4ZJSA

Crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing the main immunogenic region (mir) from the human alpha 1 subunit of the muscle nicotinic acetylcholine receptor in complex with anatoxin-a.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
206
structure length
206
Chain Sequence
EHETRLVAKLFKDYSSVVRPVEDHRQVVEVTLGFTLQDIVKADSSTNEVDLVYYEQQRWVDYNLKWNPDDYGGVKKIHIPAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine receptor subunit alpha,Soluble acetylcholine r
publication title Main immunogenic region structure promotes binding of conformation-dependent myasthenia gravis autoantibodies, nicotinic acetylcholine receptor conformation maturation, and agonist sensitivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 206
sequence length 206
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zjsA00
4UY2A 4LMLA 5AFJA 5SYOA 4COFA 2WN9A 3JADA 5CFBA 2BR7A 1UX2A 3TLVA 5HEJA 5HEGA 4HFCA 5HEUA 3UU8A 3ZKRA 4ZK1A 3EI0A 4IL4A 3WIPA 4XHEA 4ILCA 2BYQA 2XQ3A 5L4HA 4HQPA 2Y54A 4ZR6A 3SQ6A 4UM3S 2XQ5A 2Y56A 2BG9A 2YMDA 3SIOA 4BFQA 3U8LA 2XQ9A 2BYSA 5AFNA 2WNCA 4TWFA 5HEOA 3LSVA 3WTJA 4TWDA 3UUBA 3TLWA 5L4EA 2Y57A 5AFMA 2UZ6A 2BJ0A 2ZJUA 3RQUA 3SQ9A 3ZDHA 2XNVA 3UU5A 4AFTA 3RI5A 4PIRA 2C9TA 2XZ6A 2XQAA 3TLTA 4B5DA 2XQ7A 3UU6A 3UU3A 4XK9A 3IGQA 4QH1A 4ZK4A 5AFMB 4Z91A 5CO5A 2XNTA 3RHWA 3C84A 3RIFA 5AINA 3P50A 2XYSA 4NPPA 4ZJSA 1I9BA 2BR8A 4QACA 4QH4A 5AFKA 3U8JA 5KE4A 4TNWA 5JMEA 2BG9C 5AFLA 4QABA 4EZ1A 5LG3A 5FJVA 4LMKA 4HFDA 4AFHA 2X00A 2YOEA 5J5FA 2PGZA 3U8NA 3WTHA 3EHZA 2Y7YA 2QC1B 3P4WA 2WZYA 2YMEA 2VL0A 4IREA 3WTLA 2X00D 4Z90A 2XQ8A 4ILAA 4AFGA 5L47A 5J0ZA 4HFBA 2W8FA 5J5HA 5J5IA 4F8HA 2Y58A 4HFIA 3SH1A 3WTOA 4UM1A 2XNUA 2XQ6A 4ILBA 5KZUA 3UQ4A 2BYPA 3GUAA 4LMJA 1UV6A 2YKSA 4A98A 4ZZCA 3U8MA 3WTIA 4A97A 2BYNA 3PEOA 3TLUA 2XZ5A 4UM3A 3WTMA 3PMZA 4HFHA 5HEHA 2ZJVA 3WTNA 3ZDGA 2WNLA 3JAEA 5BRXA 4ZJTA 3JAFA 2WNJA 4NZBA 4UM3P 3RQWA 2XYTA 4X5TA 4UXUA 5HCJA 5HCMA 4TWHA 2BYRA 2XQ4A 4D01A 4TNVA 3U8KA 2W8GA 3C79A 5BW2A 4ZRUA 5AFHA 3WTKA 3T4MA 4ALXA 3RIAA 4ZZBA 4FRRA 2BG9E 5TVCA 4BQTA 5BP0A 5IUXA 5J5GA 3UU4A 4IL9A 3TLSA 4HFEA 4QH5A 3UQ7A 4QAAA 2BG9B 4DBMA 1UW6A 2YN6A 4WV9A 2PH9A 5LXBA 3EAMA
chains in the Genus database with same CATH superfamily
4UY2A 4LMLA 5AFJA 5SYOA 4COFA 2WN9A 3JADA 5CFBA 2BR7A 1UX2A 3TLVA 5HEJA 5HEGA 4HFCA 5HEUA 3UU8A 3ZKRA 4ZK1A 3EI0A 4IL4A 3WIPA 4XHEA 4ILCA 2BYQA 2XQ3A 5L4HA 4HQPA 2Y54A 4ZR6A 3SQ6A 4UM3S 2XQ5A 2Y56A 2BG9A 2YMDA 3SIOA 4BFQA 3U8LA 2XQ9A 2BYSA 5AFNA 2WNCA 4TWFA 5HEOA 3LSVA 3WTJA 4TWDA 3UUBA 3TLWA 5L4EA 2Y57A 5AFMA 2UZ6A 2BJ0A 2ZJUA 3RQUA 3SQ9A 3ZDHA 2XNVA 3UU5A 4AFTA 3RI5A 4PIRA 2C9TA 2XZ6A 2XQAA 3TLTA 4B5DA 2XQ7A 3UU6A 3UU3A 4XK9A 3IGQA 4QH1A 4ZK4A 5AFMB 4Z91A 5CO5A 2XNTA 3RHWA 3C84A 3RIFA 5AINA 3P50A 2XYSA 4NPPA 4ZJSA 1I9BA 2BR8A 4QACA 4QH4A 5AFKA 3U8JA 5KE4A 4TNWA 5JMEA 2BG9C 5AFLA 4QABA 4EZ1A 5LG3A 5FJVA 4LMKA 4HFDA 4AFHA 2X00A 2YOEA 5J5FA 2PGZA 3U8NA 3WTHA 3EHZA 2Y7YA 2QC1B 3P4WA 2WZYA 2YMEA 2VL0A 4IREA 3WTLA 2X00D 4Z90A 2XQ8A 4ILAA 4AFGA 5L47A 5J0ZA 4HFBA 2W8FA 5J5HA 5J5IA 4F8HA 2Y58A 4HFIA 3SH1A 3WTOA 4UM1A 2XNUA 2XQ6A 4ILBA 5KZUA 3UQ4A 2BYPA 3GUAA 4LMJA 1UV6A 2YKSA 4A98A 4ZZCA 3U8MA 3WTIA 4A97A 2BYNA 3PEOA 3TLUA 2XZ5A 4UM3A 3WTMA 3PMZA 4HFHA 5HEHA 2ZJVA 3WTNA 3ZDGA 2WNLA 3JAEA 5BRXA 4ZJTA 3JAFA 2WNJA 4NZBA 4UM3P 3RQWA 2XYTA 4X5TA 4UXUA 5HCJA 5HCMA 4TWHA 2BYRA 2XQ4A 4D01A 4TNVA 3U8KA 2W8GA 3C79A 5BW2A 4ZRUA 5AFHA 3WTKA 3T4MA 4ALXA 3RIAA 4ZZBA 4FRRA 2BG9E 5TVCA 4BQTA 5BP0A 5IUXA 5J5GA 3UU4A 4IL9A 3TLSA 4HFEA 4QH5A 3UQ7A 4QAAA 2BG9B 4DBMA 1UW6A 2YN6A 4WV9A 2PH9A 5LXBA 3EAMA
chains in the Genus database with same CATH topology
4UY2A 4LMLA 5AFJA 5SYOA 4COFA 2WN9A 3JADA 5CFBA 2BR7A 1UX2A 3TLVA 5HEJA 5HEGA 4HFCA 5HEUA 3UU8A 3ZKRA 4ZK1A 3EI0A 4IL4A 3WIPA 4XHEA 4ILCA 2BYQA 2XQ3A 5L4HA 4HQPA 2Y54A 4ZR6A 3SQ6A 4UM3S 2XQ5A 2Y56A 2BG9A 2YMDA 3SIOA 4BFQA 3U8LA 2XQ9A 2BYSA 5AFNA 2WNCA 4TWFA 5HEOA 3LSVA 3WTJA 4TWDA 3UUBA 3TLWA 5L4EA 2Y57A 5AFMA 2UZ6A 2BJ0A 2ZJUA 3RQUA 3SQ9A 3ZDHA 2XNVA 3UU5A 4AFTA 3RI5A 4PIRA 2C9TA 2XZ6A 2XQAA 3TLTA 4B5DA 2XQ7A 3UU6A 3UU3A 4XK9A 3IGQA 4QH1A 4ZK4A 5AFMB 4Z91A 5CO5A 2XNTA 3RHWA 3C84A 3RIFA 5AINA 3P50A 2XYSA 4NPPA 4ZJSA 1I9BA 2BR8A 4QACA 4QH4A 5AFKA 3U8JA 5KE4A 4TNWA 5JMEA 2BG9C 5AFLA 4QABA 4EZ1A 5LG3A 5FJVA 4LMKA 4HFDA 4AFHA 2X00A 2YOEA 5J5FA 2PGZA 3U8NA 3WTHA 3EHZA 2Y7YA 2QC1B 3P4WA 2WZYA 2YMEA 2VL0A 4IREA 3WTLA 2X00D 4Z90A 2XQ8A 4ILAA 4AFGA 5L47A 5J0ZA 4HFBA 2W8FA 5J5HA 5J5IA 4F8HA 2Y58A 4HFIA 3SH1A 3WTOA 4UM1A 2XNUA 2XQ6A 4ILBA 5KZUA 3UQ4A 2BYPA 3GUAA 4LMJA 1UV6A 2YKSA 4A98A 4ZZCA 3U8MA 3WTIA 4A97A 2BYNA 3PEOA 3TLUA 2XZ5A 4UM3A 3WTMA 3PMZA 4HFHA 5HEHA 2ZJVA 3WTNA 3ZDGA 2WNLA 3JAEA 5BRXA 4ZJTA 3JAFA 2WNJA 4NZBA 4UM3P 3RQWA 2XYTA 4X5TA 4UXUA 5HCJA 5HCMA 4TWHA 2BYRA 2XQ4A 4D01A 4TNVA 3U8KA 2W8GA 3C79A 5BW2A 4ZRUA 5AFHA 3WTKA 3T4MA 4ALXA 3RIAA 4ZZBA 4FRRA 2BG9E 5TVCA 4BQTA 5BP0A 5IUXA 5J5GA 3UU4A 4IL9A 3TLSA 4HFEA 4QH5A 3UQ7A 4QAAA 2BG9B 4DBMA 1UW6A 2YN6A 4WV9A 2PH9A 5LXBA 3EAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY2 A;  4LML A;  5AFJ A;  5SYO A;  4COF A;  2WN9 A;  3JAD A;  5CFB A;  2BR7 A;  1UX2 A;  3TLV A;  5HEJ A;  5HEG A;  4HFC A;  5HEU A;  3UU8 A;  3ZKR A;  4ZK1 A;  3EI0 A;  4IL4 A;  3WIP A;  4XHE A;  4ILC A;  2BYQ A;  2XQ3 A;  5L4H A;  4HQP A;  2Y54 A;  4ZR6 A;  3SQ6 A;  4UM3 S;  2XQ5 A;  2Y56 A;  2BG9 A;  2YMD A;  3SIO A;  4BFQ A;  3U8L A;  2XQ9 A;  2BYS A;  5AFN A;  2WNC A;  4TWF A;  5HEO A;  3LSV A;  3WTJ A;  4TWD A;  3UUB A;  3TLW A;  5L4E A;  2Y57 A;  5AFM A;  2UZ6 A;  2BJ0 A;  2ZJU A;  3RQU A;  3SQ9 A;  3ZDH A;  2XNV A;  3UU5 A;  4AFT A;  3RI5 A;  4PIR A;  2C9T A;  2XZ6 A;  2XQA A;  3TLT A;  4B5D A;  2XQ7 A;  3UU6 A;  3UU3 A;  4XK9 A;  3IGQ A;  4QH1 A;  4ZK4 A;  5AFM B;  4Z91 A;  5CO5 A;  2XNT A;  3RHW A;  3C84 A;  3RIF A;  5AIN A;  3P50 A;  2XYS A;  4NPP A;  4ZJS A;  1I9B A;  2BR8 A;  4QAC A;  4QH4 A;  5AFK A;  3U8J A;  5KE4 A;  4TNW A;  5JME A;  2BG9 C;  5AFL A;  4QAB A;  4EZ1 A;  5LG3 A;  5FJV A;  4LMK A;  4HFD A;  4AFH A;  2X00 A;  2YOE A;  5J5F A;  2PGZ A;  3U8N A;  3WTH A;  3EHZ A;  2Y7Y A;  2QC1 B;  3P4W A;  2WZY A;  2YME A;  2VL0 A;  4IRE A;  3WTL A;  2X00 D;  4Z90 A;  2XQ8 A;  4ILA A;  4AFG A;  5L47 A;  5J0Z A;  4HFB A;  2W8F A;  5J5H A;  5J5I A;  4F8H A;  2Y58 A;  4HFI A;  3SH1 A;  3WTO A;  4UM1 A;  2XNU A;  2XQ6 A;  4ILB A;  5KZU A;  3UQ4 A;  2BYP A;  3GUA A;  4LMJ A;  1UV6 A;  2YKS A;  4A98 A;  4ZZC A;  3U8M A;  3WTI A;  4A97 A;  2BYN A;  3PEO A;  3TLU A;  2XZ5 A;  4UM3 A;  3WTM A;  3PMZ A;  4HFH A;  5HEH A;  2ZJV A;  3WTN A;  3ZDG A;  2WNL A;  3JAE A;  5BRX A;  4ZJT A;  3JAF A;  2WNJ A;  4NZB A;  4UM3 P;  3RQW A;  2XYT A;  4X5T A;  4UXU A;  5HCJ A;  5HCM A;  4TWH A;  2BYR A;  2XQ4 A;  4D01 A;  4TNV A;  3U8K A;  2W8G A;  3C79 A;  5BW2 A;  4ZRU A;  5AFH A;  3WTK A;  3T4M A;  4ALX A;  3RIA A;  4ZZB A;  4FRR A;  2BG9 E;  5TVC A;  4BQT A;  5BP0 A;  5IUX A;  5J5G A;  3UU4 A;  4IL9 A;  3TLS A;  4HFE A;  4QH5 A;  3UQ7 A;  4QAA A;  2BG9 B;  4DBM A;  1UW6 A;  2YN6 A;  4WV9 A;  2PH9 A;  5LXB A;  3EAM A; 
#chains in the Genus database with same CATH topology
 4UY2 A;  4LML A;  5AFJ A;  5SYO A;  4COF A;  2WN9 A;  3JAD A;  5CFB A;  2BR7 A;  1UX2 A;  3TLV A;  5HEJ A;  5HEG A;  4HFC A;  5HEU A;  3UU8 A;  3ZKR A;  4ZK1 A;  3EI0 A;  4IL4 A;  3WIP A;  4XHE A;  4ILC A;  2BYQ A;  2XQ3 A;  5L4H A;  4HQP A;  2Y54 A;  4ZR6 A;  3SQ6 A;  4UM3 S;  2XQ5 A;  2Y56 A;  2BG9 A;  2YMD A;  3SIO A;  4BFQ A;  3U8L A;  2XQ9 A;  2BYS A;  5AFN A;  2WNC A;  4TWF A;  5HEO A;  3LSV A;  3WTJ A;  4TWD A;  3UUB A;  3TLW A;  5L4E A;  2Y57 A;  5AFM A;  2UZ6 A;  2BJ0 A;  2ZJU A;  3RQU A;  3SQ9 A;  3ZDH A;  2XNV A;  3UU5 A;  4AFT A;  3RI5 A;  4PIR A;  2C9T A;  2XZ6 A;  2XQA A;  3TLT A;  4B5D A;  2XQ7 A;  3UU6 A;  3UU3 A;  4XK9 A;  3IGQ A;  4QH1 A;  4ZK4 A;  5AFM B;  4Z91 A;  5CO5 A;  2XNT A;  3RHW A;  3C84 A;  3RIF A;  5AIN A;  3P50 A;  2XYS A;  4NPP A;  4ZJS A;  1I9B A;  2BR8 A;  4QAC A;  4QH4 A;  5AFK A;  3U8J A;  5KE4 A;  4TNW A;  5JME A;  2BG9 C;  5AFL A;  4QAB A;  4EZ1 A;  5LG3 A;  5FJV A;  4LMK A;  4HFD A;  4AFH A;  2X00 A;  2YOE A;  5J5F A;  2PGZ A;  3U8N A;  3WTH A;  3EHZ A;  2Y7Y A;  2QC1 B;  3P4W A;  2WZY A;  2YME A;  2VL0 A;  4IRE A;  3WTL A;  2X00 D;  4Z90 A;  2XQ8 A;  4ILA A;  4AFG A;  5L47 A;  5J0Z A;  4HFB A;  2W8F A;  5J5H A;  5J5I A;  4F8H A;  2Y58 A;  4HFI A;  3SH1 A;  3WTO A;  4UM1 A;  2XNU A;  2XQ6 A;  4ILB A;  5KZU A;  3UQ4 A;  2BYP A;  3GUA A;  4LMJ A;  1UV6 A;  2YKS A;  4A98 A;  4ZZC A;  3U8M A;  3WTI A;  4A97 A;  2BYN A;  3PEO A;  3TLU A;  2XZ5 A;  4UM3 A;  3WTM A;  3PMZ A;  4HFH A;  5HEH A;  2ZJV A;  3WTN A;  3ZDG A;  2WNL A;  3JAE A;  5BRX A;  4ZJT A;  3JAF A;  2WNJ A;  4NZB A;  4UM3 P;  3RQW A;  2XYT A;  4X5T A;  4UXU A;  5HCJ A;  5HCM A;  4TWH A;  2BYR A;  2XQ4 A;  4D01 A;  4TNV A;  3U8K A;  2W8G A;  3C79 A;  5BW2 A;  4ZRU A;  5AFH A;  3WTK A;  3T4M A;  4ALX A;  3RIA A;  4ZZB A;  4FRR A;  2BG9 E;  5TVC A;  4BQT A;  5BP0 A;  5IUX A;  5J5G A;  3UU4 A;  4IL9 A;  3TLS A;  4HFE A;  4QH5 A;  3UQ7 A;  4QAA A;  2BG9 B;  4DBM A;  1UW6 A;  2YN6 A;  4WV9 A;  2PH9 A;  5LXB A;  3EAM A; 
#chains in the Genus database with same CATH homology
 4UY2 A;  4LML A;  5AFJ A;  5SYO A;  4COF A;  2WN9 A;  3JAD A;  5CFB A;  2BR7 A;  1UX2 A;  3TLV A;  5HEJ A;  5HEG A;  4HFC A;  5HEU A;  3UU8 A;  3ZKR A;  4ZK1 A;  3EI0 A;  4IL4 A;  3WIP A;  4XHE A;  4ILC A;  2BYQ A;  2XQ3 A;  5L4H A;  4HQP A;  2Y54 A;  4ZR6 A;  3SQ6 A;  4UM3 S;  2XQ5 A;  2Y56 A;  2BG9 A;  2YMD A;  3SIO A;  4BFQ A;  3U8L A;  2XQ9 A;  2BYS A;  5AFN A;  2WNC A;  4TWF A;  5HEO A;  3LSV A;  3WTJ A;  4TWD A;  3UUB A;  3TLW A;  5L4E A;  2Y57 A;  5AFM A;  2UZ6 A;  2BJ0 A;  2ZJU A;  3RQU A;  3SQ9 A;  3ZDH A;  2XNV A;  3UU5 A;  4AFT A;  3RI5 A;  4PIR A;  2C9T A;  2XZ6 A;  2XQA A;  3TLT A;  4B5D A;  2XQ7 A;  3UU6 A;  3UU3 A;  4XK9 A;  3IGQ A;  4QH1 A;  4ZK4 A;  5AFM B;  4Z91 A;  5CO5 A;  2XNT A;  3RHW A;  3C84 A;  3RIF A;  5AIN A;  3P50 A;  2XYS A;  4NPP A;  4ZJS A;  1I9B A;  2BR8 A;  4QAC A;  4QH4 A;  5AFK A;  3U8J A;  5KE4 A;  4TNW A;  5JME A;  2BG9 C;  5AFL A;  4QAB A;  4EZ1 A;  5LG3 A;  5FJV A;  4LMK A;  4HFD A;  4AFH A;  2X00 A;  2YOE A;  5J5F A;  2PGZ A;  3U8N A;  3WTH A;  3EHZ A;  2Y7Y A;  2QC1 B;  3P4W A;  2WZY A;  2YME A;  2VL0 A;  4IRE A;  3WTL A;  2X00 D;  4Z90 A;  2XQ8 A;  4ILA A;  4AFG A;  5L47 A;  5J0Z A;  4HFB A;  2W8F A;  5J5H A;  5J5I A;  4F8H A;  2Y58 A;  4HFI A;  3SH1 A;  3WTO A;  4UM1 A;  2XNU A;  2XQ6 A;  4ILB A;  5KZU A;  3UQ4 A;  2BYP A;  3GUA A;  4LMJ A;  1UV6 A;  2YKS A;  4A98 A;  4ZZC A;  3U8M A;  3WTI A;  4A97 A;  2BYN A;  3PEO A;  3TLU A;  2XZ5 A;  4UM3 A;  3WTM A;  3PMZ A;  4HFH A;  5HEH A;  2ZJV A;  3WTN A;  3ZDG A;  2WNL A;  3JAE A;  5BRX A;  4ZJT A;  3JAF A;  2WNJ A;  4NZB A;  4UM3 P;  3RQW A;  2XYT A;  4X5T A;  4UXU A;  5HCJ A;  5HCM A;  4TWH A;  2BYR A;  2XQ4 A;  4D01 A;  4TNV A;  3U8K A;  2W8G A;  3C79 A;  5BW2 A;  4ZRU A;  5AFH A;  3WTK A;  3T4M A;  4ALX A;  3RIA A;  4ZZB A;  4FRR A;  2BG9 E;  5TVC A;  4BQT A;  5BP0 A;  5IUX A;  5J5G A;  3UU4 A;  4IL9 A;  3TLS A;  4HFE A;  4QH5 A;  3UQ7 A;  4QAA A;  2BG9 B;  4DBM A;  1UW6 A;  2YN6 A;  4WV9 A;  2PH9 A;  5LXB A;  3EAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...