4ZJUA

Structure of a nadh-dependent enoyl-acp reductase from acinetobacter baumannii in complex with nad
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
QGLLAGKRFLIAGVASKLSIAYGIAQALHREGAELAFTYPNEKLKKRVDEFAEQFGSKLVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTLDGDFTDVTDRDGFKIAHDISAYSFVAMARAAKPLLQARQGCLLTLTYQGSERVMPNYNVMGMAKASLEAGVRYLASSLGVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRNVTIEEVGNAALFLCSPWASGITGEILYVDAGFNTVGMSQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Structure of a NADH-dependent enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD
rcsb
source organism Acinetobacter baumannii
molecule tags Oxidoreductase
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zjuA00
2GERA 5T57A 5IXSA 4ALIA 4FGWA 2OUIA 4KDFA 4RCVA 1Y5RA 1MG5A 2ZJ1A 3NDJA 3Q1LA 4A27A 5L53A 2PKQO 4TMFA 4IDEA 4BNZA 3JYQA 1O89A 4IJWA 4M86A 4YRDA 3RUAA 5THQA 2EERA 1NQ5A 3JV7A 3ON5A 4ZD6A 5JY1A 5TT0A 1PL6A 4RLHA 1P3DA 4B3JA 3BMCA 4CLOA 3DBRB 4ND4A 4ZRNA 3FD8A 1W0CA 1NTOA 4PG5A 1CRWG 2O2YA 1BG6A 4XGIA 1I24A 3ZNPA 2YQ4A 4MVJD 3COSA 2P9GA 4NIMA 4NDNE 4I9NA 1XLTA 1HSOA 4NJOA 1QORA 3AK4A 2UV8A 3ROQA 3JQ7A 4DC0A 3FPCA 3DDNA 3WB9A 2RHCA 5IDYA 1QLHA 3WGQA 5L40A 1ZSVA 4M1QA 5JFOA 1HT0A 3ZU4A 1DC6A 4LMRA 3OEWA 1KOLA 3JTMA 3K8ZA 4WLOA 4RLSA 4NMHA 3SJ7A 1GPJA 3K5PA 3QLJA 2B4RO 5F1KA 2Q50A 4UUPA 1A7KA 4PLVA 3VPGA 1DHTA 2PH5A 3QW2A 2GRAA 3AM4A 3WBFA 5I9NA 3JQFA 3T7EA 2VHZA 4OYRA 3RFVA 1ZJYA 4XB2A 1IZ9A 3QVTA 3CPSA 3CKYA 5TS3A 2FPPA 3I52A 2Y1FA 1UH5A 5F1OA 3RVDA 2QQ5A 2HMWA 2NWQA 4O6VA 4CM4B 5C5IA 4A03A 1WMBA 3T4EA 3BTOA 4OH1A 3DHYA 4OAQA 4XCVA 5TQVA 4E13A 3NKLA 2EKPA 3IQDB 4BMNA 1GV1A 3A4VA 4H15A 3E03A 4LSMA 2EJWA 1C0LA 3TZ6A 4B3HA 3I4FA 2HK8A 2YZ7A 1Z75A 3UAGA 1MB4A 3QIVA 4OOFA 4CM9D 4DXHA 4UREA 3G3EA 5A9SB 5HTOA 1R6DA 3EZYA 4E21A 3OH8A 4WOKA 5DULA 4EJ0A 1ISJA 3HWRA 3AI2A 1EFKA 3D3WA 3WNQA 3F5QA 1UZMA 4ILKA 4YDRA 4EEZA 4D3SA 2Y68A 1IHYA 3H5NA 4OXNA 2OO5A 4XJTA 1EFLA 2Y99A 4EI2A 3A9WA 2FHSA 4KUHA 5CPBA 1ZK2A 4S3MA 2AXQA 3JQ9C 3V1UA 3VTFA 4I5DA 1E5LA 3VPXA 2AEJA 1KETA 1WMAA 3P7MA 1TT5A 1PZEA 2C2XA 3DZBA 3OEYA 3GGPA 4JIGA 3LDHA 3T7CA 3MTGA 1NFFA 4DPKA 1EVJA 2WWRA 2FN7A 4OXKA 1MFPA 1U3TA 3KO8A 1R0SA 3GHHA 1QP8A 4BQPA 5CG2A 3HDYA 3JD0A 3QV1A 3VDQA 4JJFA 2DC1A 3H9GA 4BL5A 4NQZA 1Q7GA 3KZVA 5HA5A 2Z1MA 4EEXA 2EEZA 3VPSA 2YJZA 1KIFA 4BKUA 2FR0A 1LQUA 1MLDA 1ZKMA 1NBOA 4MVJP 3I83A 3RUDA 3GPIA 2BLLA 3FNGA 4DVJA 5FWNA 5IXYA 3S2EA 1Y81A 2FSSA 3Q2IA 4BNNA 3I5MA 1VSUA 3RFTA 3WQQA 1R4MB 2RHRA 3O4RA 5COBA 5HS4A 3PDUA 1EUCA 4WLFA 4BOYA 1T24A 2ZCVA 3RIHA 1XSEA 4DIBA 4DWVA 2EIHA 1I10A 3WYBA 4D7AA 5JMWA 4FQ8A 5IFLA 1LU9A 4XR4A 3IOYA 3WXBA 2I65A 1XWFA 2B4TO 3LYLA 3TWOA 2DLDA 1HDYA 1K6JA 1T2CA 3ROMA 5BNTA 1DIBA 1YBMA 4J49A 4M49A 5AYVA 4GVLA 1PGPA 1VPDA 1DO8A 2VRCD 3AUAA 4E2YA 2DFDA 3TFOA 3ETDA 3WX0A 4U7WA 3E5MA 5A04A 5JW6A 1IE3A 3PHGA 4FDAA 5B37A 1BHSA 2WYUA 3H9QA 4BHTA 4MVJF 1P1FA 1ONPA 1Z6ZA 4KDEA 3SLGA 1J4AA 1HYHA 1NAHA 4A7PA 3CXRA 2X0RA 1B0AA 4CLDA 3ZV5A 3I1JA 1JW9B 4MVJM 1E77A 4PLTA 2GN6A 2ZTUA 3UCEA 1LRKA 4FD3A 3VVBA 3WMXA 3JQGB 1PEDA 1W73A 4I1IA 4MKRA 3UW3A 3UCXA 2GZ2A 3ANLA 4CMHA 3WIEA 2ZTLA 4QFCA 4YJHA 4LVUA 3H65A 1QG6A 4O5OA 1TXGA 1MFZA 1YJQA 4YVFA 3L9WA 1IHXA 2X5KO 4TZTA 3V1TC 3VH3A 3WS7A 3KEQA 4DMLA 2OFPA 3ZNOA 3AUUA 4CMCA 2X5JO 1B3RA 1EBFA 2ET6A 1P0CA 1EUDA 2EP5A 2EV9A 3DTTA 4I9HA 4QECA 1D4FA 1F8GA 1K6XA 4UEOA 3I9MA 4JN6B 1PJCA 1VJ1A 1HSZA 3ZHZA 3PFFA 1T1SA 3VC7A 4JBGA 4B7CA 4M87A 1VC2A 2WE7A 1HE3A 1G1AA 2NU7A 2PK3A 4Y98A 3W4JA 1P1IA 2HK9A 1E1MA 5ITVA 1GCUA 1XQ6A 1YWGO 3ZZNA 3AUSA 4WE3A 1JVSA 4E5KA 3O03A 4IGEA 3VKVA 2PGLA 4HV4A 1NXQA 1N92A 1P9LA 5EINA 2VNSA 4C4OA 1A7AA 2BGLA 3LT4A 2ZB7A 2CMDA 1KVUA 2XAAA 3ZNNA 2V6BA 4GKBA 3WICA 4Q3BA 1BVRA 4BV8A 4PLGA 4ZRMA 4KMSA 1NQTA 4CM9A 1R66A 1B26A 3CEAA 2Z1NA 3ASVA 4CM1A 2POQX 3W6UA 3KETA 1EVZA 1XR3A 5G4LA 5IDQA 1VJ0A 4RF3A 3ONDA 1EK6A 3OFSA 5ENDA 5ILOA 4II3A 4UVIA 3DOJA 3WOHA 4EITA 7ADHA 4RDIA 4WCFC 4ALJA 3AFMA 3OHSX 5G2OA 3GMDA 3ANNA 1PGJA 1HDOA 3LLSA 4XIJA 3DBVO 4YB8A 3LK7A 4DQUA 5I7SA 2W2KA 2W90A 4IDCA 2Q1SA 3OQBA 2Q2VA 4DREA 1Y8QB 2AG5A 4M8SA 4CLRB 4E6PA 4UUNA 4IY1A 1P1RA 2CFCA 2VWHA 4HXYA 4PLPA 3VKUA 3HDJA 2JJYA 4FJ0A 4RQTA 1KBZA 1LQTA 1YL6A 3LVFO 3MZ0A 4NFSA 4RVSA 4UEJA 4NG5A 4D3FA 5EESA 3VVCA 1H9BA 5J23A 1BRMA 4NFHA 2JAHA 1C1DB 2BD0A 2C0CA 3B6ZA 3GFGA 5JE8A 3GZNA 4W99A 3TFQA 4Z9YA 1VE9A 3KHUA 3IAHA 5KVVA 1HZZA 3BMOB 1KEWA 4A10A 4ND5A 5HM8A 1KEVA 2OORA 1ADCA 3JD1A 4R68A 3EMKA 4YBZA 2OGUA 1Z7BA 4A73A 2DPHA 1LLDA 2Q2WA 5FYDA 1E3JA 3FPLA 4W9NA 2CSUA 1EUZA 2HLPA 4A2CA 2UUPA 4GGOA 5CFZA 4K26A 3OIGA 3LC2O 4M54A 4J91A 3EC7A 2EGHA 2ZCUA 4KWIA 1R0KA 3NTRA 1P33A 1BSVA 3GVXA 1KEUA 1T25A 3R0IA 4QXMA 1JKJA 1PSDA 4TRRA 2WEKA 5DP2A 2VRCA 4IXWA 3GG2A 4OQZA 5I9LA 1DFIA 1CIVA 2P4HX 1RM0A 5A4DA 4J43A 1J6UA 4WLUA 4AJ1A 1I36A 2ZB3A 1DIHA 4I5FA 4QO7A 3QWHA 1JU9A 4PLCA 1OOEA 3W8EA 3JQ9A 2GSDA 1NNUA 1FMCA 4PCVA 1GAEO 1U8XX 1PWZA 3UHAA 2WD7B 1B2LA 1SB9A 4NU6A 1Z7EA 3UH1A 1DEHA 1HDGO 5I7FA 3GNSA 1ZUD1 4XKJA 1R37A 5TIIA 1KC1A 4UVHA 1DJQA 4YAGA 5TRTA 5IN4A 5K6AA 1EDZA 1PJSA 3JQFC 4GX5A 4YJGB 2QYSA 5DDIP 1L7DA 4PRKA 2Z5LA 2HQ1A 4U6QA 4BUCA 5ILGA 5IDWA 2HJRA 4L8VA 4Z6KA 3A1NA 1WW8A 1Z45A 3CMCO 3DBLB 3GHYA 4PIVA 1V35A 1YGYA 3EDMA 2DUUA 1DRUA 4IDGA 5CHEA 4C7KA 4OSPA 1QSGA 5T64A 4BNMA 1PTJA 3P5SA 4BMSA 3PK0A 4F6CA 5FEUA 3U4HA 1N9GB 2DUWA 1E3WA 5ITWA 1Q1NA 4R54A 2O3QA 1E7RA 3OJOA 3S2IA 4NR0A 1ZJZA 3MOGA 2OP1A 3I9JA 2UVDA 3KYCB 4J90A 3E5RA 5CDYA 5C7OO 2J3JA 3KB6A 4MJLA 1DC3A 5JAZA 1HWYA 2O7SA 4CQLA 1E7YA 2BHLA 3RBZA 2Q1UA 1NYTA 5L95A 3E48A 3PVZA 5A3JA 2PD3A 3DBRA 4J7CA 1YDEA 1GD1O 1ZEJA 3ADOA 4JJIA 4YJFB 1J0XO 2O4CA 1HL3A 1U28A 2QIOA 5ES3A 4L75A 4CMIB 1EE2A 5JBIA 1H6CA 4Q3NA 4BNLA 4BO1A 4O63O 4BGUA 1QXSA 2OMEA 1T2EA 1Y7TA 4D43A 5CEFA 3ZWWA 5AQ1A 4H3VA 4XWYA 3U49A 3H6KA 5KKAA 4H16A 1ZEMA 2WYVA 1SCUA 3GLQA 3S2GA 3VPHA 3AOEC 2NTNA 2HRZA 3MJCA 3OIFA 3CINA 5JDIC 2JD1A 5KJCA 4D3DA 4YR9A 1TT7A 4I9UA 1LRLA 4B79A 3I9KA 4DLAA 4CLEA 2BFMA 4BO6A 4AJLA 5H83A 3EGOA 4IBOA 3C24A 1WNTA 1E5QA 2RCYA 2PNFA 4GSKA 4W82A 4YQZA 4E31A 1D1SA 1F12A 1CQIA 4B8ZA 3G0OA 1UXHA 5EIOA 3RBVA 4BNJA 2Y93A 4RPLA 1P1JA 2QRKA 4HWKA 4PZCA 3VZRA 3ZV4A 1IUKA 5JCJA 4D46A 3OA2A 3U4DA 1JN0A 3E8XA 1NQAO 1MA0A 2GCGA 3WFIA 1FJHA 5DT9A 4DQXA 3H9JA 3ZWVA 3GOHA 5COQA 3PI7A 4BKQA 2HCTA 3SC6A 2IODA 1EVYA 2A92A 1F06A 4IIUA 1M6WA 1Y1PA 1NASA 1I32A 2EKLA 3WQRA 5JNLA 5I7EA 3VZQA 3TOZA 3GGOA 2EKQA 4R5HA 1ID1A 4OGWA 4MIOA 2BF7A 1A9YA 3ST7A 2O3TA 4DGSA 1PL8A 2DTDA 2W2LA 3DR3A 4IIVA 3TNLA 2A94A 1ZK4A 3GEGA 3QVSA 4LRTB 4CV3A 3AM3A 9LDTA 4WNCA 3C7DB 3AY6A 2P9EA 4BS9A 1ZNQO 3NUGA 1E7MA 1X15A 3GRKA 3PQDA 1M75A 3BTSA 5T8KA 3AWDA 3DZKA 4UVGA 2Q1WA 3GY0A 2J3KA 3DZGA 3JD3A 1PQUA 5T67A 4KZPA 3ZWYA 1JDJA 3EY4A 4RVFA 5F5NA 4LVCA 4PG4A 1FK8A 5TT1A 4J9VA 2VWPA 5AXAA 2Y0EA 2AA3A 2CVQA 2DBZA 1U4OA 1T2FA 1P1KA 3RQSA 4BO5A 6LDHA 2J5RA 3PGJA 2WYWA 2BGMA 5EL0A 2X23A 4UUOA 1YL7A 5LCXA 4ZGWA 4YQYA 4BO2A 1PJQA 5KIAA 1NVTA 1ZXBA 3LC7O 4NZ9A 1CETA 2ZTVA 3FI9A 1UDAA 4YXFA 1LSOA 1Y8RA 3AW9A 4HBGA 2AQ8A 3ZU2A 3FRJA 3NT5A 2NACA 3GGGA 2C7VA 4R3WA 4WEOA 5HRUA 4PG6A 1E1NA 1NM5A 4HFJA 4FR5A 3ETEA 5TNXA 4MP6A 4PVDA 3GFBA 3LU1A 4P22A 2C29D 4WCDA 3O26A 4YA6A 1YB5A 2IE0A 3EHEA 4KUGA 5A5FA 3RBXA 4UULA 1BDBA 1HDZA 3NV9A 4E2WA 2B4QA 3VHRA 1SC6A 4E32A 1TVEA 2ZYAA 4BNFA 3ICCA 3VAZA 2B69A 2DPGA 4FS3A 3C85A 1UP6A 2WTBA 5JXWA 1T4DA 3EZLA 4TRJA 3RUHA 2CDCA 5JC1A 4TKLA 2Q49A 3DAFA 1J5PA 1AHHA 2D0IA 3FBGA 3JQ8A 4GX0A 5B4VA 1HDCA 1D7OA 2YHIB 1ENPA 1UXJA 3HDHA 1HEUA 3H9EO 3V2HA 3FNHA 4F6LA 1PS9A 3GK3A 4CMEC 3ONFA 1H94A 1DBVO 4GAEA 1P1HA 4NNJA 1R4NB 2OXIA 1DAOA 1HE4A 1ADGA 1M67A 2QRLA 4WPGA 5LDGA 1HLPA 1C14A 2E4AA 2AE2A 4CM6A 4XQCA 1WVGA 4BNWA 2GZ1A 1PJ4A 4WUVA 3MJ4A 1SEVA 2NSDA 3E18A 4WNIA 1UXGA 1Y6JA 4H7PA 4CLHA 3S55A 3OECA 4DBVO 4CMGA 2BH9A 2EHDA 4IINA 3N74A 3HDQA 1AUPA 5CAEA 5KJ1A 2X7HA 3I3OA 2BI8A 4ZICA 4EGFA 1AHIA 2TMDA 1X0VA 4ROSA 5A5EA 4XQ9A 1ISHA 1H6DA 2CDBA 1LDBA 4BGEA 1FDVA 4MVJH 2YDXA 1OFGA 2X9GA 1BXGB 1RPNA 2Y0CA 4IZIA 4D0RA 1OBFO 4PG7A 2Z95A 2Q3EA 3W8DA 3PJFA 1BTOA 2DBRA 3PIIA 4PLWA 3WSVA 3DHEA 4RZIA 5G0WA 3VZPA 1MXFA 1Y5MA 1MP0A 4XX0A 4W7HA 4W9NC 3CTMA 1YBAA 1I3KA 2PY6A 1NFQA 1C0PA 3TJRA 1B8PA 2Y1CA 4IJVA 3JQBA 4U0KA 4OSOA 5F21A 1GYRA 2PD4A 2X8LA 4Y6RA 1VM6A 1NWHA 4J0EA 4KOAA 1XA0A 3GVHA 2YHUA 3K2BA 3UKOA 1W8DA 4BNYA 2Q4EA 3RASA 1U2DA 2YFHA 4FJ2A 1R12A 2G0TA 3JQEA 2JKVA 4O59O 3TSCA 4F45A 2IEDA 3WTCA 4FN4A 3DBHB 1V3UA 1ARZA 1YXMA 1JTVA 2B37A 3GF4A 3SXPA 4BO9A 3U4IA 3NDRA 1S7CA 4IDFA 3I6IA 3PJDA 4MP8A 1CERA 2G5CA 3ZWCA 4AJ2A 5L4NA 4PN3A 4HNHA 4BNXA 1W4ZA 1RM3A 1R15A 3QHAA 5TF4A 3O8QB 1C0IA 3DHNA 3BZUA 4ID9A 3JQ6A 5KCZA 1MV8A 3TRIA 1VRWA 1OI7A 2X9VA 1FDUA 4OO3A 4RVDA 3BMNB 3ZN2A 2Y1EA 3OA0A 2AQHA 3Q0EA 1NVMB 4ZQEA 3JQAB 4ND3A 5A9RA 4G81A 4BB6A 1WLYA 2WM3A 3B1JA 1E6UA 3G1TA 4OXYA 1O5IA 5ICMA 4FB5A 2B5VA 4CV1A 1ZSYA 1E7WA 3VZSA 4CR6A 3EYWA 5A9TA 1N1EA 5A02A 4Z9XA 3LT0A 5JC8A 1U2GA 2Q1TA 2HAEA 1C1XA 2PWZA 3AOEA 1HE5A 4JXKA 2AE1A 5IAAA 1XGKA 5K6AC 5JDIA 3DOCA 4J4TA 2HMTA 3U5TA 3GN1A 1RWBA 1X7HA 3JD2A 4MVJE 2VHYA 3PJGA 4L4RA 5ER6A 4ESOA 2EWMA 2RIRA 2FSVA 4DRYA 1K6IA 4J1TA 1KC3A 3OF2A 2VUUA 4GLLA 2C5EA 1N5DA 4GH5A 4MP3A 5DBGA 5EJ2A 1O94A 5GMOA 2ZQZA 2GD1O 4ZQFA 1MGOA 1UJMA 1KY4A 2VOJA 3L77A 2YV1A 1E3EA 1CDOA 4L0QA 1U8FO 4QFDA 4GX1A 4WCFB 3ZCXA 1PS0A 3BIOA 3FF4A 4YRBA 4G5HA 5BQFA 4NJMA 1J49A 3DAGA 1M66A 3DEYX 2X0IA 1QV7A 2C7GA 3HZZA 3LZ6A 2HMUA 4XR9A 4E2ZA 2YV3A 2IXBA 4BO7A 3GDOA 3WIDA 1BW9B 2SCUA 2VTEA 3F4LA 3M2PA 3PLNA 4JX8A 3F46A 4D42A 3SBOA 2Q46A 1ZW1A 4MVJI 3U62A 5BSGA 1IOLA 4BVAA 2C2YA 5BT9A 1XCBA 3KSUA 4HFMA 3JCZA 3BMQB 3KXDA 4HADA 3DFZA 5THKA 1QRRA 4QO8A 3WWYA 3RFXA 5BSHA 1IPFA 2FOIA 1Z73A 2I76A 5FI5A 4DPLA 1PJTA 4TVOA 1Q7BA 3PP8A 5L7YA 3OMLA 5KKCA 1DJNA 1U5AA 3HADA 1HDXA 2I67A 1ENZA 4YJGA 1B3BA 3V2GA 1OC2A 3QWBA 5IF3A 1X7DA 1ZVMA 2DBVO 1V6AA 5FI3A 3NTQA 5ER9A 3ZU5A 3RU7A 2H63A 1SBYA 4O1MA 1JWBB 4R1TA 4S1VA 4TROA 1WDKA 3ONEA 4OJNA 3MJEA 4HFRA 3WGGA 4MINA 5CP8A 3RD5A 4BO8A 1WDMA 3GMSA 4NBWA 1DPGA 4MOWA 4OQYA 4YRAA 2J5KA 4L4SA 4ZQHA 1NR7A 3RUEA 2LDBA 3GEMA 2NTJA 4R3NA 1IPEA 4CLOB 1YB4A 3C8MA 4R16A 3DL2A 1LUAA 2Y1GA 3W6ZA 3KYCA 4GGPA 3N58A 4IXTA 1A9ZA 1Z82A 3ZDFA 3ADPA 2VYVA 4Z0HO 4MO2A 3NT4A 3X2EA 3LF2A 5DP1A 3JQ7B 2JAPA 4B4UA 3KEOA 5KVSA 4YJDA 4J6FA 5G4KA 1I0ZA 4FFMA 4NK5A 4YT5A 5IZCA 3BHJA 2DAPA 5T8KC 2O50A 1O9BA 4MKXA 2PLAA 1ADFA 1LDMA 4I5EA 1R16A 2QHXA 2VT2A 3AFNA 1YQDA 3RI3A 1K5HA 1U1IA 3MWDB 3RCBA 3PZBA 4G2NA 4CMEA 1BVUA 2NUAA 3TOXA 4NBUA 1ISMA 4AJNA 1S6YA 3TZHA 1JAYA 2ZYGA 4BO3A 4QEDA 1LDEA 4IZHA 3QY9A 1HETA 2B5WA 5CDTA 5ENVA 1A72A 4DPMA 1UDCA 3PWKA 4LCJA 2XPCA 1ZK0A 3CIFA 3WG9A 3NTOA 1LTHR 1Q7CA 1ORRA 3U9LA 2IXAA 4YYZA 1P74A 3F1KA 2AQKA 1LLUA 3ANMA 2BELA 1U7TA 5GZ1A 1DLIA 1N2SA 4LSWA 3OJFA 3W4IA 4W6ZA 5F1PA 1LC0A 4L73A 2X0NA 3H9UA 1P44A 4FFRA 2X0JA 4K28A 1YBVA 3WSWA 4PFJA 5AXDA 3DB2A 3JSAA 3SJUA 3ZV6A 3GVPA 4MKZA 4E5PA 2HKIA 4CQMB 3QWIA 2O48X 3F1LA 3GUCA 5L51A 1JVBA 5DBIA 2ZQYA 4EYEA 2H5LA 4BNTA 4LRSB 4E30A 1IULA 1DHRA 2VUSA 3ZNQA 4KTVE 3AOGA 4IQGA 4E0BA 3TZCA 1TT5B 4WEQA 1UUFA 4XQGA 2JCXA 4JQCA 3S1LA 3BA1A 5LDHA 4UAGA 3RU9A 4DLBA 1DFGA 4J1QA 3GQVA 2JFHA 4BNIA 1O95A 2G1UA 2W2LD 1T1RA 4OIMA 2AHRA 4Q3DA 4AFNA 3DZJA 1GQ2A 4FFLA 4Z9FA 4GKVA 4YAJA 3O38A 2D5AA 2OBNA 2ZB4A 4EW6A 1OAAA 2GLXA 3TDKA 5DNAA 4R01A 5EN4A 1KVQA 3K6JA 2PKRA 1T4BA 1X1TA 4CUZA 3IP3A 5FF9A 4NPCA 1PQWA 3INGA 3NGXA 1GDHA 4FFNA 4RPHA 2YW9A 5BR7A 2CF6A 3W4KA 1I3MA 3CUKA 4IUYA 4EBFA 1SNYA 2ZB8A 4RORA 3HJAA 4L76A 2Q4BA 4CMBA 3MTJA 2VQ3A 1VJTA 2FZWA 3PWZA 1R0LA 3K31A 3PWSA 3U0BA 3QA9A 1PGNA 3HQ4O 2WMDA 4JBHA 4Z0PA 2J3IA 2W4QA 1IZ0A 3I9NA 1YB1A 4IJKA 1GU7A 2D4AA 2JCYA 3RC7A 1E1LA 2B83A 1W6UA 2G17A 1NAIA 4BNVA 2HMSA 3EVNA 1X14A 4AJ4A 1D8AA 2AQIA 3KLPX 4CM8A 3DONA 1PU2A 1E1KA 4XA8A 3DZIA 3DTYA 3D64A 3TPCA 4XDZA 2J5QA 1HYEA 2I6TA 4IS2A 2ZIZA 2JD0A 5JYDA 3NYWA 5L7TA 1C3VA 5I8ZA 5GZ3A 1OC4A 1UP4A 3FNEA 1JWAB 1Q2XA 3K2EA 1XEAA 3QSGA 4PLYA 4J4BA 2EF1A 2P91A 3DQPA 4J2OA 2FPIA 1B8VA 3L6DA 1O8CA 3QWFA 1L1FA 5MDHA 3L9XA 4J1NA 1WP4A 1H6AA 1X13A 3QE3A 4PVCA 4TRNA 3H2SA 4U0JA 4CMJA 5B4TA 3JQBC 3ZHYA 1YJ8A 3DWFA 4NU5A 5HWSA 2R00C 2A9FA 2H9IA 3JQCA 1I5RA 5G0UA 3M1LA 5AOVA 3GRPA 2QRJA 4WGGA 1GUZA 1GV0A 3G49A 4G65A 3CSDA 4M89A 1CWUA 4R41A 3ULKA 3GR6A 2P68A 3HN2A 3WLEA 4XRGA 4INAA 3VOSA 3GDFA 4YJHB 1I2BA 1KVSA 3WFJA 4ZJUA 1H2HA 4FPXA 4X54A 4CM7A 3E6AA 1LSJA 2EXXA 1QKIA 2VRBA 4A0SA 5ICSA 5K9ZA 2BFPA 1PS8A 5EERA 3WQSB 5EMHA 1P31A 1ISFA 5A3VA 4RV9A 5CDGA 1C0KA 4GLOA 3RUCA 5ADHA 1PX0A 2VHWA 4NH4A 1GZ4A 4GL4A 3TL2A 2B0JA 1OZAA 3D4PA 5DCYA 3MJTA 4BV9A 3D7LA 3PGXA 4OHUA 4P8RA 2J6IA 3NEPX 2DVMA 2C82A 3R3JA 2VHVA 2G82A 2ZK7A 4NFYA 4N18A 2PH3A 1GCOA 2JFFA 1ADBA 4CV0A 1I3NA 2NQ8A 1E7QA 1BMDA 4MPDA 4PRLA 8ADHA 1IY8A 5A05A 2A35A 3DXFA 3U3XA 4CMAA 1VI2A 4DBZA 2J3HA 2HJSA 1HLDA 4R9SA 4A5OA 1UAGA 1NPDA 3RKRA 2RBEA 4OMUA 3QVXA 4LGVA 1MUUA 1WZEA 2Y1OA 3GAFA 3IP1A 3F6YA 1PR9A 1YL5A 1GYQA 1UXKA 3EAGA 1K89A 4ZQBA 5IN5A 4PG8A 1PIWA 2NU9A 4OL9A 3D5QA 4YEDA 3PRJA 3H3JA 2P9CA 3A28A 3DMTC 4IS3A 4P4NA 4CM4A 1P77A 1XHLA 4KP7A 4BB5A 3ZV3A 4BNUA 5EPOA 4DTIA 2NU6A 4E5MA 3JYLA 1FDWA 4XIYA 3DC2A 1ML3A 4MDHA 1LRJA 3IMFA 1HF3A 3D1LA 5TC4A 2W2KB 3U09A 1E7SA 2F00A 5A9SA 3MEQA 3MJVA 2IZ0A 1VL0A 5IJZA 1DXYA 4RPGA 4Y67A 2C20A 3RUFA 1SMKA 3O8QA 2R6JA 2AW5A 1ENOA 3BHMA 2GASA 2DTXA 2C5AA 1ZXLA 3I9LA 1QYCA 3CE6A 3KV3O 1DAPA 1RYEA 2UUOA 3TQHA 2ZKLA 1PQPA 1V9LA 3H3FA 1EQ2A 5L9AA 1Q0LA 1L7EA 2YFQA 1YVEI 1Y9AA 3GZNB 3H8VA 3AM5A 5DCUA 3TZKA 1YO6A 3UVEA 3ZW9A 4GWGA 4Q3AA 3H4VA 3ZGYA 2FRDA 1ZSNA 4IDBA 4R1NA 4W4TA 4CR8A 4HUJA 3KTDA 3H5AA 1JKIA 3KVOA 5BSFA 5L3ZA 3P19A 2VZ9A 1LDNA 1LBEA 5BNFA 4DQVA 2BKAA 2HMVA 4B4OA 4CJXA 3FR8A 1QR6A 2I66A 1DB3A 4WASA 3FBTA 1N1GA 1GEEA 1HXHA 2NVBA 3ITDA 3BXXA 3KUXA 2JHFA 1VL6A 2PZKA 4TRMA 1PWXA 4IDDA 5IG2A 1Q0QA 3Q6IA 5C7LO 2CVOA 4FCCA 4CODB 2O3SA 1R4MA 1N7HA 3L4BC 1ZIDA 1NHWA 2O2SA 4XD2A 2JFGA 3N7UA 5T5QA 4BGVA 3K73O 4FC6A 4XJSA 1AXEA 2AMFA 2VZ0A 5TSDA 1ULUA 4D79A 1P45A 3PTZA 4WLEA 4CM5A 1XIVA 4HNGA 2VOEA 4B7XA 3PHJA 2DM6A 1VKNA 5TGDA 5L4LA 2PR2A 5IZCC 4J9UE 1T2DA 1SB8A 3V5NA 3WGZA 4ALKA 4ZHSA 3STHA 3OQ6A 3QQPA 2OBYA 2FP4A 4BMVA 4RPKA 1F17A 3WGHA 4E5YA 4C7JA 3ITKA 3M6IA 3DZHA 1NQOA 4ZN6A 1PJBA 4JJGA 1TA4A 1O6ZA 3KM0A 3WMWA 2P5UA 3BMQA 4J7XA 4N5LA 5KVCA 1HTBA 4R1UA 4IMPA 2PFGA 3SEFA 2OHXA 2EGGA 2C59A 3JQGA 1YE3A 2NM0A 1TLTA 4GPD1 1NX6A 3LQFA 2GZ3A 2DKNA 1V3VA 2EW8A 2NNLD 2V6GA 2IRWA 3F5SA 2R2GA 5DN9A 4KWHA 4M55A 3D3EA 5AXBA 2YDYA 3UXYA 1E3WB 3WTBA 4BO0A 4YAIA 2CUKA 2IZ1A 2FY8A 3NT2A 3NRCA 3INTA 1LLCA 1BWSA 1DC5A 3L4SO 3ZU3A 1D3AA 4QUKA 1LI4A 1AE1A 4OM8A 3PIDA 1GY8A 4CQLB 1NP3A 2H6EA 1YQGA 3S2FA 1RJWA 1PJ2A 1U9JA 4RF2A 4XQEA 4U8GA 3DAPA 1G0NA 1U3WA 4IJUA 2B35A 3SC4A 2EG9A 2CDAA 4AVYA 3OJ0A 2PTGA 3GT0A 1NHGA 2G76A 4XGNA 4MVJG 1V8BA 1YOVB 3KBOA 4URFA 3U4CA 5A1TA 1KY5A 3T4XA 2EW2A 1RYDA 4YT2A 4BNHA 4DIOA 1KEPA 1E92A 3OIDA 5KJEA 4AJOA 3ZI0A 3TL3A 2VYVD 3OJEA 4LMPA 3OBBA 3WYCA 2EJVA 3LLVA 1KS9A 4E3ZA 3PZRA 1P0FA 2O23A 3PDJA 3ZWOA 4XRRA 1DDOA 5JSFA 1KERA 5TLSA 3LSYA 2NLOA 2R00A 1JLLA 2W8ZA 4RVHA 3FHLA 5HS6A 3R3SA 2WD8A 4TVBA 4D45A 1UAYA 1DFHA 2PGJA 2V6MA 3NX4A 4YAKA 1I2ZA 1MG0A 4HP8A 4R4JA 5CPFA 2VCYA 5H82A 5JAQA 1H0KA 5KOIA 2AG8A 2NV6A 2ZYDA 2RAFA 4QSMA 4CR7A 4FOSA 1PZHA 1VLLA 1AGNA 1EDOA 2PKQP 3WR5A 2GUGA 3F9IA 1VSVA 1DRWA 4GVXA 1FDSA 3I9OA 4GSLA 3TZQA 1EZ4A 1EMDA 2JL1A 2X22A 4DC1A 5TX7A 3B1KA 2GGSA 4TZKA 1YONA 1SO8A 5KJFA 1Y8QA 2HRBA 4CLRA 4AJPA 2HSDA 2PZMA 1ISGA 1IL0A 2IZZA 1D1TA 1ZH8A 3ZWMA 2Y66A 4RVUA 3F3SA 1U7HA 1JKFA 2O3UA 3DOOA 4HKTA 4OKIA 3K96A 2IYPA 1DC4A 4DMMA 3ROKA 3GVIA 2RH4A 2D2IA 4J16A 1OMOA 4D44A 1ONNA 5JY6A 3ABIA 1GL3A 2GDZA 1KVRA 2X5OA 3IIEA 5G0SA 4BKRA 1SPXA 3CZRA 1FDTA 3V8BA 3FSRA 1C1DA 3LF1A 4CQMA 3HSKA 2D59A 1VL8A 5IZ4A 1HZJA 3RJ5A 2NVUB 2X58A 2W98A 3BMOA 3D0OA 3E9MA 1NVGA 4XYLA 5KWEA 3WYEA 1MC4A 4Z0TA 4AJIA 1QLJA 2VNAA 2D5CA 1I3LA 2E82A 2DBQA 3KYDB 1EVIA 3CZMA 2E49A 4GX2A 1EE9A 3OJLA 1V0JA 1NWCA 4RQUA 4JP2A 4Y9DA 3RKUA 3OP4A 4QQRA 5L7WA 1V3TA 5DOVA 3DMTA 4IM7A 1H9AA 1GUYA 5JO9A 4BKPA 6ADHA 4CLXA 1UP7A 1SOVA 3HNPA 5BSEA 3VH1A 1UDBA 1X1EA 1H2BA 3W1VA 5B1YA 8LDHA 1GADO 3E9QA 1NPYA 4W7IA 1I33A 5C37A 1YS4A 3GZ4A 3HFSA 2QYTA 4JCOA 1Y8RB 1HRDA 4E5NA 2P5YA 3GC6A 1MXHA 2X4GA 3NDIA 1FXSA 3PJEA 5B4UA 2CNBA 3Q11A 4GQAA 4P4LA 4IQ0A 1CEQA 1ISIA 3C1AA 1A4IA 4QX6A 3FWZA 4I5GA 3ICPA 5DZSA 2CD9A 2CZCA 1LA2A 1G0OA 1UZNA 2I3GA 2V65A 3AY3A 4I08A 4Q9NA 3WDSA 3GVCA 4KQWA 4NK4A 4ALNA 4B4WA 4DYVA 5JAMA 3GG9A 2GN9A 2HO5A 4CPDA 4IQ8A 3ETGA 4Y6SA 4ONEA 3WJ7A 3ZWXA 3G79A 4IPTA 1KVTA 2CVZA 1Q0HA 2A4KA 2JD2A 1MX3A 3GH3A 3RC1A 2WD7A 3UUWA 5U9CA 3OSUA 4WLNA 4NBTA 4AL4A 3PXXA 4CM3A 3IKTA 4QTZA 2I3AA 4ZVVA 4JROA 3JQ8B 9LDBA 1F8FA 1NR1A 4XGKA 2ZATA 5AVOA 3WGYA 5U4QA 2ZJ0A 4DYDA 5JDCA 4L4XA 1WWKA 1EBUA 3FWNA 2Q2QA 1LX6A 2ZTMA 3DBLA 3K9QO 3SLKA 1WXDA 2FR1A 2DU8A 3RROA 2BMAA 4N7RA 2YUTA 5KJ6A 1K0UA 1GYPA 4ALMA 2UDPA 4RZHA 4K6CA 3V2UA 1N9GA 1PGQA 1G6KA 4Y6PA 5COAA 5JCJD 2UYYA 3L4BA 3ZHBA 2GR9A 4YACA 4PLZA 3BMCB 3JD4A 4B7UA 3X2FA 4MVJA 3C1TA 1U4SA 1RKXA 4AICA 3IJPA 1GR0A 4EDFA 3GEDA 4ITUA 4N5NA 2FWMX 3MJSA 2X6TA 3VH4A 2VTDA 5C7IO 4XYEA 3UN1A 1F14A 2GN4A 3SX2A 1GEGA 5KVQA 2AEMA 1IYZA 1KYQA 4YJFA 3BTUA 4CMIA 1CJCA 3WGTA 1VKOA 1I01A 3S8MA 5A06A 1B14A 4JGBA 2H1SA 1UR5A 2Y67A 3IDSA 4HY3A 1B7GO 4YT4A 4E12A 2TMGA 4FC7A 3NJ8A 3UGKA 1E3SA 2PZJA 3MCVA 5EQFA 2C54A 3VDRA 1AXGA 4AJKA 4B8WA 1PZGA 3QP9A 3KSDO 1DIAA 1Y9EA 1YDWA 4OKNA 3Q9UA 4GBJA 3L6EA 1IB6A 4FOOA 4E2XA 4O0LA 1BXZA 4WOJA 3OQ1A 4CUJA 1PL7A 4J7UA 4FW8A 3UCFA 3BAZA 5K0ZA 1CF2O 2NADA 1BXKA 4ND1A 1GFSA 3FR7A 3GNQA 1LSSA 2BGKA 1N7GA 1QYWA 5I9MA 2PA3A 4JP3A 1BGVA 1WDLA 1JAXA 1YKFA 3QVOA 2VT3A 3LC1O 2NTVA 4RDHA 3RUIA 4TWRA 3M2TA 4IGFA 4F46A 3OETA 1I2CA 1XQ1A 1Z74A 2E6UX 1LEHA 4LK3A 4F3YA 1M76A 2J8ZA 3D3WB 3JYPA 4MIEA 4FFPA 4P4GA 1DOHA 1K3TA 2BFAA 1QYVA 4RGBA 5F3RA 1QMGA 2PD6A 4GMFA 4GI2A 2I9PA 3C3XA 1A27A 5HBRA 5JAIA 5JMPA 3V1YA 2OP0A 2XXJA 2I5PO 1U5CA 1GQQA 1RM5A 1E6EA 1JQBA 2FPGA 3VH2A 1H5QA 3B70A 4TKMA 3KLMX 3PPIA 3ORFA 3ZWNA 1GTMA 4KQXA 4B3IA 3AI1A 4DIFA 5U1PA 1F0YA 3B20A 1N8KA 1U3UA 1E3LA 2Y1DA 5TJHA 4AJEA 2XOXA 4R51A 5F5LA 3DO5A 1C1XB 3F4BA 2VYND 3E1KA 2O3RA 3W8FA 1TB4A 4YCAA 1ZMOA 2YV2A 4PZDA 3AUTA 3KRTA 3VPFA 1NPTO 3WJAA 1UXIA 1PZFA 1XU7A 5JS6A 1GUFA 3HE3A 3GAZA 2XXBA 1EK5A 3JQAD 2DT5A 3L6OO 2QG4A 4BNGA 5I7VA 1SZJG 3D5TA 4KTTE 4RPJA 3VTZA 1X0XA 4U6SA 5CG1A 4GMGA 3AU8A 4WKGA 2Q99A 2Y05A 3PQEA 4JK3A 2HUNA 3ZWBA 4EUHA 3QJ5A 5I8WA 4DL9A 4K6FA 3HB5X 7MDHA 3BHIA 1AN9A 4ND2A 2UAGA 4Y8VA 5L45A 3JQDA 4NBVA 4B4VA 3KYBA 5KTKA 1NFRA 5CEJA 2C07A 1DRVA 2NVWA 3G17A 4P38A 3C1OA 3E9NA 4LCEA 3P2YA 3UFXA 1EQUA 5B12A 3H5RA 3IS3A 4XYGA 4NJMB 3INRA 4WK6A 1JA9A 2QZ9A 1PR3A 2PV7A 4Q3EA 4EUFA 1HYGA 4N5MA 2IDZA 1U3VA 4YT8A 1HKUA 1MC5A 4R5MA 4DA9A 1B16A 4E33A 5MGBA 4IDAA 3PHHA 4XDYA 1LDGA 1I8TA 3HN7A 4AJJA 4UVDA 5BNIA 3ENNA 3GNTA 1A71A 4YPOA 4FSHA 2DTEA 4PLHA 3WGOA 4EJMA 1O0SA 3ZWAA 2CF5A 3E82A 2D3TA 3PLRA 2E37A 3GDGA 2YYYA 4A26A 3D4OA 3M1AA 2JHGA 2YHIA 4OOEA 4QT0A 4BO4A 4R9RA 3C7AA 3ZHXA 5G0TA 2BFOA 3RSHA 1XU9A 4GWKA 4BQRA 4FBGA 3IL2A 4YAEA 2WSBA 2B36A 3PFWO 4XEHA 2CY0A 5GY7A 3RJ9A 3SVTA 2VN8A 1B15A 3CH6A 1R4NA 1ZK1A 2V7PA 2OZPA 3FCOA 4XB1A 5CDSA 2GO1A 3UF0A 3PYXA 3PYMA 3OM9A 2D1YA 3KOUA 4ZQGA 3KSZO 3DZFA 3FN4A 1PJ3A 1M2WA 3LT2A 4CMKA 4R69A 4LISA 2X1HA 3R1IA 3NJ4A 4TSKA 4WECA 2XF8A 5FFFA 2WE8A 4FJ1A 2FR8A 4WJZA 1PGOA 5EQDA 3Q9NA 3AJRA 2AEFA 4EUEA 2Q45A 1K2WA 5CEEA 4UVEA 4IMRA 4RF5A 1LNQA 2DFVA 4BGIA 4CUKA 4AG3A 2WDZA 4KUEA 1LLQA 2GN8A 4J0FA 1XYGA 2JCVA 4PZEA 2E48A 1ULSA 3PEFA 2VHXA 3IUPA 3RC2A 1WPQA 3BYZA 3PHLA 3UICA 3AU9A 3A14A 4J1SA 1E3IA 4BIIA 2QZZA 5JYEA 5G4KB 3B1FA 3ZW8A 4JLWA 2IYOA 1SOWA 5G0VA 4XZ3A 1BXGA 2VZ8A 3PQFA 2GPTA 5AXCA 5TJ9A 2QX7A 1YOVA 4L74A 2NU8A 3LT1A 1HE2A 1E0DA 2IEBA 3K92A 4J3FA 5DCWA 1XG5A 3EUWA 3WGIA 3G1UA 4RL6A 5JLAA 3JYNA 5DBFA 3NAQA 4AJHA 3R6DA 4UEKA 4EJ6A 4L9RA 4K1LA 1ZK3A 1B8UA 4JNKA 3TF5A 3MWEB 4D41A 3PHIA 3IUSA 5C3MA 1ONOA 3UOGA 3RWBA 2P4QA 1QYDA 2BRUA 3GA0A 5GZ6A 3MOIA 4HX5A 4MIYA 4YWJA 1A5ZA 2PGDA 3CMMA 4FFOA 4FIZA 3C7CB 3DBHA 1DIGA 1EEHA 2GF2A 3RAJA 1X7GA 5JCXA 1LC3A 1LSUA 1XKQA 1SAYA 4JBIA 4RO0A 4DLLA 1TI7A 3IC5A 5IDXA 4DUPA 1GZ3A 2O3JA 2HDHA 3PYLA 4D0SA 2BI7A 1ZBQA 3L07A 3RC9A 3HHPA 3HB4X 1PJLA 2V6FA 3F47A 3EVTA 2O4UX 2Y0DA 3WLFA 2VYNA 4II2A 1LXCA 2F1KA 4NHEA 4U5QA 3I4CA 4YTEA 4BNKA 3K30A 4Z3KA 2VUTA 3BMNA 3HFGA 3EK2A 3JYOA 3AY7A 3JQAA 3ROPA 3FNFA 2VWGA 4J4HA 4CV2A 1HDRA 3QWAA 3H2ZA 2D8AA 2YQ5A 3GN2A 4CL8A 4ALLA 4Q3CA 3FTNA 3QVWA 2VWQA 2GYYA 4Q39A 5JDCC 3HG7A 1ZZEA 4HFNA 5KNLA 2NQTA 2HK7A 2FZEA 2NVUA 1CQJA 2LDXA 1XELA 4CQMD 1CYDA 1ZO8A 1M6HA 4TQGA 2HU2A 1E6WA 4N54A 4RVGA 3KYDA 3ZH2A 3WNVA 2QW8A 3Q2KA 3ASUA 3ENKA 4ZA2A 3TN7A 2RH8A 4CL3A 5A03A 3I6QA 3A06A 4FGSA 4NBRA 1A4UA 5DOZA 2OL4A 1H93A 3WBBA 1QYXA 1GQYA 1GZ6A 2I99A 1XDWA 1DLJA 3I23A 5H81A 5CDUA 1SEPA 1LDYA 1YRLA 4WCFA 5LC1A 5L4SA 1ZMTA 3EW7A 5T6BA 2OOSA 1QV6A 3FTPA 3NGLA 1ENYA 4LW8A 1T2AA 1WAMA 2ILTA 5JPIA 2YY7A 4NI5A 3BTVA 1FF9A 3P2OA 4WLVA 3DFUA 3IKVA 3O9ZA 4CM8B 2GNAA 1H6BA 1UZLA 1ZCJA 4XYBA 2O7QA 1BW9A 1GPDG 3H7AA 4ZU3A 4K9DA 4LN1A 3QRWA 1I30A 3Q3CA 2FMUA 4Z3DA 5JO0A 4RF4A 4I8XA 2WJPA 4RJTA 1TEHA 4EZBA 3DMYA 4R1SA 1T26A 1WZIA 1ZFNA 1DSSG 2P2SA 1YH3A 3GUYA 3L0DA 2DQ4A 2PZLA 2X86A 3IJRA 3HUDA 2X9NA 3D4NA 4PGFA 4XYMA 1LJ8A 3AI3A 3OICA 3GPDG 2EP7A 4J2HA 4UUMA 3ZWPA 4BKOA 4E4YA 4PLFA 1RM4A 1BDMA 5DF1A 1DIRA 1YQXA 3WWZA
chains in the Genus database with same CATH superfamily
5T57A 2XUZA 2PJDA 3HJRA 3KDPA 3GD5A 3T41A 3CLRD 3IBCA 4FEEA 4RCVA 1Y5RA 1JEEA 2ZJ1A 1MN6A 1XA3A 3HN6A 1QQBA 4OJQA 2PKQO 1IC6A 2BBTA 3GRRA 5JJCA 3FOEC 2F8TA 1R64A 1WCIB 1NMSA 3FFXA 3VZCA 1EP2B 4IDEA 1XN4A 4BNZA 4C3UA 5A71A 3OT1A 5AKLA 4FCTA 4I99A 4NJEA 4OHYA 4IJWA 4UDYX 4YRDA 5JZVA 4FWTA 2PX6A 4OBWA 1QIFA 3K70C 4NMWA 4DYHA 5CK5A 3URKA 3IVAA 4F3KA 4D9IA 4XWKA 3ON5A 2CLSA 5BWOA 4ZD6A 4MMZB 3UKDA 5JY1A 1N78A 4A8JB 5A3QA 3L7JA 1RQGA 2H7VA 1QTRA 4PG5A 4OUDB 3U31A 3LHIA 2B2XA 2D2XA 1FNMA 3ABSB 3IOEA 4HATA 2FPRA 3F8WA 3IP7A 4PO1A 5K6RA 1JDNA 2ISQA 4GM4A 4MTLA 4UNNA 2BDEA 2QVGA 2PKYX 1V1RA 2VPWA 4BWYA 4AO6A 1KJIA 1SUPA 3WGNA 3FZEA 4I9NA 1XAIA 4EUNA 1YNSA 2JANA 2VQDA 1QORA 3AK4A 1SZDA 3Q7EA 4KE9A 4MSUA 4KSBA 4OV6B 4DC0A 3FPCA 3ANTA 2ZSHA 1E64A 3HDVA 1QLHA 3QE4A 2ACVA 1X92A 3UAYA 3MELA 4LI3X 4WN9A 2B8WA 1BKYA 4I55B 4KQ2A 5JQGA 1NVDA 2AJDA 3RSSA 3W78A 4C07A 2X7JA 1CUXA 4NMHA 3QLJA 3T5CA 3T3DA 2ZWIA 4GEKA 2Q50A 4UUPA 4F1KA 1QYIA 1VIVA 2OV6A 4IIBA 4O4IF 4Y2PA 5BY2A 2YIJA 2OORC 3AM4A 5LQNA 3JQFA 3T7EA 4OYRA 2P69A 3GJ4A 1U8UA 4ZYVA 4FR2A 3H2YA 1ZJYA 3W5CA 2FW8A 1G2IA 1W94A 3SKVA 5I8PA 2QLBA 1UH5A 5F1OA 5JNRA 2QQ5A 4RM2A 5K4GA 1V41E 1FMFA 4CM4B 4KXMA 4GBGA 1PJAA 1UPFA 4A03A 7REQA 2P4SA 3DHYA 4NL4H 1O9HA 1SWWA 4OAQA 1K4MA 4F60A 2ZYWX 4E13A 5CBPA 1QFYA 1C3LA 1AV6A 2EKPA 4H6WA 1OBOA 3OC0A 1GV1A 1JKMA 2RIPA 3A4VA 1XL1A 4HLUA 1VA5A 1Y7IA 2AMYA 2IELA 2R84A 4C6RA 4OG2A 5H4HA 3BT7A 1C0LA 4NPHA 1Y4DE 2OZKA 1MB4A 3QIVA 4IJMA 1Q44A 3I1FA 3L1KA 3G3EA 1HE8B 4LZZA 1GPYA 1JR4A 1QZTA 3OH8A 5DULA 1G8AA 1F8YA 1VPTA 5CTJA 3VYSB 5A2GA 1WSWA 5I9SA 1KI9A 1XTJA 1EFKA 2DYKA 3EVDA 2FOLA 1FZTA 3WNQA 3Q3VA 4EEZA 4BLSA 2X13A 3V4PB 2Y68A 1IHYA 5A7FA 4EI2A 3K70D 3LFTA 4ZT6A 1SG6A 4PPNA 4QJIA 3R7SA 3H2KA 4OFXA 4KUHA 5BNWA 3ZD6A 5CH5A 4ATNA 2AXQA 2C31A 1OR8A 3FUTA 3QJGA 4QREA 3NM4A 4R71A 1ZC4A 2FAXA 3OE5A 1G5HA 5JJLA 1VHTA 3E5NA 2CJPA 1A9RA 2JKZA 4Q3LA 3MILA 4ZREA 2VUIB 4E4TA 2XT6A 4KH0A 4UHHA 1WU8A 3UJ8A 2I54A 4QPZA 4ADSG 1EVJA 2FN7A 1HTWA 1IEVA 2PZ8A 4OXKA 3NALA 1R0SA 2WMOB 1L7AA 1PFYA 4P34A 3B6EA 2AJTA 2DC1A 4G63A 4BL5A 3FYUC 4DBLE 3KZVA 5HA5A 3ENQA 4L22A 4OQLA 2EEZA 1KIFA 1Y3IA 3JWIA 4LI0A 1YACA 3BVPA 2CZQA 1GUBA 1ZKMA 3G23A 3OVMA 3K1YA 1JSLA 1JIXA 1NW5A 3F9RA 721PA 4G0PA 3I83A 3K5WA 3L0IB 2HWKA 1EXMA 1EFRD 1CUAA 1JILA 3FB4A 2ON6A 3EDQA 1RRFA 3R9WA 3L02A 2O54A 3AG6A 2GB4A 3Q4GA 1VFPA 2IK8A 1K3UB 1ZMBA 4RPCA 1JB1A 4DF3A 3RFTA 4DMGA 2RHRA 4ISCA 1S96A 1Y3AA 3M3HA 2O5EA 1JXAA 3PDUA 1EUCA 2QVBA 3AZPA 3G8AA 5KQPA 5MN6A 4DIBA 4RFSA 2OD7A 2WM2A 5DNDA 3GI1A 3ZHTA 1JHVA 2BKEA 3LBNA 1KAMA 4O1HA 4UTNA 4FMDB 4IIJF 4YAUA 5KCMA 1G55A 2VVTA 4UW9A 4G8CA 3RW9A 4R0MA 1GNLA 4FE3A 3PLAE 3F2IA 1EINA 1U0RA 1OV6A 2OZEA 3FYSA 3IYLW 4YHBA 4HNVA 3A3KA 3HY4A 3TSWA 3T1YB 5AVUA 3ROMA 4V3CA 2I2AA 5AYVA 3RAPR 1PBTA 4DLUA 2OXTA 4E2YA 4ZHQF 2V96A 3C8DA 2B4AA 3DE2X 1U2EA 4AY3A 1JLSA 1XXHA 3IA2A 5A04A 3R5FA 4WA7A 2A9KA 3H9QA 4PZPA 4XW2A 4RDXA 3CW9A 3IVRA 1P1FA 2XUDA 4M8NE 4KDEA 4NWIA 1J4AA 1HYHA 4YP7A 5B3JC 3ELYA 4KXXA 4EVSA 1R9MA 4OMCA 4V0SA 2QX4A 3KPJA 1B0AA 1JTEA 5D5PA 3PXUA 3WLPA 1T35A 4E4RA 1GL9B 3EXHB 1SM4A 1COWD 1A97A 1ADYA 2GN6A 2ZTUA 1LD3A 3UCEA 5HG0A 1QOPB 3ICWA 1UMDB 4OD0A 1I14A 3WMXA 2C4NA 3OMWA 5J58A 1GCGA 1P7CA 2CLOB 3RE1A 1BX0A 4NMXB 2XNDD 4GI5A 1CUGA 2GZ2A 3ANLA 3ET5A 4LNUB 2H08A 1CY0A 1MO2A 3QU2A 3M6LA 4M0DA 4NBKA 4QFCA 5CM2Z 5AI9A 4YJHA 3UGTA 1WCXA 1YDGA 2JFUA 3R5KA 4O5OA 5CW1A 3TLMA 3P71T 3PVCA 1Z2CA 2XV1A 2XBUA 1IHXA 1O57A 2X5KO 3WMRA 2ZVJA 3WS7A 4Y2YA 2ZM6B 1Z28A 3KEQA 4URWR 2X0EA 4DMLA 2OFPA 4MXDA 4ODIA 4CMCA 3LVQE 4ZOCA 5KWJA 1EBFA 3CNBA 5TQ0B 3IEMA 3KVRA 2D2FA 1KMHB 2JLYA 3ME5A 1VRCA 1YQQA 2C2WA 4II7A 5C5EA 1MRNA 1K6XA 1M7HA 1HSZA 1T1SA 2VJAA 4B7CA 2CC2A 1VC2A 3ILVA 3OTIA 1X1AA 4A2WA 1MHPA 2R7AA 3W4JA 1JE0A 3NRBA 4RL4A 2HK9A 1UDRA 3G85A 3PQ5A 3GLIA 1GNTA 1GCUA 2XTMA 2WFAA 1TA0A 1J5EB 1JVSA 2B9EA 4XPIB 5IXJA 3O03A 5MN5A 3DMHA 1Q12A 2R8PA 4AXXA 3KB2A 3WL3A 1QO9A 4QPCA 1AB5A 1DJLA 3CSSA 4Q9IA 5IBPA 1P9LA 3S4YA 4N4AA 2OENG 2PMDA 1QAOA 2BGLA 1W4BA 2ZB7A 2DH5A 3GRYA 1ILEA 3LKVA 1TQ6A 2NZYA 4UM5A 2XAAA 1XTSA 4P7KA 3ZNNA 2PL5A 4RTSA 2NPOA 2E4YA 1UC4B 3DDWA 3EA4A 3L01A 3K0AA 4INJA 3WICA 3L0SA 3MVEA 4FEGA 4RE5A 3E81A 2GHTA 3N8GA 4QVKA 4CM9A 1R66A 2O0HA 3VMFA 4L5IA 1B26A 3DP7A 4IICA 5TQ2A 3CEAA 3MAJA 3PUZA 1M2JA 2Q3LA 2POQX 1PUJA 1E4YA 1F38A 3R20A 2B8NA 1EX7A 3M4NA 3KETA 1XR3A 3DHWC 2JIOA 4TYNA 5KAPA 5IDQA 4K9NA 2QSZA 1Z5WA 3IRUA 4Q4AB 4O29A 1AK2A 2IITA 1V1MB 3LKZA 1Z0SA 1KF0A 7ADHA 1RPZA 4Q00A 4RDIA 5ALYA 4ALJA 5JZMA 4N8EA 3LDAA 3OCCA 3PL1A 1KNXA 5GGXA 4F38A 3TQRA 4KI7A 3RVPA 3O4GA 5AM5A 3BXHA 4E51A 3LLSA 2W2QA 3DBVO 1PRYA 1V11A 4UD6A 1E4OA 1RC0A 4DCNA 1DWUA 3NC0C 4W9RA 2OBLA 3WKAA 4BCDA 1FRFS 1T8PA 2Z9BA 4LVOA 4NZNA 3WFZA 1L4MA 2CW5A 3B82A 5CK4A 5CVDA 1QF6A 2J9FB 4J03A 2PT9A 4UEJA 3TW0A 2QRVB 4D3FA 5CLIA 3VVCA 4AP5A 1XPOA 3MFYA 3G6KA 2V7VA 3BH7A 2HFJA 1BRMA 3DGFC 3B13B 3V42A 4YMLA 2C0CA 1MQ9A 3L7MA 4YMUA 3A37A 1RRMA 4W5HA 4W99A 1QHXA 3HA7A 3V97A 3TFQA 1M2OB 3KHUA 3WL6A 3DM5A 1JAZA 1KEWA 2PYDA 1P5JA 1W88A 1UKAA 1KPGA 2IZOA 4QQKA 4DEXA 2I91A 4ND5A 4IVPA 1X19A 2HJHA 3IR7A 1KYXA 1ADCA 3JD1A 3DDCA 3EMKA 1V6SA 1Z7BA 5AK4A 4A73A 2KX7A 5FYQA 1LLDA 1ZDMA 3HH8A 4GIBA 3OZBA 4PQEA 2Q2WA 5CFNA 3EIOA 1E3JA 2Z09A 2O6LA 4AZTA 3EEIA 3OO0A 3NOXA 4HYYA 4N12A 3I1IA 4W9NA 5ELMA 4HBZA 3IDQA 3TKLA 5KUTA 3ESAA 3FNBA 3PFIA 1CRPA 1QWSA 2UUPA 1N75A 2BMJA 5DWVA 2MU1A 4IUCS 5HKOA 2V7TA 3MMZA 3OIGA 2J6HA 2JBHA 2ZCUA 3LPMA 4DLKA 1R0KA 1EFPB 4KO8A 1BSVA 2VSNA 3GVXA 1CB7A 4QXMA 4ZVOA 4OHBA 5A2QA 3QX9A 3VO8A 3VU1A 2I1WA 1PNRA 2QTWB 4PN7A 2JGLA 2C3UA 1XZLA 4ZZIA 1SA0A 3I30X 1YR8A 1YI1A 3AIIA 1WXQA 4JQSA 3BKXA 2OKGA 3SSNA 1A3CA 5JU6A 4KI0A 3MLEA 1GVNB 5PNTA 1O96A 1CIVA 2LCIA 1P0QA 3TB4A 1G7RA 2OOKA 1RM0A 4YFYA 4A3SA 4JYZA 4KN5A 2ORED 2P79A 1J6UA 2OGSA 1LBSA 4NNOA 3ZE0B 1Z22A 1XLTC 2AG6A 3ZG6A 4E5VA 1DAGA 4F11A 1CFZA 5F7XA 1NNUA 4YRSA 4N6NA 4XGQA 1FMCA 1W5BA 1W48A 1S8NA 1SVSA 4JQOA 3K9HA 3GLFE 2TSYB 1B2LA 1SB9A 1ZOPA 3ZS8A 3GB9A 3HYLA 5EHZA 2FPWA 5I7FA 3MGGA 3E4DA 3GNSA 2IFTA 1IN7A 1EK2A 1S2DA 2JARA 3MS7A 3RQIA 3HXMA 1QBGA 3C74A 3NHWA 1WULS 3DVAA 1DKMA 3TR6A 4OA5A 1M72A 3LOPA 3LQ4A 1EDZA 4GX5A 1KRWA 3QEJA 1L7DA 4PRKA 2QVYX 1WOYA 2Z5LA 1LVUA 4KPFC 1K7EB 4C4PA 5IDWA 4K6HA 4NU0A 5JH7A 1IHOA 1ONSA 5JECA 1NMYA 3A3YA 4L8VA 4A9AA 1DJPA 1WW8A 4Z6KA 1RCUA 3S3TA 4W9MC 3WZLA 1S2IA 4FNAA 1RWKA 5IK2D 2MSLA 1DRUA 3NV7A 4P80A 3A70A 3N0XA 2J9YB 5BSTA 5T6MA 4EKNB 1QSGA 3QE9Y 2OQRA 5DTIA 1NSFA 2OB1A 5ES4B 1P8AA 1SG0A 3OJWA 2MMCA 1EGQA 4XM0A 1FA9A 1K5GA 1PF7E 2ZU0C 3PK0A 4Y2TA 3UWSA 4AWAA 5AW3A 2YW2A 3MIZA 3R4VA 4R54A 5AHRA 2XHZA 1SUWA 1ZX1A 1D4ZA 3E4CA 3EZ6A 3NXKA 5K3AA 4MS4B 3S2IA 4AKSA 1AA9A 4NR0A 3VGPA 1ZJZA 2IT1A 3CB4A 1HX7A 3HGQA 3CPHA 1RTKA 4L28A 4V2UA 5AJWA 4DVGA 2A0UA 3HFRA 5A5GA 1YE8A 4J90A 5AVYA 4K2HA 1XRJA 2ECOA 3L5OA 3L8ZA 4IIXA 4KFCA 5CDYA 4XB6B 3KB6A 5BW8A 1DC3A 3DOFA 1SXIA 2C1XA 1GRCA 3QSYA 2BHLA 3EG9A 5DK6A 1YULA 3FGNA 4B3XA 1NYTA 1XF1A 1U9ZA 2AW3A 2CLEB 1UT8A 5A3JA 2D5LA 3DBRA 2JZOA 5EWLA 1YDEA 3CH4B 2G9UA 5A3SA 3ZD9A 1FW6A 2IHZA 4AKTA 4YJFB 2O07A 4NBLA 5ES3A 2RE8A 1MAAA 4YWHA 5JSZA 1Z2AA 2Z08A 4Q3NA 4BO1A 1E3DA 2VXCA 4O63O 1QXSA 3FOAA 3ANSA 4TL7A 2OV3A 3KT6A 5E4JA 1JR3E 4RD3A 2HNKA 4G5YA 4B43A 4AUMA 1NBMA 2JFQA 2BEWB 1ZEMA 2WYVA 1SCUA 2Z3VA 4NLLA 1NNSA 1WY7A 2F1OA 4Y2XA 2HRZA 5DYWA 3SX0A 3OIFA 2WIJA 2PXHA 1E2FA 1P4GA 1R5BA 2JD1A 1QH1B 1SXGA 3L0PA 2CYAA 4I9UA 4S12A 1LRLA 5KJCA 1AK9A 3HUTA 2BTEA 4PC1A 1IBSA 2OM2A 2FQWA 5H5JA 3PHBE 4MULA 3JAKB 4EI7A 4AJLA 4F04A 2QSUA 5BSMA 4IBOA 4ZEOA 1E5QA 4KNYA 2ZUTA 1DKUA 1W29A 2JGFA 3ZYCA 4QGSA 1D1SA 1CQIA 1TVKB 2YINC 1EDBA 2QRHA 2A58A 4J1TC 4LE0A 1PVDA 2YV5A 4MMYB 4UHDA 4RPLA 1JNYA 1GG8A 4HWKA 1IY0A 2ARKA 3OLZA 3VZRA 2VHEA 1EFHA 1KJZA 3LDFA 3E3AA 2V4MA 3KZXA 4P92A 2CV0A 1N7JA 3OA2A 3BIXA 3QBVA 1JN0A 1BQEA 1QQ7A 2WAAA 1NQAO 1ZQ9A 2GCGA 3E8XA 2AF4C 4DQXA 4EKEA 4XLZA 1N6IA 1FQWA 4MEBA 5COQA 5BV1A 1TO1E 3A1CA 3SC6A 3D3JA 4Q9HA 1WP9A 3THYB 2Q6KA 2XYHA 2EKLA 3CY6A 4ZFNA 3VZQA 3DKRA 4QOEA 4OBBA 4UE3S 1U2ZA 1CUZA 4OGWA 4NRDA 3JALB 2FPGB 3CRNA 1TZMA 3GDHA 3NIWA 4UAJA 2LCQA 3B6MA 2W2LA 2XJ9A 4IIVA 1QQTA 2A94A 2VYCA 3ZY3A 3LO8A 4L5CA 1M8GA 4P81A 5JTUA 3VKGA 1ZI9A 1Q95A 4Q4JB 4BS9A 2GK3A 1E7MA 1EDEA 1MO5A 1M75A 3GCXA 4DW8A 1NC1A 1QUFA 3T99A 1YR9A 2Q1WA 4WW0A 4QQFA 1CVIA 3MA0A 3DZGA 2BFEA 3L3BA 2LNDA 1LBTA 1WCV1 3EY4A 2IUFA 4LVCA 4WFIA 4PG4A 2GBLC 2VAMA 1J23A 1WMDA 5AXAA 1Y8ZA 5B3AA 3OU2A 2DBZA 4YUWA 1P1KA 3Q6NA 6LDHA 1NOIA 4FOTA 3L4KA 5FH9A 3PGJA 2Q62A 4KACA 3T9AA 2BGMA 1VJ5A 4CL2A 4U7DA 3EOZA 1C9NA 1N2CA 2C78A 1XTBA 3IVGA 3P9XA 5DBEX 5AM4A 4G6ZA 1AOXA 1B1CA 3KB1A 1WKBA 4N6OA 5KIAA 2VDMB 1KMIY 4NABA 1NVTA 3DPUA 1U7WA 2PGXA 4URHA 4C14A 1T15A 3CVYA 4TGLA 4EQZA 4N8DA 1UDAA 5AVZA 5A4FS 4RY2A 2HOQA 3BB1A 4NFLA 4RADA 3N2LA 3ZE1B 1ZGGA 1J06A 2OCDA 3ZU2A 2AD1A 1WUYA 2NACA 3LCJA 1BQ4A 1KDOA 4R3WA 1LWOA 2H92A 4HLCA 4WIAA 1KI3A 5B3LA 3C43A 5HRUA 4DBLC 1G8GA 1BN6A 2E1PA 2G70A 3IIMA 3OCXA 4PVDA 3MINB 1ESDA 5EP1A 3T1VA 3B3FA 2J5XA 3GFBA 1LFDB 1G8FA 1QFXA 3DWIA 3RRNA 2D1FA 2C29D 3O26A 3STWA 2AN1A 4NZMA 4YA6A 2AXEA 1EFUA 2R8YA 2A88A 4MUNA 2HSWA 1BDBA 1HDZA 1TFRA 3G8YA 4UULA 3GT7A 3RK4A 3SYTA 4P4UA 1G21B 2B4QA 2NZUG 4R7ZA 3TDNA 4E32A 1VHJA 2WU8A 1KZGB 1TKRA 5CT8A 3RARA 2XRZA 2BTQA 3LK6A 4OL0A 1DIOB 2QRNA 3AW8A 4KE8A 4QU9A 4UCQA 4B35A 2XCSB 4X5OA 3RJZA 2FPIB 3KYJB 4NBSA 3R9KA 3UTCA 3V32A 2QNRA 4KYUA 4Q4HA 3EPRA 4UNRA 1KOGA 2CDCA 1K5DA 3UAZA 4IIGA 4TKLA 5EIAA 2Q49A 1C50A 3SCZA 3JQ8A 4FDTA 2LCFA 1GWNA 3U3RA 1J22A 3FPHA 3CR3C 1NA5A 1ENPA 1PFUA 1G19A 1UXJA 1HEUA 3ZXIA 4RIGA 3QE0A 1ODKA 3I9FA 3V2HA 2WFMA 1HQCA 3GK3A 1YUBA 4F56A 1RBZA 4G4IA 1DBVO 1RQ7A 1V4NA 3H0EA 4H59A 4DQ0A 4RNDB 1DAOA 2OXIA 2JAXA 4YUVA 3RSGA 1AQIA 4R0NA 2QLJA 1IBMB 2XNKA 2J67A 2B20A 4WPGA 2EKBA 3CX3A 3MD9A 5LDGA 4MPJA 4M6WB 4WY8A 2E4AA 3LWBA 2N47A 4YH1A 3QHPA 2BFNA 1U0BB 4O4JF 1XTZA 3C3DA 3C48A 4A91A 5BVHB 3BDVA 1P6XA 4OCZA 1HNNA 1PJ4A 4G5GA 4WUVA 3IP6A 1RJ9A 1QOZA 1YUMA 2KLHA 2P9QA 3E18A 4JVNA 3RBAA 4K9RA 1C9MA 3O21A 3PQ2A 4H7PA 4MEJA 2CEAA 3SBDA 4DJFC 2PLNA 3DV0B 3JX9A 2BISA 4V38A 4K8RB 2EHDA 1JSCA 1NF9A 3N74A 4COOA 1GAWA 1AUPA 2IYXA 4V0KA 4EF5A 1F9AA 4ZICA 2BI8A 1QBKC 4O4HB 4RH3A 3SJCA 2TMDA 1CZUA 2F43B 4ZCMA 5FORA 3ZY6A 3TGLA 4BGEA 2VEDA 4MS1A 4IF6A 3FJ1A 2Z8ZA 2QRMA 4HPXB 3F9CA 3QEBZ 2D13A 3RHZA 5FWAA 4WY5A 1H8HD 4ABTA 4IVNA 4N9QA 1P2VA 3BGWA 3S5JA 4I4LA 5F78A 2OO3A 1M6VA 2R6ZA 2WW8A 3QLVA 4AD8A 3EIUA 3F67A 1E1YA 2HYDA 2PT7A 4X7RA 1FYXA 1F2TB 3PVSA 3TEMA 4E08A 1T0BA 2R11A 4RS3A 3DAYA 2GAJA 1ZD9A 3PIIA 3WSVA 1JFFB 5K6TA 1UKBA 2YBEA 3RYHB 1I7QB 4PSCA 3OE4A 3L4JA 1T0HB 3VZPA 1KI8A 1MXFA 2I03A 1QIIA 1XO1A 4OP2A 5BPHA 4RYLA 1C0PA 1JIIA 4F9GA 2ZUFA 1B8PA 2Y1CA 4IJVA 3JQBA 5FLKA 4OSOA 3PB3A 1YZFA 1M1YA 4MQ6A 1T29A 1I0IA 2GVZC 2ZJYA 3VU9B 1NWHA 1P81A 1XA0A 3AC0A 3HA3A 3KQMA 2G9RA 4FK8A 3RASA 1OXTA 2X41A 4D9KA 3JQEA 3FE2A 3H11A 2AI1A 2IEDA 4PSAA 2JFVA 1JTVA 1UJCA 4QRIA 5IKEA 4R6WA 2HSJA 1S7CA 5E1DA 2QUIA 1U0TA 2EQAA 2VP3A 3LYAA 4YCDA 1ZRNA 1PKEA 4MP8A 5FEMA 3TFWA 4AJ2A 1GP2A 3CPEA 4OF4A 4DWOA 3SZOA 5L4NA 4PN3A 3LHSA 2NAFA 1JG7A 2FZLA 1U7DA 5TF4A 1AQNA 1C0IA 1UOEA 2ZUBA 1QJCA 2ASVA 4C9BA 4CTOA 2I7VA 3JQ6A 1FFXA 1UFRA 3CLSC 3IHTA 1OB2A 2YVAA 2KMLA 1OI7A 2J08A 3FZYA 1X1DA 2DETA 1IJBA 1KAQA 3LP6A 1JSXA 4HN9A 2FQYA 4ND3A 1C3OB 4G81A 3PR3A 1UC8A 3HSSA 4IJ6A 3GMIA 5A9RA 3U13A 5ICMA 5TXGA 5JFGA 5JVDB 3ZKAA 1OYYA 1Z2EA 4OXYA 1O5IA 3ZGXA 4CV1A 1IY9A 1QQ6A 4CR6A 1JXMA 3OQHA 3G9XA 2YVQA 2QV0A 5E2IA 1W85B 3I64A 1C1XA 4ZEXA 2PWZA 1YCHA 3AOEA 1HE5A 3B36A 1T43A 2WD9A 3IODA 4FYYA 5DXFA 2I2DA 1D09A 3ROXA 4WZZA 5JDIA 2A2ZA 1DKOA 2JJ8A 1DO2A 3AF6A 1ZRMA 1KKMA 5FOWA 3U5TA 2I71A 3MLBA 4HDMB 1FTWA 3BWXA 4HGOA 5FBZA 4PGAA 1E1QD 1RWBA 2MSCB 3KLBA 1UCFA 2VHYA 4ZZ0A 3PKIA 5ER6A 3HEMA 3UUFA 2PRYA 4DRYA 1UC9A 1K6IA 2H4ZA 3P45A 1KC3A 4S1PA 1L5GB 3TSAA 4RA6B 4UFNA 4QXQA 3OCJA 2WYIA 3HO6A 4ROTA 4C06A 3SZRA 3NHPA 4TZ6A 4L6IA 2QLMA 4XQ0A 5ALOA 4Q7MB 2W2XA 4ZYLA 1O9GA 1XEWX 4ZKEA 1UJMA 2YV1A 4L0QA 2LW7A 4Q12A 3EDCA 4BTEA 4QASA 3NWJA 2BFBA 4YRTA 2J4CA 3LUJA 1CE8B 1X1BA 4L6CA 1R6VA 3BIOA 1XAGA 2E4VA 3FF4A 3K94A 4NC9A 3HV2A 4F96A 4YRRA 2ZZNA 1C4WA 1USWA 3H86A 4QDTA 5KTMA 4HUQA 3OZVA 3ET4A 3NWPA 2EX0A 1EP9A 3HZZA 2C7GA 2XB2A 3I9V6 2JBWA 3L7YA 2PEZA 3WRXC 3OF3A 4BUZA 3WOVA 1THMA 4UXIA 2NXCA 1A9TA 2XD9A 3ZVNA 2Z5GA 3GDOA 2D0PB 2DR2A 4R7TA 1NBWB 2A78A 4DMHA 4ENSA 3RAFC 3PXAA 1BW9B 3IQXA 3N87A 5B1SA 2VTEA 2B30A 3M2PA 4WA8A 2XGJA 5M34A 4WDQA 1P18A 2BKUA 3F46A 4QQ8A 4U00A 1RYHA 5G1PA 5T3YA 3EGEA 4O2AB 1SU8A 2UVQA 4FX2A 4MW2A 5B2ZA 4MVJI 4UD2A 4KO2S 4E03A 3VKHA 1HQYE 2BMFA 3E0QA 5MHTA 3CLSD 1THGA 2AT1A 2C2YA 3Q5DA 1MOQA 3WE7A 3AJ9A 4EFDA 4E46A 4YRPA 1AMOA 2I7DA 3BMQB 5CLQA 1Q11A 4F2WA 3ZE7A 2G8NA 4LBYA 3DFZA 1G8KA 2JRLA 2FKNA 4QO8A 1BE8A 1L6RA 3RFXA 1NDQA 1C8LA 2ASEA 3FH0A 2I76A 5CBKA 1RLTA 2W11A 3DL0A 2IS2A 1G3UA 1QUEA 4TVOA 2FN8A 3PGKA 1NT2A 1RKUA 3IPRA 2QP3A 3QIAA 1V48A 3T9DA 1U9IC 4BVBA 2GJ8A 3ZVKA 3EW9A 1X7DA 5GJWC 1W4AA 2CV1A 3H5OA 4KK3A 1RYMA 2DBVO 5DX8A 1KORA 4OHOA 3KS9A 5BWCA 2I2CA 3NTQA 1TU4A 3PC4A 3ILXA 4O2RA 1KEEB 1FSSA 4R1TA 4NJEB 1YQ9A 2WU1A 4N03A 1YZUA 1Z13A 2F3PA 2YMLA 2W6PA 2G80A 1H2RS 3HY6A 2WWIA 3MJEA 1UFVA 4MINA 5ALXA 3F0TA 1RAEA 1VG9B 2LV8A 1ZVVA 2GEFA 4YRAA 4L4SA 1XN1A 4ZQHA 1EAYA 3GLTA 5EAIA 3RUEA 4Z1OA 4FR0A 1NN3A 3M6XA 3WMEA 3L82B 3TRDA 1J56A 1GL7A 3DE0X 3KYCA 3N58A 4IXTA 3QLUC 4GLJA 5IMBA 5CB4F 3DZ8A 2SBTA 4I1YA 2O14A 1Z82A 3A32A 2WDPA 4BFSA 3ADPA 4EVIA 3Q8KA 1ZR2A 5AVVA 1V1RB 2VYVA 4MV3A 1QB7A 4YI5A 3CEJA 4MO2A 5IKPA 1T3GA 4U6NA 5MFZA 5DP1A 4ZEWA 2I1LA 3RUPA 3UGJA 5FBWB 1MZPA 1I0ZA 2V7EA 1KKLA 3CRMA 3BHJA 3HS3A 4M1ZA 5T8KC 3I09A 3KKZA 4KGXA 4KQ1A 1CR4A 4MKXA 3SIWA 3OZRA 3J80A 4P3XA 3LUAA 4WN9B 1JNXX 3AFNA 1SUCA 3JPWA 1XMIA 2QXYA 5JQGB 3HBAA 3AT1A 5JARA 2G04A 3KPUA 1AKNA 4BVJA 2GESA 3DUWA 3OM0A 2FRDC 1M5RA 1UBSB 2NUAA 4NBUA 1ISMA 4W1SA 2YKGA 2V9PA 1S6YA 2GPWA 2JIQA 1UBGA 1QMPA 1UBLS 3QELA 3TNJA 4IR7A 3IVCA 4Q37A 4QEDA 3TLBA 1LDEA 3OC6A 4X1IB 1ECJA 3VMMA 3ZHUA 4JOCA 4G0NA 2AXNA 1HETA 2B5WA 3QFTA 4C3ZA 2DMRA 2HIMA 5ENVA 2W48A 5FUBA 4OIFA 3DXXA 7REQB 3A1UA 1ZK0A 1DXQA 3CUVA 1U3GA 3NTOA 1LTHR 2ZYTX 3V8PA 4ANFA 2IU6A 5CBPB 2DERA 1G21E 1WZNA 3U9LA 1ACLA 2R2AA 3F1KA 2AQKA 4I6GA 3UAOA 1B6RA 4AF6A 5LQCA 1VE1A 2J0QA 1NM5C 3JWPA 4KPYA 1WMSA 4PAMA 1YFLA 2OK7A 1JLMA 1M5UA 1NW6A 2C9BA 4QNNA 5AK3A 2QROA 1NXXA 2Q0SA 2YWXA 5LA6F 2GYVA 4D8UA 5KNCH 3M83A 1T4GA 1T3ZA 5HOQA 1K7CA 4A15A 1VECA 2X76A 4F5ZA 4Z54A 3HM9A 1YBVA 2NSHA 5KINB 3JASA 1G16A 2XCUA 3RTEA 1M54A 2IYTA 3F4KA 3F1LA 4YQFA 3DLCA 2ZQYA 1FBTA 4EYEA 1YZQA 1EPUA 3WYGA 4X9XA 4P7GA 3UPDA 2ZSAA 3A58B 4F4UA 1QCYA 4KTVE 4DABA 3G2OA 1US8B 1H3EA 2GH1A 1UUFA 5D8DA 4XQGA 2OQVA 3QBDA 3SE7A 2CBGA 2CVFA 4JQCA 3W9YA 1OV4A 3C3KA 5IABA 3RU9A 1DFGA 1WZ2A 4QDUA 2C7QA 3SC3A 2G1UA 4Q3DA 2AHRA 2P6OA 4MR7A 1P4SA 2NMVA 2F1IA 5J5CA 4Z9FA 1G5PA 2OSBA 5HFJA 1V95A 4ZVRA 4YAJA 3GLGA 4NV3A 4U2KA 2X0DA 2OBNA 4ZVSA 1A9OA 3TRJA 2HY7A 4G86A 3ZD8A 2G9ZA 4RSMA 1A8SA 3SWWA 1Z0FA 1RHMA 1OAAA 3TDKA 3H1BA 3LRPA 4Q0MA 1EGMB 1XVVA 1DKQA 2X8BA 3EXHC 3LUPA 4HYEA 5C53B 2PRKA 1YCDA 3RRMA 1X86B 2V0NA 3T7AA 2ODQA 1CJMA 2YW9A 2ZTHA 1D0IA 1T5LA 4OHCA 4XSHA 5E4FA 3I92A 3W4KA 1W4RA 1X8KA 2PZBA 4FOPA 5JSKA 2R3SA 3ZVRA 1O4VA 5DMHA 1U7XA 1KQ3A 2ZB8A 1EBBA 3BFPA 4TWAA 1WPGA 4RORA 2HLDA 1RQPA 2AXPA 4MYTA 4U2BA 4EKGA 2IL1A 2X2EA 1X87A 1AKTA 1JDBC 5FO1A 1EUCB 3AY0A 1RIIA 4G26A 1VJTA 3C8HA 1A76A 1XNGA 3NEYA 4H1VA 3DJFA 2DH6A 4BAZA 3NP9A 4RFSB 1GZUA 3MS2A 4P3PA 4B83A 4UM9B 1TTTA 4QUJA 3A4NA 1O58A 2J3IA 2OCGA 1IZ0A 1JR3D 4EIWA 2ZI7A 5D5QA 5BN1A 4F9TA 4X3OA 3LI2A 2CXSA 1K92A 3NVMB 3B9BA 3SLRA 1HORA 1LFAA 3L8HA 3QM1A 4HDSA 1D8AA 3NQ41 4L5JA 5EIEA 5KTRA 2GD2A 1E1KA 1W34A 5LBUA 5ERYA 3Q9LA 1KDTA 1NI5A 5CNJA 5LB4A 3SPXA 3TPCA 5LOVA 4ENWA 5JH7F 4JUDX 2JD0A 3VR0A 2UUAB 3GEEA 2HCRA 2PBFA 3OIVA 5C1BA 5I8ZA 3S99A 1HNXB 2XQGA 2X2FA 4D80A 1E3QA 4H27A 1RRGA 1Q2XA 2AOUA 2WSIA 3FAZA 3B6JA 2PBLA 5JCOC 2WUGA 3RHFA 1OYOA 3ACCA 2EF1A 1XXHB 2UVPA 3JWHA 621PA 3OX2A 5LXTB 5TPWA 2QP9X 1B8VA 3ZGVA 3JRNA 3I28A 1S3IA 2ZOSA 3BWDD 5G3ZA 5IVPA 1AGPA 4IH1A 2JLCA 1WP4A 1X13A 3D4BA 3QE3A 4OUKX 4U7HA 1WUJS 4ZANA 3SIRA 4YX9A 5B4TA 5D01A 3WLSA 1YJ8A 4DIEA 2H9IA 3JQCA 4HQ0A 2AOTA 3DAOA 4UBMA 1ZG3A 1HFWA 3DMGA 3CBQA 3USES 5CFRA 1OBHA 2CMKA 4WGGA 5AI0A 2ZI6A 4M89A 4LZPA 3CSDA 3ZHOA 1CXZA 2FMXA 5EE1A 2P68A 3ULKA 5KYYA 4JJAA 4XRGA 4LHSA 3TJZA 3GZTB 4YJHB 3PGMA 1JXOA 3WFJA 4DLSA 4S24A 4FPXA 3FSEA 2QN1A 2ODEA 3GA7A 4LJAA 4X54A 5DN6D 1Z0UA 2EXXA 4EUSA 4JEUA 5ICSA 5K9ZA 1QNLA 2VIIA 1RWWA 5M04A 1P31A 2ZKIA 2FFJA 1ISFA 3UENA 4RV9A 2J6BA 4FYIA 4H0CA 4RWZA 3VR1A 2Z58A 3KKPA 4GLOA 3RUCA 2C7RA 1J42A 4YIHA 4PPQA 2FF5A 2V97A 3PT5A 4GL4A 5IWAB 3TL2A 5K3OA 1WB9A 3D4PA 3N0TA 4BV9A 1V43A 2XE8A 3MPOA 4BDSA 1T4CA 1PCXA 5CVTA 1Q92A 3NEPX 4WBXC 3CVVA 1Y37A 2C82A 4UCXA 2HT6A 1VMDA 2VHVA 3ZWDA 5AVRA 1OFVA 3GLIB 4K05A 3QFHA 2JFFA 1CBUA 2IHVA 4N40A 1J8FA 2NQ8A 1E7QA 4TN5A 1RWVA 2YJGA 1C41A 3GEHA 1QTIA 1ZRSA 2FCAA 1QTQA 2A35A 3DXFA 1WW3A 4RIIA 3O93A 1QC5B 2IF0A 2VK2A 3G5MA 2WHXA 4ZI5A 4DBZA 4ZJYA 4H7JA 4HDRA 2DSTA 4A5OA 2KWIA 2YXEA 1NPDA 3EXG1 1WMFA 1N0VC 4HB3A 1RRVA 1DUVG 1MUUA 3K0AB 3Q41A 4LK2A 1PV2A 2WIDA 3P4YA 1OSNA 2YXBA 3F6YA 4G25A 1G2PA 1GNQA 4MRAA 1R00A 1YZVA 5IRCD 1V5FA 4REQA 3R6GA 1KQNA 2YWGA 5EIWA 1C8BA 2DHCA 3EZFA 5TQ2B 4XVRA 3GFRA 3GPLA 4ZJZA 2DPYA 2RARA 3PRJA 4C2AA 4FCVA 4XH9B 4LQDA 4DV3B 3TAUA 4GR5A 1JAHA 3DMTC 4IS3A 4MGEA 5GGYA 1XPRA 3O2QB 1XHLA 4UE6A 4YK7A 4GR9A 1NDUA 2XSZA 1LPMA 1GPMA 1TYEB 3B1WA 3ETNA 3ND8A 3PD1A 5GJVC 3S7ZA 4OJMX 2GWHA 4DTIA 5K8VA 3BWVA 3H1AA 2WF7A 3JYLA 3NI2A 2VTVA 4E5MA 4G36A 5I5GA 1IK4A 1WY5A 4WUTA 5A0FA 3FWPA 1FLAA 4QC2A 1RBYA 3OFVA 2JI7A 4JIMA 4CI9A 1DAKA 3HV0A 1VMIA 5TC4A 3I34X 5LQJA 1V11B 3C4JA 1Z5PA 1ZJJA 1LF5A 1NN0A 1UMCA 4B4DA 3NFYA 1VL0A 4KSCA 4RPGA 2IYSA 4FCWA 3B5IA 3H5WA 4E2FA 1E4VA 1J8YF 2K5UA 1SMKA 4O25A 3RUFA 4QNMA 1OXKB 4YAOA 4ZT3A 1ENOA 1CDDA 2BGJA 3BHMA 1LV7A 2DTXA 2QVZX 2OHVA 4XIIA 4I7EA 2A3NA 5AICA 5FX2A 3TSYA 1SVMA 2IDJA 4DT1A 2C8KA 3I9LA 3QPDA 5GPBA 1XZFA 2PO7A 3CE6A 2AS0A 5ALZA 2I6FA 1E2UA 3UFBA 4EHKA 5BW4A 2JJQA 3U48A 1DAPA 4YGYA 1XNHA 3H3FA 5L9AA 3ZVMA 4OM7A 4E5SA 1L7EA 2SNIE 1EB9A 4I4TA 6CHYA 1B23P 1JF8A 1JMYA 3ZIAD 4ND6A 4Q3AA 4X6XA 3KOWA 3INNA 5AKYA 3EF3A 3A7DA 3QUBA 4BASA 1M1UA 2DHEA 2IEGA 3Q5EA 1CRLA 4E7OA 3KZCA 2A5JA 5H59A 3KTDA 3R7WA 3HCNA 4FFWA 1JKIA 5LU8A 1V2HE 4RTOA 3U7QB 1XZAA 3P19A 2VZ9A 3EX7C 2XT9A 2VF2A 3H2HA 5BNFA 4XDHA 4DQVA 2BKAA 2HMVA 4IGIA 1KZ6A 3FR8A 4EMBA 3G2PA 3WWCA 2F1JA 4WASA 2X3FA 1OFIA 1SUFA 1HXHA 4M46A 4RIFA 2CWWA 3IEUA 4FMDF 4Z86A 4HRVA 1VL6A 2YJ3A 3OOHA 4HOYA 5TB5A 4CGYA 2C5HA 1KZ9A 1XD8A 2C4UA 1UKCA 2FDXA 1W2WB 3EAQA 4LV8B 4TRMA 1ZITA 4IDDA 4Q9KA 5EVJA 4CU2A 1IJEA 1QGYA 3V2IA 2R6DA 3DD5A 3ZI7A 4CODB 5HQ3A 4LOAA 2O3SA 1USGA 1XFAA 1WCWA 3L4BC 3RVMA 1SA0B 5I4CA 1ZIDA 4AY2A 1Z2NX 3IE1A 4CIYA 3N7UA 5T5QA 2WVHA 1KP3A 3IVXA 3FB1A 3F6BX 4XJSA 1O96B 2WAXA 3PCXA 4B71A 2RK4A 1PBNA 4ZAYA 1CD5A 1SVNA 4CT4B 4B7ZA 3PTZA 3A2MA 5ESDA 3P26A 4WLEA 2QJTA 5K45A 4CM5A 5FBVB 1BYUA 2IYWA 5F51A 3U60B 2MYTA 3QUCA 3RODA 2P6RA 2CLHB 2QL7A 4NP6A 4BQQA 3CCBA 3SYRA 3OUTA 2PR2A 1NVFA