A;  3GVB A;  5J8X A;  3NY4 A;  4OOL A;  4LEN A;  3IWQ A;  3ZG5 A;  4PM7 A;  3AGF A;  3C5A A;  3IF6 C;  1LL9 A;  2R9X A;  3UE3 A;  2FFF B;  3VP4 A;  1J9M A;  1XPB A;  1MWR A;  2XEP A;  3VMA A;  1BLH A;  1E3U D;  1ZC2 A;  4GKU A;  1M40 A;  4Y0O A;  1E25 A;  1ES2 A;  2GDN A;  2ZQ8 A;  4OP8 A;  4P0M A;  4R4R A;  4C6Y A;  3G2Y A;  2J9O A;  1WYB A;  1YLY A;  3HRE A;  1PIO A;  1MKI A;  1ES4 A;  1H5X A;  4X69 A;  1HVB A;  1MPL A;  1ERO A;  3ZVW A;  1CI8 A;  4X55 A;  4PM6 A;  4S2J A;  4B4Z A;  3VFH A;  4E3I A;  3S4X A;  2EXA A;  5F83 A;  4LV0 A;  3UN7 A;  2ZQ9 A;  4MNR A;  2ZC4 B;  3C7U A;  5CED A;  3NCK A;  5BOH A;  5HAI A;  2XD5 A;  1LL5 A;  2WAE A;  5E2H A;  1GHI A;  4UAA A;  2HP9 A;  1NYY A;  1CEF A;  1S0W A;  4KZ6 A;  5FQQ A;  4RX2 A;  4F94 A;  1DJC A;  1Y54 A;  3HLF A;  2V1Z A;  3PAE A;  5G18 A;  1I5Q A;  5FQM A;  3BLM A;  2X71 A;  3BFC A;  1GHM A;  3ZDJ A;  3UNW A;  1IKG A;  1HTZ A;  3Q7V B;  3WS0 A;  4OQ0 A;  1QMF A;  2A49 A;  3A3D A;  4ZTK A;  1NZU A;  2EXB A;  4K0W A;  1CI9 A;  1XGI A;  4MEZ A;  4K91 A;  2WZZ A;  3ITB A;  5EOO A;  5FI7 A;  5JYO A;  5E2E A;  3PBT A;  1IYP A;  5DVA A;  1W8Q A;  1NXY A;  2PU4 A;  2WK0 A;  2VGJ A;  4PM8 A;  1E3U A;  3AGD A;  3RXW A;  4JXW A;  4K0X A;  1CEG A;  1YMS A;  2XLN A;  4WEJ A;  5HAP A;  1ESU A;  3VP3 A;  3A3I A;  5FSR A;  3UDX A;  3VSL A;  3OPR A;  1L0F A;  4MBH A;  3NI9 A;  5A91 A;  3GTC A;  4HES A;  2JC7 A;  3W4O A;  1JVJ A;  1E4D A;  1I2S A;  3CZD A;  3BYD A;  2DCF A;  2P9V A;  3CG5 A;  1IYQ A;  4BLM A;  1SKF A;  2Z2L B;  1BZA A;  3V39 A;  1NYM A;  3M2J A;  5M19 A;  4WEK A;  3UDF A;  3ZVT A;  5HX9 A;  1SDE A;  3HLB A;  5EVI D;  4OVD A;  4P85 A;  4GNU A;  2Z2M B;  4U0T A;  4WZ4 A;  2ZC6 B;  3LEZ A;  4JLF A;  2A3U A;  5FQI A;  4E3K A;  2RCX A;  1PYY A;  3C4O A;  4EBN A;  1K6R A;  2ZQ7 A;  2Y2J A;  3LY4 A;  5A90 A;  2XF3 A;  1MY8 A;  1LI9 A;  3VSK A;  4DDS A;  1K25 A;  4N9K A;  1H8Y A;  5D3O A;  4WEL A;  3V5M A;  3RJU A;  4JF4 A;  4OPY A;  3GRJ A;  4KZ5 A;  1XA1 A;  4UA7 A;  2Y2G A;  2OLU A;  2ZJ9 A;  4DE3 A;  4BQM A;  1W79 A;  4RA7 A;  3HLW A;  1DJB A;  3G35 A;  5CGW A;  1K57 C;  1MBL A;  2P9V B;  4E3M A;  4B88 A;  1LI0 A;  4ZDX A;  2PBY A;  4IBX A;  1FCM A;  2E8I A;  3PAG A;  4DXC A;  5CHJ A;  3HLD A;  4H8R A;  3C4P A;  3FZC A;  3HUN A;  2HDU A;  3IF6 B;  4PM9 A;  3VP0 A;  4EBL A;  1K56 D;  3PTE A;  2QZ6 A;  4U0X A;  5CEB A;  2WKE A;  1OME A;  4KZA A;  4NK3 A;  4R23 A;  4PMA A;  3HBR A;  5AQA A;  3BFG A;  3V50 A;  4OOY A;  3BRM A;  2ZM8 A;  4OPQ A;  4BEN A;  4JXV A;  1FR6 A;  1L0D A;  2V20 A;  3MZF A;  4Y7P A;  3ITA A;  3N8S A;  4S2O A;  4GZB A;  4KZ8 A;  5CHM A;  3N8R A;  4BD0 A;  3GQZ A;  3BFD A;  5CGS A;  2Y55 A;  1BSG A;  2WAD A;  1C3B A;  3IF5 A;  3PBR A;  5CEC A;  1LHY A;  5FI6 A;  3B3X A;  4QB8 A;  2HDR A;  5CRF A;  1WYC A;  1MWU A; 
#chains in the Genus database with same CATH topology
 2Y4A A;  1DJA A;  3MQO A;  3VFF A;  4KZ4 A;  3KO6 A;  3MQQ A;  3V3R A;  5FAP A;  3P09 A;  2QWS A;  2L1M A;  4HQA A;  4HH2 A;  2Z6C A;  2ZD8 A;  3K2N A;  3E4O A;  2O99 A;  5DTS A;  1D7E A;  3OCL A;  4I38 A;  3FWL A;  2G7U A;  4DE0 A;  1JTG A;  2A24 B;  2KLI A;  1G6A A;  1MXO A;  4FCF A;  2NUT C;  3PBQ A;  4EEU A;  5HZH A;  2GZA A;  5KZH A;  3PBN A;  4Y2F A;  2VKS A;  3Q82 A;  3Q1F A;  2VV6 A;  2Q9M A;  5I94 A;  3UPP A;  4FH4 A;  3B42 A;  5EVI C;  4X53 A;  1XA7 A;  2Y2I A;  1VEU A;  1VHM A;  2HDQ A;  1SKO B;  1TEM A;  2XRN A;  3ICY A;  2OSU A;  4DDY A;  4BBU A;  1ONG A;  1GA0 A;  3DTM A;  1H0M A;  1MKM A;  3D72 A;  1YM1 A;  2WGW B;  1JWP A;  1FQG A;  3E4P A;  5HAR A;  1NWZ A;  3MZE A;  1TD5 A;  5U47 A;  1TDL A;  3T1X A;  2FH5 A;  3ZNT A;  4WZ5 C;  1G28 A;  1TF1 A;  3E0Y A;  1P9W A;  4D2O A;  4KG2 A;  3LR5 A;  2VGL M;  2KOI A;  2B5R A;  3GR2 A;  4Y5F A;  1PI5 A;  2HJE A;  3WS1 A;  2W27 A;  4QWO A;  4GB7 A;  2W1R A;  2JBF A;  1PW8 A;  3VV4 A;  3JYI A;  1N9B A;  2PR5 A;  4OQH A;  3GV9 A;  4EXO A;  3JVV A;  4S2N C;  5F1F A;  3PBS A;  3N7W A;  2JCH A;  4GW9 A;  3VP1 A;  3GEC A;  4CLC E;  4IVK A;  1WE4 A;  2KDK A;  1PFL A;  1PWC A;  1CJF A;  3IWI A;  4Q0J A;  3G31 A;  1FCN A;  4E3L A;  5L09 A;  1YLT A;  1TVF A;  3IXH A;  2ZM2 A;  4LFU A;  4HI4 A;  2R9W A;  5FQK A;  2V1B A;  4FSF A;  1K4F A;  3VOY A;  1Z09 A;  4II7 A;  4MCW A;  1SDN A;  4DMZ A;  2RL3 A;  3KSG A;  1UWP X;  3NDE A;  4NXE A;  2PHY A;  2D02 A;  3SH7 A;  1VQQ A;  4KZ7 A;  2H0Y A;  3A0V A;  4HY8 A;  4XUX A;  3A3F A;  4JGQ A;  5HWW A;  4O8G A;  4UA6 A;  3HL9 A;  3EQV A;  3H9W A;  2WKR A;  5AQB A;  2Y2H A;  3UPO A;  4UQI M;  4I3J A;  4LV2 A;  1XJ6 A;  4KG6 A;  1KDW A;  2Q9N A;  4X1M A;  1Q2P A;  2JE5 A;  1BLP A;  4BD1 A;  2VV8 A;  3E2K A;  5L10 A;  4QY5 A;  1FOF A;  1ESI A;  3BLS A;  2HPB A;  3S1Y A;  4ZJ3 A;  1W8Y A;  4R38 A;  3FKV A;  3CMZ A;  2Y2N A;  2IWB A;  2EWW A;  1UGU A;  4H6J A;  3ZNY A;  4E6X A;  4CLC A;  5AQ9 A;  4GD8 A;  1OT9 A;  1KVM A;  3UO9 A;  1KGF A;  5I5L A;  1ES3 A;  3IHB A;  4NKP A;  5DFX A;  4DE2 A;  3BFF A;  4Q0H A;  4KZ3 A;  2OAQ 1;  4Y17 A;  3A3J A;  2EX2 A;  2G2U A;  2UWX A;  2HDS A;  3CJM A;  5GHZ A;  4I39 A;  1D06 A;  2ZMA A;  3PHY A;  1ES5 A;  1YMX A;  1G5U A;  3UB8 A;  4JGO A;  3IH9 A;  1F98 A;  1DP6 A;  1M6K A;  3VOL A;  1W5D A;  3NDG A;  4G3W A;  1G68 A;  4MBF A;  2HJ9 C;  1BUE A;  4LV1 A;  2P7J A;  5GLA A;  1FCO A;  1XJ3 A;  1YKD A;  1G6O A;  3NJA A;  3IS2 B;  3IWQ A;  3AGF A;  1GSV A;  1T1B A;  3IF6 C;  2W3F A;  4DJ3 A;  1BYW A;  1XPB A;  1E3U D;  1ZC2 A;  4Y0O A;  2ZQ8 A;  1PIO A;  1MKI A;  1ES4 A;  4X55 A;  3QP6 A;  3S4X A;  2QJ5 A;  2EXA A;  5F83 A;  3MS6 A;  2ZOH A;  1IOU A;  2XD5 A;  1GHI A;  4UAA A;  1CEF A;  1Y54 A;  4L9F A;  3PAE A;  4HP9 A;  3BLM A;  2VEA A;  2X71 A;  1GHM A;  2PRF A;  1YAX A;  5HDD A;  3A3D A;  1TS8 A;  1XGI A;  1S4R A;  5E2E A;  3PBT A;  1IYP A;  1W8Q A;  2PU4 A;  3RXW A;  4K0X A;  2XLN A;  4WEJ A;  1P9R A;  3UDX A;  1L0F A;  3GTC A;  3W4O A;  3CZD A;  2VK3 A;  3O5Y A;  5HDC A;  4LGW A;  1BZA A;  1ZHH B;  3LFV A;  3R4K A;  4WEK A;  3ZVT A;  5HX9 A;  3HLB A;  4U0T A;  4WZ4 A;  4JLF A;  3C4O A;  1K6R A;  3JVU A;  4X25 A;  5C5K A;  3V5M A;  1XA1 A;  2Y2G A;  2ZJ9 A;  4BQM A;  1W79 A;  3G35 A;  1MC0 A;  2P9V B;  4CLC B;  2E8I A;  4DXC A;  1ZTU A;  4ARZ A;  3HUN A;  2HDU A;  2Z6D A;  3PTE A;  4KZA A;  2K7S A;  1UWN X;  1XJ2 A;  3HBR A;  3BFG A;  1T18 A;  3LID A;  4OPQ A;  1T1C A;  3T4S A;  3MZF A;  3ITA A;  4KZ8 A;  5CHM A;  3BY8 A;  2A24 A;  2FZ0 A;  3PBR A;  4PAU A;  5FI6 A;  5CRF A;  1Y28 A;  2XH9 A;  4ETX A;  5EUA A;  1BT5 A;  2VGK A;  4KZ9 A;  1IFQ A;  3QHY A;  5FQJ A;  3TOI A;  3VE4 A;  2V8F A;  5FAT A;  4WZ5 A;  4OLG A;  3E2L A;  5TGF A;  5HSQ A;  2WUQ A;  1GA9 A;  2IWD A;  1ERQ A;  3IT9 A;  3BJN A;  2WGW A;  5IHV A;  1K57 A;  3N4I A;  3GDI A;  3ISG A;  2XD1 A;  4BL3 A;  1K54 C;  4MN6 A;  4ZJ1 A;  3ZG7 B;  4E3N A;  3LI9 A;  2IA2 A;  4HH3 A;  4A5R A;  2XGN A;  4P87 A;  3L9K A;  4EQ1 A;  3IX3 A;  1KE0 A;  2H5S A;  1KVL A;  3K3C A;  4R1G A;  2J9P A;  3NC8 A;  4EV4 A;  1I2W A;  2CMN A;  3T4K A;  5AQ7 A;  4MN5 A;  2QMI A;  4NXF A;  5DJT A;  3ZGA B;  3WS2 A;  3N6I A;  5A92 A;  3D9Y A;  3NIA A;  3IXG A;  2ZC3 B;  3H7W B;  3PR6 A;  1IYO A;  2IWC A;  3G32 A;  4CJN A;  1KGG A;  3A0R A;  4PPR A;  1S4S A;  2JHE A;  3NOT C;  5FL3 A;  1AXB A;  5GLB A;  2VX8 A;  4GDB A;  2W0N A;  5TFQ A;  1PWD A;  4M3K A;  1FIL A;  1N9O A;  1LLB A;  5CER A;  1ACF A;  4GCZ A;  1TS0 A;  3MKF A;  1IEM A;  5CHU A;  2ZQD A;  3SZT A;  4L0L A;  4PKY A;  1K4E A;  3MBZ A;  4EBP A;  3NUL A;  2Y59 A;  5L07 A;  4ARZ B;  5GLD A;  3W4P A;  4C75 A;  2Y2P A;  2ZL1 A;  5DTT A;  2WYX A;  4LV3 A;  4WYY A;  3RTY A;  4DRT A;  3G6O A;  5FDH A;  2JKR I;  3T4O A;  5EVI B;  4IED A;  2E8J A;  5L8M A;  1L0G A;  3ZQ5 A;  3E98 A;  1EW0 A;  3MF0 A;  4PM5 A;  4LRY C;  2X01 A;  3LIB A;  2K31 A;  3L7H A;  1OPX A;  4CLC D;  1YLP A;  3FG8 A;  5GHX A;  4WBG A;  2X02 A;  3EQU A;  4HBU A;  3OOV A;  3G30 A;  5TBM B;  3OPP A;  2Y2Q A;  1P0Z A;  4S2M A;  2XQZ A;  2YKF A;  1OTA A;  1EI5 A;  4WL9 A;  3FKW A;  4XT2 A;  2XSS A;  5LBR A;  4ESP A;  3S7O A;  4BBT A;  5F82 A;  3BQ8 A;  3OZH A;  1JWZ A;  3QP2 A;  3HLG A;  3T4J A;  1GHP A;  1GCE A;  1OTD A;  3FPV A;  4YWZ A;  4U3T A;  3QNC A;  5FI2 A;  1S1Z A;  3MR0 A;  5DKL A;  3RXX A;  3LI8 A;  1BLC A;  1XXM A;  2QJ7 A;  4FOF A;  2Y2O A;  3MFD A;  3IF6 A;  3KYZ A;  5CGX A;  3LIC A;  4WN5 A;  4X68 A;  4C3Q A;  4DN0 A;  2O9A A;  3O86 A;  5DF8 A;  4RX3 A;  3VOZ A;  4GS9 B;  4LCL A;  3T1Q B;  2DMW A;  4HEF A;  4N1X A;  5FAS A;  1H8Z A;  4PKY G;  4WF0 A;  2XFT A;  2ZM0 A;  5GLC A;  4ZBE A;  3U2A A;  4OOM A;  1TS7 A;  3HVF A;  3PXP A;  2FFY A;  3IS2 A;  4XUZ A;  4L9E A;  5GL9 A;  3P7N A;  3ZHH A;  1K55 C;  4GN2 A;  1RGY A;  2XA7 S;  3O88 A;  4FH2 A;  1MWT A;  1SCW A;  3IHA A;  1U60 A;  4CPK A;  2ZMF A;  3IBJ A;  5EPH A;  1LL8 A;  4OQI A;  2BLS A;  2L4R A;  3IQA A;  3HUM A;  1N9N A;  1SHV A;  4EUZ A;  2Y2K A;  5FAQ A;  2JKR M;  4QHC A;  3FPW A;  3DWZ A;  4FD8 A;  5J8X A;  4OOL A;  4LEN A;  2V0W A;  1F5M A;  2HV1 A;  2R9X A;  3UE3 A;  2LB5 A;  5K5B A;  2GDN A;  4C6Y A;  4PHT A;  2QHK A;  1OTI A;  2Q0O A;  1H5X A;  4X69 A;  1ERO A;  1CI8 A;  4S2J A;  3BQA A;  2VA0 A;  4MNR A;  1Y4O A;  2ZC4 B;  3C7U A;  3HCY A;  5CED A;  1S66 L;  5BOH A;  3S7Q A;  4DJ2 A;  2ZL1 B;  4Q0I A;  5E2H A;  2HP9 A;  2L0W A;  4RX2 A;  4F94 A;  5G18 A;  1IKG A;  3WS0 A;  2PR6 A;  4KUK A;  4GLQ A;  1QMF A;  1NRJ A;  2OWH A;  3TJZ C;  3LUQ A;  2EXB A;  1W63 M;  4MEZ A;  3CUE C;  2W3E A;  1OJ5 A;  5HD5 A;  5DVA A;  2WK0 A;  2HF6 A;  4G3K A;  3DTE A;  4E04 A;  1YMS A;  3VP3 A;  2W3G A;  3A3I A;  3OPR A;  5A91 A;  4MBH A;  1E4D A;  3BYD A;  2DCF A;  2P9V A;  1IYQ A;  2PAV P;  3E4Q A;  1T1A A;  2M1C A;  3M2J A;  5M19 A;  4XT2 B;  1W63 Q;  5EVI D;  4OVD A;  2ZC6 B;  4Y13 A;  2A3U A;  4EBN A;  1P97 A;  4I5S A;  1K25 A;  1H8Y A;  4JGP A;  3RJU A;  3UB5 P;  2OLU A;  1N9L A;  4RA7 A;  3HLW A;  3LR4 A;  1LI0 A;  4ZDX A;  1FCM A;  4H8R A;  3FZC A;  2JKT I;  3IF6 B;  3VP0 A;  1K0K A;  1OJG A;  5CEB A;  2QZ6 A;  2WKE A;  2V1A A;  3QP4 A;  2M7V A;  1OME A;  4NK3 A;  4WUJ A;  4R23 A;  5F69 A;  4OOY A;  1CQA A;  4NEE D;  2V20 A;  4Y7P A;  3N8S A;  1MZU A;  3NEC A;  1BSG A;  5CEC A;  3IF5 A;  3TRC A;  2KX6 A;  2GX5 A;  5FDS A;  1WYC A;  1BLS A;  4YOF A;  2H28 A;  4WM9 A;  3LYX A;  3WS4 A;  3MJQ A;  3A3E A;  2ZC7 A;  3DW0 A;  5CTN A;  5J3W A;  1Q2Q A;  3VE3 A;  4KEN B;  4OLD A;  3DWK A;  3G4P A;  4HJ6 A;  4UA9 A;  3O87 A;  1NLY A;  5AVE A;  4ID4 A;  4IBR A;  1L3L A;  4OQG A;  1VET B;  3NBL A;  4IVI A;  1H8M A;  3OC2 A;  1IYS A;  3V67 A;  4EER A;  4QU3 A;  4N92 A;  3F1P B;  3LO7 A;  1RP5 A;  3QNB A;  4Q8I A;  4O0P A;  3MZD A;  3MXS A;  4MLL A;  4RVA A;  3ZG8 B;  3H7W A;  2C6W B;  3CPT B;  1HD8 A;  4LPZ A;  5J4E A;  1FSY A;  1S6R A;  5EM1 A;  4R6L A;  4P6B A;  3WRZ A;  3UPN A;  3W4Q A;  1ZKJ A;  4OH0 A;  3UMD A;  2CC1 A;  4LCM A;  4S2K A;  4YIN A;  2EFX A;  1X0O A;  3QP1 A;  1KDS A;  1O7E A;  2OAP 1;  2WKQ A;  3HJK A;  3UE0 A;  3GMW A;  3MMH A;  2EWV A;  2I72 A;  3UB7 A;  2J3T D;  2Y91 A;  1NJ4 A;  2JKT M;  2VGL S;  3MXQ A;  4E6W A;  4BL2 A;  5KSC A;  4JBF A;  1JWV A;  2Y2L A;  1NRF A;  4UHU A;  4ZAM A;  3CLO A;  1D1J A;  1QME A;  2QKP A;  5HW3 A;  3BWL A;  4DE1 A;  1ODV A;  1PZO A;  1VM1 A;  5KSH A;  4KQR A;  4EEP A;  2VZW A;  4FUW A;  4EET B;  3EWK A;  3QP5 A;  3CHW P;  3M2K A;  2XA7 M;  3O3V A;  5EVI A;  1XGJ A;  2LB9 A;  3C7V A;  5IT5 A;  3LY3 A;  1L2S A;  2PBD P;  2ZLY A;  4KUO A;  2ACG A;  2XRO A;  4WMC A;  5HD3 A;  2AVX A;  1YT4 A;  3UB6 A;  1T19 A;  3LCE A;  4O01 A;  5L2F A;  4JPM A;  5A93 A;  5HPF A;  3IX8 A;  4JF5 A;  2VV7 A;  3JPU A;  4GDN A;  4RQ9 A;  3OPH A;  4XXR A;  4Z1W A;  2J8Y A;  5TBM A;  3KX0 X;  3NOP C;  1LT0 A;  4LLO B;  1F2K A;  1OT6 A;  4IUK A;  3Q7V A;  4R4S A;  3SH8 A;  2V8C A;  1TS6 A;  4GOG A;  4ZJ2 A;  3ZG9 B;  2EX9 A;  2DRW A;  3IWO A;  4S2I A;  3ZG0 A;  3H82 B;  3MXR A;  2H0T A;  2WZX A;  2OLV A;  4X1L A;  4YFM A;  2WKH A;  1K6S A;  1CK3 A;  4G3V A;  4M4X A;  4S2N A;  2H10 A;  1K55 A;  4P6Z S;  2V0U A;  5M1A A;  2ZQA A;  5DF7 A;  2ZOI A;  1XX2 A;  3F1N A;  5E2G A;  2Y8H A;  5DKK A;  5FEF A;  3I7J A;  3T4T A;  4GS9 A;  2WAF A;  5AVF A;  4KQO A;  3OPL A;  3GSG A;  1ALQ A;  4CQH A;  5A8B A;  1PRQ A;  4R3B A;  2NUP C;  2EX6 A;  3A0S A;  4OPR A;  4MDZ A;  1STZ A;  1ONH A;  4MBK A;  5IS1 A;  1J3W A;  4HOI A;  4BMW A;  4NXB A;  2B18 A;  3P98 A;  2UV0 E;  4BJP A;  1FR1 A;  5HFO A;  4X56 A;  4N1H A;  4JXS A;  2WGI A;  4QJG A;  1JTD A;  3S7N A;  4JF6 A;  5HPI A;  4B4X A;  2J7V A;  3R7W B;  3ZFZ A;  5JYP A;  2QYB A;  3MKE A;  3WS5 A;  1PWG A;  3KSI A;  4LRZ E;  3IXD A;  3UME A;  2B95 A;  2INW A;  4OKP A;  1SZV A;  1HZO A;  1Z6F A;  1YLJ A;  5HWT A;  1IEL A;  4I3A A;  1PI4 A;  1KE4 A;  1S67 L;  4HIA A;  4PM7 A;  3C5A A;  4L9G A;  1BLH A;  3IX4 A;  2PD7 A;  1M40 A;  4UEY A;  4JGR A;  1ES2 A;  3LGO A;  4R4R A;  3G2Y A;  2J9O A;  3HRE A;  4HJ3 A;  4PM6 A;  4WLA A;  4B4Z A;  3VFH A;  1V9Z A;  4E3I A;  4LV0 A;  3UN7 A;  1HLU P;  1F9I A;  3NCK A;  1LL5 A;  4KZ6 A;  5FQQ A;  1DJC A;  3HLF A;  5DFY A;  2OOL A;  1I5Q A;  3NOU C;  3ZDJ A;  4NG2 A;  3Q7V B;  3UNW A;  1YPR A;  4OQ0 A;  3T50 A;  3P01 A;  2A49 A;  4EES A;  4ZTK A;  1NZU A;  3KSH A;  1CI9 A;  3B47 A;  2WZZ A;  5EOO A;  5JYO A;  3RFB A;  4LRX C;  2W3H A;  4PM8 A;  1CEG A;  5FSR A;  4HES A;  2JC7 A;  4EU0 A;  4B93 A;  3CG5 A;  4BLM A;  1FIK A;  5IU1 A;  1LSV A;  1SDE A;  1V9Y A;  4GNU A;  5CX7 A;  5DJU A;  2W1T A;  2RCX A;  3F1N B;  1PNE A;  1PYY A;  2ZQ7 A;  3C38 A;  5A90 A;  2XF3 A;  1MY8 A;  4DDS A;  5TJJ A;  5D3O A;  4JF4 A;  4OPY A;  3GRJ A;  4KZ5 A;  5KIZ A;  4UA7 A;  3MSH A;  4DE3 A;  1DJB A;  1K57 C;  4HJ4 A;  1WA9 A;  3PAG A;  2D01 A;  3C4P A;  4EBL A;  5HWV A;  4PMA A;  2ZM8 A;  3DTI A;  4JXV A;  1FR6 A;  1L0D A;  4GZB A;  4MN7 A;  3N8R A;  3BFD A;  3W2Z A;  2Y55 A;  2WAD A;  1C3B A;  3B3X A;  4QB8 A;  2HDR A;  3CWF A;  5MC7 A;  4QD4 A;  3U4L P;  2ZMV A;  2MJ6 A;  3BY9 A;  4Y0T A;  5FQ9 A;  1VET A;  5DTK A;  3F1O B;  4IHQ A;  3HLE A;  2ZQC A;  2K2N A;  3UDI A;  1FSW A;  5F68 A;  5EVE A;  3BM6 A;  1O07 A;  3F1P A;  3KYE A;  2WGV A;  3SW1 A;  2DNS A;  3IBR A;  4DKI A;  4B9O A;  3EEA A;  1K56 A;  2PYR A;  2XK1 A;  3W8K A;  4HHD A;  3CPT A;  3SH9 A;  3CIT A;  3VP2 A;  4KQD A;  3D4F A;  2EFU A;  1XKZ A;  5HDS A;  3UB9 A;  3MQ0 A;  3SS5 A;  3TSG A;  5AJG A;  1GSX A;  4BWI A;  2QPN A;  5HAQ A;  3Q81 A;  1XJ4 A;  2XFS A;  2VJW A;  4R70 A;  4AFI A;  1AWI A;  1RGZ A;  4R3J A;  5E2F A;  3T4Q A;  4HBT A;  3BEC A;  5EVL A;  3T12 B;  4GHI A;  3UY6 A;  4P6Z M;  4GD6 A;  5G4Y A;  2J3T C;  2GNX A;  4EWF A;  3S22 A;  3NHQ A;  4S2L A;  1YLW A;  5DF9 A;  1TDG A;  3IH8 A;  4R0Q A;  2ZC5 B;  4WMC D;  3MFX A;  1VEU B;  5TR7 A;  2XDM A;  1OTE A;  1KOU A;  2P04 A;  1MWS A;  4NET A;  4YNR A;  2I9V A;  5HL1 A;  3Q7Z A;  4HP4 A;  1KE3 A;  3CAX A;  1KGE A;  2R78 A;  4GJ4 A;  4E3J A;  2JKG A;  1DP9 A;  4X6T A;  3LIE A;  1H3Q A;  4Y3I A;  2W1T B;  2BAS A;  3TE8 A;  4S2P A;  1EWZ A;  3D3O A;  3UE1 A;  3IXB A;  1LSW A;  1K54 A;  5M18 A;  3WWX A;  1JNU A;  3ZYT A;  4E3O A;  1ZG6 A;  2O9C A;  2P08 A;  4OON A;  3TG9 A;  1NZO A;  4EQI A;  4R3A A;  1W7F A;  2Y2M A;  5EM0 A;  2ZBB A;  4I3I A;  3M6H A;  3LR0 A;  2G2W A;  3SS3 A;  3G34 A;  4ETZ A;  5EEC A;  3HUO A;  3EGX C;  2HP5 A;  3H82 A;  3DBA A;  3KSF A;  4JXG A;  2P74 A;  1NLZ A;  2PU2 A;  2BG1 A;  2WKI A;  3SOI A;  2HP6 A;  4IJG A;  1N4O A;  5EV0 A;  2PDR A;  1A0K A;  1PW1 A;  2HGV A;  5EE8 A;  2YKH A;  3C2W A;  4KG5 A;  3DTK A;  1XFQ A;  3T4L A;  2Y79 A;  3FC7 A;  3HLC A;  5HL6 A;  3N8L A;  1XP4 A;  3BFE A;  4K08 A;  3UE6 A;  3HJI A;  5EOE A;  4Z9Q A;  2OV5 A;  3LR3 A;  1S1Y A;  1RCJ A;  3LIA A;  5G4Z A;  2V2F F;  3QP8 A;  3RH8 B;  1CF0 A;  3ZCZ A;  2VLG A;  1BUL A;  2PT7 A;  3G2Z A;  4Y0U A;  5F5Y A;  4F3L A;  1YQS A;  3BEB A;  3LEQ A;  4ZRR A;  4EW7 A;  3M6B A;  1L0E A;  5FA7 A;  3R7W A;  1BTL A;  3EGD C;  5F1G A;  3AGE A;  5FAO A;  3PBO A;  4JKT A;  4N9L A;  3LIF A;  4GHI B;  5E43 A;  4O7D A;  3T1S A;  4ME4 A;  3OLO A;  1K38 A;  4RYE A;  4FTX A;  2GJ3 A;  2O0Y A;  3SS4 A;  4EUV A;  1NY0 A;  1ERM A;  3V3S A;  4H6J B;  1YSQ A;  2EX8 A;  3Q07 A;  1PZP A;  5J7E A;  3OCN A;  2B02 A;  4DF6 A;  4KZB A;  5KMW A;  3C8C A;  3TW8 A;  1YLZ A;  5CXW A;  4OPZ A;  1OTB A;  3FV7 A;  5GHY A;  4DXB A;  4QY6 A;  4KQQ A;  5FEG A;  2A2L A;  1DY6 A;  3WRT A;  5CTM A;  4OP5 A;  1ZG4 A;  2PD8 A;  3FYZ A;  2W3D A;  2XR0 A;  1IKI A;  2C5W B;  3GVB A;  4CLC C;  3NY4 A;  4D60 A;  3ZG5 A;  2WKP A;  2O9B A;  1LL9 A;  2FFF B;  3VP4 A;  1J9M A;  1MWR A;  2XEP A;  3VMA A;  4GKU A;  1E25 A;  4OP8 A;  2BTF P;  4P0M A;  1WYB A;  1YLY A;  1HVB A;  1MPL A;  3ZVW A;  2EA9 A;  2ZQ9 A;  5HAI A;  3B33 A;  4UQI S;  2WAE A;  3OBF A;  2M7U A;  1SKO A;  1NYY A;  2HZ5 A;  2JN7 A;  1S0W A;  5F6A A;  1GSW A;  4NXG A;  2V1Z A;  5FQM A;  3BFC A;  2V9A A;  1HTZ A;  4Y15 A;  2OWJ A;  4K0W A;  4K91 A;  3ITB A;  5FI7 A;  2J3W A;  3ULF A;  1NXY A;  3EEH A;  3S7P A;  2VGJ A;  1DP8 A;  1E3U A;  3AGD A;  4JXW A;  5HAP A;  1ESU A;  3VSL A;  3NI9 A;  1JVJ A;  1I2S A;  1VB6 A;  1SKF A;  2Z2L B;  3V39 A;  1NYM A;  3UDF A;  2J80 A;  2JKF A;  3T1R A;  4P85 A;  2Z2M B;  1DRM A;  5FQI A;  4E3K A;  3LEZ A;  4MMN A;  4BBV A;  2Y2J A;  3LY4 A;  1LI9 A;  3VSK A;  3KYQ A;  4N9K A;  4WEL A;  3K3D A;  4F3L B;  4QPR A;  3EOI A;  5CGW A;  1YSP A;  1MBL A;  4E3M A;  4B88 A;  2PBY A;  4IBX A;  3CI6 A;  5CHJ A;  3HLD A;  4PM9 A;  3F1O A;  3DAV A;  1K56 D;  4IUH A;  4U0X A;  5EFW A;  3PYP A;  3C30 A;  5AQA A;  3V50 A;  4HNB A;  1LSX A;  3BRM A;  4BEN A;  1XFN A;  3CUE A;  4S2O A;  3BW6 A;  2PYP A;  4BD0 A;  3GQZ A;  5CGS A;  1LHY A;  1MWU A; 
#chains in the Genus database with same CATH homology
 1BLS A;  2Y4A A;  4QD4 A;  1DJA A;  3VFF A;  4Y0T A;  4KZ4 A;  4WM9 A;  5FQ9 A;  3V3R A;  5DTK A;  5FAP A;  3HLE A;  2XH9 A;  2ZQC A;  3WS4 A;  3P09 A;  3UDI A;  1FSW A;  5EUA A;  1BT5 A;  3A3E A;  3BM6 A;  2ZD8 A;  1O07 A;  2ZC7 A;  3DW0 A;  2VGK A;  2WGV A;  2DNS A;  4KZ9 A;  3QHY A;  5FQJ A;  5CTN A;  3TOI A;  4DKI A;  5DTS A;  3OCL A;  3FWL A;  1K56 A;  1Q2Q A;  4DE0 A;  2XK1 A;  1JTG A;  3W8K A;  5FAT A;  1G6A A;  4WZ5 A;  1MXO A;  4OLG A;  3E2L A;  5TGF A;  4KEN B;  4OLD A;  3SH9 A;  3DWK A;  3G4P A;  4FCF A;  3O87 A;  4UA9 A;  3VP2 A;  3PBQ A;  4ID4 A;  3D4F A;  4IBR A;  2EFU A;  2WUQ A;  1GA9 A;  2IWD A;  1ERQ A;  4OQG A;  1XKZ A;  3IT9 A;  5KZH A;  3PBN A;  2WGW A;  3NBL A;  5IHV A;  1K57 A;  4IVI A;  3N4I A;  3OC2 A;  1IYS A;  3ISG A;  3SS5 A;  3TSG A;  2XD1 A;  4BL3 A;  4QU3 A;  4N92 A;  2QPN A;  3LO7 A;  5HAQ A;  3Q81 A;  3Q82 A;  3Q1F A;  2XFS A;  1RP5 A;  1K54 C;  3QNB A;  4Q8I A;  2Q9M A;  5I94 A;  3UPP A;  4FH4 A;  5EVI C;  3MZD A;  4X53 A;  3MXS A;  4MLL A;  4RVA A;  1XA7 A;  4ZJ1 A;  2Y2I A;  3ZG7 B;  4E3N A;  1RGZ A;  3ZG8 B;  2C6W B;  4A5R A;  2XGN A;  4P87 A;  4R3J A;  2HDQ A;  1TEM A;  1HD8 A;  5E2F A;  4HBT A;  2OSU A;  1FSY A;  3BEC A;  4DDY A;  5EVL A;  1S6R A;  3UY6 A;  1ONG A;  1KE0 A;  4GD6 A;  4P6B A;  1GA0 A;  2H5S A;  3DTM A;  1KVL A;  3WRZ A;  3UPN A;  1YM1 A;  4R1G A;  2WGW B;  3W4Q A;  2J9P A;  4EWF A;  1JWP A;  3NC8 A;  1FQG A;  1ZKJ A;  4OH0 A;  5HAR A;  2CC1 A;  4EV4 A;  4LCM A;  3MZE A;  1I2W A;  4S2K A;  3S22 A;  5AQ7 A;  4S2L A;  5U47 A;  4YIN A;  2EFX A;  1TDL A;  1YLW A;  2QMI A;  5DF9 A;  1TDG A;  3ZGA B;  3WS2 A;  3ZNT A;  1KDS A;  3IH8 A;  2ZC5 B;  3N6I A;  4R0Q A;  1O7E A;  5A92 A;  4WZ5 C;  3NIA A;  3UE0 A;  3IXG A;  4WMC D;  3GMW A;  2ZC3 B;  5TR7 A;  2XDM A;  2I72 A;  1IYO A;  2Y91 A;  1MWS A;  1NJ4 A;  2IWC A;  3G32 A;  1KGG A;  4CJN A;  4NET A;  4D2O A;  4KG2 A;  4E6W A;  5HL1 A;  4BL2 A;  2B5R A;  3Q7Z A;  4PPR A;  5KSC A;  4JBF A;  3GR2 A;  1JWV A;  1PI5 A;  1KE3 A;  2Y2L A;  1NRF A;  1KGE A;  1AXB A;  4UHU A;  4ZAM A;  1QME A;  5GLB A;  3WS1 A;  4E3J A;  5HW3 A;  4X6T A;  4GB7 A;  4GDB A;  5TFQ A;  2JBF A;  4DE1 A;  1PWD A;  1PW8 A;  4M3K A;  1PZO A;  3JYI A;  1LLB A;  1N9B A;  5CER A;  4OQH A;  3GV9 A;  4S2P A;  1EWZ A;  1VM1 A;  4KQR A;  4S2N C;  3PBS A;  5F1F A;  5KSH A;  3N7W A;  3UE1 A;  2JCH A;  3MKF A;  1IEM A;  3IXB A;  1K54 A;  3VP1 A;  3M2K A;  5M18 A;  5CHU A;  2ZQD A;  3O3V A;  5EVI A;  1XGJ A;  4IVK A;  1WE4 A;  3C7V A;  3WWX A;  3LY3 A;  1L2S A;  4E3O A;  1PWC A;  4L0L A;  1ZG6 A;  2ZLY A;  3IWI A;  1K4E A;  4OON A;  3TG9 A;  3MBZ A;  1NZO A;  4EBP A;  4EQI A;  2Y59 A;  1W7F A;  1FCN A;  2Y2M A;  1YT4 A;  3G31 A;  4WMC A;  4E3L A;  3LCE A;  1YLT A;  1TVF A;  3IXH A;  3M6H A;  5GLD A;  2ZM2 A;  3W4P A;  5L2F A;  2G2W A;  4JPM A;  3SS3 A;  3G34 A;  2R9W A;  5FQK A;  4C75 A;  5A93 A;  4FSF A;  5EEC A;  3HUO A;  4JF5 A;  2HP5 A;  4GDN A;  1K4F A;  3VOY A;  2Y2P A;  4JXG A;  2P74 A;  3OPH A;  4XXR A;  2J8Y A;  5DTT A;  2WYX A;  4LV3 A;  4WYY A;  1SDN A;  2PU2 A;  2BG1 A;  2WKI A;  3SOI A;  4DRT A;  2HP6 A;  2RL3 A;  5FDH A;  1N4O A;  3NDE A;  5EVI B;  4IED A;  3SH7 A;  1VQQ A;  4KZ7 A;  2H0Y A;  1PW1 A;  3Q7V A;  4R4S A;  1L0G A;  4XUX A;  3SH8 A;  4PM5 A;  5EE8 A;  4KG5 A;  3A3F A;  2X01 A;  4GOG A;  4ZJ2 A;  3ZG9 B;  2EX9 A;  2DRW A;  3IWO A;  4S2I A;  4UA6 A;  3HLC A;  3HL9 A;  3EQV A;  3ZG0 A;  3N8L A;  1XP4 A;  1YLP A;  3BFE A;  5GHX A;  5AQB A;  4WBG A;  2X02 A;  3MXR A;  2Y2H A;  2H0T A;  2WZX A;  2OLV A;  3EQU A;  4HBU A;  3UPO A;  3G30 A;  4LV2 A;  5EOE A;  4YFM A;  2WKH A;  1K6S A;  1CK3 A;  3OPP A;  2Y2Q A;  4KG6 A;  4S2M A;  1KDW A;  2Q9N A;  4S2N A;  4Z9Q A;  1Q2P A;  2XQZ A;  2JE5 A;  2H10 A;  2OV5 A;  1BLP A;  4BD1 A;  1RCJ A;  1K55 A;  1EI5 A;  3E2K A;  3FKW A;  2V2F F;  5M1A A;  2ZQA A;  5DF7 A;  4QY5 A;  1XX2 A;  5F82 A;  3ZCZ A;  1FOF A;  5E2G A;  1ESI A;  3BLS A;  1BUL A;  3I7J A;  3OZH A;  2HPB A;  3S1Y A;  2WAF A;  1JWZ A;  4ZJ3 A;  1W8Y A;  4KQO A;  3FKV A;  3G2Z A;  3OPL A;  3HLG A;  3CMZ A;  2Y2N A;  4Y0U A;  2IWB A;  3GSG A;  1ALQ A;  1GHP A;  1GCE A;  1YQS A;  3BEB A;  3ZNY A;  4U3T A;  3QNC A;  4R3B A;  5FI2 A;  3M6B A;  1L0E A;  2EX6 A;  4OPR A;  5FA7 A;  3RXX A;  1BLC A;  1XXM A;  4E6X A;  1ONH A;  1BTL A;  4MBK A;  2Y2O A;  5AQ9 A;  5F1G A;  3AGE A;  3MFD A;  3PBO A;  3IF6 A;  5FAO A;  5CGX A;  4GD8 A;  4JKT A;  1KVM A;  4N9L A;  3UO9 A;  5E43 A;  1KGF A;  4O7D A;  4X68 A;  4C3Q A;  1ES3 A;  3IHB A;  3P98 A;  3O86 A;  5DF8 A;  1K38 A;  4RX3 A;  3VOZ A;  3BFF A;  4BJP A;  1FR1 A;  4KZ3 A;  4RYE A;  4DE2 A;  5HFO A;  3A3J A;  2EX2 A;  2G2U A;  4LCL A;  4HEF A;  4N1X A;  3SS4 A;  2UWX A;  1H8Z A;  5FAS A;  4X56 A;  1NY0 A;  2XFT A;  2ZM0 A;  4N1H A;  2HDS A;  5GLC A;  4JXS A;  1ERM A;  4ZBE A;  4OOM A;  3V3S A;  3HVF A;  2WGI A;  3CJM A;  2FFY A;  5GHZ A;  4QJG A;  4XUZ A;  2EX8 A;  5GL9 A;  3ZHH A;  3Q07 A;  1PZP A;  2ZMA A;  1JTD A;  1K55 C;  4GN2 A;  1RGY A;  3OCN A;  3O88 A;  4JF6 A;  4B4X A;  2J7V A;  4DF6 A;  3ZFZ A;  1ES5 A;  1YMX A;  4KZB A;  5KMW A;  5JYP A;  3MKE A;  3WS5 A;  4FH2 A;  1MWT A;  1SCW A;  3IHA A;  1U60 A;  1PWG A;  4CPK A;  1YLZ A;  5CXW A;  3IXD A;  3IH9 A;  4OPZ A;  5EPH A;  1M6K A;  4OQI A;  4OKP A;  1W5D A;  2BLS A;  3NDG A;  3FV7 A;  5GHY A;  4DXB A;  3IQA A;  1G68 A;  4QY6 A;  1HZO A;  3HUM A;  4KQQ A;  4MBF A;  1Z6F A;  1YLJ A;  1DY6 A;  1IEL A;  1SHV A;  1BUE A;  2Y2K A;  4LV1 A;  5CTM A;  5FAQ A;  3WRT A;  4EUZ A;  4OP5 A;  1ZG4 A;  5GLA A;  3FYZ A;  1PI4 A;  4QHC A;  1FCO A;  1KE4 A;  2XR0 A;  1IKI A;  2C5W B;  3DWZ A;  4FD8 A;  3GVB A;  5J8X A;  3NY4 A;  4OOL A;  4LEN A;  3IWQ A;  3ZG5 A;  4PM7 A;  3AGF A;  3C5A A;  3IF6 C;  1LL9 A;  2R9X A;  3UE3 A;  2FFF B;  3VP4 A;  1J9M A;  1XPB A;  1MWR A;  2XEP A;  3VMA A;  1BLH A;  1E3U D;  1ZC2 A;  4GKU A;  1M40 A;  4Y0O A;  1E25 A;  1ES2 A;  2GDN A;  2ZQ8 A;  4OP8 A;  4P0M A;  4R4R A;  4C6Y A;  3G2Y A;  2J9O A;  1WYB A;  1YLY A;  3HRE A;  1PIO A;  1MKI A;  1ES4 A;  1H5X A;  4X69 A;  1HVB A;  1MPL A;  1ERO A;  3ZVW A;  1CI8 A;  4X55 A;  4PM6 A;  4S2J A;  4B4Z A;  3VFH A;  4E3I A;  3S4X A;  2EXA A;  5F83 A;  4LV0 A;  3UN7 A;  2ZQ9 A;  4MNR A;  2ZC4 B;  3C7U A;  5CED A;  3NCK A;  5BOH A;  5HAI A;  2XD5 A;  1LL5 A;  2WAE A;  5E2H A;  1GHI A;  4UAA A;  2HP9 A;  1NYY A;  1CEF A;  1S0W A;  4KZ6 A;  5FQQ A;  4RX2 A;  4F94 A;  1DJC A;  1Y54 A;  3HLF A;  2V1Z A;  3PAE A;  5G18 A;  1I5Q A;  5FQM A;  3BLM A;  2X71 A;  3BFC A;  1GHM A;  3ZDJ A;  3UNW A;  1IKG A;  1HTZ A;  3Q7V B;  3WS0 A;  4OQ0 A;  1QMF A;  2A49 A;  3A3D A;  4ZTK A;  1NZU A;  2EXB A;  4K0W A;  1CI9 A;  1XGI A;  4MEZ A;  4K91 A;  2WZZ A;  3ITB A;  5EOO A;  5FI7 A;  5JYO A;  5E2E A;  3PBT A;  1IYP A;  5DVA A;  1W8Q A;  1NXY A;  2PU4 A;  2WK0 A;  2VGJ A;  4PM8 A;  1E3U A;  3AGD A;  3RXW A;  4JXW A;  4K0X A;  1CEG A;  1YMS A;  2XLN A;  4WEJ A;  5HAP A;  1ESU A;  3VP3 A;  3A3I A;  5FSR A;  3UDX A;  3VSL A;  3OPR A;  1L0F A;  4MBH A;  3NI9 A;  5A91 A;  3GTC A;  4HES A;  2JC7 A;  3W4O A;  1JVJ A;  1E4D A;  1I2S A;  3CZD A;  3BYD A;  2DCF A;  2P9V A;  3CG5 A;  1IYQ A;  4BLM A;  1SKF A;  2Z2L B;  1BZA A;  3V39 A;  1NYM A;  3M2J A;  5M19 A;  4WEK A;  3UDF A;  3ZVT A;  5HX9 A;  1SDE A;  3HLB A;  5EVI D;  4OVD A;  4P85 A;  4GNU A;  2Z2M B;  4U0T A;  4WZ4 A;  2ZC6 B;  3LEZ A;  4JLF A;  2A3U A;  5FQI A;  4E3K A;  2RCX A;  1PYY A;  3C4O A;  4EBN A;  1K6R A;  2ZQ7 A;  2Y2J A;  3LY4 A;  5A90 A;  2XF3 A;  1MY8 A;  1LI9 A;  3VSK A;  4DDS A;  1K25 A;  4N9K A;  1H8Y A;  5D3O A;  4WEL A;  3V5M A;  3RJU A;  4JF4 A;  4OPY A;  3GRJ A;  4KZ5 A;  1XA1 A;  4UA7 A;  2Y2G A;  2OLU A;  2ZJ9 A;  4DE3 A;  4BQM A;  1W79 A;  4RA7 A;  3HLW A;  1DJB A;  3G35 A;  5CGW A;  1K57 C;  1MBL A;  2P9V B;  4E3M A;  4B88 A;  1LI0 A;  4ZDX A;  2PBY A;  4IBX A;  1FCM A;  2E8I A;  3PAG A;  4DXC A;  5CHJ A;  3HLD A;  4H8R A;  3C4P A;  3FZC A;  3HUN A;  2HDU A;  3IF6 B;  4PM9 A;  3VP0 A;  4EBL A;  1K56 D;  3PTE A;  2QZ6 A;  4U0X A;  5CEB A;  2WKE A;  1OME A;  4KZA A;  4NK3 A;  4R23 A;  4PMA A;  3HBR A;  5AQA A;  3BFG A;  3V50 A;  4OOY A;  3BRM A;  2ZM8 A;  4OPQ A;  4BEN A;  4JXV A;  1FR6 A;  1L0D A;  2V20 A;  3MZF A;  4Y7P A;  3ITA A;  3N8S A;  4S2O A;  4GZB A;  4KZ8 A;  5CHM A;  3N8R A;  4BD0 A;  3GQZ A;  3BFD A;  5CGS A;  2Y55 A;  1BSG A;  2WAD A;  1C3B A;  3IF5 A;  3PBR A;  5CEC A;  1LHY A;  5FI6 A;  3B3X A;  4QB8 A;  2HDR A;  5CRF A;  1WYC A;  1MWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...