4ZJUA

Structure of a nadh-dependent enoyl-acp reductase from acinetobacter baumannii in complex with nad
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
QGLLAGKRFLIAGVASKLSIAYGIAQALHREGAELAFTYPNEKLKKRVDEFAEQFGSKLVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTLDGDFTDVTDRDGFKIAHDISAYSFVAMARAAKPLLQARQGCLLTLTYQGSERVMPNYNVMGMAKASLEAGVRYLASSLGVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRNVTIEEVGNAALFLCSPWASGITGEILYVDAGFNTVGMSQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a NADH-dependent enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD
rcsb
source organism Acinetobacter baumannii
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zjuA00
3O8QA 2IODA 3TN7A 4FFLA 1PJLA 4YJGA 2AQ8A 2Y1OA 1V6AA 4TKMA 3V5NA 3HE3A 3ONDA 5HS6A 4YRBA 3DOOA 1W8DA 2GZ1A 3CMCO 1PS0A 1DLJA 2C5AA 3FHLA 3ONFA 5JCXA 2VYND 1SB8A 2ZJ0A 3MTJA 4RDIA 5F1OA 5JDIA 4H3VA 4TRRA 3IP3A 4XJTA 1I2BA 2VRCA 1JN0A 3I23A 4XRGA 3T7CA 4BO9A 1DRVA 5G0VA 5L4LA 3WJAA 5CDGA 2FN7A 4EDFA 1NQ5A 2DPGA 4CQLA 4AVYA 1PQWA 5JAZA 1IPFA 3FPCA 4RF2A 3RKRA 3EGOA 3H65A 4BO0A 3WFJA 3H5RA 3RI3A 1DFHA 1YB4A 1WNTA 1BDBA 3UAGA 2DKNA 4JJGA 1N9GA 2J3HA 3GMDA 3PYMA 5L7WA 1I2CA 3ANLA 1W4ZA 1LLDA 2A35A 3WYEA 3C85A 2B4TO 1GUYA 3DBRB 3DBLA 1AHIA 4LN1A 4XZ3A 2GR9A 4AJEA 4BHTA 3GDGA 4YAKA 3V8BA 1Y9AA 3B6ZA 1LNQA 2FHSA 2NVUA 1A27A 1YB5A 4I5GA 1RJWA 2UAGA 3X2EA 1XWFA 4YJFB 2EERA 1KY4A 3I3OA 1E0DA 3TL3A 3NV9A 1U3VA 3SBOA 3CZMA 3ICPA 3TZQA 3I4FA 3UF0A 2PFGA 2FWMX 3KBOA 4J2HA 5A9TA 3EZYA 3RD5A 2JKVA 1JAYA 4PLYA 5AQ1A 5IDWA 4XGKA 3AUTA 1T4BA 5IDYA 4RO0A 5L7TA 5FEUA 2WEKA 4CLOB 4PCVA 1PJBA 2WJPA 4BNFA 1XHLA 4WNCA 4WOJA 2I3AA 4TQGA 4BB6A 2GGSA 4N5MA 1HYGA 4E2XA 5CDSA 4IQ0A 3GDOA 1KEUA 3LU1A 4XGNA 4NR0A 5DCUA 3WICA 1P44A 4GAEA 1PEDA 3INTA 3WS7A 3QJ5A 4P38A 1HDOA 3ADPA 5JPIA 5CDUA 4YQYA 3N74A 2RIRA 2VZ8A 4XR4A 1L7DA 1QLJA 2EJWA 3JD3A 3K73O 4YBZA 4U6SA 2NVUB 3RAJA 2O3SA 3LF1A 4NU5A 1T2EA 3ITDA 5BT9A 1ULSA 4D46A 2OZPA 2VYVA 2AEFA 3DZIA 3DDNA 1CETA 3WGOA 2ZB4A 2O4CA 3U4IA 3DAFA 4YJHA 5GZ6A 1QP8A 4NK4A 4E5NA 4F46A 4P22A 3ZGYA 2Q2VA 4CODB 4IDEA 4XWYA 3RQSA 3ZW8A 4NIMA 1EVJA 4JGBA 2D4AA 2BFMA 4Y67A 4LMRA 1QYDA 1YQXA 1WZIA 4YQZA 2VYNA 2W90A 4MVJI 1YL6A 2FPGA 2AW5A 4WLVA 3DWFA 4EI2A 1QG6A 3ZWWA 2RHCA 3U49A 4OO3A 1EQUA 3EHEA 2VRCD 1Z74A 3FF4A 2EV9A 1E3LA 1ISFA 1C3VA 3PLNA 3ZDFA 1L7EA 2A4KA 2AEMA 3OICA 1R4MB 4E5PA 2Z1NA 1MFPA 4UAGA 2OBYA 5JO9A 1YKFA 3M1LA 4NFYA 5AVOA 1PJSA 3TPCA 1ML3A 5I8ZA 5L40A 1I24A 2UUPA 1GPDG 5KTKA 4UEJA 1PGOA 3PDUA 4IIVA 1SAYA 4XYEA 2AE1A 1YDWA 4IDAA 1HLDA 4MVJP 4NNJA 1CYDA 1NHWA 1O5IA 2CVOA 3HDYA 4D7AA 2ZYGA 3B70A 3NT5A 1EMDA 1F8FA 3QQPA 4RVUA 1EE2A 1OAAA 4NHEA 4ALKA 4MVJF 3AUSA 2QYSA 2Y68A 2EKQA 4GMGA 4QUKA 1AN9A 4CQLB 4G2NA 3UICA 1DEHA 1C0IA 4HBGA 4CM8B 2I76A 1QORA 1Y8RB 3F4BA 4J7UA 1GZ3A 3RBXA 4HX5A 1KVUA 1D1SA 1NAIA 4A73A 4PZCA 1IHYA 1LRKA 4CMAA 2E6UX 3QW2A 3JQ7A 4BNXA 5ADHA 1O9BA 4OXNA 1ZSYA 5B4VA 5TSDA 1DOHA 2D8AA 2NADA 3GHYA 1J5PA 5JYEA 3CIFA 2G17A 1F06A 3M1AA 1WVGA 3ZNQA 1UP6A 3VVBA 1HXHA 5KVSA 1NXQA 3AI1A 1ISGA 2XF8A 4W99A 3KYDA 4CV0A 1N5DA 1MP0A 4ID9A 2JFHA 3PGXA 2BI7A 3GNSA 5JAMA 3BTUA 3Q9NA 2DU8A 2B36A 2XAAA 1HZJA 2QHXA 2Z5LA 3WWYA 3GGPA 2C07A 3GEGA 1DC6A 4KUGA 1KETA 5B37A 2QQ5A 2CF5A 1UDBA 3TZHA 5EQDA 3EK2A 1Z7BA 3JQEA 1ONNA 4M86A 1NX6A 1QSGA 5JE8A 4DIOA 2IRWA 4ND3A 2VZ0A 4E13A 5TT1A 1IUKA 3QWIA 2NU6A 3AM4A 4HFNA 3I9MA 1E1MA 5K6AA 1P33A 2V6GA 3BZUA 4FFOA 5L51A 1B15A 1XG5A 1GQQA 1LDGA 3ZWYA 5C7IO 4PG5A 1TT5A 2UV8A 3LT4A 1ENZA 2GN8A 4DIBA 2J3KA 4IY1A 4CMBA 5DOVA 3ZHZA 4O6VA 5JYDA 1DLIA 2JD0A 2P9CA 1GV1A 3H5NA 3NT2A 4HFJA 1IZ0A 1V35A 2YFQA 2WMDA 1O95A 3FPLA 3O4RA 4UUPA 1I5RA 3GOHA 3I5MA 5LC1A 2NWQA 2O3UA 4BKRA 1JWAB 5JNLA 1IYZA 1WPQA 5EESA 1PS9A 1PJ3A 4AJ4A 1GUFA 1T2CA 4R1NA 3VH2A 4WECA 2RAFA 1L1FA 1ISHA 3NGXA 1PZEA 4Q9NA 3PI7A 4ZD6A 2D1YA 2ET6A 2B35A 4YVFA 1HKUA 1M2WA 4JX8A 4TKLA 1HSZA 1A9YA 3OH8A 2AQKA 2PKQO 3NYWA 3DHEA 1JDJA 3SJ7A 2IE0A 3ABIA 3MOGA 4NFHA 2HSDA 4E0BA 2PD3A 4MOWA 1P9LA 3KYCB 4BKOA 5I9NA 3D5TA 3F4LA 3L6EA 1YOVB 3C8MA 4JIGA 5IDXA 5DT9A 5AOVA 3UOGA 1DIGA 3BMQA 1Q0QA 4RL6A 4FOSA 3EMKA 4AL4A 3HWRA 3PLRA 4ESOA 2Q99A 1H6AA 1M66A 1U1IA 5L95A 1ZEJA 1P45A 4OOFA 1HDZA 1DC4A 3TOZA 3SLKA 3MJTA 1MUUA 4MVJA 2VHWA 5A02A 4L4SA 4F45A 1BRMA 1U3TA 3K2EA 5K0ZA 4U5QA 4GSKA 2VWPA 1U3UA 3B1KA 2H63A 3JQ9A 3MJCA 4HY3A 2JAPA 4DQUA 3OM9A 4OSOA 3WXBA 4YAJA 4KQXA 4P8RA 2YDXA 4OKIA 5C5IA 1LXCA 4Z9YA 1M6WA 4Z0PA 4DIFA 3ZWMA 2X1HA 3IDSA 1CQIA 2HJRA 4H16A 5THQA 4CQMA 3S8MA 3E82A 3PQEA 1R15A 3H2SA 4I08A 4W7HA 1NYTA 5BQFA 3ZHBA 3GEDA 5LDHA 3MOIA 3MTGA 1SCUA 5TJHA 1J4AA 3ZH2A 2B5WA 5JS6A 1HDCA 3GGOA 3DQPA 3JSAA 1ULUA 4IDBA 4PRLA 1D1TA 2OOSA 2QZ9A 3FR7A 1HYHA 3ICCA 4IDCA 2DM6A 2DAPA 5DBGA 1I01A 4GGPA 1LSJA 3IQDB 3GRKA 3FCOA 2BGKA 2FOIA 2W8ZA 5HTOA 1W73A 1GCUA 4XIJA 4D3DA 5CG1A 1HE4A 1H9BA 1RPNA 2ZYAA 3DMTC 4AJPA 3ULKA 5I8WA 2I6TA 1SEVA 4EZBA 3JQGB 1ZSNA 1GQ2A 2D3TA 4MIOA 1BMDA 1DXYA 2NU8A 4RPKA 2FPPA 2UDPA 3OJOA 4U0KA 3RJ9A 4EJ0A 1JA9A 4OHUA 4RVSA 1P74A 1NASA 2IDZA 4YDRA 3GEMA 5K6AC 3H9UA 4CLXA 3ZU2A 3RKUA 4HXYA 3PVZA 3JQBC 1VI2A 3MEQA 3ZI0A 2UVDA 3DR3A 4MO2A 1CERA 4NPCA 5BSFA 5A1TA 3MCVA 3PWZA 1P1JA 2X0RA 2HLPA 2QRKA 4MKZA 4XKJA 2V6FA 3T4EA 4DUPA 4IXWA 1HTBA 3NKLA 4TRMA 2GO1A 2NACA 2VHXA 3KB6A 2P4QA 5J23A 1M6HA 3CXRA 4KWIA 3WGQA 3RIHA 4E5KA 3DBHB 3GG9A 1Z45A 2EF1A 3GPDG 5JDIC 2EJVA 1FDWA 4MKXA 4Z0HO 1J6UA 5GMOA 3WYCA 4ZQBA 4CLRB 4F6LA 4CLOA 3BMCA 2G82A 4IGEA 2I9PA 3P2YA 4LGVA 2JFFA 3NEPX 1DHRA 3V1TC 2Q3EA 4FQ8A 3QWFA 3DTTA 3OIFA 1T25A 2NSDA 4GPD1 4R51A 3TJRA 4FD3A 3W4JA 5JC1A 5F5NA 2CZCA 4RLHA 2YDYA 3M2PA 4PZEA 2BFAA 2FSSA 1IZ9A 1IL0A 1HE3A 2FY8A 3FD8A 3INRA 4TZKA 1DPGA 2GUGA 4IPTA 3IUSA 3KZVA 2J8ZA 5GZ3A 3RBZA 2UUOA 2EW2A 4PLTA 1WLYA 2GLXA 1TXGA 1ZZEA 3WJ7A 1SEPA 1NR7A 3WOHA 5IFLA 4UUNA 2O3QA 1LDEA 5FF9A 2X58A 2HMTA 2P4HX 4CR8A 4GX1A 2QRJA 4E2WA 4CM9D 5DBFA 5HBRA 4LVUA 4BO4A 4XQ9A 2FSVA 4UVGA 2PR2A 3QVSA 1U9JA 2DPHA 1H6BA 3SC4A 2CMDA 1H6DA 4WCFC 2B83A 3HB5X 5CFZA 3RUDA 4GX0A 8LDHA 1U8FO 1QMGA 3EYWA 4KQWA 3WGYA 2PH5A 4L4XA 1DC3A 4YXFA 3RC2A 3WIEA 4DA9A 2V65A 3BTOA 1WP4A 3JQCA 3I83A 3R3SA 4DGSA 1A7AA 2YV3A 1E3EA 3AM5A 5TF4A 1QYWA 2EEZA 5H81A 3AW9A 2GF2A 2Y0EA 3IJRA 3LLVA 3QHAA 4ILKA 2JD2A 4PFJA 4ZN6A 5CEJA 1ADBA 2Y05A 5IXSA 5EIOA 2W2KB 3AY7A 4GWGA 3DB2A 2NTNA 3GNTA 3ITKA 5KOIA 2DTDA 1OC4A 4IM7A 2J5QA 1PJ2A 2C7GA 1WMBA 1R4NB 4PG6A 3KVOA 4LSWA 4BNHA 4BQRA 5DP2A 3JYQA 5JMPA 2D5CA 4I5FA 5DNAA 4J1NA 3PFWO 1Q7CA 2NLOA 3PDJA 7MDHA 1FMCA 4WPGA 1E7RA 2YUTA 1A72A 5T67A 3TSCA 1QKIA 3AU8A 1DJQA 3LT2A 4RPJA 3ROPA 2Y1EA 3VKUA 5F21A 3VPHA 1RYEA 1YQGA 3ZNOA 4JN6B 1LX6A 3AU9A 2NUAA 3SXPA 1B8VA 1HT0A 4QSMA 1JW9B 3I1JA 4JCOA 1NM5A 3F6YA 5A9RA 1QYCA 2OP1A 1Y8RA 5T6BA 1D7OA 3JQBA 2Q1WA 3V2UA 4KOAA 1HYEA 2PZJA 4P4GA 6ADHA 1H93A 5I9MA 5CEEA 3AI3A 4J9UE 5MGBA 1ZJYA 1C0KA 3SLGA 2VWGA 4ZICA 1ADCA 2E37A 5EJ2A 5TGDA 1T1RA 4DLAA 4MKRA 3G79A 5I9LA 1LSSA 4NBWA 1ENOA 3WX0A 4CV2A 3C1AA 1IY8A 1OC2A 3H2ZA 1ZIDA 3JD1A 4NBTA 3WNQA 2CDAA 3EUWA 4AJOA 1I33A 1V3VA 3CSDA 5IXYA 1N9GB 2O3JA 4EITA 3WGHA 2VTEA 3AWDA 4E31A 4I9NA 3W8FA 5C3MA 2WYWA 4PLFA 2PK3A 4TZTA 3S1LA 1P0CA 1XQ1A 4WLUA 5ICSA 2DQ4A 4PG8A 3JQ8A 4LK3A 4YACA 3DZHA 3L9XA 3TL2A 3HNPA 3D0OA 4J90A 3IC5A 4ITUA 2NTVA 1QR6A 5JLAA 1M76A 5KKAA 4FPXA 4IJWA 4R9RA 5U9CA 1BW9A 1ZO8A 1ZJZA 2Z1MA 2DVMA 1ZMOA 1UXJA 4IXTA 3L9WA 1VL6A 1AHHA 1PL8A 3QVWA 4R9SA 2Y67A 4INAA 1GQYA 3E5RA 4IMRA 4D0SA 3AM3A 3DOCA 3RU7A 5LDGA 2ZQZA 2PTGA 4R5MA 3GVXA 3VVCA 4CM8A 4XQGA 3UXYA 5A03A 1PR9A 1GUZA 2PY6A 4Q39A 2LDXA 4JP2A 1GZ6A 3TFQA 1GADO 1X7HA 2X0JA 3L6OO 5A3VA 1V0JA 2HRZA 3ZHXA 3QIVA 4S1VA 3Q11A 1GPJA 3E9MA 3E18A 4XD2A 1NR1A 1G0OA 3ZV3A 4FC6A 1YQDA 3RFXA 3PIDA 4MIYA 1TVEA 4BNTA 5DBIA 4OIMA 1YL7A 3GG2A 4PVCA 3K96A 3PYLA 1W6UA 4DRYA 1CJCA 2P9EA 4L9RA 4ZQGA 1LDMA 3OIDA 1HWYA 3FBGA 3ROQA 3OJLA 4D43A 4B4OA 1MB4A 4BV9A 4N54A 3GFBA 4BNNA 2EGGA 4WJZA 1VLLA 3FBTA 3Q0EA 2AA3A 2A92A 3WQRA 3W4IA 3PHIA 3D3WA 4MP3A 4CMIB 4R4JA 3CKYA 1BTOA 3FTPA 4E30A 2VOJA 1LRLA 3BMQB 2B4QA 2H1SA 4Y6SA 5I7EA 5C37A 3UGKA 1V9LA 2YY7A 2AMFA 2NVWA 3MWEB 1DIHA 4W7IA 3L4BC 3WGZA 1KVQA 3OMLA 4WCDA 4BS9A 4LCEA 5EMHA 4A03A 1EVIA 3AFMA 3UW3A 5KVVA 3FNHA 3U62A 3QP9A 4A2CA 3OP4A 4DPLA 5BR7A 4RVGA 5A4DA 1C14A 2YHIB 1Q1NA 1YONA 3WFIA 1ADFA 1EVYA 2VHZA 2OMEA 1ONPA 1DIRA 4BKQA 5DOZA 5JMWA 4DVJA 4D3FA 4J0EA 1LBEA 5TS3A 2CD9A 3WG9A 1E6EA 4E21A 3K31A 3U4CA 1JKIA 2B37A 1C1XB 2W2LD 3H9GA 1LDBA 4L4RA 4J16A 3U5TA 3FSRA 1BXGA 3BTSA 3IAHA 2BI8A 4XEHA 3ZV4A 1ZEMA 4BMNA 3BTVA 3GMSA 5JDCC 3BMNB 3ZWPA 2E4AA 2VTDA 1MG5A 2VN8A 3NT4A 5F1PA 3AOEA 1PGNA 4KWHA 4ROSA 5A04A 5AXAA 3NTOA 3OJ0A 3CINA 1HDYA 2ZB8A 3KRTA 1T2AA 3UKOA 3K8ZA 1A5ZA 4OL9A 4ONEA 2Y99A 2RH8A 1SOWA 3NTQA 3NJ4A 3LC2O 1ZK0A 2Y0CA 1R66A 3OQ1A 3COSA 4N7RA 4QFDA 3HG7A 1N1EA 4IZIA 1BVRA 3FWNA 3H4VA 3INGA 2X9GA 2X5OA 3GPIA 3PHHA 4YPOA 3OBBA 2XXJA 5AXDA 2PA3A 3WLFA 3UCFA 1PL6A 1DC5A 5JY6A 4E5MA 4O0LA 2UYYA 2IZ1A 3GZ4A 4PN3A 1R4NA 1VE9A 3CEAA 3FI9A 3X2FA 4DPKA 4W9NA 3DZJA 1OI7A 4U7WA 5KKCA 1AXEA 1K6XA 1KVRA 3HADA 3IUPA 3DBLB 1E1NA 3DBRA 5THKA 4ZJUA 4DLLA 1OOEA 1VM6A 1HDRA 1I32A 2O48X 1X1EA 1XU7A 3L77A 4QXMA 3AOEC 3DFZA 1R0LA 2HUNA 5EQFA 2BD0A 3S2EA 3EVNA 4B7CA 4CL8A 2VYVD 5L7YA 4YJFA 1DRWA 4C4OA 4DXHA 2AXQA 3AK4A 3BMCB 1I2ZA 2HRBA 2YJZA 4RQTA 4BKUA 3WMWA 6LDHA 1YE3A 5IJZA 1A4IA 3GVHA 1PGQA 2H9IA 4BMVA 3L07A 2NU7A 3DZBA 3GUCA 2O7SA 3U4DA 2BELA 4YAIA 3O38A 4J4HA 3GVCA 4JROA 4R01A 4L8VA 1VKNA 3GF4A 3HDJA 1YH3A 4R5HA 4PLZA 2VHYA 1V3UA 1KYQA 4BGVA 3F3SA 4Z3DA 1A4UA 2IZZA 2OGUA 2WE8A 4OXKA 4HWKA 4RQUA 5L4SA 1XQ6A 4DC1A 2ILTA 1U7TA 2ZKLA 2HMSA 1C1DA 3KOUA 3RCBA 3P7MA 1SOVA 2X5JO 1VC2A 2CUKA 3AJRA 2X7HA 1KC1A 4GWKA 4XB2A 1F14A 3PRJA 3G49A 4PG7A 2OL4A 2GCGA 1G0NA 2X9NA 3MWDB 2VUSA 2YQ5A 4OXYA 2ZTVA 3VH3A 3SJUA 4YT8A 4YJGB 4AJIA 1U4SA 2W98A 4HFRA 4Y8VA 5L45A 5ENDA 2GD1O 3E5MA 3G1UA 3PP8A 3PZBA 4LISA 4GX5A 1LLUA 4BNIA 1N7GA 2Y1CA 4CM7A 1Y8QA 5IAAA 1K3TA 4QQRA 3S2IA 1H2HA 5G0UA 3ZCXA 2G1UA 4R68A 4EW6A 3BIOA 2DTEA 2DBRA 4E33A 1H0KA 1LA2A 4FW8A 1N2SA 4K28A 4OYRA 5BNFA 1HE5A 3WTBA 2JAHA 1UZNA 3PQDA 3WSVA 3KYBA 1JAXA 1EDZA 4UUOA 4GBJA 2O2SA 5TRTA 4BNLA 3GVPA 1X0VA 5GZ1A 1CDOA 3EAGA 3ZU4A 3N58A 3FN4A 4Y9DA 1EFKA 3GHHA 3NDRA 2Y93A 5F5LA 1E7YA 5TNXA 4DYVA 1PIWA 3DZGA 1GV0A 3OSUA 2DC1A 2P2SA 1AUPA 1UXIA 3FR8A 3JD0A 5CPFA 2JHGA 2FR8A 3E8XA 4ND5A 4BO7A 3PJFA 1KEVA 5ER6A 3E6AA 5L53A 2X9VA 2FZWA 5G0WA 3KHUA 3OJEA 4FFMA 3DAGA 4EYEA 3WQQA 2EKLA 3ZWCA 3RUEA 3HSKA 1UR5A 3K9QO 2C0CA 4J4TA 3PHLA 3W6UA 4AJJA 4B79A 3U4HA 2WE7A 2YQ4A 3QVXA 1ZXLA 2QX7A 3D3WB 1ISMA 1LSOA 4N18A 2VWQA 4CMIA 1X1TA 2EP5A 3PWSA 4RLSA 5G2OA 4R69A 4M55A 3GUYA 4B3IA 5F3RA 1GYQA 4XQCA 1ZUD1 3HDHA 3FWZA 1JVSA 3PIIA 3WNVA 5BNTA 5T64A 4FJ0A 3M6IA 3TNLA 3W8EA 4KP7A 4TVOA 1WDKA 4BO1A 3E48A 3JYNA 4CQMD 3PYXA 1A7KA 2Z95A 4GI2A 3E9NA 2WTBA 5A9SB 4B3HA 4PLHA 4MP8A 1D4FA 3RFVA 2O3TA 3JQDA 3HUDA 1P1HA 3RUHA 4NG5A 1NPDA 1LC0A 5KVQA 5KIAA 4RF3A 1VSUA 3STHA 1BDMA 1A9ZA 4LRTB 4FIZA 3L6DA 1MG0A 1J0XO 4RV9A 1B2LA 1GEEA 1WXDA 3DZFA 4GKBA 2YV1A 1C1XA 2AQIA 4R3WA 5A3JA 1QYXA 4HFMA 4WK6A 5IG2A 1BWSA 2XXBA 1EBUA 1K6JA 3NGLA 2ZTUA 4YR9A 1ZH8A 4ZRMA 5TJ9A 3EDMA 3C1TA 2R00A 4CUZA 3HFGA 4HV4A 3VH4A 1DB3A 4B8WA 1EQ2A 3WIDA 1YOVA 1F12A 4ND1A 4J0FA 1RWBA 3D4PA 5JSFA 2P68A 3FTNA 1V3TA 1EUDA 3BMOB 4J6FA 2VUUA 3RSHA 4KUEA 2Y1DA 2DUWA 1DRUA 4CMHA 4I8XA 4P4LA 4G65A 1KVSA 3JQ6A 1PQPA 3K2BA 3RUAA 1EK5A 4NK5A 4IJUA 3JYLA 3U9LA 4JK3A 4J43A 3TRIA 4O63O 1NP3A 2X23A 2OFPA 5DDIP 1VL0A 4UREA 3S2GA 5KNLA 3R1IA 4JJFA 4R16A 3GN1A 1FF9A 2OBNA 1E92A 5FYDA 1U5AA 4CL3A 1BXZA 2EP7A 4NBRA 5G4LA 2FPIA 1R37A 1FXSA 3F1KA 3R3JA 3GGGA 4AG3A 4J91A 4IMPA 2Y66A 2IEBA 3ZWVA 2Q46A 2V6BA 1UXHA 1M75A 4CM3A 1VL8A 3F47A 1I36A 5KJCA 4CMEC 4NDNE 3AY3A 1NVTA 3I9JA 1B3BA 1LDYA 1DFGA 2IEDA 2AHRA 1H5QA 2EW8A 2J6IA 4MPDA 3I9KA 1JKJA 4MVJM 4ZHSA 5KWEA 2JD1A 4OH1A 4OMUA 1N92A 5JO0A 3HFSA 2C82A 4GLOA 1CF2O 2V7PA 1UXGA 2Q50A 3GA0A 3GK3A 3LT1A 4BGUA 3KYCA 1G6KA 4AJHA 1ZVMA 4Z0TA 2JCXA 3KV3O 2R2GA 3OIGA 3OFSA 2O2YA 4A27A 4GH5A 2FRDA 4QX6A 2CY0A 4CM4B 1ADGA 3VH1A 4D44A 1ZK2A 1NQOA 5JXWA 1PGPA 5JC8A 3CE6A 4BNZA 2D2IA 2J5RA 2BFPA 3K30A 4K6CA 4W82A 3U3XA 2GYYA 3FNEA 3WGIA 3LZ6A 2Q1UA 2GSDA 1XCBA 3ETDA 3G17A 1W0CA 4DLBA 3GY0A 4QECA 5BSHA 3VPSA 1B16A 5COBA 4RZIA 3LLSA 4O1MA 2JL1A 3LC1O 4XDYA 4YWJA 1BXGB 3SC6A 4HKTA 5A9SA 2C59A 2PD4A 1N1GA 3BHIA 1HDXA 1SMKA 2CFCA 3IKVA 3OA0A 3JQ9C 4XQEA 5G4KA 4C7KA 1I0ZA 5COAA 2EWMA 1BHSA 1FDTA 2AEJA 1NWCA 3K6JA 4J7XA 4YEDA 3KEQA 4R1UA 3QWHA 4D42A 1XDWA 1K0UA 3ZWAA 1S7CA 5IN5A 2BKAA 4WLOA 4D3SA 3IL2A 4G5HA 1D3AA 3PHGA 3V2HA 5T8KA 1T2DA 4RPGA 3NTRA 1KERA 2CDBA 4QT0A 5DZSA 3NAQA 3KSZO 4EEXA 4E2ZA 3CTMA 2PNFA 3Q3CA 3ENNA 2HMVA 4CUKA 1N8KA 3DOJA 4U6QA 2C5EA 4YJDA 5KJEA 5A05A 2PLAA 2R00C 1OMOA 4AJ2A 4NBVA 4MVJH 4IIUA 5AYVA 3WGTA 1U2GA 2OUIA 1GYPA 2GRAA 1IB6A 3ZWXA 2GN4A 2HK9A 1H2BA 5IF3A 4NH4A 2HKIA 1NPYA 3DMTA 4GMFA 4B7XA 4E3ZA 1UDCA 4AJLA 3UHAA 5B4UA 4AJNA 1RM0A 1U5CA 2X0IA 2ZK7A 4D79A 1E1KA 2Q4BA 1FK8A 4TRJA 3ZZNA 1MX3A 2W2LA 4M1QA 1BXKA 3TDKA 1LQTA 1KY5A 5CDTA 1C1DB 3C1OA 3QLJA 3GNQA 4IZHA 3Q2IA 4NJMB 4FR5A 4YRDA 1LLCA 2PWZA 3OA2A 4PLGA 1ZK1A 1H9AA 3GN2A 3L4SO 3F1LA 1E3IA 3RBVA 2OXIA 2DFDA 3F9IA 3OQ6A 4HUJA 4BB5A 2X5KO 5HA5A 3B20A 4BGEA 3DXFA 4J49A 4QFCA 4CMJA 4DREA 1UZLA 1JU9A 2IXBA 3TOXA 2QYTA 1T24A 1Z6ZA 4EUHA 1YO6A 4R1TA 2C2XA 5TQVA 1HF3A 2DT5A 2JFGA 1QYVA 3P19A 4I9HA 3H7AA 4WEQA 4BKPA 2IZ0A 2ZTMA 1SPXA 4FS3A 3ZU5A 4C7JA 1ZKMA 4IJKA 2VNAA 4B7UA 5JW6A 4BL5A 3H9JA 2HAEA 2EIHA 2PZMA 3DTYA 4PGFA 5C7OO 4HNGA 4CV1A 4DWVA 2YHUA 5DF1A 3ZN2A 4NMHA 1B26A 1VJ0A 5DCYA 4AFNA 1ENPA 4TMFA 3GR6A 3W1VA 3WR5A 1XELA 1R4MA 2CDCA 3GT0A 4UVDA 5I7SA 3LVFO 3RU9A 3EW7A 3WBBA 4ZVVA 2DBZA 1TT7A 2HCTA 4M89A 4MVJD 3Q1LA 4BMSA 1WDLA 2ZYDA 3DZKA 4GSLA 4XJSA 3D64A 3GVIA 4E32A 1CRWG 3EC7A 1YJ8A 2PKRA 3ZHYA 4RF4A 1YDEA 1BVUA 1RYDA 4MJLA 2E48A 1N7HA 1P77A 5ICMA 5KVCA 4RPHA 1XR3A 1B8PA 1OFGA 4ALNA 4CMCA 3WWZA 2CVZA 2Q49A 1NWHA 1GD1O 1Y5MA 4GKVA 1MXHA 4EJ6A 3S55A 3CZRA 3H3FA 3JQFC 1NFQA 1I3MA 4YYZA 4IBOA 3H9EO 1UJMA 2VOEA 2JHFA 3ANMA 1DAPA 5AXCA 5H83A 1ZW1A 1LU9A 2FMUA 4XDZA 1SB9A 4LMPA 1HLPA 2D5AA 2AQHA 1UUFA 3GZNA 1NNUA 4Y98A 1Q0LA 3W6ZA 2O3RA 1NVMB 2YFHA 4OQZA 1I10A 1KBZA 3I9LA 4GLLA 4O59O 2QG4A 3EY4A 3GFGA 3LC7O 3A14A 4CMEA 4Z6KA 5JBIA 3VZPA 1AGNA 4I9UA 2FP4A 2BMAA 4AJKA 3RWBA 4YT4A 1EZ4A 1TI7A 2SCUA 1E6UA 4DYDA 2V6MA 4B4VA 4OGWA 1MGOA 1P1RA 1UAGA 3KXDA 4NZ9A 3TWOA 1UZMA 3I4CA 1F0YA 3RUCA 4NJMA 1J49A 4EGFA 4Y6RA 5CG2A 4MDHA 4DL9A 4R3NA 4XB1A 1ZSVA 2DTXA 3JQFA 2DBVO 1U3WA 1O94A 4PLVA 1YJQA 5HM8A 1A71A 3KUXA 3JV7A 4O5OA 4E5YA 1YS4A 3JQAA 4I5EA 4ZA2A 3TZ6A 1XLTA 5H82A 4EJMA 3HHPA 3AI2A 3RC1A 1T26A 4FN4A 1PQUA 2GZ3A 4CM5A 1KOLA 1KEPA 4ALIA 1LDNA 2WD8A 4B4UA 4XIYA 5EL0A 2BGLA 3GAFA 1ZCJA 5JFOA 2VT2A 4CMKA 4PLWA 4OM8A 2HJSA 2HK8A 1E6WA 1XA0A 3JD4A 4ZQHA 1IOLA 1XSEA 2OORA 4J1QA 1QXSA 1NQAO 2GDZA 4RJTA 1JTVA 4RCVA 1LTHR 3GAZA 1E3WA 1VSVA 1Y1PA 4NQZA 1DHTA 3IJPA 7ADHA 4QO7A 3RC9A 5G4KB 1I3KA 4BIIA 2P91A 2C29D 3TF5A 5T8KC 1E1LA 1UP7A 4JQCA 2WYVA 1PJQA 1BW9B 2VNSA 4K9DA 3BMOA 2H6EA 1PL7A 3MJVA 5IZCC 1K6IA 4EBFA 3Q2KA 4NJOA 2D59A 2OO5A 5FI3A 5IDQA 3TZKA 1SBYA 3LDHA 2Q2WA 2P5UA 3I6QA 3R0IA 4MVJE 1VJ1A 2Q2QA 4IDGA 4TRNA 4YCAA 1HETA 5KJ6A 4WOKA 2GZ2A 4RORA 1Z7EA 1QV6A 3H3JA 4H7PA 4I5DA 1IHXA 3IIEA 4URFA 3PHJA 1PTJA 4BNJA 3FNGA 1PWZA 1B3RA 2X22A 1XU9A 4OQYA 2NTJA 3SX2A 3WBFA 1GR0A 3W8DA 1GL3A 1EFLA 3PPIA 4FFNA 5DCWA 3RASA 5IZCA 3VPFA 3WQSB 1PS8A 3CMMA 3CH6A 4YB8A 3DC2A 4UVEA 4XCVA 5G0SA 1X13A 1NQTA 4DPMA 2ZATA 1UP4A 5EINA 1EVZA 2PGLA 1LEHA 1ZK3A 4I1IA 5B4TA 3IOYA 1XGKA 1RM5A 1VRWA 3D7LA 4LRSB 4BNYA 1WDMA 4A10A 3VDQA 4AICA 1LJ8A 2F00A 3WGGA 3B1FA 1UAYA 1TT5B 1ZMTA 1KVTA 2CVQA 2HU2A 4RDHA 3EZLA 3OEWA 5G0TA 4J3FA 2EGHA 1I30A 3HJAA 2YV2A 4TWRA 4E12A 1PR3A 1XKQA 4YAEA 2PD6A 4B4WA 1DSSG 3A06A 2BGMA 2YW9A 3N7UA 3DHNA 3JYPA 5CP8A 1RM4A 4CJXA 3JQ7B 1I3NA 4DQVA 4FGSA 2WDZA 1YBMA 5JCJA 1R16A 2C20A 4JXKA 3DFUA 1MC4A 3WTCA 5JAQA 1Q2XA 1WAMA 2Q45A 4KDFA 4BUCA 3LT0A 1R6DA 4R1SA 1O8CA 1E7WA 3QA9A 4OKNA 2H5LA 4YAGA 2PZLA 2QRLA 3AUAA 3PK0A 4GQAA 3TQHA 1PWXA 2I3GA 4M49A 5TT0A 2GN6A 2GNAA 2GERA 1TEHA 1PSDA 3G0OA 2QIOA 3KLPX 3KYDB 2G76A 2ZB3A 1Q0HA 2JJYA 1K5HA 3NDIA 1YRLA 1ID1A 4U8GA 1V8BA 1E5QA 3QE3A 2VRBA 3ON5A 4M8SA 5K9ZA 2P5YA 1E3WB 1PZHA 3LQFA 3O03A 3HN2A 3KM0A 4UVIA 2XOXA 3ST7A 4CUJA 4N5NA 1XEAA 2VHVA 3DAPA 4LCJA 5F1KA 1P3DA 2IXAA 4WEOA 3WYBA 1YXMA 5KJ1A 3A9WA 1LSUA 4FJ1A 1PJCA 4BO8A 3FRJA 2QW8A 2I99A 1PZFA 4GVXA 4W6ZA 4XA8A 2DFVA 4A5OA 4D0RA 2R6JA 3MZ0A 1T1SA 4XYLA 5IZ4A 1GAEO 4W4TA 5FWNA 2CNBA 3BXXA 1TB4A 4WNIA 3ZNPA 4P4NA 2P9GA 4U0JA 3VZSA 4PRKA 3RUIA 1HE2A 4S3MA 1DJNA 1EDOA 2EKPA 3HDQA 5DN9A 3D4NA 4Q3AA 2VT3A 4WLFA 4BO6A 4FOOA 5HWSA 1JKFA 2DLDA 1X7DA 1GY8A 2B4RO 3OEYA 1D8AA 4YA6A 3L0DA 2HDHA 2PZKA 2O7QA 3ZW9A 1E7QA 1CWUA 3BAZA 5L9AA 4IJVA 3D1LA 3UH1A 1HSOA 1LLQA 5I7VA 4JJIA 3JQ8B 5LCXA 4F3YA 1SC6A 3DHYA 3JYOA 1UDAA 2DUUA 4BOYA 3WMXA 1U4OA 4BO5A 1HL3A 3OECA 3I52A 4G81A 4Z9FA 4NU6A 1PGJA 2WD7B 1FJHA 5AXBA 4JBGA 3LSYA 1GFSA 1ORRA 4MVJG 3ETGA 1YB1A 1GZ4A 1NFRA 3BA1A 1MXFA 4B8ZA 4DBZA 2WM3A 4IQ8A 4CR7A 1O6ZA 3BYZA 2ZB7A 5JCJD 3JQAB 4Q3BA 1P0FA 4QEDA 3BHJA 1S6YA 4ND4A 1TLTA 2ZCVA 3RJ5A 1AE1A 3GRPA 1HZZA 3O9ZA 4JP3A 4WE3A 3SVTA 5BSGA 5JY1A 3AFNA 1YBVA 1UXKA 1ENYA 4YT5A 4R54A 3LK7A 3AOGA 3IP1A 1E5LA 2F1KA 4N5LA 2HO5A 5ITVA 2X0NA 3CPSA 4XRRA 5TIIA 3QY9A 3TFOA 4M54A 3ZV5A 3RFTA 2BRUA 2ZIZA 2QZZA 4Q3CA 4BNMA 1PX0A 4TVBA 5IN4A 4WGGA 5ITWA 1HEUA 2O4UX 5U1PA 3H8VA 1ZK4A 2ZJ1A 3VKVA 3E1KA 2WYUA 1CIVA 1XIVA 1M67A 3K92A 4BVAA 3P2OA 3B1JA 1NVGA 1JWBB 5B1YA 3PTZA 2FR0A 2G5CA 4BNGA 1Y8QB 2WSBA 3P5SA 1SNYA 2NQ8A 4BO3A 2ZCUA 3PZRA 4XR9A 4XYMA 2X8LA 3RROA 1NAHA 1GU7A 3G1TA 3OHSX 3PWKA 5DP1A 1X0XA 1YL5A 3KTDA 4L0QA 3PJGA 3MJEA 1IULA 4KTTE 1Z82A 1FDSA 1ZFNA 1QV7A 2VWHA 4PZDA 5CHEA 3HQ4O 1GEGA 3JTMA 4FSHA 3V2GA 5A06A 4XX0A 1P1KA 3I6IA 1WWKA 2C2YA 5CPBA 4AJ1A 3I9OA 3RC7A 5TX7A 1IPEA 4WCFA 2RCYA 3KSDO 3WLEA 4CLHA 3PQFA 4DQXA 4ALLA 3GLQA 2XPCA 1E77A 4JBHA 3AY6A 3UVEA 4ALMA 5HRUA 4RGBA 2PH3A 2PV7A 4ZGWA 3O26A 5C7LO 3QSGA 1MV8A 4TSKA 4NI5A 3W4KA 3D4OA 3UCXA 3PJEA 4LW8A 1E3JA 2EXXA 4H15A 2RHRA 3QRWA 1X14A 3ADOA 1NHGA 1X15A 4WLNA 4ZQEA 3DONA 2B5VA 2Y1FA 4CM9A 1YVEI 1ONOA 3ENKA 4EEZA 3BHMA 3VTFA 2POQX 2IYOA 1B0AA 5ES3A 3U09A 3OF2A 4L73A 4IQGA 3NJ8A 2Q1TA 3F46A 3WDSA 1G1AA 2BFOA 1EUCA 4ZU3A 4J7CA 1DFIA 1K89A 4PVDA 3RUFA 4KZPA 1FDUA 1T2FA 3VDRA 4CLRA 4E2YA 2PGDA 4DC0A 1U28A 1VJTA 3A1NA 4BNUA 1UH5A 3OETA 4JLWA 1DIBA 3NDJA 4CM1A 3E9QA 1E7SA 2YZ7A 1U8XX 5ILOA 3OJFA 4J1SA 4Q3DA 2NQTA 3JD2A 3JQAD 4JNKA 1KIFA 4KTVE 2OP0A 1I8TA 4UEKA 1VPDA 2BLLA 4J4BA 4BV8A 1PJ4A 4PIVA 1WW8A 2JCVA 1Y6JA 2E82A 2J3JA 3DBVO 3ZWBA 4CV3A 1GDHA 3C7DB 2VQ3A 4TROA 4ZQFA 1LC3A 1C0LA 1Z75A 2AG8A 3ROKA 4WASA 4BGIA 3C7CB 1E3SA 4MP6A 2Y0DA 1YWGO 2RH4A 2WD7A 4CR6A 2FR1A 2D0IA 4GGOA 4J9VA 5ENVA 3O8QB 2EHDA 5I7FA 3DL2A 4FCCA 5MDHA 4D45A 1U7HA 3UFXA 2TMDA 3IMFA 1NBOA 4WKGA 5ILGA 5CAEA 2CSUA 1ZNQO 1GTMA 1AXGA 1ZXBA 3AUUA 4LVCA 3KSUA 1GYRA 3PFFA 2W4QA 3KO8A 4UEOA 1U2DA 1NFFA 5EERA 2A94A 3L4BA 1Y81A 2FZEA 2VZ9A 4J1TA 4NBUA 3MJSA 1XYGA 8ADHA 3CUKA 3DEYX 2J5KA 3ZV6A 2HQ1A 3UN1A 4DMLA 3JQGA 5U4QA 3WB9A 4DMMA 3ROMA 1P1FA 1ZBQA 1F8GA 2HMWA 2BH9A 3C3XA 2AG5A 2PGJA 3IS3A 5T57A 5L3ZA 1IE3A 1WZEA 2EG9A 1HRDA 5L4NA 1H94A 3PXXA 4UVHA 2GPTA 1Z73A 2YHIA 2E49A 3VZRA 1LUAA 1KEWA 2BF7A 3G3EA 4YTEA 5BSEA 3H9QA 5TLSA 4GVLA 2DBQA 1O89A 2C7VA 4E6PA 3Q9UA 4XYGA 3VPXA 2I5PO 2J3IA 4KMSA 4MINA 4UULA 2I65A 2BHLA 4F6CA 4RF5A 3DBHA 4NFSA 2B0JA 1ARZA 3BMNA 4IUYA 4CQMB 4CPDA 3NX4A 4KUHA 2Y1GA 3ZWOA 3Q6IA 2CF6A 1ISJA 2VUTA 4K6FA 4IDFA 1Q7BA 9LDBA 2X6TA 1PZGA 4Z9XA 1E7MA 1R0SA 4DBVO 4YRAA 4EUEA 2Q4EA 4HP8A 3GDFA 2Q1SA 4RPLA 1QRRA 4WCFB 4MIEA 2YYYA 1PJTA 4CM4A 2WWRA 1Y9EA 3F5SA 3F5QA 1WMAA 4CLDA 2GN9A 4FB5A 1C0PA 4FGWA 3A4VA 1FDVA 3UCEA 4DTIA 4BQPA 4A26A 1BSVA 4L75A 1MFZA 2O50A 1SO8A 5T5QA 4W9NC 1DO8A 3OQBA 1MA0A 5KCZA 1NPTO 1PU2A 3HN7A 3QV1A 3HZZA 4IS2A 4II2A 3VC7A 4A7PA 2ZQYA 4ND2A 2X4GA 3D3EA 1R12A 3ETEA 4RVHA 3DMYA 4IGFA 4RZHA 3D5QA 4JBIA 3GH3A 3LF2A 3T7EA 3DO5A 1RM3A 3NRCA 4WUVA 4LSMA 4QO8A 3FNFA 1OZAA 4RVDA 3RVDA 4FC7A 3S2FA 4Y6PA 2C54A 2NNLD 3V1UA 4GX2A 3KETA 1EK6A 4FBGA 4QTZA 4HNHA 5FFFA 5TC4A 3NUGA 5B12A 4XYBA 5KJFA 1TA4A 1SZJG 1T4DA 3C7AA 1F17A 4IS3A 4K1LA 4CMGA 4BNWA 3HB4X 2HMUA 4X54A 3MJ4A 2GASA 1JLLA 3V1YA 4Q3NA 1Q7GA 1R0KA 4YJHB 2AE2A 3A28A 5ER9A 3K5PA 4WLEA 1P1IA 1Y7TA 1YBAA 1BGVA 4IINA 3ONEA 5JDCA 3JCZA 1RKXA 3PJDA 3VHRA 2O23A 2PKQP 5FI5A 3VOSA 1B7GO 4FDAA 5EN4A 4A0SA 1DAOA 1GCOA 1NTOA 4OJNA 3TZCA 2NVBA 5DULA 1DBVO 4PLPA 4CLEA 4GL4A 4Z3KA 3ASVA 3QWBA 4K26A 5A5EA 5CEFA 1LI4A 3H5AA 4OAQA 5CDYA 4CM6A 5COQA 3C24A 3E03A 1EEHA 1LRJA 2I66A 3UUWA 3PEFA 3U0BA 3GZNB 4FFPA 3QVTA 1EBFA 1X7GA 4ALJA 4YT2A 3M2TA 1CQJA 1JQBA 2NU9A 3PGJA 2IYPA 4L76A 1OBFO 1EE9A 2VCYA 3H6KA 3SEFA 5BNIA 3VAZA 4XGIA 4RVFA 4BNVA 4M87A 2A9FA 1ISIA 1VKOA 3T4XA 3VTZA 1LQUA 4PLCA 4FFRA 3IKTA 2B69A 4OOEA 1CEQA 1KS9A 4II3A 3VZQA 1O0SA 4OSPA 4HADA 4UUMA 1YGYA 1BG6A 2NV6A 3KEOA 3ZU3A 3EVTA 4J2OA 3ZWNA 4EUFA 4KDEA 5JAIA 1MC5A 1EUZA 3ORFA 1DIAA 4L74A 1B8UA 3VPGA 2RBEA 1P31A 2I67A 1KC3A 1H6CA 3ZNNA 2W2KA 3LYLA 2NM0A 5EPOA 4B3JA 2LDBA 3QVOA 1QLHA 4ZRNA 1K2WA 3QWAA 3R6DA 2G0TA 4PG4A 5GY7A 4BNKA 2X86A 3WSWA 4R41A 5HS4A 2OHXA 1JVBA 3ASUA 1Y5RA 2JCYA 4BO2A 1MLDA 4IDDA 1DDOA 1HDGO 4E4YA 5A5FA 3I9NA 9LDTA 3KLMX 1I3LA 3ANNA 2ZTLA 1B14A 4Q3EA 3GQVA 4D41A 3GC6A 4FJ2A 2HK7A 2TMGA
chains in the Genus database with same CATH superfamily
3O8QA 2I7VA 3FB4A 1EJBA 2FEMA 3O7WA 3QBEA 1O97C 1AS0A 2AMVA 3FPAA 4FFLA 4HEQA 4LCBA 2Y1OA 3RVSA 3LBHA 4MCJA 1Z4MA 2NN3C 3TNJA 3LMKA 4YRBA 4N7MA 2FMXA 4OYHA 3HYCA 4K9NA 2J59A 3RARA 4AZSA 1G59A 4S12A 1PS0A 1X1DA 4DCPA 3ONFA 3OT4A 5JCXA 5P21A 1KK2A 2IHUA 1M1YA 2ZJ0A 4Q4JB 1KDVA 5I4CA 4XJTA 1DWOA 2QMUA 1JN0A 1GPMA 2FU5C 1RQLA 1E4VA 2F3TA 1OSNA 5L4LA 3CYFA 1C3EA 3IPAA 2ZYUX 4TTPA 1ATZA 4F8JA 1G18A 2BEKA 4CQLA 4PAQA 2QQ0A 3V00A 4G0XA 4HNTA 4OM7A 3RKRA 1C7RA 5JISA 3H2BA 1GT6A 3IQEA 1KO1A 3PUVA 2ZUUA 4BO0A 2VHQA 3U26A 4CKBA 1DFHA 1XALA 4HGRA 1YFJA 1EX1A 1AF7A 1WNTA 2TMKA 3UAGA 2DKNA 3DE7X 4ABYA 3FUWA 1RFGE 1BYIA 1ZL2A 1D4ZA 4JXZA 2C2GA 2GCOA 4F2DA 1IVNA 3WYEA 1P7YA 3C85A 3U6KA 3DBLA 1Z5OA 1QPBA 4FI3F 4HZIA 5CRIA 3UMJA 3K9BA 2G63A 3VHLB 4URVR 3UJPA 3R9XB 3STTA 3B6ZA 1KJ8A 1LNQA 3P96A 4F5EA 3TEFA 3NANA 1EUCB 1IWPB 4PO9A 3EISA 1A82A 2EVWX 4G5XA 1D6SA 3TNDA 3X2EA 3ZHOA 3TG2A 3V1NA 3HC7A 3O1JC 4KO3S 4EB3A 1FP2A 4ITRC 3MTQA 1PT7A 5CCBA 1O1YA 3SBOA 5A5GA 4LYDA 4PO8A 1NF9A 2WUWE 3GJXC 4D57A 4J2HA 4EFMA 4LJSA 4P0PB 2A9PA 1CZLA 5T7BA 5CFNA 4QRDA 4E11A 4HTFB 3C5CA 1YI1A 1IQPA 4FINA 3ESDA 2CNDA 1JIJA 4Q21A 1NV9A 3AUTA 4B2YA 4RO0A 3EE6A 1NN0A 5FIUA 1XA4A 3N5KA 1VJDA 2CXSA 2Q2NA 3EFHA 2PU7A 4FSDA 1PF7E 1RDFA 4G6ZA 2FEKA 3N87A 3CRQA 1ZD4A 1IOZA 1OFUX 2N42A 3LHIA 4R0VA 4Q4HA 1P0IA 1R5BA 4RTOA 3E3MA 2ICAA 3O8RA 4KBYA 2GGSA 5D00A 4D25A 3JWJA 1RC1A 2PT6A 5LB2A 3EEBA 3B2QA 3UT5B 3GDOA 2C3PA 2GQ0A 3AEUA 1GTJ1 1LTQA 2JRCA 1FX0A 4PZPA 3X1YA 4NR0A 4Q18A 5JCOA 1CY8A 3LKVA 3S1AB 2JK1A 4CDRA 1PEDA 3INTA 3NWJA 4PQRA 3LXMA 3WS7A 4HD8A 3ZR4B 2C5LA 3PGKA 4O2LA 3IPRA 5AKEA 1DEAA 2E4YA 3JD3A 4CIWA 3AINA 1C1HA 3K73O 4U6SA 4UUQA 1RWQA 5KNDH 5KHOC 1QC5A 2NO1A 4O4JB 1T2EA 4WRRA 2VBIA 1ULSA 4EG0A 2VYVA 3OOSA 1T9GR 1USUA 3QPWA 1UJCA 4N3AA 4AG6A 5KEIA 2HADA 1GSAA 3WKBA 4CL2A 1VFPA 5J58A 4QU0A 3WQHA 1R0WA 1HYQA 4M0CA 5CX4A 1D4OA 4BP9A 5B57C 1SGWA 4F8YA 2X2FA 3WKAA 3SYKA 3ZGYA 1RYZA 1PNTA 4OGFA 1QHNA 1OGYA 4IDEA 1X7YB 5H59A 4MRMA 2DX7A 4NIMA 3JXEA 2QBYA 1UBLS 1KGSA 2BFMA 4Y67A 1NV8A 4LMRA 4E1AA 2XYHA 1K86A 1WZIA 1Z08A 2VYNA 2W90A 4LDQA 1HURA 4MVJI 5DYNA 3T9DA 1SA0A 4EI2A 1SFRA 5A7GA 2WJGA 1IXKA 3HACA 4QGFA 3KQYA 4B85A 5IVHA 2O8FA 5GIOE 1O7JA 4QPZA 3ETJA 2EV9A 2JJQA 1OHHD 1ISFA 1II8B 3IJ5A 3ZDFA 4KRFA 2A4KA 1P18A 2ZWOA 1SVKA 2B9EA 4AYXA 5FWYA 5LPNA 3UJNA 3HGMA 1R4MB 1XN4A 2Y1LA 3R3UA 1XEWX 2Z1NA 5TMEA 5TR9A 3SYLA 5K0TA 3A3KA 1ZM2A 1SBHA 4UAGA 1T5LA 1XCOA 3G9ZA 3PKZA 3WKCA 3ZBPA 2BRUC 2A30A 2AW3A 1PJSA 2CD7A 1ML3A 3NCTA 4LJAA 4PRZA 1CQJB 1NUSA 2NU9B 4Q7EA 5IWCA 1I24A 2UUPA 2WM8A 3FH0A 1GPDG 1Q0TA 1MBZA 3X1KA 1N32B 1A5SB 4QOFA 1J2RA 5JSKA 3OVMA 3PDUA 4IIVA 1CZKA 5IT5A 2A1UB 1YK1A 5KTPA 2PU5A 4XW2A 3FM9A 4NNJA 3PENA 4YV0A 5FLYA 1EAMA 1I4EB 1FQWA 3WRYC 4ZDKA 2Y9MB 1ZHHA 3OO0A 1A1VA 1EMDA 4R8MA 1G20B 1F8FA 7GPBA 4XPZA 3UZUA 2RE8A 2CFSA 1OAAA 3AUSA 2Y68A 4FNGA 1T29A 3MMPA 1GVHA 5D3QA 3U3ZA 4RTLA 4CQLB 3LQ2A 4J8PA 1FRFS 4M60A 1KPGA 1R00A 2QI9C 2QTAA 3ND6A 4CM8B 1NVVQ 2AN4A 3N2NA 3B6JA 3R8XA 1QWOA 4LXXA 3UBMA 1GZ3A 4EPTA 2CJXA 4HX5A 4RUKA 1QM5A 2PFSA 1RWXA 1XWIA 2LR0A 1IHYA 1KZ6A 1NW4A 3OZTA 1M8JA 3FKSA 3M6MD 2E6UX 4PZCA 5EMLA 3D43A 2RD2A 4NV0A 1GG9A 1FMLA 1P5HA 2C00A 3CVWA 4OXNA 4OFBA 5JJCA 4C06A 3WLLA 2FUNB 4U8HA 2HYIC 1J5PA 3PPXA 3QKRA 1QZUA 3QZUA 4BUZA 4CL0A 4PF1A 5LQAA 1F06A 1UP6A 4NARA 3GFPA 3SYRA 1Y8ZA 3AF3A 1E2FA 1NKVA 2QZPA 4L78A 1V9SA 1OILA 3VVBA 1S89A 3ZYZA 1ISGA 3PC3A 1U3FA 2OBLA 4I55B 4M9QA 4R2HA 3C45A 3RWMB 3RYFA 1V96A 4CV0A 1EU1A 2JFHA 1BJKA 3PGXA 2WTEA 2FUKA 2BI7A 3GNSA 5JAMA 1E89A 2FZCA 2DU8A 4FDVA 5KAPA 2XAAA 4Q1CA 5K2MA 1A97A 2QTRA 1P80A 1EUYA 2VHTA 1KMHB 2H1OA 3IO5A 3SICE 3VBEA 4FS8A 1QQBA 3ORRA 4KUGA 1KETA 3TLCA 2OC9A 4FHEA 3IX7A 3VVMA 5FPKA 1QQ5A 5EQDA 5HBGA 2NZJA 2P6NA 3MCUA 4ZT2A 5CLQA 4L4UA 4PPYA 1QSGA 2HLNA 3B36A 2YXLA 4DIOA 5LLTA 3KJXA 2OYRA 4IAOA 1IUKA 1NXSA 1G63A 2HPAA 3CLVA 2R62A 1L3CA 3MJHA 3QWIA 4JVSB 4W1PA 3T35A 2CZQA 3VR4H 1PN3A 2C5SA 2JFYA 2JEZA 4H7EA 1P33A 3REFA 3TDNA 5B64A 4ZCTA 5BRNA 3I2KA 4L50A 5CDFA 2ZT7A 4RAOA 1GQQA 1D0VA 1X39A 3C43A 1TT5A 3GCDA 2GN8A 5AW8A 3SX4A 4IY1A 4CMBA 5DOVA 1N8NA 1YCDA 3ZHZA 4B3FX 2JD0A 5FUVA 1GV1A 1Q5PA 3HI6A 2ZUWA 3NT2A 5EKXA 3WIOA 3D7NA 3ZGNA 1M0TA 1FYVA 5A5DA 2ST1A 1M2HA 4AO7A 3R7BA 3IVMA 2WMDA 1PJZA 4WACA 1E9BA 3GOHA 3DVRX 3TTWA 2JANA 3SSMA 4HB4A 1GNLA 4HWOA 1IHDA 4R1LA 2FFAA 5JNLA 2GHIA 5EESA 3GUVA 1PS9A 3MWGA 1QUEA 3WKDA 1GSHA 4AJ4A 1XN1A 1ZGZA 4CEJB 1X1SA 3N0WA 4DV3B 1T3GA 4R1NA 3TW6A 3H6HA 3U48A 1VP3A 2XQKA 3VH2A 3IAEA 4WECA 4DV0B 2RAFA 1G5FA 1JLHA 1U0SY 3NGXA 4N7JA 4RIEA 4AMVA 1JQLB 2WSLA 3LBIA 1X80A 4Q9NA 2WFLB 4E5SA 4EVQA 1FXWA 5DSTA 1X8XA 1KAEA 2D1YA 3KT0A 1DVRA 3GUUA 4QYWA 1W19A 4YVFA 1M2WA 4WN3A 3TB4A 1EGAA 1OKKD 1EX9A 1Q74A 3QVKA 4MB6A 4D8YA 1UF9A 5BSKA 10MHA 1NNI1 2AQKA 3KQVA 4RJ2A 5E0OA 5EIAA 2QMEA 1MJGA 4ML3A 3KQOA 4V2UA 4ZK2A 2GKOA 5FAXA 2VUIB 3DF7A 2AFIB 2HSDA 1QVAA 2H52A 1QCCA 2P4UA 2PD3A 3HKBA 3KYCB 2R8YA 3BZWA 1XLVA 3DE6X 3QXXA 4BKOA 1U2PA 2Q5HA 5AJXA 2P2LA 2WMOB 2PYIA 2VJNA 5IDXA 5AOVA 1T8TA 2QK4A 1L9XA 2GYWA 2BM8A 2GEJA 2VDQB 1Q0QA 3E22B 3G7NA 5EIWA 3FGZA 1O6GA 1KAQA 4B3SB 3OFVA 2W8BA 5CX1A 3GP5A 1ZINA 3MTAA 2Q99A 4PTZA 4A5SA 5IK2D 3OF5A 3HP4A 1M0EA 3X1WA 3CX8A 3IE2A 1ZEJA 3KLNA 4KFRA 1P45A 2ZYHA 1XAGA 1ZIYA 2YYSA 4LJYA 4R2MA 5FPTA 3WAKA 4YAWA 1SU6A 3MJTA 4D9GA 2XMDA 1LWOA 2VHWA 1YZVA 3W2IA 5A02A 3UIEA 1ZAYA 4KFTA 4PWYA 2JIRA 1YA6A 4LC0A 5AVXA 5EQTA 5DI3B 1BQ4A 2IOQA 2H63A 2SHKA 4HY3A 2JAPA 3A9VA 1QPGA 2PUTA 2AYYA 4OSOA 4PZYA 4KQXA 3PGVA 4P8RA 4O2AA 1A8QA 1IEXA 4YRMA 1B4DA 2ADMA 3UQZA 4Z0PA 4DIFA 1N0VC 3CS3A 1CQIA 2HJRA 2V8BA 1TEZA 4ARZA 1YJBA 3IEXA 2HB6A 3A6EA 5IX8A 3AIIA 1ESNA 4YP0A 3PQEA 3FSJX 4K9LA 1NYTA 2LXNA 3MTGA 3PJRA 1SCUA 2O0MA 1J4AA 1U8TA 1AV6A 3FCEA 4KMRA 1MV5A 1JEOA 1KFCB 3A3YA 2W0SA 1JEQB 2H57A 3D2BA 4XI9A 4WFJA 1IXSB 5EJEA 5JS6A 2O59A 5DNCA 1AKTA 1XTJA 2WJZB 3AETA 4EJ2A 4PRLA 1T9GS 1KI6A 3TLGA 4EKGA 1HYHA 2JJ8A 2ZSJA 3IO3A 1NQXA 3DUFB 4QLAA 1CUVA 2RAVA 4GGPA 5A5VA 1LSJA 3EH1A 1NKTA 3GRKA 5AW6A 1WUTA 4IIXA 2VQ6A 1I7QB 4CKXA 4HEHA 1GCUA 2HA3A 2LPMA 5CG1A 3CCCA 3CNHA 2OCDA 2IUYA 2FSIA 1DKMA 1H9BA 5I8WA 2FPGB 1EVKA 3KKEA 1HA3A 3QLEA 1GQ2A 2P2NA 4YO7A 3AERA 3MUFA 1IY2A 1TAHA 3CUVA 2NU8A 1V16B 4L8YA 1N36B 3GH1A 3IAAA 2OXTA 1U0JA 4EJ0A 3ZQ6A 5KNDA 2C7BA 2V7WA 4OHUA 4DFDA 1P74A 1NASA 4E5DA 1SQ5A 5L3VA 3H9UA 2WUVA 2LCQA 2CMGA 4BX9A 1NQWA 1MB2A 4PEVA 3IRUA 4NABA 3PVZA 2PRZA 1DV1A 3JQBC 3P4XA 4Q1VA 2QSZA 1SRRA 5EWMA 3MEQA 4MR8B 4COOA 5LXTA 4MUEA 4DZRA 2EWVA 2UVDA 4MO2A 1K68A 3L0IB 4XJVA 4ZDWA 1OKKA 3GLIA 3MCVA 3PWZA 3GLGB 2ZFUA 1PG5A 2HLPA 2WILA 2VPTA 3WL5A 3T4EA 4YUWA 3DTVB 4IXWA 1KWGA 1IK4A 4N6GA 4HQ0A 4HDCA 3AILA 2VSXA 1XFAA 4FHCA 1KJWA 2G5TA 1V7QA 3HR4A 4F1KA 1S4MA 1E6MA 4PX3A 2OO5C 4KWIA 4E5KA 2YMPA 4V3CA 1OFHA 3DBHB 3THWA 2EF1A 1BE8A 1H1LB 1T9CA 3D81A 5GMOA 3WYCA 1FU7A 1T9BA 1XI2A 1YRBA 4X60A 2BTOA 1REQA 4QWMA 3VV3A 4RBNA 5E9WA 1VCOA 1LBTA 2OBXA 1GAXA 3KUCA 2RBGA 3T4UA 2SKCA 3V1TC 1NN1A 1UBUS 1T5BA 5JD4A 2D7JA 3LKZA 2WPDD 1T9AA 1SVOA 3ENQA 1L5MA 2H18A 5K3EA 4H1VA 4O3FA 4BLTA 1CK4A 4FD3A 4JA2A 2DCMA 3V4ZA 5BY2A 5F5NA 1J2EA 2QWXA 4C78A 2JG3A 4AI6A 5BXYA 5TY0A 4JGGA 4LOHA 4BBAA 5JASA 1LPBB 2ENUA 2BFAA 2NZYA 2WP0A 1OU0A 3FD8A 1C2YA 2XNKA 3INRA 4PZDA 4PFKA 3V2GA 2CXNA 1L4EA 3HY4A 5HK8A 1OY1A 1PFWA 4JLJA 4KXYA 3QA3E 4PLTA 3RABA 1F8XA 1QGUA 1R2QA 1TXGA 2CYCA 2GLXA 2XYRA 3MJRA 3ZIAD 2A4MA 4DC9A 3HBMA 3MMZA 2VH5R 1Z39A 2GXQA 4FUQA 4KK3A 3T95A 3KAKA 3WE7A 1AXRA 1KGDA 1LDEA 4HAXA 5GADl 4WA8A 2BIFA 2X58A 3CG0A 3L6UA 2P4HX 4Y30A 3UY4A 2BMWA 1VKRA 2WJ6A 2QRJA 4E2WA 3B1YA 2BGRA 1OBHA 1VBNA 5HBRA 3I05A 2FSVA 2JLVA 3W1WA 2PR2A 5JD3A 2DPHA 4IXNA 3SC4A 4B4DA 4XCQA 4OHFA 2UUAB 4K1XA 1IG3A 4HSGA 3RUDA 3EYWA 4JQZA 4A15A 3Q10A 2NZWA 3VHXB 4O1HA 5DKFA 2V65A 1YACA 2Z4RA 3BTOA 2PUWA 3NP7A 1Q2UA 3OLWA 4PC1A 3I83A 3QUTA 4IHJB 2OZKA 4DGSA 1F60A 2PRSA 1DTWA 4NCIA 1ZCBA 1UKAA 5H81A 4F1WA 5LJIA 3DLHA 1W9HA 3LLVA 3IJRA 4TLLB 5C46F 3FPFA 3QJYA 1H4VB 3BDAA 4PFJA 4JJKA 2F62A 1AKNA 4I3HA 3SKVA 4D9NA 4DJDC 4Y1EA 2Y05A 1MABA 4MWEA 2W2KB 4P32A 1W29A 4TYPA 4TT3D 3T7IA 3TINA 3ITKA 1FA9A 5KOIA 2DTDA 4WAUA 4DG9A 1Q84A 3GCXA 2BSQA 2MSEB 3BRQA 2CBZA 5TPZD 2CV0A 1G8JA 3U6BA 5G1NA 1RRGA 2BMEA 2HM7A 4BNHA 3WAGA 2WVHA 5DP2A 3JYQA 4LY0A 2QN9A 2NLOA 3PDJA 4RM3A 4QDKA 1FMCA 4TLAA 5HDQA 1JKXA 5DGTA 3AUYA 3DLPX 2F9MA 4MQFB 4GMDA 4P34A 3FPSA 1EX7A 5T67A 1W9MA 1GCGA 3DFKA 2R6CA 3AU8A 3VZDA 3LT2A 3BHNA 1MB0A 5JAUA 2Y1EA 5KNCH 2C77A 2E0IA 2V4ZA 5F21A 5KQRA 3BGDA 1CQZA 1CRZA 1YUBA 5BQXA 1L5FA 1XMVA 2BW0A 3TLGB 1LX6A 4CCSA 2FVXA 4UM5A 4YYEA 2X42A 3EGXB 3JATA 4JCOA 1NM5A 2BE9A 3E9RA 2H4FA 3F6YA 3HYSA 4BVFA 1P0MA 1D7OA 2QTLA 3JQBA 5T6BA 5DSXA 4KOAA 1HYEA 1XPRA 1IZZA 2VP9A 6ADHA 1H93A 2QN3A 3VDMA 1QX4A 2YXBA 3OX2A 4EPXA 5MGBA 3E22A 1DGQA 2JHAA 3CRZA 2VWGA 2ECFA 1SCBA 2E37A 2R751 3FMOB 5KNCA 5JSHA 1P17A 1VHQA 2WG2A 3G79A 4MKRA 2MT9A 3F5FA 5I9LA 4MWSA 1ULHA 2NU6B 3WX0A 4Z1MD 1TADA 5EJIA 2FEXA 2EBHX 3H2ZA 1SKUA 4IKPA 3K1YA 1UT6A 2OTCA 3IIJA 4NS4A 4TT8A 5D6OA 4P58A 3D0QA 4M8KA 4IIFA 1TVMA 3UUGA 1XTQA 4YFYA 1S4QA 5C8YF 2O0KA 4JUFA 3BE4A 2WIAA 5LR6A 3KLOA 3MVEA 2CCJA 1H2EA 4FOTA 1CJKC 1DU4A 1A4XA 4HDRB 3QSYA 4WOCA 4PG8A 3JQ8A 4YACA 3BCRA 1E2IA 3SU8A 4BEBA 1OF1A 5JBQA 4W8GA 3WRYA 1CRPA 3QY0A 4ITUA 4UM9D 2PIAA 1Z7WA 4NZPA 4ZAZA 3O90A 5E9JA 5UKDA 4F38A 1RHKA 2L17A 1SCUB 3BZBA 1KI3A 3I12A 3LYUA 4FPXA 4R9RA 5U9CA 1YQUA 1OT5A 1ZO8A 1UZUA 4LWZA 4N3GA 1RJGA 3SXUA 1QB7A 4EI7A 1QRSA 3ZDYB 1AUOA 2C04A 1SN7A 2CXUA 5K51A 4ZJPA 4TN1A 4R9SA 1KXZA 3N6XA 4GP9A 2XT0A 4IMRA 3AM3A 1PFGA 4G5RA 4HAWA 4B7ZA 1M1XB 1UPXA 2CE2X 2JFPA 3IT3A 4RD4A 1QU2A 2GVZC 5BSRA 4CM8A 3IURA 3UXYA 1G7TA 1UZAA 3TQOA 2LDXA 1GADO 2YOGA 1X7HA 2X0JA 5BNZA 4LFAB 3R0ZA 3A6JA 3IIIA 2K2WA 3UWMA 3KK0A 5D85A 4LYJA 2BFFB 2IEZA 4OU5A 3ZHXA 1YGPA 3E9MA 1NR1A 1EHYA 3DUWA 4URXR 2HF7A 3ZV3A 4L02A 4DR1B 3CLTD 3HVRA 3EF0A 3PIDA 1W94A 2UYHA 1X7ZB 4REQA 3KCNA 3IVGA 4G8DA 2ZB2A 4OIMA 2XMPA 4RWEA 3HVHA 5I9TA 1YL7A 3D2LA 3N2KA 2UXBB 2IEGA 2O8EA 1T6ZA 2XWJI 3ZTTA 1CJCA 1IG0A 2P9EA 2YL2A 4ZQGA 1A7JA 2Z2JA 3OIDA 4FNAA 3ROQA 1J97A 3KWFA 3OJLA 3HJFA 5JROA 1QYRA 3FDFA 1MB4A 1V8OA 3M4ZA 4GQIA 4N54A 4QJ4A 4ZO7A 3VNQA 1SKMA 2NPFA 2G7MC 2OFXA 4WJZA 1FS5A 2BBWA 2ZJ5A 1E5TA 4ER6A 1DMRA 4PW0A 2A92A 2AOVA 1UDXA 2OQVA 4MP3A 1Z83A 4DLUA 2XDWA 3DB1A 4XD7D 1AHNA 4YRGA 3CKYA 2ERXA 3FTPA 4FYYA 1LRLA 2NSJA 2B4QA 2A9OA 3T3HA 2Q1YA 5K0BA 4HAYA 5EZSA 5E9QA 1V9LA 4ENWA 2AMFA 1KQ3A 1F4PA 4P36A 1CJTC 1E9EA 1DIHA 4O4LB 5CCEA 4K87A 3WGZA 4KODA 2AKYA 3OMLA 4RNCA 4G8JA 1GZUA 4G9GA 4BS9A 1EFUA 2GFQA 3WHIA 3L7IA 1FZTA 2CWWA 5KVVA 1JTFA 2XQFA 4J75A 1UWLA 1JB9A 3I5YA 1EHCA 4DPLA 5A4DA 1Z17A 1BH6A 1NDQA 1JGTA 1SPBS 1I4LD 3N8GA 3WFIA 3IHWA 2ON6A 1HT3A 2F43A 3EQ2A 4NNOA 2R44A 2XNHA 5EXEA 3RGWS 1DIRA 4G3XA 1DCTA 3FXAA 4Z1MA 1OZHA 2Y3IA 2F17A 4FYWA 5DOZA 4DVJA 5DM4A 4J0EA 1CY0A 3HCAA 4RIGA 2C99A 3OE5A 4D3FA 2HO4A 5TS3A 3V8NA 1VLHA 5KSPA 1SUDA 1E6EA 1QG2A 2VO1A 3JPWA 5CT8A 5A0VA 2G1AA 4C05A 4M1SA 3U4CA 1JKIA 2B37A 3RK4A 4QHYA 3T5DA 5JAPA 2P27A 2C3OA 4UEQA 4TL6A 3H9GA 4GXQA 3TTVA 3AHHA 3JATB 3HCCA 5FUWA 3ZV4A 2JK0A 5E2BA 4WY5A 1ZEMA 3QKSB 4PPNA 1RJ9A 5I7RA 1VRVA 2P1ZA 1JZQA 2EFHB 1MG5A 3OO1A 5ELLA 2A9VA 3L7AA 4RPIA 3AMVA 1A2QA 4ROSA 2YKGA 4HDSA 2GCNA 5AXAA 1QE0A 2VAMA 3JAWA 2B20A 1AC5A 5D3ZA 2YWBA 3K8ZA 3NONA 4OL9A 5EWJB 4TMYA 2O2EA 5HG0A 3I2FA 4RADA 3V42A 3TUZC 1Z0FA 4F4UA 1ZN7A 3NJ4A 3CONA 5IVIA 1MMFB 3VNAA 5LZ7A 1ICEA 3GW8A 1L0BA 3ND8A 4GFDA 5HRAA 3GJ0A 1JG2A 3GARA 3QQ5A 2A9JA 3FWNA 3ZDRA 3O7MA 5B1EA 4MJ3A 5CFMA 2GEFA 4RKYA 2PA3A 4WV3A 2VQSA 5CT6A 1FMFA 4IYJA 5C18A 4FP9A 3K9NA 4XWOA 1W5AA 4RFLA 3QU9A 2AF3C 2UYYA 4RGVA 4TTSA 4X6YA 4I9GA 2CGEA 2H2HA 1ZI8A 3TAHA 5KX5A 2ZWAA 4CTJA 3X2FA 1WMFA 1OI7A 1YAHA 4M1WA 4D9KA 5H5JA 1OREA 2DQYA 3G0IA 2D5LA 4KLAA 4R7GA 4XVQA 2Z8YM 3CUYA 1TUEA 4C88A 1J06A 1UDRA 3HADA 3DBLB 1E1NA 4Y7CA 3W77A 3M6XA 4QJBA 2PWYA 2JLZA 2PT5A 4N48A 1OI2A 5FOSA 1IC6A 1XEXB 1I32A 2IXEA 1X1EA 4QXMA 5KSOA 1XDGA 3DFZA 4P86A 3WL7A 2HUNA 4UOEA 3STWA 5EQFA 4MPPA 3SS9X 2XA2A 3BRCA 5KYKA 2YWCA 3QTTA 1HNNA 3M4XA 2WAOA 3EWAA 2DZDA 3AEYA 5EIBC 4DXHA 4NC9A 4TV8A 4F9EA 3IQZA 5MF6A 2IOFA 2HRBA 2P3LA 5BMVB 1N2ZA 3WMWA 4EMSA 5IJZA 3D3JA 1L5ZA 2EZ4A 3BXEA 3NS7A 1QHGA 2UYGA 2IITA 2H9IA 3BDIA 4LXQA 4MI9A 2QU7A 5H1YA 4EB0A 4JU8A 1W48A 4IJQA 1DI0A 2POCA 4GXNA 3IPXA 4L0DA 5EP2A 4AMGA 4J2TA 2OEPA 4YAIA 2FRXA 4J4HA 3R24A 5IMSA 2PSSA 3GF4A 3C5VA 4M0EA 4RMIA 2C9YA 1YH3A 4Q00A 2Z98A 3NMUF 3HABA 2I78A 5L6MB 4Q4JA 1L5OA 4QD3A 1W85B 4MULA 3KHTA 3IR5A 2ZRJA 2J85A 4P3PA 5DXAA 5HEKA 4C89A 4Z3DA 2G09A 1CZUA 1A4UA 1YC2A 1Y7IA 1GIAA 4K3VA 3VVLA 4N3CA 1EM8B 5B2FA 4MR9B 4MKHA 1XXHE 3RVJA 1SKYB 1U7TA 4ZARA 1C1DA 2Q4DA 2ODBA 2W7TA 2X5JO 4YJ2B 3LP8A 3E2MA 2NZVG 3AJRA 3N2GB 3QOWA 5E2AA 5F73A 4XB2A 2XSZD 1ZWLA 2CLDX 1CR2A 4HRYA 3ORHA 4G26A 4PG7A 1TUIA 1G0NA 2GCGA 1R0BA 2X9NA 2WW8A 2OPHA 3A1TA 5JHGB 2WWYA 3CZPA 3U31A 1GNTA 4QKQA 4MQUA 2ZJAA 1YR7A 3MNFA 4LZNA 4YJGB 1T6NA 2NUPA 2IBMA 3RF7A 2BH2A 1D0IA 5LA6B 1U4SA 2RH9B 5JSZA 4Y8VA 5L45A 1RLUA 1YFLA 3R44A 4YY3B 3QPUA 1ZRMA 2O7NA 5I3ZA 1AJEA 3CN9A 1DX9A 2PDAA 1Q11A 2V7QD 2ZSEA 4GX5A 4LISA 3MM4A 1Y8QA 2HL6A 4O4JA 4CM7A 2XKJE 4ZYZA 4B45A 3LM8A 3SZMA 3QI7A 2D7CA 5ALHA 4F96A 4C4SA 1H2HA 5G0UA 2PUGA 3WQBA 1E64A 4GMXA 2YX1A 3H1PA 4O8ZA 3ZH9B 4EW6A 2I8LA 3BIOA 1H1LA 2HCRA 2DTEA 5EYPA 3T0GA 3RAFC 1IJFA 1H0KA 3A1CA 3K7EA 1JG4A 5E2IA 5GAJA 1ZNYA 2O1EA 3Q7EA 2XT6A 2NUAB 1N2SA 2Z8ZA 4OYRA 1GRQA 4B3GA 3PUHA 2JAXA 3WSVA 3KYBA 1EDZA 4GBJA 4QGBA 1GGNA 3ANTA 5IH3A 4C03A 2VXBA 5ANRB 1RWPA 1X0VA 5A3QA 3BL8A 1QOPB 1CDOA 1EFHA 1OXKB 2RAPA 2HJ9A 1U99A 3BD8A 3N58A 3QLVA 4A92A 2Y93A 1SCIA 3OSUA 3M1YA 3D7SA 1O5OA 2XV1A 2OILA 4DEXA 4LSGA 5LUBA 2NGRA 3AHFA 3IELA 4OI2A 1DKQA 1QOZA 2WVJA 4PC2A 3H2HA 3GJ3A 3PJFA 3TBFA 2WF8A 5ER6A 5B3LA 3E6AA 3WLIA 2ZCJA 1TVKA 4HLCA 4Q4HB 2FHPA 4J0QA 3WGJA 4EYEA 2EKLA 4HH3C 3VNVA 3NAMA 3AX6A 4URYR 2XGJA 1QF9A 1QRAA 2CHUA 2HEGA 2QQEA 3OE7D 3PCRB 2XVMA 2C0CA 4FGJA 4J4TA 3TPZA 4Z3OA 5ELXA 2MSKA 5C1IA 5GWXA 1Z0SA 2RGYA 3NIWA 3QVXA 1B93A 3RYCB 2QX4A 3D9QX 4NPHA 2IEIA 3DE3X 1KHHA 2REBA 1CDDA 2EP5A 1OWLA 3JRWA 5G2OA 1VB3A 3THRA 2XYGA 2WHPA 3AUKA 3F7TA 3JWHA 5TQJA 1P1BA 3CJTA 3ORYA 4EO7A 2NXCA 5EZYF 3QIAA 3FNQA 1W0KD 1O95C 1ODCA 2YBDA 1GITA 4C4AA 2CLCX 2AB0A 2BHRA 4FGKA 2XUOA 1DCMA 2XRMA 3D1VA 3M6IA 3PNYA 4KR0A 5IUKC 4C7BA 3GMTA 3TUIC 2O54A 4RS4A 4IRUB 1D1QA 4JLPA 4JL6A 1FNNA 3WFZA 1NJFA 4B6GA 5E6SA 3EXHA 3CPEA 4YRFA 2NUTB 2X8JA 4BYGA 5A71A 2OHFA 2ZROA 2C5BA 3IA7A 4U6NA 3E9NA 1J1UA 4C0AC 4XQ0A 2IH5A 1NXOA 4F7WA 4O3MA 2YWEA 3ORQA 3IJEB 1NPDA 1LC0A 1JHDA 3QKRB 4HK4A 4JCCA 3RUHA 4BE7B 5BVGA 3U7GA 4RF3A 3RC8A 1BDMA 2I4MA 3GJ5A 2R84A 4IQ4A 3ZGVA 5LQKA 1H8HA 4LRTB 2I91A 1VB5A 4MV3A 4TMWA 1RZRA 1MG0A 5KYYB 5L6LB 2RB4A 2IZOA 2JCBA 4GD3Q 5ECGC 3DPIA 5L3QA 2AQIA 2JI6A 5LMUB 2VDWA 5A3JA 3TIIA 3STUA 4WNAB 1A8HA 3AVOA 2XXBA 2CHFA 5G3YA 2QX6A 4HRXA 1U7PA 1JHOA 3ZBUA 2Q5QA 4ENUA 1I3OA 3MPOA 4FVTA 1V1JA 3TE7A 1DAEA 5TJ9A 1Y3BE 3EDMA 2XJ9A 3Q5GA 2HCJB 5BNWA 2R00A 3Q8KA 3HFGA 4HV4A 4ZRDA 1DB3A 3NOQA 2IYAA 2QRVB 3AHJA 4GNKA 4E4RA 2MWMA 1VG1A 1P9RA 2Y2VA 3MA0A 4L5BA 4ND1A 3C0KA 4F0JA 5FULA 5HZKA 3T0IA 4X7MA 4WJKB 3AVPA 4JKIA 5IEBA 3EPKA 5BN5B 2V97A 4INZA 3S99A 5IJ0B 2P3QA 3CNEA 3MMXA 3BMOB 3MXTA 3TVDA 4J6FA 1WV1A 1YDMA 2VUUA 4PSAA 1KEEA 2OECA 3FTDA 1J24A 1CUFA 1UIRA 1RJEA 2QVYX 4M76B 4ZEVA 3RYIB 2AN9A 3LL7A 1EIZA 4C7XA 3ZXSA 4I8XA 4QJ3A 5B30A 1A8PA 1H4QA 1KVSA 2JGFA 2R8ZA 3M33A 2DECA 5AVQA 1PQPA 2OQ2A 2W6QA 2XY4A 4G1FA 1NURA 2Z43A 1GOTA 1EK5A 4N3NA 3RUAA 3GFRA 4IJUA 4KPYA 4J43A 5JJIA 4NG4A 1W4LA 4EG6A 2OFPA 3RSFA 1VL0A 2QP3A 4JJFA 1Q0SA 3W6NA 2DQKA 3HJUA 3HZHA 5FYDA 1S01A 2W22A 2PZBA 1K66A 2ZEJA 3JR7A 1M33A 5A3RA 2ZBGA 2EP7A 1D7AA 2C5FA 1Z5VA 2GDJA 2LD4A 2QAGB 3BD6A 3G7UA 3IXQA 3KD2A 3IA2A 3Q5DA 4L8WB 3R3JA 1JXOA 4JT9A 1R50A 3TBHA 4AUKA 2IEBA 4KX3A 1QKJA 3EZNA 4X20B 1EPUA 3IOEA 2IU0A 3IEVA 1F5SA 3R7NA 1XNJA 2JLQA 2B8NA 3MILA 2F1HA 3F47A 5KJCA 5AI9A 5FO1A 1W1WA 1MJHA 2QS9A 2YY5A 3DO6A 1YQTA 4AYWA 4KPGA 5JADA 2AF4C 4BFVA 2C1ZA 3MRTA 3HKDB 3HFJA 1DFGA 4Y2HA 5K4GA 3GA7A 3TGWA 1XF9A 1H5QA 2FGKA 2AFHB 3NG1A 3EXG1 3BDVA 7MHTA 3IKJA 5CB0A 3TKYA 5JO0A 1FS6A 1MOZA 3W5UA 4OB8A 5E7IA 1JHMA 3ZJUA 4M8LA 4BRSA 2QRNA 4BAZA 2O8DB 3WGKA 3LT1A 3RWOA 3HKBB 3KYCA 3ZY6A 1ZVMA 3I64A 2GVDC 2R2GA 3OIUA 4ZDIA 2FRDA 4QX6A 4BLWA 3BWEA 4CM4B 1G7SA 1UK9A 2QM3A 3EPRA 2OCAA 4BBJA 1PK9A 5ICCA 1ZK2A 5HTKA 2B1JA 1S8FA 2FZKA 4Q9IA 3ADKA 1L4NA 1L7MA 1WY7A 3EZGA 2OVFA 1ELOA 5HE9A 4BNZA 3K30A 4W82A 4DJTA 2GYYA 1GM5A 5AM2A 1UEXC 3FNEA 2OK8A 1RS0A 4JD5A 4P3YA 1JBKA 1H1TA 3FYDA 5BXQC 2R4QA 2XBLA 4UU8A 1C4XA 1JPJA 3MWLA 4ENTA 1U1GA 3IP9A 3LLSA 3U7QA 5C8XA 2JL1A 2P65A 4Q7JB 5CT5A 4DSAA 2VXYA 4LNAA 3JVDA 3HP1A 4HKTA 5BSVA 3TDMA 1N1GA 1F0NA 3ISVA 3WL6A 3EXHC 3DDWA 1SMKA 2CFCA 1QFJA 4XDHA 5AKGA 4FOPA 5AHRA 2J3DA 2VRWA 1FP1D 5COAA 1NULA 2EWMA 3HYRA 5ALVA 3O83A 1FDTA 2PXXA 1NWCA 1UBNA 2R1UA 4J7XA 3M6AA 4R05A 4Y1GA 4ANFA 4E4TA 3R5XA 4D42A 1OX4A 2J30A 4MUHA 3GD7A 4EG1A 1S2OA 1IZ7A 5IN5A 5AJUA 4FXPA 2VDWB 2BKAA 1P1CA 5I9BA 3IL2A 3V2HA 2FUG1 3SJAA 1NA5A 2QVLA 4MB0A 2FB9A 1OZ0A 3NTRA 1V11B 2CDBA 4QT0A 3NAQA 2GXAA 3RVQA 2PNFA 4XARA 5HMMA 2G1JA 3VC2A 3BIFA 3HR7A 1N2XA 2G4CA 4G8BA 2HMVA 4RETA 4CUKA 5FLXA 1N8KA 8MHTA 4X7RA 5KTRA 3SE0A 4F5ZA 2OHJA 3DOJA 1Y1RA 2P8JA 4PHTA 4YJ2F 4UE3S 1RIIA 2R00C 3G8BA 2J31A 4P08A 3TLEA 4AJ2A 1AV7A 2QJRA 3BD7A 3LY7A 4L27A 3HVKA 4KXVA 4EQ6B 1TQ2A 2ZYTX 821PA 5K6RA 1OIWA 2KB0A 1GYPA 2GRAA 3FUXA 1Q92A 3N70A 3DKVA 5IF3A 4L15A 2HKIA 4G9EA 4E3ZA 1UDCA 4FR0A 3UHAA 5B4UA 4AMBA 3VNRA 2CJYA 3T5BA 5BR4A 1RM0A 1U5CA 2BEUB 4RAQA 2ZK7A 4H4EA 5EE0A 3U39A 1X80B 1HDEA 4YRNA 3GLHE 221PA 1MX3A 1CEXA 3KLBA 5DB4A 4DBLE 3AKCA 4ZMBA 1O03A 1U63A 3P0JA 3KQLA 3TDKA 3GEIA 1KY5A 1O5TA 3UB3A 4ZODA 3MTIA 4L3WA 4IKEA 1U90A 2UZ3A 4NJMB 4YRDA 5LLSA 1SU4A 5DEOA 3AQ4A 3OA2A 4B0OA 4DDHA 3L4SO 3F1LA 1E3IA 1RYBA 1TQ8A 2J3EA 3C1UA 3C4JA 3C7KA 4RV4A 4X91A 2KW5A 5C8DA 1KR5A 2NXEA 3DLCA 3GQBA 1BKYA 5E8RA 3V2IA 2IOFK 2X5KO 5HA5A 2D1TA 3NHSA 4U2FA 4P83A 3Q2OA 4BGEA 2OO3A 4HDSB 4QFCA 1K7YA 2IYVA 3HWWA 3TKLA 2PGOA 1IM2A 1AB5A 2QG9A 4B6OA 2Q3HA 1Y6RA 4P80A 5K05A 2ZRNA 2WT9A 4KXLA 1N5KA 1B00A 1T24A 3B78A 4RFVA 4F1JA 4OTZA 4R1TA 2DT5A 4BKPA 3CZQA 3P19A 3VMFA 1H85A 2BJVA 3OPMA 3ZU5A 4BU1A 1ZKMA 3SDBA 1G8MA 5C3UA 2Z6UA 4IJKA 4U7DA 5TDHA 2C8VA 2VNAA 5E6SB 1SWVA 3U3MA 2EIHA 2PZMA 3UPTA 1DKNA 5C7OO 1F8YA 4DWVA 3ZN2A 2A2ZA 8ABPA 4NMHA 1VJ0A 4AFNA 5DCYA 5TQ2A 3WLPA 4TMFA 2XB2A 1TLLA 2JAWA 3Q4GA 1XDZA 2IP1A 3PCTA 3W1VA 5IS2A 3DKIA 1DTSA 3GJRA 1XELA 3WR5A 3OKFA 4OHZA 3WLJA 4PO1A 2FV8A 1H2AS 4UNSA 3GT0A 3TSAA 4A8JA 4K0RA 5FNZA 2VIIA 5HQTA 2GTHA 3DVLA 4LV8B 3LBNA 3AEKA 3PKIA 5L3SB 4IIEA 1CUUA 1FFAA 4M89A 3T7EA 1T4MA 1NW5A 4L5YA 2VA9A 2I4IA 5LSAA 3OY2A 4JJAA 4EY3A 3SDSA 3TOVA 2O1XA 3ZOZA 2RGXA 4HS4A 3S40A 4KOEC 4EKNB 2ZULA 5GOZA 1PP4A 2ZJYA 1CULC 1UT8A 4BXOB 2PKRA 3GGCA 3OZAA 3DUFA 2NTEA 3ZHYA 3VPDA 4YAOA 1RYDA 3DNMA 1U9ZA 3DFIA 1BX0A 3OZWA 2IQIA 3LX8A 1N5OX 1P77A 2ILVA 4PZLA 3G1WA 3UXMA 2R1TB 4LE2A 5BMVA 4TT3A 1CJVC 4RPHA 3VHXA 3RRZA 1ZN2A 1OFGA 1DXHA 1Z2NX 2BDTA 2CVZA 3LY9A 4OA8A 3DNPA 1Y5MA 5EP4A 3SI7A 4GKVA 3IPYA 3S55A 3H3FA 1R4AA