4ZJ9A

Small heat shock protein agsa from salmonella typhimurium: alpha crystallin domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
ATPAYDLQKRDANNYLLTVSVPGWKEEELEIETVGGNLNITGKHTEETVEDQTHWIYRGIRKADFQLSFSLPEHAKVNNAKLEQGLLLVEIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple oligomeric structures of a bacterial small heat shock protein
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Chaperone
molecule keywords Aggregation suppressing protein
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zj9A00
2WJ7A 3GUFA 5DS2A 2Y1YA 1X5MA 2MNWA 3QORB 3L1GA 3GLAA 3J07A 3EUDA 1RL1A 3IGFA 2CR0A 3Q9PA 4PCKA 4RZKA 2Y1ZA 4YE0A 4ELDA 4ZJ9A 1WGVA 3Q9QA 4JUSA 1EJFA 2BOLA 3QORA 2JKIS 4JUTA 1WH0A 2RH0A 2N0KA 3QORD 4YDZA 3QORC 3AACA 3L1EA 2O30A 4I88A 3W1ZA 3N3EA 2CG9X 5DS1A 2N3JA 4MJHA 1WFIA 4FEIA 2KMWA 4M5TA 3GT6A 1GMEA 4YL9A 4M5SA 2XCMC 4YLBA 3AABA 2KLRA 2K8QA 2Y22A 3VQLA 3L1FA 1SHSA 4PBDA 3VQMA 4YLCA 5LUMA 2WJ5A
chains in the Genus database with same CATH superfamily
4S2SB 5I6XB 4N2MA 3OAYK 1PD1A 1E4HA 5CJQH 3HC0A 3IFPA 1J0HA 2HT2C 4BHUI 3T0EA 5DC2A 2G0LA 1RZKL 4UOW0 5B21A 3PAUA 35C8H 4HEPA 3REWB 1KYFA 4N0FA 2XV6B 3CJJA 3FO1A 2X70B 3EFFA 1E28A 4RQQB 1O7DC 1FFOB 1I3GL 1TJIH 4G7VL 4G8IB 3ZRCC 2VABB 3K4DA 1LO4H 3M1BB 4O02A 2VLKB 2VO8A 3P02A 3U7YL 3APNA 5IQ9B 1MG3C 4IRSC 1NCAL 1S6NA 2R9HD 5IM7A 2OMYA 3UCQA 4J1UA 1YQVH 4YHNB 3CC1A 4PGBB 1BV8A 2MFNA 2WQVA 4XX1G 4YHMH 3RKDC 3X12A 3UH8A 5I15H 2JB5H 3JV5A 4BKLB 2FQFA 2ZUVA 3BP7B 4RA3A 2GY5A 5DUBB 2K3HA 4XC1L 1JNLL 4G8EA 1DQJB 1G9NL 1KY7A 4XP1H 1HOCB 4APQC 3SDXA 5EU7E 3QIWB 1JZ2A 4A38A 1RK1A 5F9JA 5SX4H 1VACA 4M1GH 5CN2A 3GC3A 4J3UA 3RGVA 5DTFA 5LO7A 4DP9X 3U36B 5G2NA 3CFBB 1JZIA 1A4KA 3C5JB 1NJ9B 3K6FA 1OOAA 1TKWB 3QDGA 3QO1B 2F5BL 4PCKA 3LKPB 5I1HL 4ZX5A 1WFOA 1YY8A 4J1UB 4YHNA 3DUUB 3TNNB 1HH6A 1JYWA 4KZDH 4PJ7A 3CXHK 3OAYH 4HSQA 4IBSA 2BP0A 3V4VB 2ADFL 3HE7D 1KLFA 1GPOL 2UY6A 3GK8H 4M9OA 1AMYA 2D0GA 2DEXX 2WZPD 2LV4A 4ZT1A 4YHYC 1DCLA 4NNYB 2OI9C 2QEJA 2B4CC 1NAKH 2FLMA 5GS1A 1Q72L 3VX1A 2AK1H 3H1ZA 4ANVA 5CINL 2Z1KA 1WAAA 4G6JH 4OGAC 5EU6A 5AAWA 2ZOKB 4GRWE 3WNKA 3BKJL 1DLHB 4WK4B 1QHQA 3WS6A 3VVWA 4UT6L 1F2QA 2VLJE 2WXOA 3BD5A 4PRNB 4PY8J 3RB7A 5LLIC 1A4KB 2Y1AA 4LP5A 4QRTA 4ZSOE 1S8DA 3N0PB 4IMKC 3VRJA 2B16A 3KPRA 3SY6A 1SHMA 4EIGB 4QHUA 4A63A 4KKLD 2P5WB 1GGBH 4FKHA 1RHHB 4AE0A 2CXKA 4HOMA 2NX5E 5I0VA 1U58B 2QSCH 5F9WB 1DYZA 1KLFB 3GSNH 3W9EA 3IVKB 1GW6A 1IC4L 2FX7L 3ABLB 3DECA 3B2DC 1N5YL 2Y9RT 5I1CL 3CZNA 4AV0A 4E42B 1A8ZA 1V5JA 1V8HA 1INDL 1JHTB 4RDQG 3X13A 3D2TA 4LIQE 4WO4C 5EIIB 4KKNA 1BZOA 1DBKL 5H94B 3FT2B 2C4XA 4BQ9A 1S7RA 4R7XA 1ZLUK 3LQZA 4K8RH 2VXTH 5TDOB 1A7PH 5B8CC 4QD2E 3C75A 2Z4QA 3LXBA 3ZE1E 5C6PB 1P7QB 2H45A 3MTXA 5CSBA 3BAJA 4MQ7B 4QAMB 5DS1A 2EVJA 1UYWL 1WAEA 1FVEB 4WJKB 3RI5F 1LXMA 5D2LF 3HJ0A 5IHZA 3FQUA 4G6AC 1G9MC 3ZVVA 5DLML 4U1GC 5CJ8A 1MCPH 2G4EA 4FTVE 4KKPA 3N91A 2NY2D 4A7GA 4WU7B 4UIKL 1OSPH 1N3NA 3T0EC 3E8UL 2HJFB 1OGAB 3GMMA 2GIXA 2CLRA 4NQSB 3WE1A 3ZHLA 1BM7A 5C0AA 5GHWL 3ALPA 3BEVB 1FNSH 3GLEA 4V1DA 4B5ZA 1YZZA 2ZNWA 1C16A 3HRZB 2V7HB 5AYUH 3SN6N 1JGLL 5C71A 3GWJA 5FA3A 4LLYB 5TE6L 3MRKA 4IIQB 4MWFA 1I4FB 1SQ2N 1BOYA 3RVUC 1DBMH 3IAPA 4NNXB 2YD7A 2OJZH 4BZ1L 2WINA 5ACLA 1O7SA 3SDAB 2DYSB 4CC1A 1Y1UA 1JL8A 1XGRB 4YFDB 5D1ZD 2Q8AH 3QEGH 1JP5A 4HJSA 3H9SE 1ZVNA 2H2SC 1R46A 1E9QA 2IG2H 3R0NA 5IHWA 4K23L 3STLA 1E27B 2H1XA 4FYTA 4HKBB 3O6KH 1CGVA 5MERB 5EBMB 5IB3B 4LOVA 1CLYH 4A66A 3ULVE 5KBPA 4NQEE 1UOVA 3RFZA 4ZFOA 2YBRA 4XNQA 2DLGA 1MAKA 4KITB 4Y5VA 3S37H 4UT7H 4AMXA 2F53B 1EEZA 1F4WL 5D2LA 4J5VA 3MBEA 3L3OC 1HHHB 4WWKB 5D9SA 2I9LB 3CZUB 3Q8EA 2V37A 1B90A 4OCSH 1IT9L 1NGYA 2ARWA 4HF5H 4D0BB 3LEYL 1KLGB 1OB1A 1DQDL 2PTTB 3NFNB 5J1SC 4GUQA 3O2WH 1H6TA 1HTYA 3VI4A 4QF1B 3UTPD 2YK1L 1KXQA 3RTQD 1WICA 2DF3A 2F58L 3VSVA 2J8UF 3OHXC 5HPOA 4LMQE 4KI1A 2ATKA 4Y2OA 2AEQH 3Q06A 1J8RA 4WO4B 5AW0B 43C9B 4PRHD 4HK0B 1KZQA 1QG3A 4UILL 1BFVL 3KH3A 4GFXA 1H3WM 1M05B 4QRSA 3CDYA 2EUVA 3KPNB 3NH7H 5IESH 5AOJA 2IAMA 4C8XA 4QCIA 3BAWA 4XP1L 4XCNA 4JHWH 3T4AB 4EOWL 3QWOA 5AKSA 2NY0C 1JHLL 1M1XA 4JN1L 2OW7A 3UG5A 2JCWA 2EYTB 3RJDA 3HMXA 3EYSL 1Q1PA 2DWSA 3Q2VA 2BW4A 3TJEL 4YHML 4PY7A 2CQVA 3WV0A 4JFEB 1MRDL 2J1ZA 2EAEA 3ZZSA 4K5NA 4TQHA 2IDTA 4L18A 3DV4B 4AYFB 5E56A 4Q9QH 3IDMA 3BQVA 1AC0A 1IM3D 5GS2D 3BZEA 5F44A 2PWGA 3M8OL 1J8KA 4ADJA 1XZWA 5TJWK 4X4YB 1NM4A 4QXUH 3RX9A 2C9AA 5IIEB 1K9TA 2Q1EA 5IQ7H 1YEHL 4MD4B 1F4YH 3PIQB 1R24B 1P0SE 1VERA 1JZ8A 4LRNH 1VEPA 3QIWC 3CHQA 3GF8A 3HJEA 1ADQA 2GTWB 2C34A 4OZFB 1RZ8B 4PWGA 2PPEA 5C0GB 5CAYB 4BE5A 2A6KB 4EQ3A 3C6SB 1OAUL 3GMOA 1JZEA 1DO6A 1FV1B 4W9IC 1FVDB 1MG2C 4C56B 2O5YH 1XGTB 4QTHB 3E8VA 2XQBH 5E8NA 5FO9B 1SEQL 1EV2E 2QPUA 3FHQA 3TFBA 4Z7OB 4PI2A 3MMEB 2JI3A 4EN3B 3LZNA 4XBPB 1WC7A 4PP2B 1E65A 3KYKH 5D1QD 1T2XA 1GRWA 3E7JA 4L1LA 4B3VA 1U3ZA 3T6ZA 3DHJA 1I85A 3PWPE 3SD2A 2QHLA 4LL9A 4D9LH 4JRYB 1KACB 2Q0ZX 4X7SL 4AQ8A 2Z31C 4B9FA 4ETQA 1T03H 3D52A 4GI9A 4KFZC 4B9CA 3WFEL 4NRXA 5KUMA 1S7TB 1OQOA 3QG7L 5FWQA 4AH2B 4WNQA 4WHYG 4XWOC 4G43A 3QCVL 2BCMA 4JHAH 3B8SA 3EUUA 5JHAA 1KPRB 4X9FA 3WIAA 2GK0B 2PR4H 2P8LA 4FRWA 4WWOA 1PLBA 1HQRA 3ZKMC 4JCLA 1G4MA 3AROA 1S3KH 3PWPB 1A65A 2ZUSA 3NFPA 4JO3H 4Q14A 4X4MA 4G6ML 4LCIL 2RTTA 4UNUA 4OFVA 4LLYA 4PGEB 5DI8B 2QKIC 1ZVHA 4ORGB 3JTTA 2J12B 3NABH 5I75B 4HC1L 4HUNB 4AYMC 32C2B 1I8MA 4AIEA 4RSYA 1KG0A 4PP1C 1A7RL 2Z9TA 2J6EA 3NMEA 2WXPA 1BAWA 1YUHB 1WHPA 4X99A 3EYQD 1RJLB 4FULA 4TXVB 2XBZA 4ZG1A 4X98B 4WF7A 3ZHNA 4P2RE 1ZA6A 1ML0A 4UINL 3LQMA 1QSEB 2IBZX 4JO4L 4K3DL 2W0FB 5JOPD 2D0HA 3G5YA 1NAMH 3SGDH 2K6WA 3O4LB 1UXMA 3WKNA 1E42A 4PJ5E 2E4FA 4P48A 4QKTA 1YEFH 2VIRB 5E03A 1QFUH 1CI5A 3D1MC 2ZX5A 5I1JH 2CLZB 3SDCD 5DJCA 3MNWA 2EH8L 3NFSH 3BP7A 1TPXC 3DYPA 1XIWA 4QNPE 3M6DA 4NM4H 1SPDA 1CTOA 3ULAB 4UQEA 2EDYA 4OFYD 2BNQA 1LO2H 3C12A 1TUPA 5I1IL 1M53A 3MACL 4XZUB 1KIRB 3PWUB 5IGXH 1NL0H 1T6BX 1BOGA 3DJTA 4J3OH 4MNQE 4OIIL 2PTVA 1YEJL 5F0PB 3RGVB 4UM8A 3WUZA 3ZHDA 2AKRB 4ZW8A 3TYFB 3VNZA 4YIQB 3S37L 3X14A 4MAYD 1U8PA 4WKZA 3DETC 4ZMTA 4LNRA 2ALAA 4M7JL 2IGFH 1VGEL 3BN9C 3DXAB 1J0IA 3IETB 2DH2A 2IH3A 1CS6A 1RIHH 4HH8A 4HA1A 5IBTH 3B2XA 2FX9H 3D2UD 3OKLA 1SDDA 1XX9C 2HX7A 3MV11 1S46A 4L8DB 2BY2A 3ETBJ 4FFWC 4D7PA 2G2PA 2VE6B 1RH8A 1MHEB 2ATPB 4PJBE 4N22A 1A5FL 3ILQC 2X4PA 5B1JC 4BQBA 5I17A 2V33A 3HA0A 1AR1B 1M6UA 4R4ND 4HIEB 4MB3A 1F1GA 2A0LC 5CLXA 1KF9B 5EB9A 5A3IC 3LIUA 1KB3A 3NJNA 4JCMA 3ZSSA 1SDYA 1CTMA 1KIUA 1RUPL 2QTVA 2Q7YB 5HBBA 1WBZA 2WVUA 1VRSA 1MAJA 5ETUA 4JQIL 3ZIYA 1MWAA 1ITCA 1OAXH 4Y16C 4PJIB 5IQMA 4W9KC 1LO5A 4MBOA 1AOZA 3U9WA 2TAAA 4DTGL 3PWJA 2P26A 4XPGL 4NO0A 1GYAA 2EDHA 4Y19A 4M5ZL 3QUGA 4XVJH 1ETA1 5AW7B 4Z7IA 1XH0A 5F6IC 1R3IL 5KBNC 4H88H 4FGMA 4LP8A 3Q6FB 3GSQB 3LNDA 2IANA 1N67A 3QIBD 1Z6JT 1LHZA 3KGSA 5DO2C 1T20B 5DWUL 5AVVB 5GGVH 1CFBA 3TN0D 3SJVD 5EF1A 1A7PL 1MJUH 3K6DA 4R7DA 1M9WA 4YEEA 2RBLA 5ANME 5DC0A 4MDIB 3FRPB 2XA8H 5FYJL 3U4AA 1A9EA 3GYRA 3C2AH 1FC2D 1S7QB 1P6WA 2X4SA 3QZLA 4FQLL 1CC3A 4IS6B 4PHZA 3HUJF 1IGTA 3TA4D 4OB5H 2B20A 5CGYD 4PJDB 3SYQA 7CGTA 1J8HB 1DDHA 2PWFA 4MJ6A 1KC5H 2FHBA 3W0WD 1N3NB 2Z91B 1TFPA 4IKLA 1KFAL 2GG1A 4Y4KC 1I1CA 3W11D 3HFML 1CDCA 3HZKA 4EDWH 1HDMB 3T0DA 5GRUL 4JY6A 3V4LA 3ZKXB 1PFCA 4CU7A 1MLCB 4NZ8A 2ZOLA 1S7WA 1T1WA 4ZS7H 3P0YL 1GJWA 1EO7A 2L7EA 2IQ9H 1A9EB 5KSAD 2DLTA 3I75B 2H32B 2GBVA 4Y9GA 5T8IA 3BVXA 3HZMB 3CMOH 1ZVSB 2M26A 2VL5B 2D7PA 2VXQL 4PWHA 4KTDH 1L9NA 3CN2A 2WXLA 1INQA 3T4YA 4M6OL 4YSQA 3O6LL 1MH5A 2G60L 5IWLA 3SPIA 1ADQH 5G4OA 3VWJD 4I87A 1PGRB 2BZDA 1IAMA 3QIUD 4ZFOB 1XXFC 4X9YA 3RL2B 3CIAA 3GSUA 4GS7B 1IGJA 1OARL 2IXQA 4UT9H 1Q9KB 2A4EA 4EN3D 2XG5B 2NCMA 4PJFE 4H20H 3VA2C 4XVUC 3TWYA 3UZQA 2ZP0T 1J9RA 3BWSA 5D1QB 2HFEB 3IFPB 4PJ9A 1TJGL 2ITCA 3O6ML 3UDWA 3V52H 1IZKA 5HDBB 2PLTA 1KBKA 1QUNB 1P1ZB 4E9VA 1W72A 5DJZB 4QOKD 2J57A 1IE4A 4OVUA 3D50A 4Y8DC 1HXYB 3IF1B 4CVZA 2NZ1A 2W9DL 3P0VL 4G8IA 5IFAL 1KGXA 2NR6C 5GRZA 2EO1A 2G3NA 1A7NH 1WGVA 5IHUH 4XNZC 1QNZH 1IFHL 1QW9A 5A2LH 5LBSL 1KTDB 3VSQA 4HCIA 2KQMA 9CGTA 3SOTA 3QC5X 2XWRA 1KCSH 2YGQA 5CNHA 3S36H 1EHKB 3MUGB 1K5NB 4Y2DB 2RGSA 4LKCA 1CG9A 2J56A 2PW2B 3MCG1 1MDAA 1IKOP 2B77A 1IEAA 3CZFB 1G7JB 1LVEA 2K0RA 5T1LA 2RMNA 5BVJA 4UTBH 3B9VA 4PLKC 5I19L 3SO3C 2NUPB 2EYRA 4BYHA 4BCYA 4JVPA 3SDXB 1IIIA 3GSWA 4IU2B 1MNNA 1CFQA 2C9XA 3EZJB 1CXKA 2ICWA 2Q20A 1TVBB 3V2AR 2Y2TA 3ENEA 4BK5A 3IF1A 2UVEA 4JGMA 1Y6KR 3ATDA 3RA7H 1CGSH 5HDQH 2E75C 2A4ZA 4JRLA 1R5VB 3OR7A 1UTDA 5D4IA 3RHWK 2EC8A 3R4DA 3L3JB 5K9OA 2K3TA 2WVSA 4XWGL 4U0RB 3OXRA 3QEQA 3N04A 4RGMC 3UYRL 4Y5YA 3V6FA 5JIQA 3DUUA 1UVQB 3AWFA 1MCEA 4RFNC 2G75A 3EO9L 3MODH 2E0PA 4LLMB 4X4KA 1PJ9A 2IFGA 1YEKL 1HIML 3OJDA 4L3AA 3ULVC 2CUHA 2VM4A 2E56A 5L4JA 3HBQA 3KMDA 2D31A 3UC2A 2APXA 5EU6B 5LUMA 4MCNA 2W81C 3CLFH 3DSFL 4GRMA 1GHFL 3GJEB 4FFYL 4M4PA 1MNUH 3CH1B 3KL5A 3HMXH 5BW7A 3ALWA 2OXHB 2NCEA 4HD5A 3BSHA 2B14A 4MJIB 4MKTA 5DRXB 3ZQ9A 4DGVL 1N7ML 3RVVD 1E4WH 3IDNA 2FWUA 3K0WA 4TVPE 5DS8B 4LARH 4OZIE 4M8VA 1MF2H 4P5MA 5FPIA 2WBXA 4E42A 3D9AH 1SMOA 1YLBB 2WKOA 3O3DA 1N19A 3LN4B 3P4NB 1AQHA 3QJHB 3K71A 2F19L 3DMMC 4DGVH 3OWRA 1GYUA 4F20A 2A6IA 3B2UD 3SHSA 4M5SA 3JWDL 5AAPA 3AITA 5FO8B 3L5JA 4G7SB 4UDTA 5IWLC 3WJLC 3BYYA 4GW1A 2OMUA 3DSFH 2APTA 4LCCA 3VI4F 3MV7E 1MI5D 4GO9A 4PTUB 5FUZL 3QDJD 5T5NG 1QFWI 3MRFB 4OZFG 1DE4A 4AZUA 5HHQB 3I02B 3HE6C 4WTZG 3EGSA 1KYDA 3VDCA 4AZ8B 1A4AA 2EZ0C 1BZ7B 3CSPA 1U6AH 4GKZB 4KV5F 3IDNB 5DS8A 4AITA 1RJLA 1HNFA 3QI9A 4KXBA 4W70A 4PJGE 1KGCE 4XN2A 5CFHA 5SV3A 1WIPA 3BSZA 3GMMB 3ECBA 4K94L 3GSNA 4IRJA 4NQVA 1QPXA 3QUXB 1MH5B 4H40A 2E6JA 3HG1B 3GSXA 5AOLA 5FKPA 2P5PA 3KPPB 1IEHA 4NN6B 1YNKH 2OQJA 2NX5A 4XI5C 1PSKL 1R1CA 4PVNA 4EZKA 1BA9A 3ZL2A 1D5BA 4B41A 2EVHA 3N85H 1JXJA 2EDTA 1WV7T 4WW2F 1QTYT 4QHNB 4KK9C 1R33A 2BVQB 1RJZA 2XN9B 2VSCA 2WLLA 4HULB 2HVJB 3K2UL 5F7DB 2IWGA 4YDKH 3KPRB 4ZMLA 1M2VB 3NACH 2CPUA 5BO1L 1J5OL 1F02I 1WYJA 5EZJB 3I6LD 4OU3A 3D85B 2X4NA 2FJGA 2W1NA 1F0LA 3S0PA 4RMQA 3L9EA 4GBXD 4L4TE 3ISWA 1FF5A 3CFTA 4NDMA 4OD3H 3JT2A 4BZ2H 4XVTL 4S1SL 4Z3TA 1YYML 3HEIB 3UBFA 1W16A 3MV9A 1T0MA 3IRPX 4N5EC 2YOCA 2EIZB 4JJ5A 1AGEB 4OI9A 1MCWW 3MRMA 4WKXA 5B7FA 4FQCH 2PXYD 3L1OL 2A9BA 2XYCA 1LP9B 2X4RB 1WWCA 3I6KB 3UJTL 5FYJE 5IK3A 2DS4A 2VR5A 2UYLB 3LNGA 3TBTB 2G3MA 4TQEH 2X53A 3H56A 3TCLA 5DDHB 5FCUL 3AG3B 4KKBC 4NUJA 5AUMB 2WSPA 1EZVX 2J5LC 1IC7H 4ODVL 1BYOA 5DGRA 1O0VA 1VFBB 2BRQA 4KGLA 5IJKC 3NCFB 3HHSB 2AQNA 4PIRF 1B2WH 3LRHA 1QWNA 3HR5A 5E2VH 4AQ1B 5KSBE 2Q7YA 1OARH 3CUPA 2JCCB 3E38A 1S7SB 4NQSA 4QKXB 1TJHH 2L4OA 3LRMA 3HNVH 1JFQL 1C7TA 1U4EA 5CBAA 3ARGB 4NLAA 3G3LA 4XPTL 3KCPA 1MFDL 4P5KA 4KK6C 3EFDH 5T3XD 5HHXH 5J6SA 3DA0A 1CUOA 4U6TA 2VXQH 4N20A 4IJ3B 1EZVY 2CK0H 2P7TA 4NQXB 5CR8A 3L2LA 2CO7B 5E4OA 5H35B 2ZX7A 3HC3H 4TNVK 3FFDA 1WWWX 1MFEL 4NKIH 1RURL 5ALBH 2M83A 3VA6A 3DMMA 5IB1B 2F5AH 5G55A 3CD4A 4LU5L 1LWRA 4PJ5A 3ZE0E 2Q3ZA 3VXUB 1E27A 4XBGA 3RURA 4NP4H 1Z5LA 2WBJD 4JGUA 4UB0L 1UXWB 1LK3H 2ZXGA 4E0RB 2DRUA 3NCMA 3BPCA 3Q05A 2X4SB 4ZO9A 2XTJE 4PGBA 4LSTL 3WO4B 1DN2A 2R69H 1DDHB 3SDAC 3ZMRA 2VDNB 1DL7L 2A5UA 3BWAA 2X2HA 4XH2B 5DFVD 2WZ5A 4KRLB 1EHNA 1NAMA 2YD4A 2FVNA 1ZV2A 1ZTXH 2MCPL 1TZGL 3GXFA 1FVDA 3IRCA 3TYGL 4YVNA 4HH9A 3ZDXF 4X0KB 3GHEH 4PVMA 3C2SA 5IG7B 3PJSB 3VAEA 2VRAA 5TTRA 3FUIA 3H42H 4Y89A 2EH7H 1MCLA 3MNZA 1CF8L 4DP0X 5HHQA 3MN8A 1UM4L 2X2YA 2R2BB 4RAUA 2PMZA 2C3VB 4N6RB 2DQGH 4TTDC 3FYEB 5F3HA 3NIGE 5LNEA 3PP4L 4HIIB 1FZJB 1U8OB 4KO5A 4MJID 3KGTA 3TURA 3QPXL 4TQEL 4Z3FA 3CN1A 1AYOA 5F89B 3ROOB 2Q87A 4B50A 1RZ7H 3WY1A 3P2BA 4J2XA 4H8WH 4ODSH 5AZUA 4JQIH 5HVHB 2JKXA 3BH9B 5KYXA 4GAGH 3QQ3A 3ZQWA 4K9EL 3TEWA 3L9RB 3CLEH 4KK8D 4NKMA 2WK2A 1NWOA 4U1HA 4ZNEA 4KGJA 4LSSH 3NVQA 1HQRB 1J1PH 3H8NA 4J3SA 2IBZY 4HXAH 4YGVB 2WIMA 4XN4A 5BRZA 6FABL 5JOFA 4YHZH 1CICB 1UZ6E 3L5XL 3CCHB 4NB7A 2BIPA 3BOVA 3OB8A 4LPCA 4K5LA 3MV9E 1RJCA 2XN9A 4U1KB 4NIKB 4JM0A 3I50L 4PQXA 5D71H 3V0HA 5EULV 4UQIM 1CD9B 2FRGP 3E2HC 1L7IL 1OD7A 2HG0A 5HDOA 4HZLA 5CN3A 2ID5A 2OA9A 2IGFL 1NDMB 2VDQL 3BXNB 2X6BA 1WHOA 4KJWD 1G6RL 4I3SH 3QS2A 5T1DH 1PG7W 3PV6A 4LEOA 3SEPA 5INDB 2Q7AA 2M8XA 4WEBL 3CDFA 2F1EA 2UUDH 4IYKA 5ICXA 3SDXE 3RE0A 1BQHB 4M62H 4N24A 4W9HC 3BAXA 2ODIA 4RGNE 4O4YL 1D7FA 4Z7QB 2X38A 3VNYA 1GW0A 2BVOA 1Q1JL 4XC3L 4S1QH 1K4DB 2YD5A 2HKHL 3LZOA 4N2CA 1Z66A 1GKOA 2ERJB 2J8UA 3B9KB 5DMKA 2QQQA 3U9UB 1BAFH 1Q90A 4UZSA 4FQXC 1ES0B 3EGXB 4Y7OC 4K3DH 3PP3H 2R2EA 5E6IA 2F68X 2OZ4H 2GT9A 4OM1L 3S8FB 3QH3A 4XO4A 5HGDA 1FFRA 4B9KC 4GMTH 2I9LA 3DARA 4XXDB 2IAMD 4JFHE 3MJ8A 3UPAA 5JW4Q 1S4IA 5D1ZI 1T66D 1CIDA 2NQCA 5JHLL 3G5ZA 1CU4H 3SE3A 5KSUB 2P80A 1T04B 4NIYE 2FYVA 1AQ8A 5EU7C 5HGAB 5F96L 4ZPVB 4Y1SA 2NZ9D 3MV8A 4YSSA 1ZEAL 4G6MH 5AL8A 2AEPH 4NFBA 3HMXL 1CFNB 4MA8L 4WTWA 3C5XA 3US1A 4FFYH 3RFZB 1XH1A 3U1SH 2V2XA 1QKZL 3IMBA 1JZJA 2IH1A 2F7IA 3MLXL 4P2QE 1MIEH 4OFQA 3WBDA 1SJVA 4K94C 3DOHA 4NT6A 3WU1A 1ZANH 3CFQA 1ZGLA 2W5PA 5CP7B 1IKNC 1R5IB 1F86A 5DJ2B 3CFMA 2G9HA 3KR3L 4OGXL 4W68A 4APQA 4DP7X 5F9OL 3S3BB 4HJIA 4C56E 3EOAB 1HCYA 2P42B 1I9IH 3RGVC 2Y24A 3KLSA 1AO7D 4N2BA 4NWTH 2SEBA 1BVNT 2XFGB 4U0QB 4Y4FD 1SDAB 1CXFA 3GO1L 4UNVA 3T3PB 2JLPA 3BUPA 5HJBA 5FR3A 1YN7A 5LXGH 5I1AA 2IANB 1CXEA 2KL6A 3LZRA 4WFHD 3LHPL 4LASH 5E70A 5EFIA 4C56D 4NQDD 1VEOA 5DYFA 3MBWA 5E5UB 3DIDA 5E1GA 5G5DB 3S9DB 4PRAB 2VABA 1ZOXA 3B5GA 3O3UN 3KBFA 4OLWH 4ZNCD 4N85A 1KYOJ 2P44B 1AKPA 4OKDA 1AQKH 5I19H 1KENH 3V4PL 2B0SH 3E0GA 3U2JA 3TIEB 2BY3A 5J1TC 4GKNB 3QEHA 4RBPH 4DPCX 5L4FA 3CZJA 4MD0B 3WNJA 1RK0A 4EVNB 5JZ7C 5IREA 1HEZA 4ISVB 3WS6C 1IFGA 3GDBA 4ZW6A 4Y9FA 1Y6NR 5D4HA 5BXFA 5IQ7L 4KH9A 1YYCA 1CWVA 5D5MF 1SVZA 1UATA 4G72B 4Q9CA 4QTHA 2EE3A 4BH7A 1WD9A 4FQPA 5TGBB 2VOTA 2Z35B 4HIEA 4DP4X 1P2CA 4Q9RH 2BNQE 1EGJL 3A6BL 1A1MA 3ASWA 5D7LE 4BFBD 3QQDB 4Y4HD 1A0QH 2ADGA 2VB5A 4WW1A 4U6XB 4AE1A 1IAIM 2WWNA 4XX1E 3T0EB 4XCFH 5T3ZE 2VXVL 2FJGB 1R3JA 5KTEL 2E7LC 3B5TA 1O9VA 1EHLL 5FM4A 4DGYL 3HI6L 4POUB 3RLSA 2UX7A 3QYNA 4RZCA 2QT6A 3C60C 2OZ4A 5I30H 1SM3H 1ZT7B 2FUQA 4LBAA 1KTLA 5FS5A 5TFSH 4A6YL 5KW9L 1WZ1H 4PJ8C 4YSEA 3MRMB 1SXSA 5DMGC 3RL2A 5B7EA 3BC9A 3TH3T 3ZE1F 3UTTA 1U3HC 2AEQL 3U6RA 4XBPA 1EVTC 3G6DL 1T2QL 1GOHA 5I1GL 2FEJA 4ONFL 4FP8L 5KVEE 5F7WC 3WHE0 4KQ0A 5D1XD 1XGPA 1FDLL 4M6OH 3N41B 3SDCA 4WHDA 1EMTH 2MCAA 1V7MH 4M03A 2AI0H 5JDSB 1KOAA 4FFZL 1QUNA 4KY2A 1RUMH 4JZOA 1ORQA 3MV7A 3SE3C 2NNAB 3U9PH 3ARED 1AD0B 5IW3A 4ABQA 2FO1A 3LQAL 3HR5B 3GI8H 3X1EA 7FABH 1ZT7A 3VWKA 1W0VB 1RZFL 4TTGA 4I3GA 4MDRA 2ZYRA 5SX5K 1E2WA 2GJ6D 4FXKB 3CVHA 1QR1B 1GIGL 1C1EH 3MUGA 2EO7A 1EAPB 1U3YA 1LTXA 3GZQA 3N5AA 2ZOUA 1A7QH 3ETSA 5B22A 1R9FA 3QAQA 3T77B 2BSSA 2DI9A 3T2PA 4R6UA 4W6YB 1BZQK 4HETA 3QUKB 1AKJA 4O58H 32C2A 4TNWK 3ZL4L 3SDCB 3N0AA 3UBXA 3D2UA 2HT4D 1ASPA 2A9NH 2DQEH 3G5ZB 2EADA 2VL5A 5DUJA 2VMEA 3NEXA 4ZODA 1RY7B 4JB9H 3LSOA 1J11A 3ASOB 3LZFH 3ZT7A 1DBBL 5GIRB 1X7SA 4F33A 1GVIA 2WLHA 5FYLE 1A4JB 4E0RA 2Q8BH 2XXGA 2YXWA 4L8BB 3RDJA 1IGIL 4HGMA 4N0FB 3O9WB 1QSFE 1FHNA 3G08A 4PJ7F 5EMYA 1WFTA 3OB0H 1QI3A 4Z7VB 4ZO8A 2DYPB 3T5WA 4CKVX 1FNEA 3QFDB 8FABA 2VUYA 4PRIA 2XNAA 1RU9H 1V05A 3PYCA 4G9FD 3HBGA 3IXTB 2GEQA 3A4EA 2BVPB 5HHMD 5DJDA 1AQDA 1DJYA 4QHLB 2ZWLT 4LSVL 1Z2KA 3J2PA 1EA9C 3FT4A 2Z7WA 4YK4B 1U8NB 3WEBA 1RPUA 1UXLA 2EKSA 3MGOB 1P7QA 4R96B 3N44F 2K78A 4FQIH 5DMYA 4TM9A 1SLXA 1F58H 3SJVA 4LSDA 1LWJA 2OL3L 4M5TA 1TU2B 1CDGA 2C3VA 4Q6IB 2PP8A 3VMPA 3UJIL 4WTXA 4L5FE 3ZY7A 4DIXA 5ICZA 3VFTB 1TO5A 1N5YH 3MREB 2QDWA 3NPZB 4YOKA 3K6SB 5AKVA 1UWXK 1KXTA 4KVNH 5I71B 5KTEH 4P5RA 4BCZA 5BZZA 1W80A 1QR4A 1Z9OA 4XMVA 4OJAA 4WI0A 1T1YA 2BSED 1T21A 4UDTB 1JUFA 2P8PA 3SKJL 5DFWH 3U0PA 1K5WA 2D9QB 2H2PC 4YC2C 1BP3B 2P47B 4HWZB 1IV8A 4NOFA 4GMSL 5L88H 2HLFD 2RR3A 5T1KB 2AEIT 1AGDA 2VNCA 1K3ZA 4DKAA 1IC1A 3WFCL 1RZPA 2YR3A 4CADB 5JR1H 1PY4A 3VTAA 5CINH 3L3IA 4UMSA 5IMLB 1CICA 1QNIA 2AK1L 4W6XB 3ZDZE 2P46B 3U9PL 3WN5A 2XXMB 2BJML 2VYRE 1PG7L 5JYMA 1S7QA 4FFZH 4RFNB 4AEEA 3KBHE 3ZN6A 1GPOH 3QWOB 5EDSA 5E2UH 1EMTL 3QORD 3UO1H 4EZJA 1A6AA 4KZDL 3NFSL 3JWNC 4KO7A 4Y4FB 5CILL 4DW2H 2HVKB 4U4BA 2XWJB 4F2EA 4OLWL 2CJUL 1HAUA 3IS1X 4HWZA 3D4CA 4YBLC 5FIEA 4NUMA 3E6FB 4LEXL 2MOGA 4DN4L 4DKFH 4HMDA 2Y06L 4A6YH 1L0XA 3EJSA 1CFTB 2AEOA 2Y23A 3UO8B 5HD8D 1G9NC 5ICYA 3GO1H 1U8IB 5LGHL 3D18A 4NWTL 3VI4B 4XO8A 1PD6A 4V2BA 3UBXI 1XGYL 5AVSB 4GO6B 3QJFB 3EW3B 3BZFB 1WFJA 3L81A 5J1AA 2FJHB 3NJFA 4ZSOA 1AGCB 1TZIA 4P46D 4ECNA 4YO0B 4UQAA 1YQVL 3Q3GA 3FU9A 1IBBA 4BFOA 3SPVA 1AE6L 4FG6C 1S5HA 3A5VA 3WIIH 2IDQA 1XEUA 5I9QB 5C8JA 3GEWB 1D5ZA 1WEJH 3VXSD 4AT6B 4R90L 2ISDA 2PYEA 4YHIA 4P9HL 5K1JA 2DQJH 2Y3AA 4XCNB 2JFCA 4H26B 4GW1B 5BRPA 3AWGA 4JFPA 2H0EA 2YAEA 1JHKH 3FB6A 4PYHA 5IK3B 5K59F 2AEPL 5AW9B 4JDZB 1LP9A 2X4RA 5L0QC 2Y7OA 4JDVB 3KPQA 2OR8A 2H47C 4X7SH 1RIVH 4NSKB 4JFXA 4XAWL 4GAJL 5D7JC 5K9QG 4GQZA 4GRLD 2R2HB 1LE5B 2XKNB 1NPUA 2B59B 2WINB 2BOCA 4D9LL 2H41A 1DQMH 3MV8B 5K59E 1JNHB 1AGCA 5ANHA 5BV7L 4QRPE 4JMXA 3QR0A 3MC0A 1H5BA 3OZ9H 4CBZA 4OFPA 2WO4A 4RQQA 3BSZL 4PJBB 4BDVA 4JY4A 3I85A 2OMWA 4PJAB 3T65A 4YNYA 3LEXB 4FZEL 4GSDH 5GSVB 4NQUA 3KYOA 4LL1A 3QDGB 2E7BA 4XTRC 3LVTA 5ITBH 1UM5L 3QZOA 2DQIL 3P40A 2OCFD 4APXA 1KIQA 1QLEH 3T0WA 4N8VA 2XPZA 4NLHA 4XOAA 5J8OA 2PUQT 3QFDA 4JS7A 5CUSL 1YEWA 1F3DH 1PKQA 2DAVA 3DX1A 4WW2C 4OV5A 4F3FA 2F8VA 2NUPA 4BKSC 1EXUB 1DQJA 2C9UA 1ULVA 4Z95H 5DQJB 4ZAKA 5DSCB 1WZLA 2E9IA 1EERB 1V3JA 1YO4A 2JJVA 4QF1A 3O81A 4WEBH 4ZX3A 4NPKA 5SX4I 5H4ZA 2RCSH 2WOYA 3G04B 5D2NC 5C07B 4EUPA 1BCIA 3QNZB 1DLHA 3CK0L 3VFVB 1LMIA 4JAMA 4NM8L 3HC4H 1AE6H 4GG6E 4B95C 2H3NB 2ZWZA 4U2ZA 2Y6SC 4EN2A 5KJRH 1G6VK 1KLUB 1NANI 5F96H 2Y7SA 3DK2A 1XMWA 3EDDA 2VIRA 3VCLA 2X2UA 2P5WA 4XH2A 4OAWB 5C1MB 1E2ZA 4PBXA 3F7PC 4AC4A 4AENA 1YY9D 4P23C 1UWEH 4YDLC 2X7LB 3MLRH 3PDGA 5MI0B 3UROR 2G4GA 5AW6B 3PWLB 4TNVF 5LGHH 1X44A 3W1ZA 5DVKA 3MR9B 3N43F 1KPRA 2A83B 3BDYH 3EADA 3FU7A 3Q6GL 2OP4L 4L4VE 5HDWA 4HH9B 1X5XA 1XD0A 3LIZH 5C0CB 4WV1A 3EJCA 5E2WL 1JPEA 4E41D 1MQ8A 3P2TA 4DN3L 2CO1A 2NSQA 3AQDA 3QQDA 2NYZA 2FT6A 1NBVL 4NXSA 4FCAA 2AMGA 5CILH 2XWTA 4R8WH 4B53A 2VLMD 3TZVC 2OYKA 4P5MB 1U42A 4PGZA 3VFPA 5KBKA 1EZLA 3TEYA 3QARA 1ZTMA 2F7PA 3GJFH 1ROWA 4DAGH 3X13B 4XB7A 1ECZA 5DJ6A 3CFDA 5DC4B 3I9AA 4Z7UF 2HG5B 1F4WH 4DGUA 3C6LB 1WAPA 3U0TA 4D0DA 4QO1B 3JZ7A 3ZGHA 3UZVB 1AJ7H 4K3HA 3WFCH 3DMMB 5IB1A 1BLIA 3KM2A 4XNBA 5JNYA 5F3FA 4RFEB 3E6FA 3ML8A 1A6UL 2FX8H 1MFBH 1UUNA 4OJCA 1EJ8A 2PF6A 1BQLL 1PBYA 4U1MB 1BF8A 1HKFA 4B5EA 1UOWA 4H4NA 5I76A 1GMIA 4KC3B 2IG2L 1KCVL 2XX1A 3QEGL 5JIPA 2Q8AL 5IOPB 5PCYA 3R19A 3V79C 3NCXA 3FJTA 3M7OA 5C0FA 3UTZB 4DQAA 5I66B 2RALA 1LLAA 4HXAL 3CFDB 4AG4H 4OCRL 1J1PL 5AALA 2DI8A 1EVUA 1ZK5A 2WD0A 5HYSG 1IB5A 1DBAL 3JV4A 4PBWD 1NFDB 3QB7C 1XF4A 1JTOA 2NT0A 2Y07L 1F2XK 4X8XA 1FO0B 4Y1AD 5IVZB 1TTBA 3O6FB 2O30A 1J5HA 5F9DC 1OOWA 3CX5J 1OSPL 4LU5H 4H8WL 4ODSL 3BLPX 1KN2H 1KGWA 4GKSB 5HJGA 2K9UA 3VD5A 5CEYA 3VXRB 1B88A 5MEND 5IB2B 1ET8A 1I1AD 1SEBA 3EFDL 2B5IC 1NUDA 3FC8A 4WSKA 2JJWA 1UM4H 2V3DA 4XXWC 1B9KA 5AOMA 3X3GH 3ZIMA 1GJIA 4MAZA 3C6LD 4F33B 5FGBC 3BVTA 1XSIA 3MLVH 2BW5A 1QSFB 3ZTNL 3VGFA 3LYRA 4MB5A 4BZ2A 1I7TA 1MCHA 2OQJB 2GJRA 5K1VA 5L2KD 4PJIF 1HCZA 1T0PB 1QLFA 5SWZD 4IOFD 2BC4A 4PJ9C 4M1CD 3FTWA 3OAZH 3MRRB 4ZBJA 1Z7JA 2Z93A 4OI8A 4OY9A 4HUXB 2TRYA 3ZO0A 4HHAA 4OZHE 2WW8A 2EDBA 2HVJA 4Y2DC 2DQEL 1V3LA 3DX8A 3KPMB 1XH3B 4GRWB 2AS5M 1LD9A 4WDIB 1BVKA 4F58L 1OPGH 2NQ3A 4XNZB 3VXUE 5E8DH 2G5BA 2X41A 4G7QB 4P23A 4ODTH 4PJFF 1O7VA 4F91B 5M94B 3UX9B 4XCCL 3HUJE 1YEDA 3OMAB 4XMWA 5GRVK 1MUJA 4OZIA 1C1EL 1HU8A 3ULUE 3SJVB 5F7AA 5HYQA 2JIXB 2QVTA 4FNRA 3VXUD 1UH2A 3WXWH 4JPKL 4RESB 5CZXD 5I74B 3ARQA 4ENZA 1A14L 1KGCD 4TVUA 3LQAH 7FABL 3O2DA 3DVNA 4D9RE 1RCYA 1FJ1B 4WFED 1RUML 2CZNA 3SDDD 1Q9WB 1NC4D 4FHBD 2IEPA 5IJBC 2AI0L 4F7EB 4DZ8A 2IPKB 3IBOA 4PLJD 1JYVA 2D8KA 5CBEA 3TTSA 3K46A 1RK7A 1ZA3B 3HVNA 1YN6B 4M8QB 3OKLB 1VB9A 5T5FL 3I3BA 4L8DA 5H37H 2YJQA 5ESVA 1I3VA 3HNVL 4CVXB 2FQEA 4FP8H 4ONFH 2XWBA 4IRZH 3QFGA 2BOBA 2FEEI 5AEAA 4BHUA 2FH6A 4JFOB 2H6UA 3VX0A 4IK6A 1JZDC 3QZWB 3ECUA 5IV2A 3B2VH 2WO2B 2ZUQB 1RPKA 3Q9QA 2GABA 2W60A 1A6TA 3FCBA 3EYFB 2P48B 2YA1A 1X5KA 3SPGA 4L8CB 1JNLH 1C9SA 2QVMA 4YFEA 1FG9C 1JPST 1WBZB 1E8XA 3LD8C 1QATA 4QDGA 3VB8A 4IGBB 4XXCC 1FBIH 3IJ7A 4LRIA 4LEEA 4YDJA 1TLMA 4HOXA 3BX7C 5MEOB 2VXSL 4L1BA 5C08A 4LLQB 1I3GH 4G7VH 4L9DA 4F9PC 3O0RH 5F7YC 2EDEA 3IJSB 3KJ4B 4BZ2L 4ODUB 3D18B 1IBHA 1NBZA 4PRNA 4P0DA 4P4KC 5FLUA 3ZDZB 4FKKA 4N6RA 1HL9A 1XSOA 3NACL 2BHUA 3IJHA 2WTOA 2XT1B 2XRAL 3KW8A 2WC7A 4P9HC 2VWEC 1XSKA 4QXGH 1R3JB 2FCBA 1NAMB 1PU0A 3CFCL 3WY3A 4AQAA 5H94A 4N0CD 3U1PA 1HKLL 2C1OA 1A8JH 3PU7A 4X6DF 3FB7A 3ZDYB 3V5HA 4H8PA 1WZMA 3TS8A 2BVEA 3P11H 4HUKB 4MA7H 2LTQC 4LLQA 4MJ5B 2VRKA 2ILLA 3K4ZA 1KTKE 1RMFH 4IKJA 4HJEA 2EC9U 4MMZB 1XR9B 3KPQB 4HKJA 4OLVH 3SE6A 1I9IL 3V0IA 3B3IB 4HIIA 3THML 1YMHB 4B0MB 2GAZA 4IRJC 5E6YA 3AG4B 4OGXH 3T08A 3WGUB 5ILTL 1Q4NX 5BS0E 5LDSA 4DCQB 1F6FB 4NZDA 3UTSD 3Q01A 3N1QC 5AZEL 1H6UA 4MSWB 4Z7UB 1ZWIA 1TVDA 3TIEA 2L04A 2C5DC 2HZHA 2DLIA 2OZNA 2DIEA 4R7VA 1T22B 3L5WB 4PS4H 3VWKB 5FFLA 1HZLA 4JY5L 2YD0A 1NGZA 3PGCA 3HRZA 4M3HA 3H4HA 2A38A 3WLWC 3CHOA 3GIZL 2ED7A 3QEQB 4PJEE 3SGJA 3MLZH 4GXUM 2PWEA 2QMKA 4WWKC 2BC4B 3SKMB 2YPLA 3LRSB 2HT2D 1D7BA 1G43A 1FC1A 1RULH 1P7KA 3N40F 1EPFA 3OKYA 4LARL 1E43A 1HCVA 3GTNA 4U3CA 1JRHL 1KJVB 5CGTA 3SO3B 4OLEA 3RU8L 5IB3A 3BP6B 4EUPH 3B9KA 3VQLA 5DMKB 3KLHD 1B0WA 4HKBA 2NTFB 4F57L 3LPGA 5FO2A 1HH9B 2R9HC 5T3XE 2C7UA 3MCYA 4B9ZA 2VQ4A 1QYGL 2PR9A 1JF6A 4WZ9A 5TF1H 3W2DH 3PWVB 2J72A 1TCRA 2PXYB 2GCYB 4KJQC 1YEKH 4JPQA 1D5BB 1KTDA 3KBEA 2HKHH 3C87A 4YE4H 4K7PH 3FU0A 1IFRA 4FA6A 3WKQA 3BPOC 3IN0A 3ULUD 5KAQG 1J18A 1NDTA 3B6SB 4XPAH 4APQD 3P30L 5E4AA 4UZGA 4EPSA 4HFWA 3UJJL 3KPSA 3DTXA 4FABH 3SDXF 1H15A 3VQMA 2ZUUA 2EKSB 1AGBB 1U91B 3MGOA 4PB0H 5F7MC 5GS0C 3QSKB 2HJLA 4PRPD 4ANXA 2X9XA 3F85A 3TGXA 1UD2A 4UV4H 5KSBF 2CXGA 4Z7NE 4D2NA 4IJTA 1T4WA 3QJTB 4B60A 1SLUA 3RA7L 4HK0A 5EU5B 4PI0A 1DEDA 5TE7H 3W0WE 1MFAL 3FUFA 4LLUB 4OFIA 3MRGB 4GG6B 3KPNA 3H2QA 1QBLH 2N56A 2R0WL 3IAQA 3LQAC 3K8KA 3R06B 2NSMA 4LIQH 3IJ8A 4QRRD 5F88B 5KYUB 3WHE1 2YEQA 1W8OA 1ZT1B 2YQBA 4NO0B 2C3GA 2DH3A 3V6FB 1L4IA 4IRJB 1DQVA 1ONQA 4XVSH 4OGAD 4YQXL 1P84K 4IGBA 1NCHA 2VQTA 3SKUD 1KB5H 1Z3GH 2UXGA 2PYFA 3JUZA 2PTUA 3GHBL 3LV3B 1AH1A 1XZ0B 4JG9A 5LAPA 1HAWA 4JG5A 3L3IB 2BIHA 4NI3A 4TULH 2FDBP 1WP6A 3DIFA 1G7HA 4F7MB 3EJYD 2X2IA 1WVZA 3AQXA 2N3JA 3VTMA 4GRWH 2ROYA 3P1VA 2A9AA 1RZ7L 1EGJA 3ZOAA 1KC5L 1UOLA 4W9LC 3QORB 1HI6B 2AV7A 3O6MH 3R8QA 4NC2B 2ZAGA 1FNEB 8FABB 2WSKA 3BGAA 2ICES 3D7PA 4J23A 3BMVA 3HFFA 3CPLB 5KN5A 1JMXA 3O3DB 3SQRA 3VFOB 3FQRA 4PSPA 3RZCB 3F7YB 4U1NA 2XV2A 2XLLA 3BVWA 3KHQA 1YYLH 2GBTA 2CJ3A 3FTXA 1L5GA 3MBWB 1G9MH 3DIFB 4HX1B 5DEZA 3ECWA 3UTTD 3FFCE 1MHCB 1BEYL 1NSNL 4IM8A 5DZOA 3EXLA 3VJ6B 1XR8B 5I8KL 5HHVH 3RWGA 2XVGA 5IW1A 1TSRA 3LXUX 1DVXA 2DQTL 2V2WB 5EU3A 4QT5A 1NFAA 4FL4B 4G6KL 2Y7QB 5EOCJ 5HYSB 5DA0B 4BD4A 1NPJA 1T0OA 1TQTA 2Q76B 3V5KA 4PJEA 1KN2L 1MWOA 4G3YH 3AREA 2XBTA 1E3ZA 4Q89A 3GSUB 4JFSA 1E6JH 3AY2A 4P2OC 5CWSA 3FU6A 3MLPA 3K8MA 4JKNA 4U1IB 1H3XA 4TVPD 3BRDA 3ARXA 3H9SD 1O6SB 1E2VA 3OB0K 4X0KA 5GRJL 4Z78A 3PDDA 3PJSA 5B1KA 1NCCH 3QFJB 5D1ZC 5D1XB 2LQRA 4FFVD 4ZTPH 3E6HA 4MQ7A 1X3DA 1P4BL 1TF4A 5E7FA 1XR8A 3ZUCA 4XPBL 1AP2B 4I1RA 2Z8SA 2QVIA 4PJGF 3WEAA 2GSGB 2FIRT 3MRNA 1GZQA 5TE4L 4CMMB 1B0GB 2ZXCA 2HMID 2F7OA 1H5BB 4FXKC 3GSWB 3PRZA 3SKOA 3WJMA 3RDTC 2JQMA 1QHOA 1IIKA 2EIBA 2WCPA 3A23A 5JQ6L 3P9WB 1OK0A 3GNMH 4AQZA 4Q56A 4JPVL 5FV2A 3TV3H 5KS9A 4BE6A 3KVPA 1L3WA 4FTVD 4HHWA 1FFNA 1FFTB 1T6WA 1F1AA 3CVHB 5BVPL 4Y9BA 2OTWA 4M00A 4L9LA 3V0VB 3KD4A 2CBOA 4GPVA 4S2SA 3I74A 3MRHA 2MQGA 7PCYA 1IM9D 5AZ2H 3ZKSD 1LDPH 5BRZB 5JOFB 5E2JA 4XPGH 3VE0A 2F8IA 5JDSA 2B5IB 1XGRA 3LXCA 4H8UA 4ZO6A 4IOIB 1GZQB 4CMMA 3QHZH 4YDMA 4E9WA 3PWNB 2AXHA 1LO0L 3AG1B 3TT1H 3VD7A 5I1DA 2HFGH 2CSPA 3NCJL 5E5MA 3TP4A 1YEFL 4ZSOB 1J48A 3B7TA 3B3BA 4TF4A 1QLRB 3VRIA 5E08L 3U25A 1LYQA 4HVBA 1I8UA 3QS3A 1UOKA 4FQJL 2YAPA 1QX1A 2BSRA 4CSSA 4IKNA 4NN7C 2XIDA 2LU3A 3CG8A 3LIZL 4OD3L 1FPTL 4J6RH 4YQXH 2CBQA 2QGBA 4TVPH 4KTEL 3MBEB 4OFKA 2A9CA 2OL3A 3DX9B 3MRIB 3CN0A 3CBKB 3UTSB 1QZNA 1XBRA 4OZGE 2FWOB 2BVPA 1ZD6A 3FO0H 4BEIA 3A6CH 3O8XD 1ZE3C 2P3YA 3JUYA 4PV8B 2NLJB 3KXFE 1ETB1 3W0WB 1RZJH 3BUYA 5KJRL 2BIOA 3FH7A 2P8MB 3ZK0A 2VR9A 1J5DA 2H3XC 4NEHB 4JDEA 4XNMB 3FN9A 3BWUF 4JO3L 3V0FA 3T3MB 3BD3A 1U92B 1OQXA 4K4KA 4JVUA 2X12A 4R4BA 4PJHB 3D05A 1NL0L 4HWEL 1A22B 4QWWD 4G1MA 5GS0L 2ARJA 1BZDA 3LPWA 2D7QA 4JZJB 3BPLC 4PMEA 3WFEH 3JWDC 4F7KA 4XPHL 3P30H 1OCOB 4TNEA 1U30A 5E9DB 4LHJB 5EZLA 3RUGF 1SBSH 2D2CC 3N1FC 5ILTH 1AXIB 2FWOA 4R4FL 1I9RH 3QORA 2JKTM 5BO0D 4M7KH 3GTVA 2IJ0C 2WB7A 1S9YB 4M4RB 4R2GB 4ALAL 4F3FB 1UD5A 4UQ3A 5ITBL 2EDDA 4JL2A 4KMTL 3HMWL 5C0AD 3RIAF 1UA6H 4QO1A 5FFOA 4MB1A 4NCC1 1JWUA 4JO4H 5DR5H 3STZB 2VW4A 3NIFE 2D7NA 2V7NB 3QYCA 1MLBB 4JVWA 4P2OA 1FQ9C 4UINH 4AEHH 5HVFB 5KSVB 2DL2A 1BIHA 1LEGA 1YG9A 3DROA 5DJYB 3RQ3A 5F3BB 2F19H 1OAUH 1A7RH 3TBWA 2UV3A 4AIZA 4I2XB 4NOBA 3RJOA 4JFZH 5IOPA 3ERXA 4GAJH 1N7MH 3P4OA 4LRNL 1JAEA 2HH0H 3GJFA 3FCSA 4P46A 3KGRA 1AZUA 1AHWA 2VKWA 4HOZA 4AYEC 5EEYA 4A04A 4TUJB 4F1SA 4PJEB 1E67A 5DUBA 4FA8A 1GHFH 2DQJL 1IM3A 1OXYA 4P4RB 4AW7A 2NX5B 3EHBB 2OV0A 3B9EA 5H37A 4AL8H 1KGYE 3VW3H 4ZUVA 2DEYX 4OD1L 5IVZA 3VB9A 4NN7B 5JIMA 1B4RA 4JUSA 4U6HB 2FL5B 4AYBA 3PXJA 2E7LA 4PP1D 2G3ZA 5DZ9A 1NMAH 3A0OA 2V8MA 4YGVA 3EO9H 3D39A 3MODL 1ZY9A 3EOBA 3GUTA 2VJXA 3VQ2C 4HDIA 1SF5A 2HTLC 4PCTA 1ETJA 1UA7A 2BSCA 3PGDA 2UVFA 4J3OF 5DA4A 1FI8C 2H8PB 3RY5A 4AGOA 2VT0A 2COQA 3HG0A 4OLVL 4UOZA 3M7FB 4L1SA 4ANUA 4BQ8A 1KY6A 1G0YR 1HEZB 1T7ZA 3EFOA 2O61A 3O3AB 1Y6MR 1YCSA 2VLJB 5EC1B 2YD8A 5EBLA 3AT0A 4DETA 5HDQL 4EI5A 2XDHA 4N1CA 3SDCC 2A2QT 2X44D 4PR5A 4ELKB 4H26A 3I84A 4LT7A 3DO3A 2VN4A 1CLVA 5D1QA 1MHHB 3ESOA 4Z7WE 4D8PB 1TQCB 2GB2A 4NXKA 1JS4A 1OALA 3FOMA 4N28A 3UO1L 1E5YA 4FEMA 1MHPL 2IPUK 3V10A 3BZDA 5BPPA 3B2MA 2H6OA 2KLTA 1HILB 1VFBA 3KVDD 5A6IA 2OMXB 2ZONA 1UURA 2YMTA 4AX3A 1X6LA 2NY0B 1M3IA 4FQHA 1XB3A 4WU5A 4PGCA 1JYNA 5ITFA 1HXYA 3F05A 1JXKA 4CVZB 3ZYZA 3Q8AA 4RMVA 3SB3A 2R69A 2AQPA 2N59A 4JPKH 2EDLA 1JZ4A 2BS71 5EBLB 1KEGH 3FT2A 3F7LA 4QTFA 2VXSH 2QZ5A 4NQCB 3P0VH 4TSBL 5CBAB 3L6FB 2QR0A 4ZOBA 3NQKA 3SY0A 1ACCA 4KKRA 4ODTL 2V9TA 1JTTA 2ZWYA 4POZC 2NY5L 5AYTA 1SVCP 2R2HA 3TO2B 2Y5QA 3GRBA 4S10A 2Z92A 4B9GA 3V52L 1FVEA 4KVNL 4PB9L 1PKQB 1SHXA 2ZT9C 1A21A 4WEMB 4JHWL 1DANU 3EDJA 4KNUA 3WTUA 5A3ID 4PJ5B 1DBML 3W39B 4WCYL 2NNXA 3PUUA 1SHWA 2K9FB 4K3JH 3OKNA 5SV4A 4CW1A 4P3WA 5FA4B 3ZU8A 1EO8L 4CILA 3LEXA 4Y16D 3ECVA 1BX2A 1OIOA 1BJ1H 5C09B 3VFUB 4RGND 5IQ9A 2Z65C 3KXFB 5IW6B 2CR0A 2EYTA 1T1ZA 1GC1L 1N70A 4IQHA 3UFIA 2KZBA 3AXIA 4ODHH 2X9YA 4FYRA 1DLFL 2BXZA 4ORZC 4PJBF 3BSGA 4LKXA 3T2LA 3QUYD 3MRLB 4NRZA 2LT9A 4FC3E 1T3FA 3KYMB 4OCSL 1I8KB 4CC4A 5ID0B 1G7MA 4HSCX 3FU7B 4PCYA 4ATTA 3OJDB 4FTVB 4TQ8A 2PCYA 2F8XC 5GRUH 3OKOB 4HPYH 4P23B 2FBRA 4TPRH 5I6NA 1HSAA 1MAML 3BE1L 3CHSA 5DTFB 3V6OE 4FNUA 3OXSA 3RY6C 1KFAH 4K5MA 1R24A 2ZXEB 2AMUA 5A40E 1AO7E 1DBKH 3HPLA 1T0NA 4G2AA 1NBZB 2YKLH 3G08B 5E8DL 1INDH 1ZSHA 3KL0A 4Z8FL 4PJ7B 4DOHB 4M7LT 4MNGA 1P6FA 5F7NC 5BRQA 4KUCD 4D0BA 1OSZA 1Z9SA 4NZUL 4OGYH 1PNCA 3NZ8A 4HCRH 1H6EA 3FT0A 5DD6A 1FG2B 5FYJH 4PW9A 5KBMA 3V5HB 3U46A 3B7RL 4YSAA 2A6JA 3TXAA 4A55A 4HLZG 3LY6A 4AQ1C 3JWNH 5GS2H 1AR1D 3CXHJ 1DCEA 4FFZA 4MMYB 1MJUL 2X89D 5F1OB 1KCRH 5FUOH 3WN5C 1OCCB 1BECA 3VM5A 2ITFA 3KAAA 2BOBB 3QRBA 4Y1AA 2OYPA 5L6YH 1NDGB 1BHGA 1CLZL 4A37A 3B3IA 2MPAL 2XG4A 2VDNH 3H3BC 4H88L 1IQDB 3RAJL 2DD8H 1J0KA 1KELL 1JMZA 4DCQA 2W80C 1N9PA 2EUWA 5FC9A 4AEIH 2AV1A 3D4GA 5E8EA 3HZYB 4NO0D 3GSRA 4XP9H 4BA8A 4Z77B 3DO7B 3EJQA 1J8HA 3CWGA 2DN7A 3DC0A 1I1AA 1QFHA 4S11A 2KHAA 5DF0A 1A4JA 2KC0A 1DSFL 2VITA 2CDEA 2VKXA 2F08A 5ABAA 4NAJA 3TU6A 4MAYA 4EN3C 4NQVB 1ZLWH 4LGPB 1J88A 3OG4B 4HS8L 4R2GD 1WCBA 4F9LA 4YHPA 1K2DB 1Y0LB 3TN0A 4AYDC 4ZMXA 4O00A 5ESAB 4GW4A 5KW9H 1ASOA 3SGKC 3MOQA 1ZS8A 2KKQA 1ADWA 5HGDB 4JRXB 1LQSR 2VDPB 2ZNXA 3Q6GH 4FZ8H 2PO6A 1SM3L 3KPTA 4XC1H 3F12A 1DQIA 1FGNH 3NZHL 1UWEL 3GIVB 3ML9A 4F2MB 4I1PA 2WLLB 5C6TL 2HN7B 5I8OL 3BP6A 3MCLH 2NR6D 4UI2A 5T33H 4XN9A 3RHWF 1JGVH 3RWIA 1R4XA 1WBXA 3WFHB 1C8QA 2XTSA 4G9DB 4UT6H 3RWEB 3STBA 1T4KA 1U8HB 3QDJB 2V5YA 2EIKB 3FL7A 4LDEB 2J43A 1QBML 1NC2A 4I85A 4PUBH 3O6FA 1X4ZA 4YHPB 4GO8A 2OMVB 5EUKB 5ESAA 1OANA 2YRPA 1TCRB 1M7DA 2GCYA 5EIIG 3MU3A 1GJUA 2WN2A 2WLIA 4CN4A 3OJMB 1XMEB 4Z95L 5E8PB 2YC1B 4PRDB 1C5DA 1PS3A 3QUZB 4FI6A 3KS0H 5DT1H 4UQ2B 3O2DL 5IB2A 5L4MA 1H5BC 1UGNA 2X0VA 1MRFH 2ROXA 3QJUB 3BUYB 2OK0L 5I1JL 1QLEL 2IPTL 1BFOA 5FYKD 1OLZA 3FTUA 2J4WH 3ZZQA 4KZCA 1Q0XH 2NRDA 5C0IA 5BS0D 2C9RA 2V2XB 1F8TH 4WUUA 2I07A 4IOSD 5E2WH 4M1GL 1EHXA 3BUQA 1MJ8L 5MEPA 1S78D 1J0JA 1D6EA 4EIZC 3T2NH 4AYSA 3DOSB 1G9NH 1HHJA 4HIHB 4MHHI 2P7TB 2WLKA 3ULVD 3FO9B 4U3SB 3NABL 1DEEB 1PVHA 4QRFA 3SD5A 4Q6IC 4XMPL 3A4FA 3A67H 3P3RA 4QOKA 4E9LA 4HQQH 3RWFA 2E86A 4MD5B 2VN7A 4NM8H 4K8RD 1KTJA 1YNLH 3OG6B 2YPKA 3P4LA 3RWDA 5IMMB 1Q38A 1KV3A 1CPUA 1HZKA 2F1BA 4AMKL 5FKAA 5ICYB 2XJKA 2HSIA 1CE6B 3RVVC 4YDLB 5JLZB 1AS8A 4N8UA 2W60B 1ZK9A 5IHBA 1XF3A 1WD8A 3D08A 5DLLA 3VDAA 4Z7OF 4G5AA 5DRZA 3A67L 3P69A 2FJHA 1NCIA 4D0CB 3P4OB 5DWPA 1N59B 3S8WA 5IVXF 3AMKA 3S37X 2ETWA 5ISZE 2BDNH 3VFWA 3ZDYE 1OTTC 3VWJA 2NQDA 5B3NA 2YKKA 4GMTL 1JPGB 3DK0A 5IJVB 3HAEH 3MUHL 2F7QA 2VAAB 2M1KA 3T2NL 5TGBA 4TYUA 4ES9A 1H0DA 4DKFL 4DN4H 2LW3A 5IB4A 3PL6A 2X6MA 5HJ3B 2O5YL 3FW6A 1T5WA 3FH8A 3N1GC 1TJXA 1Q0YH 5T3XL 4OVVA 3BP5A 5CSZA 2NXYB 4JFXB 5BV7H 3F3HA 4HK3N 1NOFA 5LN8A 4M7KL 2IH3B 4MJ6B 1OY3B 1FVCB 1XAUA 2JCCE 2PO6C 4LVHC 1VGKB 1EX0A 1GKEA 1RIVL 3ZJAA 2YUZA 2E5EA 4C4KO 3TIDA 1UXSA 2QPEB 1NCDL 4JZOB 3TTYA 3CZEA 1PNDA 2O61B 3V5KB 4C59B 5CCKH 5GS0H 5IFHH 1GZPB 3VGAB 4BXSV 3BD4A 1B4JL 1CZ8L 5F1IB 4P9HH 5C0BE 1QWUA 3VVVA 4RMSA 3VXOA 4OF0A 1XEDA 2YOAA 1C08A 1H3PL 5GJSL 3VM7A 2XZCH 2XN2A 3C6EA 4B6ZA 5HYIA 2Q5BA 5T3ZD 3GXPA 3FOLB 1BAGA 1KBPA 3O2VH 3V7MA 3ULVL 5JHLA 1NIBA 4ZOCA 3O6FC 5DJCB 5C0ND 1RZJL 1XQ4A 2Z34A 1A6PA 1TQWA 4LDOB 4HEPG 4LSQH 3EYSH 3MCLL 3ARUA 4OV5B 1EIBA 2YIHA 3KEHA 5CEXA 5KVDL 4YMPA 2YGNA 2BSBA 2D9CA 3GIVA 1BZ8A 4Z7UA 3DBXB 4OBRA 4MXQC 1HL5A 1NIEA 2E3VA 2E9BA 3QDME 4MZ2A 5LKNA 3VXMD 1IBGL 5EBMA 4KVCL 3L54A 4GP5B 4M6AA 2O26U 3MOBH 2XPYA 5CKAA 4KROD 1IGFH 5I6XC 2OMNA 3MOAH 1AHKA 1DVFB 3QEQD 4P2RD 3Q1SH 1UWXH 1P84J 3TT1L 5JHBA 4H25A 3WY2A 3QXVA 1XF2B 5F93C 2QFRA 4LPUA 3Q44A 4XXWA 4C4BA 4GINA 4Z76A 5L2KE 1HC1A 1W8EA 5IROC 5FGBA 1R34A 5I28A 3KWVA 4ICWA 1KBVA 3ARTA 4JX0A 1RJYA 3GMQA 3QI9D 1NLDH 2I60H 4IOIA 4NSKA 4C47A 8PAZA 5KEZA 2KT6A 1SGKA 1P5UB 3KBPA 4Z7VE 3VYOA 3OKNB 4KHTL 2BP3A 2X4NB 4N2FA 3S97C 3UTZA 5BJTA 2MPAH 3ZUNC 1VFUA 3RYMA 3SE9L 3H42L 5LNDA 3NZUA 4FHJA 2ZE0A 2MCG1 3OZLA 4QHMA 5BVPH 5JIHA 2H1PH 2FGZA 1K5NA 4Y2DA 5KVFE 1H8OA 4WFFD 5IHHA 1ZTXL 2VN6A 3H2PA 1IC0A 2IWFA 5F0MB 3CQPA 4UV7H 4K0OA 3JXAA 1PFOA 3F8UB 4FQ1L 3D0VB 4L37B 4ELMF 4ZTOH 3U2SB 4QRRA 1T89C 1BFSA 3D0LB 3CH8A 5C07E 2GUOA 3PABB 5HGAA 2F2HA 1D9KD 1FUNA 1OVZA 4O58L 1FYTE 3ZL4H 4ZUSA 4YPJA 3ESNA 3GFUA 2ZTBA 3NTCH 1KIRA 3S5LG 4B9PA 3SGEH 4GBXA 2COVD 5DSCA 5DQJA 4DUVA 3LMJL 4PRPB 1LK3L 4X7TA 5E00A 3IPEA 3OGCB 4TRPL 2QSQA 1C5BH 5FYJD 4M3JA 5JPNA 2CHXA 2DJSA 4K5PA 4DOHE 3DVGB 3E8UH 2PXYA 1CVRA 1Y18B 4MDJB 2IBGA 2IDSA 2WWKT 4LSVH 1KJMB 1T7YA 1PDKA 3IMVA 3N1PC 3R06A 4V1DE 2FQDA 5F7LB 1OTSC 3DDGA 4ENED 3UAFA 2XACC 3S4SB 1EO5A 4PJAF 4JZNA 4WEEA 4WI0B 5KG9B 4G5ZH 5D5MA 1TETL 2FNWA 3O11B 4JEGB 2HAZA 3MLUH 1FDLH 5E23A 3HVDA 5FECB 2O6FA 2R0ZH 5I8KH 1F5WA 2LVEA 4A7GF 4IMLB 2HFTA 1I9JL 1BXAA 3R18A 1NFDA 4ZOAA 5DJZA 1S7VA 4I0PB 4I77H 4LLVB 1G9ML 5C97A 1XZ0A 1AGFB 4WJ5B 4CADA 5DZPA 5K39B 3AS2A 2AEWA 3KPLA 1EEUA 2V4LA 5DRXA 5I73C 2YRZA 3L17A 2CLVA 1EFXD 4X7DC 2NW2A 4QAWA 4M56A 1QBAA 2VSKB 1FIGH 1ZT1A 4XMKL 1M7IB 3O4OC 4BFJA 1A25A 3ECQA 4MD0A 1EDYA 3BMWA 1HWHB 4XO3A 4KDVA 4KK8C 2VC2B 5AD0A 2NY6D 3VRLE 3TL5A 2V5MA 5E99H 1AI1H 4PLNC 5C70A 1WFMA 3LKRB 3BPNC 1I9EA 1LWHA 5FA3B 1CL7H 1VPOH 3CC5B 1P2CB 3L4VA 3GMPB 1HHGB 2YXVA 1MOEA 1UWYA 2D3LA 3U0TB 4D0DB 4JDEB 1INEH 4JFYA 1J86A 2MTAA 4XVTH 1Q72H 1QHPA 3RX8A 1VLXA 4NC0B 3FOLA 3I3EA 3BWUC 3ZE0F 3G9AB 1SXCA 3NJIA 1KBGH 3RWGB 4PGEA 1SQMA 3WEMA 2ENJA 1UKTA 2H0FA 3OF6D 2ADFH 4L23A 4RRPG 2X4TB 2IBBA 4BUGA 5EG6C 3HN5A 1KV7A 4LIQL 3TEXA 2VZOA 2P24A 3VI3E 3VD9A 1U58A 4HOWA 3UBHA 1CBJA 1MFAH 2IV9A 3AREB 3COOA 3NSJA 4OLZH 3LKRA 1SXNA 3RKPA 4EI5B 5J11C 1ZTXE 3MPCA 2YUXA 1XF5B 4FJZA 1OV8A 5JW4M 1YNTF 1MN4A 4NQDB 1QSEA 5TK2A 4UU9B 1SLWA 1YPZA 1X5GA 3VGHA 5T1MB 2ESVB 2BIIA 1XF4B 3BAIA 1FO0A 2BNRB 1VCBC 5IVOA 3SYAA 5CKGA 2AQRA 2OMZA 3MGTA 3H85A 4MJIA 3C9NB 3KEDA 5A6MA 1KPUA 2UY7B 4AMWA 4FQXD 4KH2A 1K6QL 5I8CB 1SXZA 3R1GH 2H7WA 4PGCB 3W2DL 4D9QD 4QJ3B 3DX7B 2BMKA 1M05A 1JXDA 1JWMB 1QFWM 3CZGA 4NBXB 4EUPB 1WG3A 5IY5B 2VN5A 4NWUH 5DD3L 4POYA 4O2FA 2Z1PA 4Z78B 4LLDA 4EIUA 5EC2A 2E6PA 2AJXL 4U3XA 3U79A 4BKTC 4DUWA 2BSSB 5HGGS 1JNJA 2QR0B 5BRZD 1DE4B 3BZ5A 1JRHH 2R1WB 1U9KA 5C0EB 5CJQL 2NW3B 4FOMA 1ET7A 5ENWA 1B0GA 4DERA 3V4PH 5EUOA 3BVDB 3NPSB 4HHAB 4YBQD 4CVWA 2WUBL 3U30C 4MAUH 2ICWJ 4MZ3A 4J28A 2GTZA 5D72H 4N0UA 3QI9B 1MY7A 3T0XA 5E5MB 3TBYB 3LCYA 3G04A 5E7BA 1CYGA 1MNUL 4IBZA 3T0AA 1EAQA 3F5WA 1XB8A 3O4LD 1S9VA 2F74A 3U7WH 25C8L 3EYVA 4P2RB 2DM4A 4OH2A 1KULA 1WFIA 2VL4A 2Q9OA 4MASA 4BIKA 1VIWA 5D2NB 3OJ2C 3LEVL 2F53A 2AJVH 2GTWA 3UIYA 3IJYA 5AKRA 5AZEH 2VM9A 1I9RL 1NFDE 1E7UA 2CBTA 3OGOE 5FOJA 1PDKB 3O4OB 1HJCA 1SBSL 4MQXD 4PJ6A 5E1IA 5FUCE 3U4BH 2PYEE 1G7MB 5ICUA 3V8CA 4DSYA 3MR9A 5KZCB 1MKFA 3IFNH 1BQUA 4XBGB 2FZ3A 3I3DA 4NZFA 4QY8B 5HYJE 2R56L 3S34L 1X5AA 4WHTB 1RZGA 1MCOL 4HBCL 2B9BA 2E47A 3K80A 5HHNA 2OCJA 2IALA 3NJVA 4GRWF 1ZXQA 1PQZB 2ZSWB 5E6ID 4ZO7A 2MEJB 3N6YA 2ZZUT 1E28B 4MA8H 4DZBA 2R27A 2BXYA 2QELA 3A3YB 1NCGA 1BVOA 3DVIA 3DWTA 2KBGA 4C55A 5D72L 5K9JH 3RTLA 2O6PA 4KX9A 1TU2A 2X0WA 3WNOA 4WGVB 1LE9A 2PN5A 1XH2A 2ZP8A 5JZ7D 2XN9D 4J3XA 4TOYH 3UC0L 2LAAA 4UTBL 1FO0L 4HLJA 1P5VA 2EEFA 2P80D 4LSUH 4AH2A 3D25A 4MCZA 5CM1A 4UAHA 3QJQB 5FDWA 1UZ6F 3L5XH 3N1MC 3GHPA 5F97E 3TZVB 4KTEH 2PW1A 1FZKB 3GEFA 1HXMA 4LSPH 1KCSL 3BYTA 3HW7A 4G8EB 3FSVA 4PWIA 3NZSA 3HHSA 1OTUC 4GLRH 4Y4HC 4Y88A 5I6LA 3L9BA 2ICEA 2FLRT 5EFIB 5IHUL 4BV1A 1GYCA 2Y2WA 3NK4A 3E80A 3GDCA 5GQBA 1RL1A 2ZYSA 3UG4A 1PKOA 1KCKA 3T8MA 2CRYA 5E08H 4ONGL 2W9DH 5TH2A 2HFGL 3BQUA 3DROB 4S1QL 1LO0H 5IIEA 4HGWB 5C7XL 3ROOA 2JQZA 4L5FL 2H32A 2YPVH 1NCOA 3QHFL 1RP9A 5E9DD 4XNXL 4JO1L 5IBLD 4CC0A 2KZWA 3IE4A 5ACMA 3MBXH 3QZPA 4PJ8D 5LB1A 4LDLB 1AO7A 1RZ8A 3RNKB 1CF1A 43CAB 3H6JA 4W9EC 4NKOB 4HPOL 1JWUB 3DYOA 5SWSB 3WE6B 1E5AA 4FJYA 1SFHA 1T5XB 3APFA 4P9ML 1QMUA 4NQDA 1U33A 5D7IF 3GNML 1FYTD 5KOMC 5JXED 4LSRH 1NEZG 4QRTB 5I5MA 3MMEA 1E9QB 3MUJA 4ZW7A 1EFXB 1E6OH 1XR9A 3FT3B 4HKJB 2ALWA 1BBDL 4XHJC 5FYLD 4QXVA 5H4YA 3ZO9A 1GTFA 3V6OC 5D7KE 5DHVA 3IU4L 4IIQC 3CMOL 4KXZH 2ATAA 1MREH 3FFCD 5EEWA 1UENA 3MV8D 1W72B 3NEEA 4DGWC 2CK2A 5GGUB 4XNUL 1BLNB 2Q3AA 3L7FB 5KBLA 2XKUA 4JR9H 1A64A 3MLSL 4LSSL 1NLBL 4UB0H 4LCWE 4WNQB 3LRGA 4GG6F 3OAUL 5EORH 3CLEL 1KDJA 1ZSDA 2CDFA 1UA3A 4NHCL 3PGCB 1AI1L 5F88A 4P3CL 4CRPA 2P28B 3PXLA 3CDCA 4QHNA 3QG6A 3ZDXB 2X09A 4NO2B 2K8QA 4Y5VC 3ZDWA 2CDGA 3HC3L 3WNIA 2B59A 2PW2A 4G42B 3VFSA 3Q2NA 3QZWG 1LEIB 1LE5A 2V2WA 3I6SA 3VD0A 1OF2B 2ZCHL 3GSOB 3TH2T 1NWPA 3JTSA 2H32H 2KYIA 2Q76A 1YUHA 4WTZA 3RVXD 2A9ML 3IBEA 5C09E 2DWTA 2WWKO 1CT8A 1KTBA 5IHLB 1JZGA 3L3OB 2FSEB 5J3HC 3UG3A 4YLBA 5E2VL 3SSGA 1DR9A 3G6AB 4MYWB 4D9QE 2OS7A 3UPRB 3LKNB 1DFXA 4XVJL 3IDXL 5D1XA 3PWVA 2NY4C 3O11A 1TEYA 5AUMA 5AB9A 1FNGB 3D87B 3T0ED 3VFSB 1KT2A 5BUGA 1TG8A 4ODWA 1EAOA 1PG7X 2J3SA 3CVBA 2JCCF 4U1NB 3S3PA 3WENA 3NA9H 1EXUA 3ZPDA 2AJYH 3SKOB 1EDHA 1V27A 2EP6A 3DGGA 4PMFA 1BG9A 4XOCA 3BZEB 3WY4A 1I7ZA 3KPLB 4ZFZA 3WL9A 2DMHA 4HGKC 1WTLA 1ZLWK 4NJAH 4LLWA 3IJSA 2FK9A 1J1XH 1W15A 3FF7A 3OL2A 5GSRA 4YHYB 4IBTA 3E9UA 5IW1B 3ZL1A 4BGDA 1NC2B 1BVZA 4NPJA 5I6KA 1CTNA 2H2SD 2IQAA 3ZZLA 3QXDB 1A2YB 2LU5A 1DVTA 1KLUA 3BQUC 2XWZA 5D6DA 3HNTL 1CXHA 3NFNA 1JK8B 3KPRE 1L0QA 5C2BH 3KNBA 1OP3H 3NCCB 1D3CA 3APCA 3QIWA 4Q2ZA 2A7BA 3CFKA 4N4YB 1X5FA 3CVCA 1NIAA 1K4DA 3WCYA 2EE9A 3SYPA 4P9MH 1G7LA 5ADPH 3RZCC 2H1PL 3LZLA 3OKOA 1MEXH 2R23B 4AVIA 2BZ7A 3FHAA 4H1LG 1WS8A 2VAJA 5GPRA 1RIUL 4NZRL 5F0LB 3FCGA 1NANH 4ZD3H 5F9WC 3ZKQD 1T5WB 3NJLA 3MJ9H 3POCA 4KHTH 5EF0A 1NTDA 3PS6A 1VZIA 3I6GA 5B3JF 3SCMC 4U4IA 1ZMYA 3RTQC 4YH6A 4PRID 2V9RA 3GXDA 4WFHE 5I1IH 3GRGA 3SYCA 5GGSB 2WZPA 4Q74A 2XQYA 5I5JA 1QACA 2BO0A 5IMKA 4JO5A 4JQXA 1CN4A 5I6PA 3TJHC 1I31A 4MS8C 1I85C 1L6XA 3BGFC 4R8WL 1RPQA 2C1OB 4WNJA 1MFNA 4FQCL 4RMRA 4Z7WA 1IC5L 2NY3D 4OZ4A 5BQ7B 4UU9A 5EO0A 5F1SA 5CJXA 1OGAD 2WVVB 1N2RB 5I18H 1BQHG 4HIXH 5DURD 1G7PB 4KVCH 3AGVA 3IGLA 2YEZB 3RWJB 1MCFA 1K8IA 3QZBA 1OL0A 4MMXB 2OP4H 3QRGH 5JNYB 1T5XA 3IN2A 5DD5L 3GZOA 5AOKA 1CFMA 2LTQB 4TUKH 4UQDA 5TE6H 5HHMB 5BO1H 4LSUL 4X8JB 1AHWC 4OD2A 3PNRB 4G9FB 1W6WA 3VTTA 1DANT 5AFAA 4FG6D 5GGTA 1E4WL 2XUWA 4KRPD 4QGYA 3U9UA 3UL4A 5EIIA 3ZTEA 3N85L 4W1TA 1WQVT 4NI6A 3IRZA 4ZUUA 2FNBA 4F8PA 3VD1A 3VWJB 5EHFA 1GL4B 1UACH 4YUEH 5I6MA 5J4MA 4DESA 4DKTA 4PW4A 1E5ZA 3UBXG 3TEZA 1FL6B 4Z0XB 3QCVH 1B4JH 4HYTB 4AJYV 3QPKA 4ZDHA 2GSIB 5DD1L 4LCUA 1UKSA 5KSBA 4RNRA 2DQFB 1SEBB 1KYAA 3TCLB 2VZ1A 2W92A 5FM5M 4TL5A 4F92B 5JPMA 1XIWC 4M5YH 4CSPA 4JFQB 1URLA 3GRWA 4KMQA 4IEFA 4U3HA 4ETQB 3LB6C 5KWYC 1YJDL 1GGUA 2QGEA 2XN1A 1O9ZA 5TDNA 3EYVB 2QQLL 4KJPD 2I5YH 4MNHA 4GW5A 3ZDZF 3QA3B 4ONHA 3SE4A 3U7WL 1JPSL 3T0BA 1ZRUA 3BW9B 5EZPA 3IDIA 1UQSA 1IGYB 2HRLA 4X5XA 1S7XA 1IBZA 3VGBA 5ECGA 1DVUA 2Z31D 2NDFA 4NPYB 5LQBH 3L4UA 1IGMH 3MRHB 4MHHG 4ZUSB 5BOPA 5G4NA 3VXPA 1ECYA 3BEWA 3MCKA 2OYMA 1MHEA 4H5SB 1OT4A 4CN1A 5D6DC 1J12A 1YHPA 2EYSB 1YEDB 1MCRA 1KYOK 2VR6A 1IMHC 1NCNA 4K71B 4XNDA 1TYEB 2AJXH 3CTTA 3BDXA 5B1JA 2V7NA 5CF3A 1SJMA 1MZZA 1ES0A 3EGXA 4N0RA 1I82A 4BM7A 1SJEA 1SOSA 2PYED 1A7NL 3WIIL 5BV7C 2QQNH 2ZUQC 4HQQL 2BVTA 1H9VA 3MXVH 4KZ0A 5EA0H 3WSQL 1RERA 2OCCB 2Y5TB 1FA4A 2AW2A 2DIJA 4JKPL 5JUEL 4GRLA 5AKTA 4JN1H 4QEGA 3ES6A 2ITDB 4AJVA 5CBEB 3WKPA 4JM2B 4KMLB 4Q4IA 1S7VB 3CFUA 2OXGB 4I0PA 4FQXB 4YWGH 5KN5B 4FXGB 4DVBB 5KANI 1XWVA 1TVHB 4TSAL 4KY1H 2HCZX 2MHAB 4KUCF 4JFWA 2ICWB 1MJ8H 4WU5B 3QZWA 1QSZA 3HI1A 3MO1B 4HJGB 5IV2B 1N12A 1KTRL 1MCDA 3EFFB 1G5GA 1CDYA 4BINA 1R3KA 2ADJA 2IAMB 2CJUH 3ETTA 2G2NA 4L8CA 4TN9A 1E8YA 5AB1A 1ODUA 1EAPA 5DUMH 1BWWA 3TBCA 1HI6A 4CC4C 5C0DB 3FU8A 3TOPA 1N0LA 4H2CA 1M7IA 2DQMA 4C4KT 2Z91A 1QWHA 4GXVL 1THCA 3QQ9C 4X6DA 4OR1A 3O2WL 3KPOA 5I8EA 4ZNEE 5CIPB 4N8CL 1IGCH 2FLBT 1ZAGA 3G6JB 3AS3A 1JPTH 3DETD 1MJJA 4DK6A 2Y36H 4ZX6A 4X5PA 4A2MA 1S9XB 1MW2A 2VXUH 3BN9D 3MSPA 4KJYB 1JPGA 4MJ4A 4F8QA 5AW1B 3VXSA 4ZZKA 1MLCA 5ALCH 4UT7L 3LSOB 5IMLA 4ICXA 5SWZB 4NKMB 1ED3B 3HZKB 3INUL 3GMPA 5DK2B 3E3QE 2CKBA 4K07A 5FA4A 4A67A 1RJZB 4PJHF 1TENA 3QFJA 2WXHA 3HZVA 3LS5H 5FB8B 4TUOB 5I1LA 5DRZB 4P2OB 2WANA 2QVKA 5IEKA 4I4WA 4F58H 5C6TH 1E3FA 1R5WB 5E5RB 4J3BA 3WIFB 4DEPB 4R4NC 2FTAA 1I3RB 2ZXQA 2A0LD 5HJDA 2FT8A 2CNYA 4PJXB 1VESA 2EXWC 1HSBB 3NA4A 3WTWA 3PWJB 4FXGC 4BZ1H 4DUXA 3AM8A 3P3YA 2EXSA 4Y1AE 5D7KD 2PWHA 2OL3H 3N43B 2H5UA 2O5ZL 4DF9A 4YN3A 4FQIL 4NQCA 2GC4C 1FNSL 4HV8A 1NFIB 2ZOKA 3WNPA 4E41A 1BPVA 3ARFD 1T20A 3S5LB 4UOJA 4LLVA 1AZBA 1D5MB 3SDDB 1ADQL 2EILB 1OEZW 4V11A 3B9AA 3N40P 5T1MA 4MMZA 3HPLB 1DVFD 1I1AC 1TETH 1EUUA 1VZGA 4H8VA 4JBSA 3WELA 2J8UE 1VGKA 3C6LC 1Q9LB 5J6HB 2QMJA 2FECI 3DX6B 4NRYA 2YMXL 4OKVA 1RU9L 4ZAKD 3WHXA 3A6OA 3NP3A 3QIBC 4H0IA 2CAKA 3EBAA 3UDWC 1MPAH 3O45B 2CO3A 5JOEA 2R1XB 1OAXL 3TN0C 3HB3C 3TA3B 2P45B 1VKXB 3GT6A 3AABA 2HKAA 1B6DA 4IEFB 5D70H 3EYOA 1ITBB 4X7FC 2Z3FA 4JFPB 1KGUA 1MRCL 4O5LL 1F6AB 2ENQA 5DVNA 5FKPB 3KCPB 1E4XL 5JIDA 2X10A 4XHQA 1L6ZA 4H8HA 3SDYL 2B7DT 2DM3A 3WKML 1IGYA 4JFYB 4NQXA 4PVLA 2WOBA 5A2JH 3BJ91 1IC4H 1E7VA 1ESOA 2VDLL 2A9NL 4ZW5A 4OZIF 4N0UB 1I3UA 3C2AL 3QDAA 4Y4KD 1FWXA 2RQ8A 4WRLA 4R96A 2CRIA 4FLHA 3LNEA 2DYRB 5ESQA 1PLGL 4FQHB 4ODXB 5C3TA 5L9DL 1P53A 2W0PA 5DWUH 1AJ7L 5HTSA 1FN4A 2X70A 3BKJH 4HPYL 3RWCA 3BRGC 3SDDC 2CBMA 3VI4E 5KBDA 4YDIH 3MRPB 4GSUA 5JA8B 1S7UA 1R3IH 4PLJC 4AVJA 2ZKYA 5AW2B 1IEBA 4LBEB 3HRPA 2ZG2A 4YSOA 4CNIA 2VR3A 2OL3B 3DX9A 3MRIA 5D7LB 5IGXL 4DAGL 3MRBA 2PETA 5KAQF 3OPZL 4OCXL 1ANUA 3KNBB 4H0GA 4KRPB 1YVLA 3H55A 2FGWH 5MENA 3VDBA 4L8SC 5F1KC 3TO4B 4A2GA 3ZMNA 4U7SA 4QIRA 4HFWB 4JMNA 2Q86B 3MNDA 3QUML 3DTXB 1QFUL 5IUCA 2KDGA 4EZLA 2IALB 3G6DH 5LAXA 1XGQB 3MI6A 3MZTA 3CH1A 5GZNC 1F1DA 4M6ML 5C0JA 1CD0A 4XVUD 4GRMB 4IHOA 1BQ5A 5EUOE 4JJOA 4OUUB 4K3JL 1IBGH 2QGDA 4WVRA 5L0QB 4L4TB 1OM9A 4FKEA 1TKWA 1KJ3L