4ZJ9A

Small heat shock protein agsa from salmonella typhimurium: alpha crystallin domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
ATPAYDLQKRDANNYLLTVSVPGWKEEELEIETVGGNLNITGKHTEETVEDQTHWIYRGIRKADFQLSFSLPEHAKVNNAKLEQGLLLVEIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aggregation suppressing protein
publication title Multiple oligomeric structures of a bacterial small heat shock protein
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Chaperone
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4zj9A00
3N3EA 3VQLA 2WJ5A 4RZKA 4I88A 2JKIS 2N0KA 5DS1A 3IGFA 4PCKA 4JUSA 5DS2A 3VQMA 3L1GA 1SHSA 3AABA 4MJHA 5LUMA 4YLCA 4ZJ9A 4YDZA 3W1ZA 2KLRA 1X5MA 4M5SA 1EJFA 3L1EA 3QORA 2CG9X 4FEIA 3J07A 3QORD 1RL1A 1GMEA 2KMWA 1WGVA 4M5TA 2N3JA 3EUDA 3Q9QA 2Y1ZA 3L1FA 2CR0A 4ELDA 4YLBA 2XCMC 3AACA 2RH0A 1WH0A 1WFIA 3GT6A 3QORC 4YE0A 2MNWA 2WJ7A 4JUTA 2BOLA 2O30A 2Y1YA 4YL9A 2K8QA 3GUFA 2Y22A 3Q9PA 3GLAA 3QORB 4PBDA
chains in the Genus database with same CATH superfamily
4XPGL 4Z1PA 1ROCA 3Q0HA 3BXNB 3ZY7A 2IPTH 1E4KC 1M6OB 2NZ9C 3U2SA 2EDKA 5CNHA 4XO9A 1KTLA 2OQJA 1Q0YH 1T2QL 2XWEA 4G1MA 1QBAA 2HVKB 4XGZB 1BX2B 4BZ1H 2V3DA 1AR1C 4KKLC 3HE6D 2G0LA 4DKTA 1A4KB 3SDYH 5B7MA 4G9DB 3TYFA 5C9JA 1Q94B 4Z7NE 2JJWA 3D07A 3VRJB 3LEYL 3V4VB 4IOSD 4OB5H 4XPHL 1S5IH 3EO0A 3ZBMA 4E9LA 2IALA 1W72B 1YMMB 2IG2H 4MDIB 2E9GA 1P84K 3CDGB 4IRZA 3K72B 5EMYA 5HYSG 1M2VB 1U8NB 2D2OA 1WD9A 3BESR 1KCVH 4EKJA 4GG6A 4BFBD 4PFEA 4GMTL 3D8MA 1EJOH 1FL3B 2HVJB 2Y25A 2AJVL 1A3LH 3S5YA 3KGUA 2BOBB 2FECL 1QBLL 3ULVE 3TJEL 4XNUH 4KWUA 2JH2A 2EKJA 4WO4B 3A6BH 1X4XA 2NOYA 3EO9H 5CR8A 1VEOA 3W2DH 2V2TA 3BUDA 1ZRUA 4Y88A 2WXJA 2YRPA 1DE4B 3QPQC 4M4RA 5EUKA 1YEGL 3UTPD 1LK2B 5I15H 1M05B 1PCSA 4BUHA 5I6MA 3ULVH 1NBZB 2AQ1A 2XN9E 2GTZA 4PJIB 2NW3A 1LXMA 1DBKL 4AYID 4K5NA 4MCYB 3L3HB 2FO8A 4J3OC 4FNLL 1ZIBA 4NOFA 2W0FA 3EOTH 5I71B 3BP5B 1AOZA 3E6FB 3X13A 1J1PH 3AG1B 3MLTB 1AMXA 1DL7L 1T7XA 3L9RB 5MERB 4CC1A 2DH2A 3QQNA 3ZL1A 1SOSA 1ZT1A 3MRQB 3MJ8B 4IK7A 2FWSA 2BY1A 1RP9A 2ADYA 4XTRC 1MWAA 4QUOA 2G5BB 5IF0A 2XWRA 1RIHL 4LRIC 1WZ1L 4RX4D 3QYMA 4WI6A 3HG1A 2AEPL 2IEPA 3NJXA 3MNVB 1ZCRA 4M43H 5BO0D 1U95A 2F7IA 4ZXBB 4QRRD 4C4BA 4PHXA 4L8SB 1B9KA 4EQ3A 4E42B 2D9QB 4PP2B 3QEQA 4Q14A 4KUCD 1DFBL 4JPKL 2EC8A 5KOMC 1N12A 3S5LB 1TQTA 2YUXA 3LNEA 4UNVA 3WE1A 3GGWB 4HIEB 2MNWA 1H15B 2G0KA 3KPOA 3QQ4A 4NWUL 2X4TA 3MNWA 4F8LA 2NXYC 3VSUA 3P2TA 5I19H 1KJVA 4FFTA 4H2CA 1TVDA 1GZPB 3WY3A 2HLAB 3V79C 3Q05A 2ZWZA 2DQ6A 4OGQC 1ET8A 3QFDB 4PCTA 1UQSA 4WK0B 5FECA 4NJ9L 2FJGA 2BCKA 3HJ0A 4ZO9A 4LPXA 4EVNB 3BKJL 1MKFA 4MA8L 2F6AA 4M1GL 3DXAD 3GMNB 3I9IA 1U8PB 2KL6A 3O8XC 1S7VA 5D4HA 4N2HA 2VZOA 2GUYA 4UT6A 1EZVX 3KBHE 4WCYH 5AAMA 1HINH 1MCCA 3CVBA 2WO4A 4OF7A 3I84A 3MFFA 3IKCA 4XP9L 4OCYH 2EDRA 4LCWE 3LIZA 1LGVA 3DX7A 3KXFB 5E99H 1LE9B 3MREA 5FA3B 4K94L 4N8PA 5CD3A 3TXAA 1MSPA 4JFWA 1CGYA 2FBRA 4LLVA 3VWKA 2VDPL 4KJQC 3QDGE 3O41B 5DO8A 3BKYL 1S7TB 2OR7A 3TH3T 2GY5A 2FZ3B 5IW1B 5J3HD 4A37A 2ADGA 3FT4A 4HS6B 4NUQA 2WYTA 4N85A 3PJSA 5AZ2H 1DJZA 1BBJA 1EIBA 4MMZB 2EKSA 4GXVH 4MRBA 5C97A 2DRUA 5IB3B 1QMUA 3D52A 4IDJL 1NAMB 4U1LA 4QWWD 1VKXA 4FQXA 2ZOLA 4WV1A 5HY9A 5BJTA 2JK5B 5E8DL 1PZDA 4J3OH 1G9ML 2ZKXA 4GYBA 2NYYD 2VLRE 4ODVH 4YDKH 1PY9A 2RALA 4KXZI 1ZVYA 5E6YA 1UGKA 3VFOA 1MI5B 3BPLB 1OAXL 3IGUA 1ETZA 3RFZB 1AC0A 1NGQH 4HCRA 1QNIA 3LN4A 4FLOA 5EC1A 4KXZH 3L4CA 3QNYB 4YDLB 5JZ7D 4GIAA 1D5XA 3BCFA 4U6VL 4HUXB 2Y0SA 3QRFM 3MRRB 4L3EE 3EG9B 5DR5H 1KMGA 3WAKA 2A9DA 2VDNH 4W9IC 4PM1A 3U7AA 4F33B 3RTLA 5EEVA 3P4MA 3PPSA 1XMWA 3OZ9H 3Q5YA 2NLJB 4GT0A 4YAQB 1IM9D 3MQIA 5KVGL 4J23A 5HGBB 2CO2A 1MAKA 4HF5L 3RU8L 4IGBA 4JFVA 4XPAL 3D69A 2NPLX 3QXUA 3FULA 4XPTH 4PJXF 3S7GA 5JW5A 1IFHH 4EN3A 4PVLA 5D7LB 1IEBA 1IJ9A 4DN3H 1NGYA 5JPMB 3MBWB 1ZE3C 2VXVH 3SKOA 2BSSB 2VLMD 1XSIA 3S48A 1XO8A 1IMHC 1PD1A 2GCYB 2W1NA 3VB9A 1JK8B 1KG0A 3ME0A 4AWJC 2UWEA 2RQEA 1GJWA 5MHSD 1OTUD 4I2XB 2ZXQA 2Z31D 2DIBA 4XVTL 1L9PA 3ATEA 1A64A 2H2PD 1HL9A 2OXHB 3NIFF 4WI5A 5CMAA 5MENA 3L16A 2VC2B 3IMBA 3ZSSA 3L9EA 5E5RB 4PVBA 5HHVH 4M7LL 2DYRB 4F7MB 3HC0B 1FZJA 3SE9H 1NKGA 3MBEC 3NN8A 3GTTA 5LCVL 4YSUA 1BEXA 3UO1L 4YZWA 4YBLC 1HCFX 4XNBA 3SZ6A 3ZKXC 2MQ3A 2TRHA 4OCNC 4GW4A 4YHZH 1H3GA 3ULUL 2C3XA 3TBTA 4PJXE 4ZMQA 5LO7A 1I8AA 4JDVA 5E1GA 2CR0A 4ZMYA 1AHMA 5EC2B 3PL6B 1FFPB 2W5PA 1EHLH 3VD2A 4TNVF 2L8AA 4IJ3B 2JB6B 1IIKA 1AGBB 5HGHA 4KH9A 4YEEA 2ISDA 4JFED 2BSTA 2B2XL 2DQDL 3L95B 1AS8A 4ORZC 3BAJA 2WCPA 1HAUA 3OZKA 3ARGB 1CTNA 4MJ6B 3J2PA 1KPUA 2EZ0C 1SXNA 5JNYA 1RVFL 4P46A 4KGJA 4I9WE 5FEBA 1XR9A 4FG0A 1OCZB 2Z7UA 3MOBH 5IY5B 1O75A 3UBXG 1AR2A 1TCRB 2WZ0A 3SCMC 3EOBA 1JGUH 4PLKC 2ZAGA 1UXMA 4OZIA 1COBA 4GKNB 4PREB 1AFVH 2BP3A 4IOFC 4YSDA 5J8OA 4KI1A 3S88H 2Q10A 3DO3A 1SZNA 1UCTA 4KOBA 3O9WD 4M93C 5EWIH 2DD8L 1SF5A 2BZ7A 3ZUNC 2XQYA 1MFDH 5IVXE 1IBFA 3RJQB 1LEIB 4ZOCA 2J5WA 1LP9F 1QSEB 2OMUA 4MQXD 3X3FL 2IV9A 3EZ8A 3KPTA 4A7VA 1SDDA 5IKCB 1CE6A 1XL6A 2NX5B 3LNHA 3ARUA 3HZYB 2RFXA 2YPLB 1RZQA 4XH2A 2F8OA 2Q3ZA 2NY5L 1GIGH 2VSCA 4JM4H 2EINB 3GHBH 4LCYB 1MCPL 1JGDB 5KSBA 3GB7B 2FNWA 1IGMH 4QY8A 3CMOH 1N64H 1SMDA 3BCDA 5EBMB 3O11A 5F9DC 5EBGA 4V1DA 4BWUA 5D9SA 5B38A 3FQUA 1Q9KA 4L4VA 4XX1G 2ROYA 4RRPG 4E5XG 3VFVB 4FFVC 2XA8H 1OOWA 2FBOJ 2H6PB 3O6FD 3DUUB 3TJPA 4JN1H 4PJGA 3S96A 1DVXA 3WKNA 5BW7C 1ZE3H 4TRPL 3QIBC 3CFDA 3H7BA 4FMKA 4J7RA 4I0KA 1MRDL 2Y1YA 4H1LB 3CFJA 3FO2B 3AS3A 4X98A 4LDEB 1KOAA 2R0LL 1F1DA 5L9DL 4WKXA 2CDFA 2CIKA 2FH8A 1AIFA 1E2WA 2F5BL 4BCYA 3WN6A 2E47A 2J25A 1VAHA 4NI3A 5C08B 2ZCLH 1LP9E 2WLZA 3T4AA 3KLHD 1EGJH 3LPPA 4XBGB 3DJ9A 2CNYA 3RVXC 2R23A 2LHAA 3BWAB 4B53A 1FL6B 1XF5B 5GGTH 2CUHA 1ZV9A 2HT3D 5INCA 2HTLD 2UY6A 3H3PH 5HYJA 1PQZA 2GYSA 3EDDA 5BXFB 4YOKA 2KPWA 1MFUA 1RHHB 5I1CL 5DVLA 5CFAA 4X0KA 5KAQF 3O0RL 3DGDA 3FCTA 4JUSA 2LFGA 3NABL 4GRLA 1A6WL 2HTKD 4E9SA 3V9FA 1F41A 4G6MH 3EGSA 5FXCH 4XP5H 2DLHA 3KPLA 4WUUD 4LSSH 5DJ6B 2J6EL 2PPDA 4RMRA 3X14A 1KJ2L 5K9JL 1EA9C 4H26B 4F15B 1E8ZA 1MW3A 2YAPA 4NT6B 3FU0A 3OB0K 5CP7A 3CLFH 5I6OA 4MJ5A 2NZIA 3HMWL 1BPLB 4H0HB 5GGRY 3X1BA 3EH5B 3GSWA 2CRIA 2BNRD 3G5XA 4KZEL 3QEGL 3GBDA 4XMKH 1DANT 1C12B 1MCEA 4XVJL 2GEEA 2DQJH 1NIEA 1T7YA 3GBLA 4L05A 1MNUH 3K6SB 3EAKA 3SDDB 3IU4H 5IMMA 1CMOA 1EERB 2DYSB 5C2BH 3VFSB 5SWSA 3FTYA 3X12B 4CU8A 4EF3A 1L9RA 2APXA 1XZ0B 1L6PA 2BOCA 7FABL 1D6VH 2DV6A 2IAND 1JWUB 2CM5A 4OFYA 4GI9A 1P2CB 4C47A 2XCMC 1QRNA 3HPJA 1T89C 5IMLB 3K81A 4XXWC 3BUBA 3MV9A 4Y0GA 3ZKQD 3VXTB 3MGTA 5DI8A 1RZKL 3U7WL 2GJ6E 1PS3A 1J11A 3WIIL 2YAMA 3PIQA 4E41A 3MLSH 2L7EA 2HFEB 4JMXA 5KG9A 3ARXA 3OZLA 4MJHA 4OUUA 3C6LD 4CN6A 4NHCL 1L3WA 4YK4C 3KL3A 5IVZA 4ERSL 1KLUB 1OGAD 5C0IA 1RUQL 1JNNH 3V4LA 2C1PA 4P04A 2Z7WA 4GKSB 4N8CH 1M56B 2DL2A 2OMBA 3WKPA 3D85A 2DWEA 5FYJH 5IG7A 2X1QA 4J3BA 4MJIA 4WFHD 2CK0H 1P6FA 5HJ3B 3WNLA 5F1NB 1LMKA 1V27A 3OLEA 1TUPA 2QQNH 4MA1C 4EI5B 3P3RA 3ZKMD 4LDCA 3LS4L 2O61B 3BGFC 2R56H 2GTQA 4X4XA 1PTZA 4ETQB 4ESKA 4HKZA 5JXAH 2DIAA 4KKPA 5TJWK 1MN4A 2G60L 3CZUB 4I5BA 2GITB 1EJ6A 1L6XA 2JQAA 3A3YB 3EYVB 1SJMA 4ZUWB 3P11L 5D4JA 1JP5A 1O6VA 2AGJL 3RBSA 4NZTL 3MYJA 2ZOOA 4GP5B 4Y5XA 3T6QC 1SJEB 1TOXA 4F37F 2JLLA 5FYLE 2P48B 3BFQG 4OM1L 2C3GA 3AT8A 4OGXL 3GQFA 1E2VA 4RRPM 1TSHA 4FTVE 2WGXA 3VFTA 1AZZC 2F19L 1WBXB 5CEYA 3ZGHA 2HLFC 3RJOA 1RIUL 1YNTF 3CCHB 3KG5A 5FYLH 2IBBA 1Q9LB 5TK2A 4DK6A 3MMEB 2FWOB 1KBVA 1TEYA 2N56A 1OSZB 12E8H 1J5OH 2PO6D 3ETBF 5EU3A 1DANU 5C9KA 3QNZA 5B21A 5KOVC 2YC1A 3QR1A 3KBEA 3QUXB 4HP5A 2IAMC 1E90A 2G4EA 5LDUA 2JKRM 3K2UH 4F7EB 2XBTA 4HKJB 1FE8H 3E8UL 2EO1A 5CILL 5D2NA 4JB9L 2ZNWA 5AW9B 4WU5A 3K0YA 3VYNA 4ZMOA 3U2JA 2WQAA 4JHVA 3LZQA 4BHUI 2IWEA 2P44B 3D2UA 4HMEA 1NIAA 4DO6A 4QJ4B 1NCAH 2BVOA 5C0DA 3RWEA 4QRQA 1Z1WA 1K2DB 2VMCA 4Y4KC 4XP6L 5IREA 2HRPL 4ZNEA 2R0WH 4K07A 1YN6A 4KO9A 4X4ZA 3QORC 4KGLA 3QIUB 5C07D 3IDMB 3U6RA 5EEUA 4KKBD 1ETA1 4OF5A 3WY2A 4F7CB 4AZ8A 2Z8SA 1MDTA 4OF0A 2AABL 4GPVA 2ZOUA 3F8UB 3WNKA 4XWGL 4UCFA 5T1KB 4OZGF 5JOPE 3G7TA 5DMYA 2KS0A 3V4UH 1ZTXH 2H3XC 5IB2B 1UFUA 5F9OH 4BFEA 2HWZL 3P1VA 5CWSB 3GSOB 3PAVA 4M48L 3QI9B 3RTQA 3RUGB 1RL1A 3Q43A 1JYNA 4IBWA 4AKOA 4Q6KA 2BVTA 3LN5A 4TNWF 3DI3B 3ZDZE 1CF8L 1F11B 1JPTL 4ONFH 4X6BB 3KYMB 4M7KH 3TF7C 3LPOA 2C7UB 3GEWB 2JKSA 1ETB1 4MB5A 5C0RH 3COOA 5JDJA 2Q8BH 3GXFA 1HKLL 4I3RL 2AS5M 3K5RA 3MLYH 4JHUA 5AVXB 5HHQA 2Z64C 4C56B 1OF2A 5DMKB 1NH6A 1K85A 4R26H 4Q9CA 5GZOA 3H9HA 3JV4A 2B4CL 1RUKH 2DS4A 3E7JA 5DD0H 3VMPA 3NZ8B 1EX0A 4ELDA 4W9EC 4WGWB 3NPSB 5LG6A 2WUBH 3ZE1F 4MNGE 4U6HB 4XNXL 2BIHA 2COVD 4S0SD 4NKDB 5KVFE 3GNML 2R1WB 4D8PA 4ZMZA 5BUAA 2W80C 1HILB 1QFWL 2A74C 2YKKA 4OQTA 1FBIH 2W88A 2Y24A 3N0AA 1NM4A 3HI5H 5GRJL 5HP5A 2DEYX 3T3PF 4H0GA 5DA4A 5KVFH 4G9FB 2HH0L 4HHGA 3FYIB 4LT7A 2JB5L 4KC3B 4ODUA 4MZ3A 3SBPA 1F90L 1TJHL 4HAFA 4A7GF 5AB9A 4ZAKA 3HNSH 1BBDL 5HI3D 5F7KC 1R9FA 1SLUA 3NP3A 3RVTC 3DYPA 1S9VA 1ZHNA 4NCC1 1CG9A 3CC5A 3TBSB 4EN2A 1VZHA 4RFOH 3DNKA 1XAUA 2WLLA 2X4RA 2XETA 3Q6FB 5ID0A 4OGAD 4R4BB 5D7KD 1LTXA 2JLPA 4F2EA 2W65A 4JFXA 4NB7A 4WNJA 3RPKA 2X89D 1C7SA 4OLYH 4M7ZC 4ZMLA 1HXYA 2GY7B 2ZOWA 1JN6B 1XF3A 2EXYD 1W8EA 5HHNB 4XO4A 5IM7A 4JCMA 4X80L 3NJVA 4OJAA 2CJUL 1JTTA 1SLVA 3NDZE 2MOVA 1BGXL 1VF5C 5JQIB 1IBDA 5KEZA 4PJFA 4UMGA 5E1IA 3O6ML 5KBDA 2ATPA 1P4BL 3ZQWA 2DTMH 5CSBA 1SOKA 1WIUA 3PHAA 3QZWB 2AAVA 1YQ2A 4HUNB 4BXSV 4GG6F 5E70A 4RA0C 3V6OC 3ULUD 4PLJD 2DJUA 4G8GE 2A6JB 4LPTA 3VFMB 4O2CB 1NC4A 1XB8A 1TFHA 3SHSA 3VXMD 1IEHA 3IJSB 3IETA 4XC3L 1ZLEA 5DHVH 4GLRI 4JBSA 3DJZA 5HD8D 4GXUN 2N0MA 3K8MA 5PCYA 4L3CA 2RB8A 1PZCA 2D0GA 4JFPA 4GLRH 5CIPB 3FO0H 2I07B 4GG8A 2DM4A 4LCIL 3S5LG 3NEXA 1WIOA 3MV7E 5J13C 4POUB 4F2FA 4HS3B 1KLGA 1R34A 5AVZB 3U0PB 5F6HI 4ANVA 1KBWA 3BKMH 4TPRL 2DICA 4Z5RB 2UYLA 5C92A 5HI4C 1UZ6F 3E0GA 1IIIA 4HJ0D 3HI6H 3KM2A 4I13B 4XXDA 4U1KB 1HQ4B 4G6JH 4FXKB 4JO4H 2AQNA 1KDJA 1R5VB 4XBEH 1Z2KA 3EYFA 1FG2A 1HIML 4GG6E 2BZDA 4GMSL 1OE1A 3ARFD 5D7JB 2LLGA 5KSAA 4IHBA 4HZLB 2FX8L 2HZHA 4BJLA 5IQOA 1QFUL 1JPFB 4N2AA 4IBTA 1MREL 3QC6X 4AG4H 3VXUA 2E76C 5ADPL 4PHZA 2ZSWB 3VU1A 1CFVL 3H3BC 4FQHB 1KENL 2AEQL 1CLZL 2CRYA 4APQC 1UJ3A 1A3RH 5KBNC 1JERA 3FZUD 4JZJC 3FFDB 4HQQL 4YHLH 2H3NA 4ZMPA 3ZOAA 2E8YA 3JUZA 3UBXI 2E5EA 4PJAB 1IB5A 5A7EA 3ESVF 5CBEB 1EBAA 4HAGA 3ZE0B 2X42A 1UZ6E 1X4ZA 5HDWA 2Y2YA 2OP4L 3MRCB 2XQBH 1VGKB 5CXPA 4DPAX 4MS8D 1UT1A 3A4DA 4JRXD 3ZYZA 5IVNA 2CLZB 2RCSL 4R2GD 1QFOA 3HE7C 1INQA 3UJIL 2FATH 1YMHB 4LL1A 1JZ6A 4HUUB 2M26A 4N2GA 5HHPA 1J8HD 4KNQA 4AJ0A 4Q4IA 3ZW3A 3HG1E 1OWWA 2Q2LA 3K6IA 3LH8A 3AXIA 5I24A 2JMRA 3HE6B 3ML8A 1CK0L 1HFUA 5BZDB 5E2UL 4PJ8A 3FTZA 4PS7A 3CZNA 4K0OA 4JFHD 3L3OB 3QBTB 3B8YA 4JZNB 3RNQB 2IPUK 3U4KA 5J5EA 3T0EA 3C8HA 4HPHA 3N85H 1AZRA 4LL4A 5DQJB 2BJML 3I3DA 1P5VB 4UINH 1FUNA 2ADJA 3BP6A 1U8MA 4XX1E 3MJ7A 3MODL 1TNNA 1FO0H 2ZUVA 2JXMB 1EANA 2V2XA 4Y1AE 4KVCL 3N1QC 4XE5B 5EH1A 4G71B 3BZFB 1Q0YL 3PQYB 2BP8A 1A4JB 3O6KL 3GZKA 5J56B 3SDAC 2CD0A 1AS6A 2NY6D 3CK0L 4YDMA 2GI0A 2QHRH 3BVNB 3UZQA 3SDYL 1TZGL 4JANB 2NT0A 3L7FB 2F74A 1ECYA 5FDWB 4G8IB 4NKMA 3SPIA 5KYNA 2R2BB 5LBSL 3VXOB 2BVYA 3M6DA 4NQDA 1UA7A 4M3KB 4S1SH 3N9GL 4HU8A 1JVKA 4UT9A 1GYVA 2RGSA 4K23H 1AGFB 4NN7B 1A0QL 2C9UA 4XB8A 4ZMXA 1A6UH 3TPUB 3VO0A 5IQ7H 3W39A 4UM9A 3H9YA 2VO5A 4FYRA 5FCSH 2YXFA 4JHAH 2D9CA 1IC5H 1A1OB 4OJYA 1BSIA 5ENWA 4YHOH 5LBGA 2TSAA 1AY1H 1ODUA 4LCCC 3K1DA 1XB3A 3KLAB 1ES0A 1RMFH 4XNUL 4DEPB 4K2UL 2ZAIA 1CT8A 1JF1B 3W2DL 1ZPUA 1BZQK 5GRUH 3EADA 1T83A 3T8MA 8PAZA 5DD3H 4HHAB 1MFBL 8CGTA 4GKLA 2JCCA 4GKZA 4QHUB 4QRRB 2EEXA 1S9YB 3GJFA 1CDUA 1X7TA 4M9PA 3VQ1C 5LJYH 3Q2LA 2WN2A 4NXKA 1VERA 5KUKA 4X83A 4CDHA 5K9KA 4NM8H 2IH3B 1KB5B 5J7CC 4XZUB 4P2OD 4NM4L 4GW5B 2BWDA 2VDLB 2YGOA 3ZHFA 4MASA 5IEKA 5DRXB 3C08L 2A9ML 1T22B 2WB7A 2OMTB 2YXWA 5A3ID 3IFNL 4OCXH 4FKHA 3VTAA 3VMNA 2WVTA 5EO1B 1IAIL 3Q2CA 2UWEF 3Q2WA 4ZSOA 4QJ3B 1YEDB 5C8JB 2H7WA 2PXYA 1N3NA 2BNQD 5DGRA 4FI8A 2F54A 1G5GA 2IDUA 4N0CD 1EZSA 3DXAB 4PGDA 3IFLH 3IRZA 3L7EB 1H6FA 1ZVSB 2QZ5A 4U1SB 3TS8A 5K9OB 3CHPA 3KW8A 3CX2A 5DJYB 4Z3IA 1T7WA 4YO0B 3R8QA 5ID1B 4X5RA 3R4DA 3EJQA 1WGOA 2MNUA 1KXVA 4YGAB 5TDNB 4ZOBA 2DB8A 2EDFA 4NQCD 4XMZA 2QBWA 4NZDA 4NQED 4O9HH 1JOIA 1OALA 1R46A 4BBWA 4N25A 5HDOA 3RVWC 4WKZA 3UH8A 4Y4HA 3ZO9A 2ID5A 4EIGB 1JHKL 5FHBL 2NSMA 5L4MA 4U1IA 5IROD 1EHXA 5I1EL 3FFCA 1K6QL 2OMWB 5FK9A 2WINA 1WH0A 3HR5B 5EIVA 4Z78B 2V7NB 1PG7X 3D9AH 1D7BA 1XWVA 4GAYB 2XXFA 4XMTA 1CFTB 4R96B 2VDKB 3FOLB 1MJJA 2RMNA 5CSZB 3G5YB 2R1YA 5MENE 2YQ3A 4N5EC 2OTPA 4N0UB 4WCYL 3PWLB 3T5WA 3C5ZD 3DIDA 4PJ5A 1ETJA 43CAB 1BEYL 1HNFA 1CLYH 5I9QB 1T66D 1XR8B 4RVBA 1BZ7A 2ZP8A 1NTDA 4LQFH 3VUAA 2ZYIA 1O6TA 2ITFA 4YDVB 4LPWA 4K71B 4OZIF 2QZQA 1BAFH 1A7PH 3KLDA 4HXAL 2X0UA 1QLFB 1B2WH 4X5XB 1XTLA 4H1LG 4HIJB 5DJ2B 4BRVA 5C0BA 1KV3A 1VJSA 5AZ2L 2K6ZA 3QZOA 3KLLA 3PWPA 4LSPH 3DIFA 1ZLVH 2AFNA 3VXPB 4M7JL 1PGRB 4WO4C 4O00A 2VE6B 5BW7A 3STLB 1R3KB 1SY6H 3ZYIA 4CMMB 2K6YA 4ICXA 2P5WD 1KEGL 4J1UB 2V5SA 3WIAA 1IM9B 4N2MA 3ZHKA 3P30H 4BFFA 4P48A 3RGVB 5EEXA 4HEPA 3ZMRA 4TQEL 1QR1A 3LKSA 4AYFB 2W9LA 1U8QB 5KSBF 4DVBB 3A4EA 3GIZL 2Z7ZA 1V3LA 4IRSD 5J6SA 3N1GC 5I71C 2VDOB 1J5HA 4ODSH 3SBQA 1XAKA 1RZ7L 3MKKA 1I9IL 3VQMA 2VITA 1O7SA 1QATA 4WGVB 2J5LB 4Y9FA 1AMYA 3HB3D 3DK2A 3RA7H 4PJGF 4LAQL 1OE3A 1S7QA 3MV8A 2WOBA 5J06A 1AGCB 3PDGA 1ED3A 1EXUB 1TG8A 2BRRH 2XFGB 4KJYB 2Z31B 4QRSA 1XF2B 1T1XA 1E42A 1EAJA 4CBZA 4XNZB 3TCLA 4I0PD 3GBMH 2HN7A 3GO1L 4R90H 1W9XA 3PAUA 1IQWL 2ZIDA 4HALA 4TF4A 1HJCA 2EVHA 1IGIH 1NCCL 2VYRE 4XPTL 3QCTH 4ZXBC 4YWGH 4L8SC 4BXVA 1BFTA 1VGEL 4KPHH 2FCBA 4PVMA 2EXWC 1NFAA 1FIGH 2LOEA 3MRKB 1VEMA 4Z7QB 1O7VA 4NZRH 1IARB 3IJYB 1YJDH 3W1ZA 1U21A 4KKCC 4O4YL 2IPKA 1GJUA 2IGLA 5DZNA 2V2WB 2M83A 4AOFA 2Y3NA 3IDJB 1V55B 4PJHA 2CXKA 2EYSB 2NTFA 3IPBA 5JPNB 5F8QC 1BM3L 3BPCB 4GFTB 5T33L 4D9LH 1BWWA 1XCQA 1I3RB 1IBZA 1GZQB 2CCLA 2EO7A 1OCCB 1RLWA 2GSMB 2YKLL 2XV3A 4YL4A 1GZHC 3AVEA 5JXED 32C2B 2IMNA 5DYFA 3EYUL 3SE9L 1V3JA 3DX6A 4HJIA 4M5YH 2HFFA 1Q0XH 3IJHB 4K5MA 3VRIA 1HDMA 3CVIL 4BWTA 1JZDC 4XRCA 3WAJA 2ZOKB 1E9OB 3BQUD 2K9FB 2X28A 1YMME 1CVSC 5IHWA 1EFXB 1PEWA 3OKYA 1ZLSL 3Q6GH 1EHLL 3WLBA 3DGGA 4AYGA 2GUOA 3KWWB 4RMVA 2E4TA 4AVKA 1CYWA 1BVLB 3V4VH 4KXDA 1AHWB 2EYTA 4EOWH 1EAQA 1W72H 5IB5A 2O6DA 1C5CH 2MNJB 5DD1H 2OPCA 3KCWA 3KEHA 1A1NB 2DLFH 2FJHB 4MZIA 4Z95H 1N26A 4YHIA 3TONA 4FFZH 1NEUA 2WKGA 2QVIA 2XNAA 3IT8D 2AJZB 3QQDA 4AY0A 3LZRA 1PFCA 2EC9T 3JYBA 4NQQA 4BKLB 3MOBL 4TVPE 3CFKB 1IZJA 3MRHA 2AJUH 4GJTB 4MMZC 4Y19B 4NQVB 1JFHA 1HWWA 1QA9A 2XIBA 4FQIL 4Q8BA 4UF7C 3RP1A 25C8L 4JO2H 1N4XL 3S4SB 3S3SA 2ZUXA 2ROXA 3K4ZA 4BA0A 4HFUH 3WFZA 5EBLA 3S88L 3U4BH 1X5JA 1JWMA 1USQA 5F71A 3LIUA 4X7CC 4J4PC 3QUZD 3P54A 3DX3A 2CALA 3QZNA 2R2HB 4P4RA 1BF8A 3O6FB 1Z5YD 2I85A 3BPLC 4AQZA 4ZDHA 4P57B 3RFZC 3KYNB 1DSYA 5DWUH 4TVUA 3H0TA 4YDLC 1WC7B 4K3HA 2DQTL 4W4OC 3CZGA 4UTAH 1OL0A 1ZA6B 4JFFD 1KGIA 3Q8FA 1NJ9B 4HU2A 1QRNE 4P2RA 4JPWH 3HLAB 4JM4L 3NH7H 4PV9B 5D6DC 3T9WA 1DSWA 4GAGH 1F1AA 3EF4A 5IB1B 3DOSA 3FT9A 4OKVB 1A02N 4YIQB 1D2PA 5C0CA 1N64L 2WYHA 1YEEL 5BV7L 4E41E 5G5DA 5FYKU 1PCXA 4HISA 1YYCA 2EH7H 1W0VB 3FF7A 1B0RA 4HT1L 1GGIL 4H8QA 4PWKA 4HFWA 1JIBA 5TTRA 4TMPA 3UX9B 5CFHA 3K0WA 2I9LA 2IJ0C 4TUJB 4N24A 5DURD 3WY4A 5JPMC 3BD3A 2X38A 3QEHA 1NCWH 1K4DB 1KCSH 5CP3H 3B2UC 2IAAC 3T65A 2F7RA 3SE6A 2ZCLL 2I60H 1YEIH 4WEUD 1I8MA 1EGJL 3ETBJ 5HVGB 4WUUB 4C8XA 1IGTA 1N7ML 1F45A 3BISA 1AS7A 3MXWH 1XCTB 4YLQT 1AZBA 2O5YH 4UI2A 5AW6B 3RZWA 4PP1D 5GGTL 2X87A 1XIWD 1DN0A 3CUPA 4NI6A 3OR6A 1TENA 2BNRB 3D3VB 4BK5A 3H3PL 4MRCA 2QSVA 1DDTA 4UQEA 3QUML 1BDYA 5F7EH 3H1ZA 3HBZA 3KPRD 5BZWA 4PGBA 2ZCHL 3AWEA 3OPZH 4W9KC 4NEHB 1XVSA 4JKPH 1H9VA 4K73A 4NENA 4LLMA 3GXUB 3MLWL 3HLKA 3MUGA 3QHFL 1QSVA 1CFQA 3U7YH 4WEMB 7PCYA 4PJBA 1BD2A 1T7VA 1LE5A 3PL6C 4XP5L 1AG0A 3AS2A 5JHDA 3M8OH 4GO8A 3MLXH 3IWUA 5CJXC 1QTYT 2YSSA 4IJ3C 4WEBH 1JGLL 4LOFA 1A6VH 4GUQA 5I66B 3WNOA 3V4PH 5FUZL 5IJDC 3CVHL 4FQQB 2AVGA 5ICXA 3P4OA 4JQXC 3MX0A 2FB4L 3MR9B 3ARGC 4XVSL 5B1JC 3TBWA 2XX0A 1HI6A 4ZMVA 4CGUB 1U33A 3GKWL 3MCYA 5BO1L 4WI0B 1MAML 3LEXA 3ZIYA 5I8OL 3C6LB 3JTSB 5IHZB 1X5ZA 3FH5A 3IU4L 2DQEH 1ZTMA 2R51A 2EO9A 3WO3B 3CH1A 1CXHA 3OM3B 5C2BL 3QJFB 5D1XD 1NAMH 1JZ4A 3QO0B 1NGZA 5C0FB 1MI5E 4H8HA 2J2ZB 4OFVA 3LS5L 1FVEB 1RZIA 4DTGH 4PWFA 4PWJA 5DJXB 4B5ZA 4HIHB 3HCVA 3GWJA 3IE9A 1QHPA 5EFIA 2MSPA 4HEMA 4BGLA 2N59A 3CSBA 1QW9A 1A1MA 1NKRA 1TNMA 3S2CA 3MLSL 4DZBA 1JNJA 3GUTB 2C3VB 2FO4B 1YNKH 4NP4L 3TV3H 1U58B 3KHQA 2AMGA 4YHNB 1X5KA 2MCG1 3OG6B 1IAOA 2E4FA 1KJMB 3OHMB 2FO1A 2X4NA 3EO1B 4N8CL 5EULV 3BIKB 2YZ1A 3NBNA 1UT9A 3OR7A 4I4WB 4F20A 4AQ1A 1TETH 3TA3B 4XAWL 3VWJB 2K9UA 1NOFA 1FSKB 2XN9D 5D5MA 3QZWG 1I1YA 4X99A 4BH8B 3DRTA 2VUYA 3T2OA 1WO2A 2P80D 3BX7C 3O3DB 4XC1L 4B3EA 3RAJL 1YEFL 2A38A 2FJFB 1NAKL 3BDYH 4TSBH 3KPMA 1J18A 3QRBA 1VFAB 2D4DA 4FFYA 3ZL2A 5BRZA 3BSZH 1DVFD 5E4AA 3QJXA 1AQKH 1JL8A 1GL4B 3HHRB 4XPFL 3F01A 1WFMA 1U3NA 1UKTA 2B59B 4HMDA 3W0WE 4ZX4A 3MNZA 5IMKB 2VC2H 5DFVD 3QCUH 4MFHA 4NKQB 1DYZA 5I8KH 2XPGA 4MDJA 2J4WL 1SDAB 1KJ3H 4CJ1A 1NSNH 4MXQD 1IQDA 1T4WA 4LASL 5ISZA 4PJFF 2Q5BA 1OGTA 2WN3A 5A2KH 1FQ9C 1HQRB 1V05A 2KQNA 2OMZA 3QUYD 4Y9BA 1CCZA 2CLRB 3UC0L 4FTDA 2XRAL 3POCA 12E8L 2CRMA 1WZLA 4R8WL 1BJ1H 5C07B 1J5OL 3NIGB 4JO1H 1ND0A 3MA9H 4PG9A 1ZS8B 2JELH 2NY0D 2CBPA 4B9CA 4UT7H 5DC0A 4QHNA 4ZYKA 1G6VK 2JJUA 4KK6C 3RKDC 1AANA 2OMYB 3SE8L 2Y1AA 2G2RB 3T6WA 5H94A 5FGRA 4E0RA 4XHJD 3WD5L 1ICTA 2Q6WA 1HHHB 4R6UA 2VDPB 4DGYH 1U93A 3HNVH 1JAEA 3QWOB 3LV3B 1KCRL 3MRDB 3MRJA 3RI5F 4PMFA 1S7RA 2FSDA 3WFCH 1S5HB 5I0VA 1SFDA 3FO9B 4KDTC 4WW1A 1LD9A 5CJQH 3FSAA 4YGVA 4F15C 2W0PA 5JHMA 1IL1B 1I1RA 4JG5A 1BJ8A 4W68A 2ZWYA 3D48R 4UUJB 5GS0L 1HOCA 1N0XL 3LRSB 4OZHA 4PYGA 4KKLD 5DS8B 3MBXL 4P59L 1FNSH 4NRZB 4G11A 4IMKA 5B1BB 1GYWA 4U1HB 3DHMA 2UZXB 4PJFE 3SDDC 4APQA 3DYMA 2JKIS 1I75A 4KI5F 3PWJA 2FSEB 4AUJA 4KX7A 3O2VL 4KRMB 5FFLA 1YN7A 4PLOB 3GMQB 2CLVB 4LCWD 4AXWB 1HZLA 4R97B 3N40P 4Z0XB 2FEDD 3PDOB 5HVHB 1QSEE 2GC4C 1NANI 4PB9H 3F83A 1TR7A 2NX5E 3D4GA 1HNGA 5HJGA 2GTWA 2YPLE 4NHUA 5KBLA 2VN6A 1NANH 5DJCA 5GZNA 1ZSDA 4PJ9D 2R69A 4U1JA 4ZFGL 1M3IA 2W60B 4HH9A 2EVJA 3V0WL 4ONFL 1AXSB 3HZVB 3IFOB 4M7KL 5ESAA 5BVPL 3U9PH 3BW9A 3NSDA 5TE4H 1OTTC 1JCKA 3OMZA 4RGOL 4YC2B 4ORGB 4F91B 5DJ0B 1MJ8L 1UEMA 3QA3A 1G7IA 3QHZL 3G08B 1JBJA 2GT9B 2ZP9A 3EFDH 3MLYL 2VN3A 4C4KO 2VQUA 4YZFF 2YA0A 5HHXH 4RAVB 1NFIA 1I82A 5D72H 4EUPA 1FV1A 2C1OB 4NGHL 2VLRD 4KI5E 4PRAB 2YFNA 2OZNA 5GRVL 3RY6C 1Z0MA 4EI5C 4K5LA 2WP3O 1J05B 1X5HA 2HYMA 5L7XH 4UQ2A 3VI4B 1T20B 4H1LH 3UOAB 4PJEA 5I6LA 4Y2DB 1OP4A 2AV1B 3ECQA 4YX2H 1Q90A 1CD8A 4XPBH 3JV0A 2PTTA 4X8CA 4ZTEA 4L3ED 5IB4B 3HS8A 1UXSB 4NRXB 5F3HB 4DETA 4XMPH 3L5XH 3WJJA 1DLFH 4OZFB 2OM5A 1FDLH 2X70B 1J1OL 1OCWH 4KMQA 4NBZB 3VXSA 5KVFL 3MTXA 4RBPH 2W07B 3H2QA 2ZX5A 3RHWF 5CCKH 3B2XA 3M1OA 5LAPA 4HULB 5LGJB 2GBAA 4W9ZA 2PKDA 1O9WA 2OSWA 5FM5M 2ILLA 3C8KB 3CPLA 2NXYD 5I1AB 1C16B 4FDWA 2R1XA 4K3EL 5T1LA 3WUWA 2O6PA 3VXMB 4Z7OB 1QWUA 4GOSA 3SO5A 4MNQB 4OLYL 4BFKA 3QG7L 4RISH 4U1NB 2EE2A 3IJ9A 3QUXC 3V5HA 2FRGP 4DP7X 3FHQA 2PCPB 4F1SA 1XHHA 4ZD3L 3GSVB 2O72A 3I6GA 3IRCA 1WCQA 3U4EB 1RJZA 2A6KA 2E86A 4B7IA 4O5LH 5CKAA 1GGBH 2NUPA 5E2WL 4WTZA 2DTML 3F65A 3U25A 5SWZB 1JWSA 2Z4QA 2ADIA 5CZVL 2A73B 2J44A 3D39A 1E6JL 1H0DA 4OLUL 3ZDYF 9PCYA 3VH8A 5JQ6L 3MRFA 1MCBA 3WFBH 1TQVA 2VZTA 1BWMA 4F58L 2GKIA 2G30A 3QIUC 3ZL4L 3CN4A 1JZIA 3WIHH 3GSQB 2R8SH 2EIZB 4KJQD 5IIEA 3BYTA 1I9JH 5DZOA 1QLRB 1CL7L 3ZYOA 4QRTB 4QCIB 2JCCF 3HFML 5IHBA 1OB1B 4OF3A 3P3UA 1GPOL 5DA0B 1WE5A 1DSFL 2OA9A 3N5AA 3O4LB 1GYAA 1WPCA 3QI9C 3AABA 3BKML 1VACA 3VCLA 4L1TA 4DO4A 2UX7A 3HN5A 2BC4B 1VCAA 1PSKH 4CMHB 3EF7A 1ZWIA 3HI6L 5GGRB 4FXTA 2X2UA 3MC0A 1F6AA 1LO5A 2J21A 4RWHA 4I9WD 4PG2A 4HC1A 5F21B 3V5KA 3JTBA 5E8OA 2R4SH 1IC0A 2DL9A 1T3FB 1RPQA 2QL1A 4OAWA 3SE3A 2XWCA 5D4QA 1J12A 1RK0B 2IQAA 4JRXB 4IRZL 2C5DC 2NY1B 1GS7A 3K6NA 2HG5B 4R2GB 3B2MA 3C5SA 1HAWA 5A2FA 1J8HB 4J3TA 1BXAA 1IBBA 1E5AA 3UJTL 1PIGA 1OIOA 4WJ5A 3HHSB 4F27A 3D18A 3O2DA 5DHDA 3QP3A 4RMTA 3WEBA 4PS4H 3NPSC 1AXTH 2FL5A 5J4MA 2PWFA 3FONB 3DURB 1RK1A 3CDYA 2FH6A 4HKBB 3UPAA 5JUEL 4HG4K 3T4YB 3KS0H 2UVEA 1QFHA 4FHBD 4QXTA 3ZTJG 2AHIA 2WNXA 4G9DA 4HSQA 1NDGA 3OXSA 3BRDA 1WWWX 3A4AA 4AVIA 1U8OB 4HIIA 1MY7A 5K69A 3IGAA 2R4RL 3MO1A 2GJZB 3RB7A 4M8UA 1G1OA 1UH4A 3BE1L 4KAQL 5KBPA 5IQLA 1RU9H 1ECZA 3BN9D 1M2VA 2NY6B 2A9NL 4GQQA 3NK3A 4QIRA 5GIRB 1SRDA 2C9RA 4H5SB 1R3IL 4L5FE 4RFNB 1FL3A 1HX0A 1MWAL 1SEBA 2F54E 4OCWH 1ZMYA 4GEJA 3N85L 5AW1B 3RDTA 4YFLI 2E7LA 5DK0A 4FQLL 1I1AB 1KJ2B 3VW3H 4OVUA 4L5FH 1OO2A 4DGIH 3D51A 5DJZB 1I9EA 2PW1B 1F6LL 3WU1A 1NPUA 4PRDA 3MBED 3QUKB 3SQOH 3UROR 3BP7B 2VH5H 1ZHKB 1HL5A 3VA6A 1T7ZA 4GRMB 3B2DC 4MCYA 5AW3B 1OAKH 4IKIA 2J1ZA 1DQDH 3IWVA 5DZJA 1ZK5A 4KKZA 1UXWA 4Y16A 3VYOA 2X41A 2WOYA 2WVSA 4BFOA 5MEOB 4CKVX 4D9RE 4POZD 3G5VA 4ISVB 3MRNB 3O45A 1ZANL 4S1SL 5I82A 4YXHH 2YEQA 2AJXL 2NUTB 1AQ8A 5DEFB 4KQ4H 5CGYC 5MI0B 1TFPA 3BGAA 4GSDH 3ULSA 1KB9K 1I8IB 2G9HB 4JJ5B 5E4IA 1QVOB 2EDDA 3BC9A 4JDZB 4AE1A 4ICWA 1ZLDA 2WBJD 4QGYA 4CJ0A 3MA7A 2DQCH 2XWJB 2BW5A 3L08A 4PJ5E 4R7DB 3OV6A 3OHXB 4JMNA 1EJ8A 2CO7B 4CL7A 3I2CL 3DDFA 5GRUL 3QFGA 4PLKD 3G6AB 1XSKA 2XFXA 2XWBB 3UTZB 1ZDQA 4NQUA 2FD6H 3TU6A 1I3GH 4FXKC 1J0YA 2ADFH 5TQ0H 2I27N 4IOFD 1CD0A 3GGWA 1IRAY 4J3XA 3BZ4B 2FNBA 3BPNB 4HIEA 3M1BA 2GVYA 1H15A 3MHZA 3TEXA 3REWB 1DQIA 3QNFA 5D7JC 2E0PA 5C0BE 4M5TA 1P7QD 1BECA 2A2QT 3QH3A 3RG1C 4KTEH 3PWPE 4KRNA 1XV8A 4X6FA 1RJYB 2WTRA 4F8PA 3EGXA 5E1AA 1BF5A 4JY6A 1FNEA 1D2OA 5E9NA 4D7PA 1VB9A 5F3BA 3NZHL 4NQCB 5I73B 2QTEA 2BDNH 2GJ6D 5JLZA 3RLSA 5EF3A 1CGTA 2FX7H 3MJ9H 1OPOA 4JKLA 4OCXL 5F88B 1TJGL 3GI8H 5E4EB 4ZJ9A 4PJHF 3RL1B 3SDCA 3T04D 1DJWA 2CR6A 1PZBA 1KWGA 5GISH 1MCIA 5F9JA 3TZVC 5I17A 2YA1A 4AJYV 3OKEB 4K3JH 2QEJA 2IQ9H 5K39B 3OF6D 4XCCL 3FQRA 2VLJB 5PAZA 3KXFA 3QIBD 1ZJAA 3VXQB 2V9TA 4QXUL 4XOCA 5FA3A 3TBYA 2WBKA 3ZTNH 4GBXA 2XIDA 3HRZB 2A4EA 2DEXX 2D7OA 1AJ7H 5I23A 3S98A 3S4SG 4UTBA 4P99A 1S7TA 2COQA 1QBML 1OW0A 1C1EH 4JFQB 1WCBB 5IW1A 1KZQA 2XLLA 3SY0A 2R39A 4ILDA 2R0ZH 3ABKB 1URIA 5CJOH 1XH3A 3L3OC 1IZKA 2GK0A 3RVXD 1UM4L 4G3YL 4Q2ZB 2OAAA 1FVDA 1KXQA 4I3SH 1TU2B 1QEXA 3BUTA 4HWEL 4AEIL 5HTSA 3D9AL 4N2KA 1BVKA 4CC4A 4X5WA 3QFJA 5DXWA 1N19A 2NW2B 3OAUH 2JK5A 1U2YA 3P73B 2VRQA 4LB8A 4MD4A 4PW9A 2GW5A 5FYLD 4AH2A 4IW4C 4Z77A 1I8LA 1IAKB 1V3KA 4M61B 4JZOB 4FTVD 1XGTB 3DOIA 4MYPA 4Y5YA 1WSST 4I85A 4ACTA 2WZ5A 4GSQA 3BYYA 4EBQL 5TE6L 1AG6A 5CEZE 4GS7B 2P5WB 2W81C 2JJVA 1O6SA 2GAZB 1S9KC 4HUXA 5DD5L 1VRSA 5E00B 3TNNB 1BQHG 4ADJA 3IRPX 2V17H 3GSNA 3EOAB 4MA3A 3SQRA 5DVMA 1W8OA 2NRDA 5CIPH 4NN7C 4ZODA 5CEZH 1KIQA 4L8BB 5DYOA 3WNJA 3BJLA 4Y4FD 5GS0D 3CXHK 3GPSA 1OT4A 43C9B 5IQ9B 1Y0LB 4ODWB 1IGJA 5L2KA 5DMIH 5F9WB 2YR3A 5T3ZE 3T3MB 1WEJH 1ZLVK 1KIRB 3HB3B 4JE4B 2X88A 4KO7A 2GIMA 3HMXH 3W11C 3WSQH 3H9SA 4DEPC 1X5AA 4WU7B 4TTDC 4UU9A 3TOPA 4EJ1C 2BVQB 1UWGL 3L3JB 3M17B 4I0PB 1Z9MA 4RMWA 2RTTA 2F5AH 5KYWB 2F61A 3P30L 1BZ9A 1FF5A 4OGYL 4Z3FA 4ELMB 1F8TH 4X8XA 2H32A 3IVKB 1ZA3B 2FHFA 1EO7A 1JK8A 1Y6KR 5H4ZA 1CWVA 3VMOA 3FQTA 1EBPA 1G9NC 2BVUA 2X1PA 4G43B 1OGSA 2EDBA 2CKBB 4I2XA 4QT5A 5JOPD 1HL8A 1MH5A 3P3TA 4G5ZH 2VZUA 3OKKB 2NT1A 1A2YA 3QNXA 4LIQE 3A0OA 3MRIB 3ZE0E 2MFNA 3MPCA 1Z9PA 3DBXA 3NPZB 4R84A 2Q3XA 2VUKA 5JO5A 3CU1A 2W94A 1CGVA 4G1EA 3D5OF 1OK8A 3OD3A 1MCOH 2GEQA 1KLFB 2NDFA 3MLRL 2D03H 2XTSA 4IU2A 5HGAA 5IFAH 5J12B 1N6UA 4LARH 1L9SA 2IDSA 4FLRA 2WK2A 5IQNA 3V8OA 1O0VA 3ARBA 4NO5A 4FYQA 5E2JA 2QGCA 1IVTA 1S46A 1TLKA 4IS6B 5F9AC 3T6VA 2DMHA 4UQ9A 5E6RB 5J6GA 4M6NH 4WJG3 2Q8AH 1YJDL 2P8MA 4MQ7A 2J7LA 4L29A 3FQWA 1X5IA 3FRUA 4LCUB 3S6CA 4QR7A 2O5XH 4OM0L 4FNRA 5GJSH 5I1DA 4WNQA 2FK9A 2ZWNA 3N91A 1ET7A 5CAYB 1CPUA 4KNUA 3ZYJA 1UFGA 2K8QA 4MJ6A 5B1JA 1LEGA 3BQVA 4XZ4A 4D9LL 4NQXB 3FB6B 2GC7C 3PUCA 1SYSA 5T5NG 5T5FH 3UERA 2WWKO 3APCA 3ARDB 1CLOH 1FGVH 3KH4A 3MNMA 5KJ4A 4B95C 3BH8A 4W9JC 3CFEA 3GTVA 4NIYE 4PJBF 4TULL 1Q1JH 3WEAA 1TCRA 3PQYE 5BRQA 5KUMA 1SQ2N 3HBGA 4RNRB 3LNIA 1Q1PA 2YD0A 4IHOB 4ABVA 1CC3A 3R1GL 1R4XA 2EABA 5DLLA 3ARZA 4M5YL 3RE0A 2X2JA 3RWDB 1WWBX 1YPZB 4L1HA 4X7SH 4CVZB 5I1LB 3AJ7A 3TBBA 1FHGA 4ABWA 1Z3GL 3A67L 4DVRL 3LQZB 4G59C 3LRMA 2IAMD 3W57A 5I1IH 1JGEB 3L3IB 2XG5B 4YR6B 5FWQA 5I6PA 3Q6GL 1K8IB 2XPZA 5ILTL 1MIEH 2IBGA 4RWYH 5DS2A 1I1CA 2DOCA 4LVHB 3B3BA 1ADWA 5I9QC 5EUOB 4FJ6A 4AIZA 5E08H 1C5CL 2DJ4A 4UAHA 1J0ZA 4LVOB 4PBWD 2BK8A 2X09A 2ZKYA 2DLFL 2NYYC 1T04B 1XGYH 3C87A 4K71C 4WK4B 2OKMA 5SWQA 4PJ7B 4FNUA 2BY0A 4TQHA 1P6AB 4X6EB 3L9YA 2KUTA 4PJBE 1BD2E 5DWPA 1MAJA 2WLNA 4KXAA 3BIBX 5D1ZB 2Z93B 4JRYB 3UJJL 3IPEA 5JHDE 4BH7B 4JFFB 3GRGA 3DUUA 1CFSA 4G8GD 5E9DA 3V0VA 5FF6B 3VXRA 5F1SA 4M6AA 1U8IA 5EU5B 5IK3B 4C54A 2P5PA 2IGFH 2Y4SA 4TVPL 1FG9C 2IXQA 5JIQA 4C58B 1Z5LB 4XVUC 2XDHA 3QO1B 1A7NH 3VJ6B 3RGVC 1G9NH 1LQSR 3QQ9C 4FHKA 4HUCA 1EWHA 4KVNH 1IKFH 5C08A 4YFEA 1F2XK 4UZGA 2BSED 4M6OH 4F8QA 5F1IA 1RI8A 5D5MF 4BDVA 5ACZA 1KB5H 1AYOA 3MV7D 3PHOB 1G7PB 5DWUL 3SBWA 3ZLQC 4N0FB 1IX2A 3BH9A 4KTDL 4UB0H 4PY7A 3SBRA 2VDLH 3SYCA 2J5LC 2PTUA 2YWZA 2VUOA 2Q7AA 4NNYA 2AMUA 3L13A 1ONQB 7CGTA 4UOQA 1OTUC 2VCOA 3FSOA 2Z31C 3DXAE 5ICUA 4HEME 4XNZC 5AD0B 5MEPA 2H2PC 1NBVL 3SSGA 3Q2NA 4MD5A 5FO7B 4BELD 4DPRA 2HRHA 2OZ4A 5T8IA 5GGSB 1XIWB 1NBYA 4TSCL 1G7QB 2JJTC 4P5KB 5EN3A 5BQDA 5L88L 5AAPA 4TQIA 2EP6A 1CQKA 3KPRB 4JGJA 5ANMA 5A6LA 5IW6A 2DMBA 2V3FA 5EO9B 3R18A 4CILA 5J6HA 1EVTC 2FT6A 5D5ME 4KVPA 5J9PB 1W0YT 2Z92A 5JPNC 4YDJB 1G7LA 3QDME 2ZONA 5A2AA 1F56A 4I18B 4TLUA 4O02A 5DK2A 2ATKB 3KPSB 3PV6B 4JFYA 4XWOD 3ZGIA 1HE7A 4XCEA 4AMKH 1YYMH 1MF2H 4K8RC 4X8JB 4GSXA 2MH4A 3V0GA 4OZHF 1HEHC 3BWZA 4DAGH 3B2PA 4Z76A 5DD6B 3L3KA 5D1XB 4DKEH 5F7UA 2XY1A 3HG1D 5DVKA 1GOFA 2CDGB 4IEFA 2JKWA 2W9EH 4NKIL 3U36B 4FA7B 3KMDA 4L0YA 3HC4H 1NQBA 4GKOA 2OULB 4JVUA 1M42A 1MUJB 1O9VA 4QTHB 4WEBL 1EVUA 2C3WA 1A6VL 1AHWC 3ABLB 3FB8B 4G42A 4RAUB 4JR9L 2XN0A 5FYKE 3V4PL 3UTSA 1C5DB 4DP9X 1RJLA 3DV6B 4IRJB 1Q9WB 4LRNH 1RK7A 3ZTJH 5HDQL 4E9XA 3B56A 4HWBH 4HUWB 2OMNA 1LK3H 4QRUA 4J12A 5EO0B 2WBWB 4Y1AD 1SDYA 5DEGA 5FYKH 3BJ91 1URLA 4WUKL 5L8LB 2W95A 3P0VL 4EIUA 3RWGA 2VR4A 2G3ZA 4HV8A 3E1ZA 3GPEA 4OZFG 1IU1A 4M9OA 2GBTA 3BKCH 3CZSA 1SNRA 3CH8A 4WFGE 1HZHL 3VFPA 2EUVA 3GMRB 5HDLA 2FLBT 1YEWA 2EH8H 2XN9B 2PCFB 1RPKA 1MZYA 1HWHB 1YUKB 3DVFA 3UTQB 5ERWB 5HI4D 3V0FA 2VDOH 2E7HA 3O6FC 3F7RA 3MRMB 1AD0A 2VR5A 1JVOA 1JHTA 2V4LA 4AE0A 3RL2A 3TV3L 2WQVA 1M7XA 3AXLB 3RWJA 2CAKA 3C5JA 3PHSA 2ED7A 3QIWA 4NWTL 1TZAA 2BWIA 1L0QA 3GK8L 2HFGH 3LEVL 4MLIA 3VRLE 3V7AE 4RETB 4PJEF 2ZYRA 1INDL 4WHTA 1DBBH 4OBSA 5AENA 3H6AA 2AV7A 4Q74A 3E80A 1TETL 2D3JA 4C83B 1CFMA 4JFDA 3NJIA 2ED9A 3FQNB 5JORB 2F53B 3ASOB 2XTLA 1RUPH 3P77B 4TTGA 3QUYB 4OD2A 3VI3A 3FC8A 3BUQA 4BSVB 3BDYL 1QEWA 3DTXB 2ESVB 3OKLA 5DQ9B 3AAZB 3STZB 1FRGH 3JWDC 3BSZL 8FABB 5B8CB 2NY0B 2BIIA 3IS0X 3P0YL 3GM8A 4FQXD 1T1WA 5F7BA 1T4KA 2ZUTA 1IKNA 3C09B 3L6FA 5DU7A 3QHTC 2QMJA 2HTKC 1D6EB 4YSOA 3EOYG 1BPVA 4Z7WA 2FYVA 4H40A 1DQJA 2Q0ZX 5F89B 4PU2A 5IEHA 1L7TH 5I76A 3ROOB 4G8FA 3CQFA 1NDMA 3G6DH 3UYOD 3X3GH 4K8RH 3RY5A 3TWCL 1MCWM 3F7QA 4JO1L 2RACA 4U3SA 2H0JA 4P23A 1NGWB 4PRNA 1UWFA 3WIFA 5IBTH 1FI8C 1T5XB 4RIRB 1WTGT 3EYOB 4OQTL 1QUNA 4PRIA 2VN7A 3QPKA 1S7SB 1E30A 4DGYL 3AU0A 4AGQA 4X6BA 4AGPA 1JGVL 2ICWB 3UCRA 5FFOA 3C60A 4D3CH 5GRWA 3GRBA 2K7PA 4UZUA 5CJQL 1T0MB 3AS1A 3CVCA 1QZNA 2O1AA 4P5RA 4Y19E 3E1F1 3H55A 4YNYB 2E9BA 3MROB 4PJ9B 4WSGA 3ZZ1A 1DCLA 3FK3A 4YMPA 4MCZA 3AREA 1AQDA 1QQDA 1BG9A 5IHUL 5TH2B 2YPVH 4S0TD 3C6LC 3H56A 3CG8A 3FUDA 3RWFB 1HC1A 2F18A 5B7EA 3ROLA 4TNGA 5MEND 3Q8BA 3S35X 3WYRA 4U6HA 2PP9A 3NJHA 3K8KA 4Y5VB 4KZDH 5KVDE 4V2BA 1L5GB 3UTTA 1BQLL 3HS0B 1NCOA 2D7PA 5KJRH 1EMTH 4PRHA 4ZTOL 5EOQH 2CK2A 3KR3H 4JFOA 3PGFH 4OLZL 4MXVE 2VLRB 3V95A 3IN2A 3LNGA 1HU8A 5D70L 5EORL 1K3ZA 5KVDH 2LFEA 3ZKMC 5FO8B 3MRLB 4YDNA 2P28B 2UX6A 4WSKA 2GSGA 4HKXB 2HJFA 4NLHA 3TH4T 1GCYA 1RFDH 3PWNB 5F72S 5LUMA 4YJZL 1E50A 3O2WH 4L3EB 5B3NA 3SIKA 2G75A 4D0BB 1BQ5A 2ED8A 1HEZB 4ZMAT 2DWDA 4GIOA 3QEUA 1PDKB 3S8GB 3EFDL 2FYYB 3Q6FA 4MSWB 2VW6A 4OH2A 4G8EB 4NC2B 1I7UA 3G5ZA 5HHXL 4BKTC 1O5DT 1KIPB 4KKAC 4BE6A 2D7NA 1PKQB 3TA3C 3VWJC 2R29H 4IQHA 1FSKC 3VFNB 2HP4A 4H7VA 4FZ8L 4P46D 4DP1X 4JAMB 3EH1A 1TJXA 4U2ZA 2CHWA 2N7BA 2VMEA 5B1CA 4K4KA 4W1TA 3WHE0 3JWDH 4W9LC 5C0AB 4WUUE 3S36L 3QPXL 3BEVB 4FP8L 3SGJC 1B3IA 3THMH 1ZKAA 5F7YC 3H8NA 5I18H 2MHAB 5EZIH 3TH2T 4RBPK 1FVCA 1NCNA 1QO3B 3TPKA 4Y9GA 3L3GB 1N0LA 4F2ME 1E4WL 3D3VE 4FG2A 4XPGH 5BQ7B 4OF6A 2YOCA 2BLFA 4MAYA 2BRQA 4XP1L 3EFFB 4JGNA 5D2LA 2AAAA 1DJHA 4OFDA 3VFRA 1H6UA 3UAJA 1CU4L 4PV8A 1VDGA 2XG4B 3LXUX 2UZIL 4BE5A 4R3SB 2QPFA 1NLDL 4PJIF 4OIAA 6PAZA 2O5ZL 1SM3H 4GP4B 4LLDB 3EZJB 1R0AL 3J7HA 3WEXB 4ABQA 1DQQA 1OT2A 2VQ1B 3LEYH 4XPHH 2NZ1A 4KKBC 5G4MA 4ZFFB 4PJXB 5JHLA 2ODHA 1OAJA 4HWZA 1CLVA 4K94C 2AXHA 2XVGA 4V1DD 1SXBA 1WWCA 2DH3A 4L4VD 4O5LL 3LHAA 1RH8A 2YD8A 3FS9A 1GGBL 3MCKB 4GMTH 3C6SB 3IEAA 2BINA 4BA8A 2WLYA 2X4QA 1QBLH 1GRWA 5H37G 3TJEH 5CBAA 1AOHA 1C7TA 3NIFB 2PWDA 1U6AL 1YEGH 4FNQA 3KDMB 4NKOB 1CICB 1MHCA 4M3JA 4DW2H 1G84A 3WIHL 2BWQA 5AUMA 1M1XA 3DECA 5IR1A 1DBKH 3ILQD 2CCVA 1YMMD 3AGVA 1GW0A 4L9LB 1Z9OA 3B6SB 4OY9A 1G9MC 1MPAL 1RZFL 4FNLH 2Q7YA 4PR5B 5C0EB 4PD4J 4Z7VA 1H5BB 3HZKB 4R97C 4PTUB 5HVHC 2VDMH 3UFIA 3HPLA 2HKHL 3FB7A 3FUFA 5HYJD 4F3FB 1J1XL 5C0JB 1P5UA 4WO4D 1JXKA 1NFDE 1ACCA 2CLZA 3B7YA 1SJXA 3AZUA 2CMRH 4GRLD 1S9XA 1RIHH 1YHPA 2V5TA 1WZ1H 1YYLL 3GXNA 3D0AA 2R4SL 1EEQA 5SX5H 2AEPH 3JVGA 4TVPD 1WAAA 1AYRA 4AYBA 4YC2C 4N1HB 5JYLA 1XGUB 5BV7B 3HE6A 5BZDA 4Z0BL 4LE8A 2EDNA 2EDOA 3SKJL 4N2DA 1DFBH 4JPKH 3RNQA 4HETA 3TA4D 4IOSA 4KUZH 1SHMA 3MZTA 1R3JB 5FKPB 1QASA 1ITCA 5HI3C 4M62L 3W82A 2YQ2A 4NWUH 3F6JA 3DO7B 1UKQA 3PLYA 3SGKA 4GFXA 4NPKA 4YHML 3CHSA 4OGAC 3D33A 4Y2DC 5D6CB 2NNCA 4Q6IB 4ACPA 4CVXA 1A4JA 2CRZA 3VSTA 4OFYD 4AVHA 1F4XL 3PGDA 2CGYA 3PRZA 4NJ9H 5LAXB 1QRND 1DUYB 4N0YL 3L48A 4QHPA 3BKJH 5I6KA 1LP9B 4BSWB 4M1GH 3DX2A 1M2OA 3ESPA 1ML0A 4EDXB 3T0BA 3LDBB 3RPIB 4E41D 2DN7A 3QUMB 1AGFA 1UZGA 1HS6A 1KIUB 3UYPA 1RU9L 3F04A 3IXAB 2AITA 3EYSH 2YEZB 2Z91A 1G6RA 3ULUC 4ZUVA 1D5BA 2FLRT 4UQIM 1YSOA 2XUWA 5E6IC 4JRWA 4PYHA 4XP9H 2FWLB 4WY7L 1FL5B 1BAWA 1ZDSA 2DM2A 2SEBB 2JKJA 3D85D 3KLAA 3L1GA 3QARA 1U8CA 4K94H 5KSUA 3SO3B 5HD8C 3CX5K 4HJUA 3EYQD 5EZJB 3ZRSA 2KDYA 2OX5B 1FORH 3CFTA 2VDPH 2P45B 3D50A 2Q86B 3CVHB 2DKUA 2O5NA 4OV5A 2MPVA 2WBJB 5D7IA 1RZPA 1YEJL 5CZXC 4QRRA 3KYOB 3L5WA 4JL2A 4L4TE 1S9YA 5EHFA 3QR2A 3LXAA 4Z18A 4IDJH 5I8EA 2XWZA 3FU8A 4BEIA 3FTGB 1KXQE 4HJ0C 4NBYB 2IH3A 2OR8A 1NGXA 1GA2A 5DO2D 2IFGA 1PNCA 4GW5A 5E8DH 2Y5TA 2AXGA 3QFJE 1G9MH 2BFVH 1EUTA 1WBZB 1P7QB 2YBRB 1PJWA 4IIQA 1I7RA 2VABA 4DKDC 5DRNB 1BIIA 1OPGH 1Y1DA 3QJTB 2AK1H 3F12A 2JI1A 3W9EB 1GTFA 2ITDB 3NJLA 1T1YB 2MCPH 2DQCL 1YEDA 4U6VH 1UA3A 3TC9A 5KVGE 1AD9B 1MEXL 1EHKB 2LE9A 4OI7A 1S78C 4A2GA 2JTDA 3FZUC 5HYIA 5KN5B 4CMHC 3ZIMA 3L7EA 3GSUA 3L9BA 4DWHA 3PXLA 3WMSA 1I3GL 4LHJB 2NY5C 4UDTB 5ID1A 1A8JH 2DY2A 4WWOA 5KVGH 3RU8H 2XVBA 4HF5H 2DLGA 4J4PD 4FFWC 3QDHA 4XPAH 4I3GA 1IBHA 1DQMH 2V7HB 1L6ZA 4MCNA 4QJ5B 5L2KE 4FA6A 3QQ3B 1H9DA 4MS8C 1N5AB 3D2UD 2WJ7A 4RZCB 2NY1C 4ZBJA 2ZICA 4OCSH 2WY3B 4AENB 4R2GC 3OB8A 1TIUA 5AAWC 1U0QA 2ZX9A 4HGWA 1J5CA 3FRPA 1N68A 2E6PA 2PETA 3VGBA 4FQ1L 4U33A 2FX7L 2QFRA 4P2QB 2YIHA 4NIKB 3U9UA 4XVTH 2OXGB 5ACLA 3GI8L 1GSKA 3FOLA 4JFSA 5GISL 4U1GB 2VXQH 3VXOA 4BWWA 3VA2C 4W9CC 4M7LH 3UGUA 3QDJB 1A6PA 5FO9B 3Q9PA 4FXGB 2VAAB 3T2QA 2WIIA 1RV6X 5LCVH 1ZGLB 4I88A 4WI7A 3UO1H 4Z7OE 5MEQA 5F6HJ 4CW1A 4MNQE 3A23A 4PWHA 4Y8DC 2VERN 2Y6SD 5HGDB 1SOXA 3ULUH 5BS0A 4JS7A 3B2UD 3BVVA 1C1EL 2G2PA 3BI9X 2NY6C 1CZ8L 3I6KB 3KW7A 4KNTA 4RFNC 5FGBC 3ATBA 4J2QA 2NR6C 4JM2D 4ZW6A 2AF2A 2E27L 3QRGH 1J5IA 3I02A 5SWZE 2B20A 5ICYB 5INDA 2J71A 2WVVA 1I1AC 4B9ZA 2L7QA 2B2XH 2DQDH 2WQSA 2ZKHL 5E7FA 1S7WA 1YUHB 1MFCL 2OYMA 3DX9A 1GGYA 4L8CB 3W0WD 4Y4FB 5CLXA 5I8CA 3OAUL 1RUML 3WJLC 1RVFH 3WHE1 2AK4A 4MMYB 3OXRA 1D5MA 1TZIA 2QR0A 2VQ4A 4MMXA 4XN4A 2XICA 4GAAA 4XR8C 1TZHA 2WZPA 4MAZA 1CO1A 3FJTA 1FAKT 5HJBA 4U31A 1T0NB 3PL6D 4Y9CA 2HG0A 2P8LB 4P9HL 3LOWA 1A66A 5E94A 5CN2A 1A9BA 3UAAA 2LW3A 3MLUL 3UZVB 5GS1A 5EBWB 2B08A 3QCVL 3O4LE 3HAEA 3UYRL 3NG5A 5CEZL 1JXGA 2JTYA 5A7BA 5MI0C 4ZAKD 1XF2A 2HLEB 1YNTB 3BAEL 4RMQA 2DD8H 1FGNL 4L8DA 4G80B 3CAFA 2A6DA 2KBGA 3M46A 3BUYB 1RZKC 4GXFA 1BXVA 2XC8A 2WXGA 1WBYA 1YG9A 3X3FH 1HSBB 1QFWM 2R27A 3IDIA 3OHXC 3WSQL 4G70B 1I31A 3SJVE 4KJWD 4LPVA 1TTCA 5J89A 2NY5H 1P9MA 3TJHD 4ABUA 3MV11 4Y7OC 5T3ZL 1MCPH 2XI9A 1CYXA 5EU4B 4E9TA 3SPVB 3BPNC 4NUJB 3IAGC 3L1OL 2OYKA 1ID2A 4K5PA 4HOWA 3PAZA 4AQ8A 4N0CC 2LT9A 2ERJB 2VXSH 1A9EA 4TRPH 1QSED 4WDIA 5CZKA 3QJHA 5E9DE 2IADB 4JFEA 4J3SA 1KBBA 5MP6L 1I7TB 5JOFA 2EEBA 1NC4D 3AY4C 2YAQA 4R83A 2YPLD 5L9DH 1U8HA 2DYPA 4OZGB 3VFUA 2F5BH 5I73C 1IGYA 1BOGB 2YD4A 1FZMB 1MFAL 4PBDA 4MNGB 4LMQE 4PPTA 4LIQL 3I75B 4AT6B 1UYWL 3ZKNC 1H8SA 5E4EC 4LMQI 5HHMB 4P2AA 1VPOL 3VD7A 1KB3A 4P0DA 1A25A 2AXWA 1MFEL 4N2EA 4UZSA 4WJKB 5IROC 4QTIL 1R47A 4MWFB 5TQ2L 3KWWA 2OL3A 4TS6A 4JO3L 4DK5A 5KWYC 2ICEB 4PW4A 2Q8AL 3B9KB 2PWGA 3ENEA 2OK0H 1WFIA 2O5XL 2E59A 5T1MA 2CJSA 2DQHL 1E28A 3O9WA 1H3TA 2FJHA 4KI5D 5AWNL 2XKSA 3O0RH 4FEMA 4G83A 5KS9A 1NEZA 1OAZL 5HYQA 1TJIL 1U9KA 4K15A 2PCYA 3B2VL 2X6BA 5KSAD 2R0KL 2BP0B 1CLOL 1FGVL 2FGZA 4OCLC 4X4YA 1RCYA 2I32A 1T66C 4GUPB 2J6EH 5K9JH 3UEZA 1KJ2H 3VD3A 5JW4Q 1NINA 2EDEA 2B9AA 4DPCX 4YK4B 1DQTA 2NNAB 3HMWH 3ZE1B 2ITCA 4ZUTB 5TF1L 2PCXA 2Y72A 3UCQA 4NO0A 5FA4B 5FB8B 3FTUA 3PG2A 2J8OA 3EDKA 4X7SL 4XVJH 4YSPA 5AB0A 2DKSA 3S3BB 1A7RH 3KEDA 4X6DA 1CD1B 4KK6D 3T3PB 2R2HA 3V0HA 3UG3A 1Z5HA 4LBEA 2ENJA 4G8GB 4O51A 4XCNA 4ZOAA 3O4OC 1KCUL 2FR4B 4GS7C 5CUSH 4BFIB 3TVMB 5E08L 3F7VB 4EI6A 1XXDC 3ZDXE 1NJ9A 1WVZA 2ZWLT 3WGUB 3U2SB 5ELIA 3LZOA 1KTLB 1RZKH 3QG6A 1P4UA 3U7WH 3SODB 4G1MB 3MV7B 1OZTG 5GSRA 1QLEH 5F9WC 4PJ8D 1CURA 4NHCH 2BSRA 1H3XA 4N28A 3TYFB 5C9JB 4ERSH 2Z8WC 1RUQH 3IDYB 1N18A 4DP6X 3EO0B 1PZ2A 3MUHL 3QJZA 3UTSE 2JJSC 1UM5H 2OMXB 3S3PA 3FQ1A 4I0PC 3PP3H 3EJJX 1A7NL 1BJMA 1QYGH 1DR9A 5EA0L 4ZPVA 3OKNA 3BP4A 4GG6B 4JQIA 1P53A 3DBSA 5F96L 1MCSA 2B1AL 4KVNL 4P5TD 5AG9A 2B4CC 4M6OL 3MRPA 3ZN6A 4MJJA 3LS4H 5HHOA 1FJ1A 4A7SA 4ADIA 4MVBC 2NXZB 2V2TB 1KACB 3II3A 3KNBA 4HCFA 2A74B 4M4RB 4JQVA 5EUKB 2XA3A 1OTTD 2G60H 1TTGA 3ISYA 1G1KA 1H19A 5H37H 3VI3F 4IDLA 1FLRL 2BNRA 3PUUA 1QPPA 2GTZB 2NW3B 2AGJH 4NZTH 3OKDA 1QKZL 2VLJE 1JZ2A 4M29A 2W0FB 1PLCA 5CSGA 3GMMA 1PYWB 2VOTA 5J12C 2K45A 5DDHA 5BZZA 5E24E 3X13B 4OM1H 1PLAA 1S9WB 3E9TA 3SYOA 4Z7WF 5HYEA 1T5KA 4Z7UA 2F19H 3MGAA 3BWUC 3VNYA 1CXFA 4QHKJ 2IANA 1ZT1B 1RIUH 1BP3B 4KMTL 4PS8A 2R2EA 3U1SL 2YA2A 3LTVA 4FX5A 5E5MA 3HOGA 1MWAB 3VG0L 4PUBH 4TSAL 4G7VL 1UB5A 3ECVA 3HG1B 3WS6A 4JFDE 3STBA 4O2EB 4KO6A 4XHQA 4R4FL 2RAMA 3OPUA 1U95B 4QRPA 4JPSA 4YE4L 3E8UH 3I9GL 4DOHB 4RQQB 3OC8A 3PNRB 4JB9H 3QEQB 3ARDC 2ED6A 3GDCA 2MPAL 3NSXA 1WICA 1OGAA 3QJFA 4HCIA 3U1QA 3L54A 2F1BA 3GMPA 4D0DA 2IVFC 3HC3L 1GKOA 3PV7A 1DLHB 4D7BA 1UH3A 3RILA 3BT2L 2WKLA 3KPOB 1HHJA 3INUH 3QQ4B 3UZEA 3D06A 2X4TB 4KY2A 5DJAA 5DJXA 4XP6H 2HRPH 2JIXA 4PSRA 2J57A 1KJVB 4NPYA 4FFYL 1AXIB 1KELL 1PD6A 1W2KT 3QUXD 3SE4C 3LRGA 2KHAA 2P4AB 2QDVA 1WAPA 4NPJA 3ZHDA 3DSFL 3HC4L 2AABH 1RSFA 1HJBC 4J8QA 1UQSB 4WSJA 1IGCL 4WWKA 2Y22A 4XWGH 5EIIA 2FJGB 5FECB 5J11B 2F54D 4PTTA 4KFZC 5J13B 1RZGA 1GOHA 4LVHC 5CGTA 4LHQB 2HWZH 3L17A 3V9CA 4WI3A 3IGFA 3T3ME 4JK0D 3FL7A 1H8OA 4LSRH 1KJMA 4LVOC 3WL9A 4M48H 3ZUCA 3US0A 1S7VB 4JG9A 4LRNL 5AB1A 5GHWH 2HX9A 1JPSL 5ETUA 4HWBL 1C9SA 3GFUA 1ZLUH 1Z9SA 4PRBA 1CF8H 1JPTH 1XH0A 3MFFB 1DQVA 2WXQA 3P4LA 3QIUD 5D1ZC 3IKCB 4HUKB 1PX3A 3FAWA 4PAZA 3DX7B 2X6VA 4Y4HD 2OJZL 2VB5A 2RHEA 2WMPA 1PZSA 5CD3B 4UOJA 4YVUA 4HOZA 3AADB 1HKLH 3BAIA 4I3RH 4D9RD 4LLVB 3WI9A 3VWKB 5JMOC 2PO6A 3FFCD 4XCFL 1A6AA 4WGKA 3WCYA 2FIKA 3DTDA 5CLTA 5HVWA 3QI9D 2KT6A 2B4CH 2CKBH 2ADGB 3FT4B 2B59A 2K70A 1TITA 3PJSB 1BBJB 2EKSB 2YAFA 3Q3GA 4DZ8A 1QFWI 1JFQL 4XNXH 2OTUA 4U1LB 1JMZA 4ZZFA 3GNMH 1HHIA 2VMFA 4PJ5D 1QFWH 2ZOLB 4FQXB 4P5MA 4WV1B 5BJTB 2P24A 3CD4A 1MG3C 5GRJH 4KJPC 1QFPA 3Q8CA 4CAGA 2EDYA 5GGUA 5DQDL 4AGLA 1CDHA 2JB5H 3VFOB 3GMLA 1ETZB 1TJHH 1VFBA 1BBDH 1J9TA 1KTDA 3LN4B 4PP1C 5EC1B 1D5XB 5C0BD 1XIWC 2J8UA 1BW8A 1E5CA 4XMLL 5D2LF 3PWPD 2R69L 3MRDA 2WTOA 3FT2A 3ZK0A 1S5HA 2ARWA 3WG7B 4ZO8A 1A7OL 2W9DH 1LILA 3VQLA 3V5DB 3B5TA 2DBLL 3LZFL 5DHYA 2H41A 3V6ZA 3K2KA 4X80H 3D69B 1ZLWH 2CJUH 1R33A 4FNSA 1L4IA 2J1XA 1E5ZA 4DP5X 3KBPA 3O6MH 1YPZE 4I18C 5JW5B 1TTBA 1IEBB 1NGYB 3F5WB 3X3GL 4HA1A 3KWTA 3CSTA 4L1LA 4AXWA 2I7OA 1KG0B 3ME0B 2H8PA 1EDHA 2UWEB 4O2FA 5AYUL 5H8DA 1Y1UA 1CDCA 2YRLA 5EUOE 3PGCA 1K5NA 1MZZA 3CDZA 4XC3H 2EADA 5MENB 4LGRB 5CMAB 5D1XC 5FO2A 1ID5I 1MCNA 1YY8A 5KZCD 5AL0A 1QR4A 4N1EA 1WFTA 1AXSA 3APDA 3HZVA 4PJ7E 4U0QB 4LCIH 4JHWL 4GQ9H 1FZJB 3OTTA 3KWVA 2K78A 3RIFK 2IC2A 4JRYE 6PCYA 2QMKA 3NN8B 4ORGA 5DJ0A 3LKNA 2MJWA 4IRJC 1WWAX 4Z7VF 4GW4B 2WVUA 4HWUA 1I9RL 2PYEA 3LKRA 3TBTB 1UWXH 4JDVB 3R7QA 1TF4A 2XKNB 1NLBH 3KWXA 4XXCC 2VT0A 2DIEA 4HWNA 3TF4A 1X9RA 3LKPB 1HIMH 2A83A 5CGYD 5HGHB 2ORBL 1KYOK 1J05A 1S8DA 4APXA 5E8EA 1CTOA 3VI4A 4FRWA 3M86A 4JRFA 1T20A 1NMAL 2BSTB 5CEZD 2XPYA 3ZHNA 1WP6A 1WAAF 2AV1A 4F5CE 4I9XA 1MREH 1EMTL 1VIWA 1T0PB 5D1QA 1KPUB 3LCYA 5F3HA 1F2QA 1YC7A 3K6OA 5ADPH 1QSFA 5JNYB 4WW2A 1JZJA 1CFVH 4P46B 1NPJA 4OZFA 5AG8A 2AEQH 1CLZH 1XR9B 5KVDL 2VLLA 3EHBB 3IF1A 1MLBA 4HQQH 2APFA 2BHZA 3BUPA 3QXAA 2CNZA 4FYTA 1WISA 4PIRF 5LGJA 2OSLA 3EOBB 4WHCA 5T3ZD 4NN6B 2X4OA 5TDOA 4Z7VE 1B4JL 1SXZA 5D7JD 2BH0A 5I1AA 1EV2E 1INEL 5LXGL 4BZ2H 1CDYA 5AQ0A 2XACC 5FM4A 4ZS7L 4POYA 1RIVL 3KPQB 3UJIH 3WXWH 2AJYL 4F9PA 3ZQXA 1PL3A 2X44D 3RZCC 2M1KA 4MXQC 4RDQG 1G5AA 3NAAH 1Z66A 2RFXB 3QUYC 5E2UH 4XH2B 4OLXH 3A6OA 2XIIA 2VXTH 3DHUA 4HC1L 3TZVD 5B8CC 1EFQA 3KPSE 2NY0C 2IDCA 2ZKWA 1WHOA 1R3HA 2BCMA 4LSQL 5EZIL 2BJMH 5IV2A 5AVRB 5KSBB 3OWEA 1EXHA 4QY8B 3C09C 4WAFA 1GH7A 1ZS2A 3O11B 2P9RA 4V1DB 4WVRA 5D9SB 4XHJC 2AQQA 3MODH 3FQUB 2BS8A 4L4VB 3VG9B 3FDWA 1BMZA 5KAQG 1JF5A 5KYXA 4KVCH 4AIXA 4PJGB 5D96B 5AW0B 3S96B 3S3JA 1OWRM 3ARFA 3CFDB 3H7BB 3NCFB 4P2YA 5SX4H 5D1XE 2VSKB 3CFJB 1E67A 2HX8A 2WXPA 1O5PA 1PFOA 2XV6B 3O2DL 3O6KH 4GI6A 4QRTA 4X98B 1YAIA 5E4OA 5FOBA 5D7IF 3VD1A 3CK0H 4PJDA 4FJYA 2CDFB 2CIKB 1AIFB 5T1DL 1TZGH 1SM3L 4K3GA 4ZI8A 2V6HA 3BOVA 3D08A 5IESL 1UZ8A 2PTVA 2Q3AA 5LBSH 3LVTA 4KUCF 4UQ3A 4H8PA 3N9GH 1KTCA 2WW8A 2BC4A 1A0QH 1ZHBA 3L45A 2R23B 2H3KA 1B4TA 5GGRA 1TKWA 5HI5C 4N2NA 3RURA 3VE0A 3WKML 2FEDC 4JJOA 5INCB 2H4EA 1Y18A 3TT3L 3ZE2F 1CF1A 1UGNA 2UY6B 2XV2A 2HRGA 3PQYD 5HYJB 2B16A 1PQZB 4KK5D 4OJFL 1T21B 3GHPA 4K2UH 2AXFA 5AZEH 1OD9A 1U92A 4PJ9C 4X0KB 4LGPB 3UL4A 1OHQA 4CVWA 3FCTB 3JYCA 5AAWA 4YLBA 3ARWA 4GRLB 4HK3J 1J0JA 3EGDA 1J8HA 3ZZQA 1V54B 3BD4A 4YXKL 4LEXL 3B37A 4DW2L 3HUJA 1MFBH 4FLHA 1URZA 3KPLB 1M9WA 1FP5A 3TCXA 3SGDI 1PMYA 3X14B 3HC2A 4MX7A 5ANHA 4ZZKA 1ILUA 3B5GA 3F85A 4YSTA 5CP7B 3OMNB 2QKIA 4MJ5B 4Y5VC 3SGDH 3DURA 4U4IA 3U0TA 4N6RA 5IJVA 2X4UA 2WXHA 2HUEA 3HS0C 2L4OA 5GPRA 4M5SA 3GSWB 2VDML 3G5XB 2CG9X 3OKOA 2YUWA 4JN2B 5D71H 4QRAA 4W9DC 3B1TA 2X9YA 3ZT6A 1XGPA 3W11D 4NM4H 2QPUA 4TTDD 3V9EA 3RWHA 5K9QG 2ZXDA 1IAII 3C08H 5IMMB 2A9MH 2CMRL 4GO6B 5I1HH 3IFNH 1KN4L 3L2MA 5SWSB 5SX5K 5E23A 3ZE2E 1BD2D 2LLLA 2XWXA 1IC7L 3WFHA 1IAIH 2XJLA 4IBQA 2BOCB 5JHDD 1JDDA 2F53E 3CHXA 3HN3A 3EJCA 1OM9A 1S6NA 1BVNT 3NFPA 5I0YA 1QRNB 2ZWKA 3HPJB 1AO7A 4LLUA 4NC1C 3MGTB 2R7EB 2ESVE 2QTVA 4KUZL 4QLRA 5DI8B 3D1MC 1DO6A 1GCFA 1FNHA 4QMEA 3PIQB 3LZNA 1II4E 1BZ8A 4R0LA 3E8VA 4E41B 4JFUA 4P49A 4DCQA 3KGTA 4OUUB 1YQVL 1HXMA 3B3IA 1MHEA 5IVZB 5AVSB 3BP7A 5C0IB 5B3JF 3ETTA 1M71A 2C1PB 3NRQA 3EBIA 2IOIA 3D85B 2DWEB 2HVBA 4F24A 2DM3A 1LJMA 1JHKH 1ADQA 5FHBH 5IG7B 5I1EH 4MJIB 2ZXAA 2QV4A 4XBPB 1K6QH 3O3AA 2YGVA 4R5TA 3CXDL 4PGEA 3CIQA 2EJ1A 4X4XB 2P49B 2E9WA 4PI2A 2GSIA 4HKZB 4LF3B 5KJ7E 3JV6A 3EYSL 4XNQA 5DFWH 2D3LA 3X1GA 4F9LC 4P3CL 4QAMB 4I5BB 4S10A 4JJ5A 3C9NA 2UUDH 2VIRA 4JDZA 2ALAA 5E6UB 1DDHA 3LSOA 1BEYH 3NSYA 3MFGB 5HPOA 4P2OA 1VSCA 2V37A 3ES6A 4W9HC 1QTPA 2ICWI 3LPFA 1X5LA 2ARJA 3MYJB 4M6MH 4Y5XB 1E9PA 1FORL 2LR4A 3V4PB 5B3JE 2YQGA 4NZFA 3UTZA 4F7PA 3QDMD 4HXAH 5BS0E 3CWGA 3KCPA 3MJWA 1L0YA 5CEYB 5TPWL 3PU7A 2VJ0A 3P02A 1U8LA 3K6DA 3WN5A 2BNQA 3IMSA 2UXVA 3CZJA 2VR7A 1CIUA 3GRWA 1JZ7A 2YD9A 4N22A 4HLZG 5IWLC 3QNZB 4M7JH 2CBQA 2FJUB 2YC1B 1RJYA 1U8JA 2L7JA 2X9XA 1KEGH 2I69A 3FT1A 5AOJA 3OC5A 4I1RA 1CICC 4ZRGA 4FG4A 5D2NB 3GM0A 2WKOA 4BCXA 5BVJA 2WQXA 4PJCA 3KBFA 4QRFA 2BFVL 2XX1A 4HJGA 4TQEH 4NQEA 4MKMA 4FHJA 2AK4E 4WU5B 4L9LC 1OPGL 5ABZA 3D2UB 2AK1L 3GIZH 3VGEA 2JWYA 3B9DA 2FUQA 4XN2A 5ISZD 2MCPL 2BVOB 5C0DB 1H5BC 1RZ7H 5JW3L 4QRQB 1I9IH 4UQDA 1NPNA 5FYKD <