4ZJTA

X-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (lsachbp) in complex with 2-thiophenylmethylene anabaseine (2tab)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
212
Chain Sequence
DDDDKLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPNSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (LsAChBP) in complex with 2-Thiophenylmethylene Anabaseine (2TAB)
rcsb
source organism Lymnaea stagnalis
molecule tags Acetylcholine binding protein
total genus 49
structure length 212
sequence length 215
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4zjtA00
2YMDA 3UQ4A 3EAMA 2C9TA 1I9BA 5SYOA 5FJVA 2XQAA 4BQTA 2BYQA 3EHZA 2BG9B 4EZ1A 3UU4A 5HEUA 2BG9C 4HFEA 5BRXA 3SH1A 2XQ8A 4Z90A 4TNVA 4UM3S 4ILCA 5HCMA 2BYPA 3C79A 3UQ7A 3UU5A 3C84A 4XHEA 4BFQA 3JADA 3TLTA 3ZKRA 1UV6A 2BYSA 2XZ5A 5KE4A 2W8FA 3WTLA 5LXBA 5AFLA 3ZDHA 3P4WA 2W8GA 4QH4A 4LMLA 3UUBA 3UU6A 5IUXA 5L4HA 1UW6A 5CO5A 5J5FA 3WTJA 4ZK4A 5JMEA 4HFHA 4UM1A 3WTOA 4F8HA 4XK9A 5KZUA 4ZR6A 2ZJVA 2BR8A 2XNTA 4IREA 5BW2A 4IL9A 4TWFA 4UM3P 3WTKA 5AFJA 4A97A 2QC1B 4ILBA 4TWHA 5AFMA 4B5DA 2WNJA 4AFTA 4TNWA 5L4EA 4QH1A 4UXUA 4COFA 4LMJA 4X5TA 3WIPA 4AFGA 2XNVA 4A98A 5AFNA 5LG3A 4LMKA 3RHWA 4ZZCA 5CFBA 2Y7YA 3SIOA 4ILAA 2Y58A 4Z91A 5AFMB 2BG9E 2X00D 2XQ3A 3U8MA 5AINA 2BR7A 3UU3A 2ZJUA 4ZK1A 2XQ6A 3U8JA 3SQ6A 5AFHA 4HQPA 3WTIA 4ZJTA 2BYRA 3ZDGA 4PIRA 5BP0A 2WNLA 5HEGA 2XQ4A 3T4MA 2XYSA 2WNCA 2PGZA 4WV9A 5L47A 3U8KA 2WN9A 4FRRA 4IL4A 3EI0A 4QACA 2Y57A 2VL0A 2UZ6A 2X00A 5HEJA 2PH9A 3JAFA 5HEHA 3TLSA 4TWDA 3WTHA 2YN6A 4HFDA 3IGQA 2YOEA 2XQ7A 3RQWA 2BJ0A 3PMZA 4UM3A 5TVCA 4ZJSA 5J0ZA 3JAEA 3U8LA 4ZZBA 4NZBA 4NPPA 3RIFA 2XZ6A 2Y56A 5J5GA 3P50A 3TLWA 4DBMA 2XYTA 3RQUA 1UX2A 3WTNA 4HFIA 4QAAA 5HCJA 3SQ9A 3GUAA 3U8NA 2YMEA 3TLUA 3UU8A 3RI5A 3PEOA 2XQ5A 2XQ9A 3TLVA 4D01A 2WZYA 5J5HA 5AFKA 4AFHA 3WTMA 3LSVA 4ZRUA 2YKSA 3RIAA 2BG9A 2XNUA 4QH5A 5HEOA 2Y54A 4QABA 4UY2A 2BYNA 4ALXA 5J5IA 4HFBA 4HFCA
chains in the Genus database with same CATH superfamily
2YMDA 3UQ4A 3EAMA 2C9TA 1I9BA 5SYOA 5FJVA 2XQAA 4BQTA 2BYQA 3EHZA 2BG9B 4EZ1A 3UU4A 5HEUA 2BG9C 4HFEA 5BRXA 3SH1A 2XQ8A 4Z90A 4TNVA 4UM3S 4ILCA 5HCMA 2BYPA 3C79A 3UQ7A 3UU5A 3C84A 4XHEA 4BFQA 3JADA 3TLTA 3ZKRA 1UV6A 2BYSA 2XZ5A 5KE4A 2W8FA 3WTLA 5LXBA 5AFLA 3ZDHA 3P4WA 2W8GA 4QH4A 4LMLA 3UUBA 3UU6A 5IUXA 5L4HA 1UW6A 5CO5A 5J5FA 3WTJA 4ZK4A 5JMEA 4HFHA 4UM1A 3WTOA 4F8HA 4XK9A 5KZUA 4ZR6A 2ZJVA 2BR8A 2XNTA 4IREA 5BW2A 4IL9A 4TWFA 4UM3P 3WTKA 5AFJA 4A97A 2QC1B 4ILBA 4TWHA 5AFMA 4B5DA 2WNJA 4AFTA 4TNWA 5L4EA 4QH1A 4UXUA 4COFA 4LMJA 4X5TA 3WIPA 4AFGA 2XNVA 4A98A 5AFNA 5LG3A 4LMKA 3RHWA 4ZZCA 5CFBA 2Y7YA 3SIOA 4ILAA 2Y58A 4Z91A 5AFMB 2BG9E 2X00D 2XQ3A 3U8MA 5AINA 2BR7A 3UU3A 2ZJUA 4ZK1A 2XQ6A 3U8JA 3SQ6A 5AFHA 4HQPA 3WTIA 4ZJTA 2BYRA 3ZDGA 4PIRA 5BP0A 2WNLA 5HEGA 2XQ4A 3T4MA 2XYSA 2WNCA 2PGZA 4WV9A 5L47A 3U8KA 2WN9A 4FRRA 4IL4A 3EI0A 4QACA 2Y57A 2VL0A 2UZ6A 2X00A 5HEJA 2PH9A 3JAFA 5HEHA 3TLSA 4TWDA 3WTHA 2YN6A 4HFDA 3IGQA 2YOEA 2XQ7A 3RQWA 2BJ0A 3PMZA 4UM3A 5TVCA 4ZJSA 5J0ZA 3JAEA 3U8LA 4ZZBA 4NZBA 4NPPA 3RIFA 2XZ6A 2Y56A 5J5GA 3P50A 3TLWA 4DBMA 2XYTA 3RQUA 1UX2A 3WTNA 4HFIA 4QAAA 5HCJA 3SQ9A 3GUAA 3U8NA 2YMEA 3TLUA 3UU8A 3RI5A 3PEOA 2XQ5A 2XQ9A 3TLVA 4D01A 2WZYA 5J5HA 5AFKA 4AFHA 3WTMA 3LSVA 4ZRUA 2YKSA 3RIAA 2BG9A 2XNUA 4QH5A 5HEOA 2Y54A 4QABA 4UY2A 2BYNA 4ALXA 5J5IA 4HFBA 4HFCA
chains in the Genus database with same CATH topology
2YMDA 3UQ4A 3EAMA 2C9TA 1I9BA 5SYOA 5FJVA 2XQAA 4BQTA 2BYQA 3EHZA 2BG9B 4EZ1A 3UU4A 5HEUA 2BG9C 4HFEA 5BRXA 3SH1A 2XQ8A 4Z90A 4TNVA 4UM3S 4ILCA 5HCMA 2BYPA 3C79A 3UQ7A 3UU5A 3C84A 4XHEA 4BFQA 3JADA 3TLTA 3ZKRA 1UV6A 2BYSA 2XZ5A 5KE4A 2W8FA 3WTLA 5LXBA 5AFLA 3ZDHA 3P4WA 2W8GA 4QH4A 4LMLA 3UUBA 3UU6A 5IUXA 5L4HA 1UW6A 5CO5A 5J5FA 3WTJA 4ZK4A 5JMEA 4HFHA 4UM1A 3WTOA 4F8HA 4XK9A 5KZUA 4ZR6A 2ZJVA 2BR8A 2XNTA 4IREA 5BW2A 4IL9A 4TWFA 4UM3P 3WTKA 5AFJA 4A97A 2QC1B 4ILBA 4TWHA 5AFMA 4B5DA 2WNJA 4AFTA 4TNWA 5L4EA 4QH1A 4UXUA 4COFA 4LMJA 4X5TA 3WIPA 4AFGA 2XNVA 4A98A 5AFNA 5LG3A 4LMKA 3RHWA 4ZZCA 5CFBA 2Y7YA 3SIOA 4ILAA 2Y58A 4Z91A 5AFMB 2BG9E 2X00D 2XQ3A 3U8MA 5AINA 2BR7A 3UU3A 2ZJUA 4ZK1A 2XQ6A 3U8JA 3SQ6A 5AFHA 4HQPA 3WTIA 4ZJTA 2BYRA 3ZDGA 4PIRA 5BP0A 2WNLA 5HEGA 2XQ4A 3T4MA 2XYSA 2WNCA 2PGZA 4WV9A 5L47A 3U8KA 2WN9A 4FRRA 4IL4A 3EI0A 4QACA 2Y57A 2VL0A 2UZ6A 2X00A 5HEJA 2PH9A 3JAFA 5HEHA 3TLSA 4TWDA 3WTHA 2YN6A 4HFDA 3IGQA 2YOEA 2XQ7A 3RQWA 2BJ0A 3PMZA 4UM3A 5TVCA 4ZJSA 5J0ZA 3JAEA 3U8LA 4ZZBA 4NZBA 4NPPA 3RIFA 2XZ6A 2Y56A 5J5GA 3P50A 3TLWA 4DBMA 2XYTA 3RQUA 1UX2A 3WTNA 4HFIA 4QAAA 5HCJA 3SQ9A 3GUAA 3U8NA 2YMEA 3TLUA 3UU8A 3RI5A 3PEOA 2XQ5A 2XQ9A 3TLVA 4D01A 2WZYA 5J5HA 5AFKA 4AFHA 3WTMA 3LSVA 4ZRUA 2YKSA 3RIAA 2BG9A 2XNUA 4QH5A 5HEOA 2Y54A 4QABA 4UY2A 2BYNA 4ALXA 5J5IA 4HFBA 4HFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMD A;  3UQ4 A;  3EAM A;  2C9T A;  1I9B A;  5SYO A;  5FJV A;  2XQA A;  4BQT A;  2BYQ A;  3EHZ A;  2BG9 B;  4EZ1 A;  3UU4 A;  5HEU A;  2BG9 C;  4HFE A;  5BRX A;  3SH1 A;  2XQ8 A;  4Z90 A;  4TNV A;  4UM3 S;  4ILC A;  5HCM A;  2BYP A;  3C79 A;  3UQ7 A;  3UU5 A;  3C84 A;  4XHE A;  4BFQ A;  3JAD A;  3TLT A;  3ZKR A;  1UV6 A;  2BYS A;  2XZ5 A;  5KE4 A;  2W8F A;  3WTL A;  5LXB A;  5AFL A;  3ZDH A;  3P4W A;  2W8G A;  4QH4 A;  4LML A;  3UUB A;  3UU6 A;  5IUX A;  5L4H A;  1UW6 A;  5CO5 A;  5J5F A;  3WTJ A;  4ZK4 A;  5JME A;  4HFH A;  4UM1 A;  3WTO A;  4F8H A;  4XK9 A;  5KZU A;  4ZR6 A;  2ZJV A;  2BR8 A;  2XNT A;  4IRE A;  5BW2 A;  4IL9 A;  4TWF A;  4UM3 P;  3WTK A;  5AFJ A;  4A97 A;  2QC1 B;  4ILB A;  4TWH A;  5AFM A;  4B5D A;  2WNJ A;  4AFT A;  4TNW A;  5L4E A;  4QH1 A;  4UXU A;  4COF A;  4LMJ A;  4X5T A;  3WIP A;  4AFG A;  2XNV A;  4A98 A;  5AFN A;  5LG3 A;  4LMK A;  3RHW A;  4ZZC A;  5CFB A;  2Y7Y A;  3SIO A;  4ILA A;  2Y58 A;  4Z91 A;  5AFM B;  2BG9 E;  2X00 D;  2XQ3 A;  3U8M A;  5AIN A;  2BR7 A;  3UU3 A;  2ZJU A;  4ZK1 A;  2XQ6 A;  3U8J A;  3SQ6 A;  5AFH A;  4HQP A;  3WTI A;  4ZJT A;  2BYR A;  3ZDG A;  4PIR A;  5BP0 A;  2WNL A;  5HEG A;  2XQ4 A;  3T4M A;  2XYS A;  2WNC A;  2PGZ A;  4WV9 A;  5L47 A;  3U8K A;  2WN9 A;  4FRR A;  4IL4 A;  3EI0 A;  4QAC A;  2Y57 A;  2VL0 A;  2UZ6 A;  2X00 A;  5HEJ A;  2PH9 A;  3JAF A;  5HEH A;  3TLS A;  4TWD A;  3WTH A;  2YN6 A;  4HFD A;  3IGQ A;  2YOE A;  2XQ7 A;  3RQW A;  2BJ0 A;  3PMZ A;  4UM3 A;  5TVC A;  4ZJS A;  5J0Z A;  3JAE A;  3U8L A;  4ZZB A;  4NZB A;  4NPP A;  3RIF A;  2XZ6 A;  2Y56 A;  5J5G A;  3P50 A;  3TLW A;  4DBM A;  2XYT A;  3RQU A;  1UX2 A;  3WTN A;  4HFI A;  4QAA A;  5HCJ A;  3SQ9 A;  3GUA A;  3U8N A;  2YME A;  3TLU A;  3UU8 A;  3RI5 A;  3PEO A;  2XQ5 A;  2XQ9 A;  3TLV A;  4D01 A;  2WZY A;  5J5H A;  5AFK A;  4AFH A;  3WTM A;  3LSV A;  4ZRU A;  2YKS A;  3RIA A;  2BG9 A;  2XNU A;  4QH5 A;  5HEO A;  2Y54 A;  4QAB A;  4UY2 A;  2BYN A;  4ALX A;  5J5I A;  4HFB A;  4HFC A; 
#chains in the Genus database with same CATH topology
 2YMD A;  3UQ4 A;  3EAM A;  2C9T A;  1I9B A;  5SYO A;  5FJV A;  2XQA A;  4BQT A;  2BYQ A;  3EHZ A;  2BG9 B;  4EZ1 A;  3UU4 A;  5HEU A;  2BG9 C;  4HFE A;  5BRX A;  3SH1 A;  2XQ8 A;  4Z90 A;  4TNV A;  4UM3 S;  4ILC A;  5HCM A;  2BYP A;  3C79 A;  3UQ7 A;  3UU5 A;  3C84 A;  4XHE A;  4BFQ A;  3JAD A;  3TLT A;  3ZKR A;  1UV6 A;  2BYS A;  2XZ5 A;  5KE4 A;  2W8F A;  3WTL A;  5LXB A;  5AFL A;  3ZDH A;  3P4W A;  2W8G A;  4QH4 A;  4LML A;  3UUB A;  3UU6 A;  5IUX A;  5L4H A;  1UW6 A;  5CO5 A;  5J5F A;  3WTJ A;  4ZK4 A;  5JME A;  4HFH A;  4UM1 A;  3WTO A;  4F8H A;  4XK9 A;  5KZU A;  4ZR6 A;  2ZJV A;  2BR8 A;  2XNT A;  4IRE A;  5BW2 A;  4IL9 A;  4TWF A;  4UM3 P;  3WTK A;  5AFJ A;  4A97 A;  2QC1 B;  4ILB A;  4TWH A;  5AFM A;  4B5D A;  2WNJ A;  4AFT A;  4TNW A;  5L4E A;  4QH1 A;  4UXU A;  4COF A;  4LMJ A;  4X5T A;  3WIP A;  4AFG A;  2XNV A;  4A98 A;  5AFN A;  5LG3 A;  4LMK A;  3RHW A;  4ZZC A;  5CFB A;  2Y7Y A;  3SIO A;  4ILA A;  2Y58 A;  4Z91 A;  5AFM B;  2BG9 E;  2X00 D;  2XQ3 A;  3U8M A;  5AIN A;  2BR7 A;  3UU3 A;  2ZJU A;  4ZK1 A;  2XQ6 A;  3U8J A;  3SQ6 A;  5AFH A;  4HQP A;  3WTI A;  4ZJT A;  2BYR A;  3ZDG A;  4PIR A;  5BP0 A;  2WNL A;  5HEG A;  2XQ4 A;  3T4M A;  2XYS A;  2WNC A;  2PGZ A;  4WV9 A;  5L47 A;  3U8K A;  2WN9 A;  4FRR A;  4IL4 A;  3EI0 A;  4QAC A;  2Y57 A;  2VL0 A;  2UZ6 A;  2X00 A;  5HEJ A;  2PH9 A;  3JAF A;  5HEH A;  3TLS A;  4TWD A;  3WTH A;  2YN6 A;  4HFD A;  3IGQ A;  2YOE A;  2XQ7 A;  3RQW A;  2BJ0 A;  3PMZ A;  4UM3 A;  5TVC A;  4ZJS A;  5J0Z A;  3JAE A;  3U8L A;  4ZZB A;  4NZB A;  4NPP A;  3RIF A;  2XZ6 A;  2Y56 A;  5J5G A;  3P50 A;  3TLW A;  4DBM A;  2XYT A;  3RQU A;  1UX2 A;  3WTN A;  4HFI A;  4QAA A;  5HCJ A;  3SQ9 A;  3GUA A;  3U8N A;  2YME A;  3TLU A;  3UU8 A;  3RI5 A;  3PEO A;  2XQ5 A;  2XQ9 A;  3TLV A;  4D01 A;  2WZY A;  5J5H A;  5AFK A;  4AFH A;  3WTM A;  3LSV A;  4ZRU A;  2YKS A;  3RIA A;  2BG9 A;  2XNU A;  4QH5 A;  5HEO A;  2Y54 A;  4QAB A;  4UY2 A;  2BYN A;  4ALX A;  5J5I A;  4HFB A;  4HFC A; 
#chains in the Genus database with same CATH homology
 2YMD A;  3UQ4 A;  3EAM A;  2C9T A;  1I9B A;  5SYO A;  5FJV A;  2XQA A;  4BQT A;  2BYQ A;  3EHZ A;  2BG9 B;  4EZ1 A;  3UU4 A;  5HEU A;  2BG9 C;  4HFE A;  5BRX A;  3SH1 A;  2XQ8 A;  4Z90 A;  4TNV A;  4UM3 S;  4ILC A;  5HCM A;  2BYP A;  3C79 A;  3UQ7 A;  3UU5 A;  3C84 A;  4XHE A;  4BFQ A;  3JAD A;  3TLT A;  3ZKR A;  1UV6 A;  2BYS A;  2XZ5 A;  5KE4 A;  2W8F A;  3WTL A;  5LXB A;  5AFL A;  3ZDH A;  3P4W A;  2W8G A;  4QH4 A;  4LML A;  3UUB A;  3UU6 A;  5IUX A;  5L4H A;  1UW6 A;  5CO5 A;  5J5F A;  3WTJ A;  4ZK4 A;  5JME A;  4HFH A;  4UM1 A;  3WTO A;  4F8H A;  4XK9 A;  5KZU A;  4ZR6 A;  2ZJV A;  2BR8 A;  2XNT A;  4IRE A;  5BW2 A;  4IL9 A;  4TWF A;  4UM3 P;  3WTK A;  5AFJ A;  4A97 A;  2QC1 B;  4ILB A;  4TWH A;  5AFM A;  4B5D A;  2WNJ A;  4AFT A;  4TNW A;  5L4E A;  4QH1 A;  4UXU A;  4COF A;  4LMJ A;  4X5T A;  3WIP A;  4AFG A;  2XNV A;  4A98 A;  5AFN A;  5LG3 A;  4LMK A;  3RHW A;  4ZZC A;  5CFB A;  2Y7Y A;  3SIO A;  4ILA A;  2Y58 A;  4Z91 A;  5AFM B;  2BG9 E;  2X00 D;  2XQ3 A;  3U8M A;  5AIN A;  2BR7 A;  3UU3 A;  2ZJU A;  4ZK1 A;  2XQ6 A;  3U8J A;  3SQ6 A;  5AFH A;  4HQP A;  3WTI A;  4ZJT A;  2BYR A;  3ZDG A;  4PIR A;  5BP0 A;  2WNL A;  5HEG A;  2XQ4 A;  3T4M A;  2XYS A;  2WNC A;  2PGZ A;  4WV9 A;  5L47 A;  3U8K A;  2WN9 A;  4FRR A;  4IL4 A;  3EI0 A;  4QAC A;  2Y57 A;  2VL0 A;  2UZ6 A;  2X00 A;  5HEJ A;  2PH9 A;  3JAF A;  5HEH A;  3TLS A;  4TWD A;  3WTH A;  2YN6 A;  4HFD A;  3IGQ A;  2YOE A;  2XQ7 A;  3RQW A;  2BJ0 A;  3PMZ A;  4UM3 A;  5TVC A;  4ZJS A;  5J0Z A;  3JAE A;  3U8L A;  4ZZB A;  4NZB A;  4NPP A;  3RIF A;  2XZ6 A;  2Y56 A;  5J5G A;  3P50 A;  3TLW A;  4DBM A;  2XYT A;  3RQU A;  1UX2 A;  3WTN A;  4HFI A;  4QAA A;  5HCJ A;  3SQ9 A;  3GUA A;  3U8N A;  2YME A;  3TLU A;  3UU8 A;  3RI5 A;  3PEO A;  2XQ5 A;  2XQ9 A;  3TLV A;  4D01 A;  2WZY A;  5J5H A;  5AFK A;  4AFH A;  3WTM A;  3LSV A;  4ZRU A;  2YKS A;  3RIA A;  2BG9 A;  2XNU A;  4QH5 A;  5HEO A;  2Y54 A;  4QAB A;  4UY2 A;  2BYN A;  4ALX A;  5J5I A;  4HFB A;  4HFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...