4ZJUA

Structure of a nadh-dependent enoyl-acp reductase from acinetobacter baumannii in complex with nad
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
b'QGLLAGKRFLIAGVASKLSIAYGIAQALHREGAELAFTYPNEKLKKRVDEFAEQFGSKLVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTLDGDFTDVTDRDGFKIAHDISAYSFVAMARAAKPLLQARQGCLLTLTYQGSERVMPNYNVMGMAKASLEAGVRYLASSLGVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRNVTIEEVGNAALFLCSPWASGITGEILYVDAGFNTVGMSQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
molecule tags Oxidoreductase
source organism Acinetobacter baumannii
publication title Structure of a NADH-dependent enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD
rcsb
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4zjuA00
4RGBA 3FR8A 4WJZA 3UAGA 3OJFA 2G82A 2PGJA 3O9ZA 1MG0A 4ZQGA 1ZK2A 4NZ9A 1A9ZA 3AFMA 4Y6SA 4IZHA 1LSSA 2Q3EA 1I3KA 2PFGA 2ZYAA 4GGPA 3ZW8A 4JNKA 1JLLA 4QEDA 1UXHA 3GVIA 3KLMX 3V5NA 1PX0A 3SEFA 3FWZA 5T67A 1NNUA 1ISIA 2ZTMA 1WDLA 4WGGA 1DLJA 3I9OA 3IJPA 4CL3A 5JDCA 4PLZA 2OXIA 3WB9A 4DTIA 1DB3A 1I36A 4XQ9A 4M8SA 3VPSA 1D8AA 2PZJA 1U7HA 2FOIA 2WYWA 2YQ4A 4BKQA 1S6YA 1U7TA 4TMFA 1EK5A 3JQDA 5JYDA 2X1HA 1DOHA 2UAGA 2NU9A 4R41A 5JMPA 1NM5A 5G0TA 1JU9A 1HYHA 1ULUA 4DPKA 1MXHA 2PD4A 2QRJA 4NJMA 5JCJA 2DC1A 3AOEC 2DBZA 2Q1TA 1WDMA 2UYYA 4BO5A 4YYZA 3PHLA 2FHSA 3V2UA 2P9GA 2BGKA 3DBHA 2FPGA 4AJIA 1R4MB 1E7MA 4RPJA 3ZV3A 4J3FA 3DZHA 1VRWA 2IDZA 3H5RA 3GH3A 3I5MA 4HP8A 1FJHA 1P44A 1I33A 1O95A 3ZWOA 5IDWA 1R0KA 1I3MA 4RF2A 2FZEA 2A4KA 4YT8A 1LEHA 1EUZA 1XQ1A 4K6FA 2ZB3A 4XQCA 3LC2O 4CLOA 1P33A 4FPXA 4LISA 1KYQA 1CERA 3OP4A 5CEFA 1C0PA 1R16A 1KVUA 4YR9A 1E6UA 1O94A 3O26A 2NVUA 2PKQO 3AM3A 3U4DA 2X7HA 2J3IA 5L4SA 4XQEA 1H93A 4AJJA 4MPDA 4B4WA 4DYDA 5HA5A 2JAHA 4FOSA 4BGIA 2EIHA 1XEAA 3ZWPA 3RD5A 5G0UA 3QWFA 1P74A 1E7SA 3ASUA 1FMCA 1J4AA 2X0JA 3EUWA 1QV6A 1HDGO 5I9MA 4Z9YA 5KOIA 4RJTA 3OEYA 2JKVA 3WIDA 3GHHA 1JDJA 2PY6A 3JQ7B 4PN3A 3RSHA 4PFJA 4PLYA 3WGIA 1UZMA 3TZKA 2BLLA 3JSAA 3ZWWA 3GFBA 5L4NA 1XLTA 4RQTA 1T2CA 3SVTA 5COAA 3ZU4A 5HS4A 1TI7A 2Y66A 3KLPX 5BSGA 2WDZA 3RIHA 3CMCO 2O7SA 1I32A 3AU9A 3GEMA 3NJ4A 3ZNQA 2DBRA 4CMEA 2PZLA 3T4EA 2TMGA 3A9WA 1PJTA 1HSOA 2OL4A 5EJ2A 2XAAA 4OYRA 3BA1A 2J5QA 4WCFB 4BGUA 1ZFNA 2EXXA 1ADCA 3QWIA 1B15A 1ZUD1 2WWRA 2QRKA 3OIFA 4JJIA 4RLHA 4WNIA 4CLHA 1BMDA 3OECA 4NMHA 2P9EA 5I9LA 1YJQA 3OIDA 5ES3A 2PKQP 3AUSA 3ITDA 4OXKA 2P68A 3RBVA 4AJOA 4J1NA 3BMCB 2YHIB 2HAEA 3BMNB 1TT5B 3JYNA 4Z0TA 4MOWA 3TL3A 1JWBB 3KSUA 2NV6A 4RO0A 3CMMA 4BNYA 2E82A 1GR0A 4FC6A 2HQ1A 4G2NA 4WCDA 3AOGA 3KSDO 4BNMA 1E1KA 4JX8A 4R68A 4J9UE 4EEXA 3UVEA 2PZMA 4DC1A 2PWZA 4ALKA 3MJ4A 3CSDA 1ZSNA 3VHRA 1LQTA 2V7PA 3QVOA 1KY5A 1F8GA 2OO5A 4ROSA 3D0OA 3B1FA 3RJ5A 4XQGA 1ADGA 3UFXA 1SOVA 1KBZA 2EEZA 1YDWA 1TB4A 2GNAA 3PIDA 5THQA 4EJMA 1NQ5A 1X1TA 3JV7A 3MJTA 2VNAA 4PG8A 5K0ZA 3BMOB 1DC6A 2WD8A 1U8XX 5CPBA 2DTEA 3L4SO 4FFLA 1P0FA 4I9NA 2NNLD 3EGOA 4A0SA 3NTQA 4N7RA 3STHA 1IB6A 1HTBA 1O9BA 4WLOA 3SLGA 3RI3A 3IMFA 1G0NA 4CM7A 5L7TA 1YBMA 1B3RA 2Q99A 1AGNA 3MOIA 5C3MA 2DAPA 1B26A 5DP1A 1XSEA 1Y5RA 5KVCA 2OBNA 3LSYA 4OJNA 3OMLA 1P9LA 4GVXA 3I6QA 3WICA 1ZEMA 4B4UA 3JQAB 4HNGA 1IHYA 3JQEA 4Z0PA 3RFXA 5F5NA 1X13A 4DGSA 2BMAA 4R9RA 5DF1A 4JXKA 5EQDA 1CF2O 4BV8A 2ZYGA 4W9NA 1OBFO 4K9DA 5TLSA 2GZ1A 3WWYA 1E7QA 1Y6JA 3KB6A 4R3NA 1NQOA 2Q1WA 5KVSA 2GDZA 5JO9A 3QP9A 3DTYA 5DCYA 3S2EA 3T4XA 4ALMA 3O4RA 4E12A 1FDTA 4CM1A 3PQDA 3V1UA 5KKAA 4I9UA 3QIVA 3GEDA 2A9FA 3KYDA 1HLDA 3S8MA 2HUNA 4RZHA 3HDJA 4F3YA 1W0CA 4A7PA 2O50A 1XGKA 3K73O 2ZTUA 1VJTA 2PZKA 1GPDG 4BV9A 1E5LA 3E82A 2O48X 3EMKA 4DMMA 1AN9A 1E1LA 5JNLA 1VLLA 4PZCA 1YB5A 1T25A 2CD9A 3WBBA 2EJVA 4TZTA 3U0BA 1JA9A 2FWMX 5L45A 4YT4A 2NU8A 4JQCA 3JQ9C 4TRJA 1WWKA 4KUGA 3CZMA 1C0IA 1N92A 4B8ZA 3E9NA 3K9QO 4D3FA 3WDSA 2CVZA 4LCEA 1YOVA 4AJ1A 3MTJA 4TRNA 1YQDA 4C7JA 2EF1A 1B0AA 3JYLA 3GUCA 3JD3A 4ZVVA 1O89A 1PGJA 2ZQYA 3D3WB 1H6BA 3I4FA 2C29D 1P1FA 2DTDA 1YO6A 4DVJA 2VUUA 4ZICA 1HDRA 3SBOA 4NBWA 2C20A 3F5SA 2X6TA 4XB2A 1F17A 3IOYA 2Q46A 3E1KA 1X7DA 1AHHA 1QKIA 2JD2A 1UZNA 3N7UA 1FK8A 1I2ZA 1KEPA 4OKNA 3TN7A 4BVAA 5FWNA 2NUAA 4J0EA 2Z1MA 1BVRA 1KC1A 2PD3A 3JCZA 5ADHA 3GPIA 1UJMA 1MX3A 4XRRA 1NFRA 4JBHA 3I3OA 4OO3A 5EQFA 4E30A 1XYGA 5A03A 4MJLA 1ZJZA 5DCWA 1DLIA 1WVGA 3M1LA 4FD3A 4PLFA 3H4VA 4ALNA 4RF4A 1PZGA 3GVPA 3JQAA 5IN4A 4IJKA 3V2GA 4YJGA 2G76A 3LQFA 5TT1A 3RKRA 3VZRA 2RHCA 1I01A 1ZMTA 1C3VA 3WWZA 5B4TA 1EEHA 4A26A 2ZB8A 4N5MA 1M6WA 1Y5MA 2DUWA 1YQGA 4O59O 3WGQA 5GZ1A 3GF4A 1E92A 1NHWA 1NVGA 4HFNA 3MTGA 2BH9A 3OA0A 3CTMA 4J4HA 3ZWMA 3GDGA 1F12A 1SAYA 4A03A 1HE5A 1GYRA 1R0SA 1XA0A 4D0SA 2Y1OA 3PJFA 4CM3A 4BS9A 3DAGA 1LA2A 2X5KO 5A05A 2NADA 3N74A 3KEOA 4BO0A 2E48A 4P38A 4J0FA 1L1FA 3ROPA 5A1TA 1LSUA 2V65A 3IKVA 5G4KB 5L40A 1PGPA 3TZ6A 1PR9A 3LT2A 2Z95A 3OETA 4XX0A 1X0XA 3JD2A 3D7LA 2NTVA 5TQVA 5GZ6A 4ZGWA 4YDRA 2AE2A 4IQ0A 4CMAA 2VYVA 4CQMD 3CXRA 3Q2KA 2GCGA 4IXTA 4QFDA 1VJ0A 3FI9A 5CEEA 3JQ6A 3A06A 4KOAA 2DBQA 1D3AA 1SCUA 2E4AA 1PTJA 3BMCA 3L6EA 4P4LA 3X2EA 1DC4A 4CUJA 1LX6A 1N7GA 3WYEA 5BR7A 3WGZA 4D0RA 1JW9B 1DJQA 2NTNA 2QX7A 4IDDA 4W99A 2Q1UA 1I3LA 3P7MA 4Q3CA 4PG5A 4J7UA 4WCFA 1E3SA 1U2GA 2FPIA 2AQIA 2GRAA 2E37A 5ILGA 3RCBA 3RUIA 3ZWYA 3B6ZA 3ZWBA 3AUTA 3MOGA 1LBEA 2W2LA 1GPJA 4EYEA 1S7CA 4QX6A 4O5OA 5KCZA 3TFOA 3MJCA 3BYZA 1ENOA 1I5RA 2DT5A 3WSWA 3TSCA 4GX2A 4IJVA 2Q1SA 3R6DA 3DAFA 4HY3A 2RHRA 1RPNA 3G17A 3I9NA 1NWCA 1EE2A 1ZJYA 4R69A 4BNJA 1E3JA 5IXYA 1QYDA 2YW9A 3TOZA 3UKOA 1YE3A 2HMUA 4KTVE 5KJFA 4XRGA 1HLPA 1U5CA 4LCJA 4KMSA 2BRUA 3HN2A 5CDYA 1VJ1A 1RYEA 3P5SA 4GBJA 4LMPA 4R9SA 5ICMA 3U5TA 4RV9A 2RH8A 2FPPA 3WXBA 3B70A 2WYVA 3I83A 4WASA 4HADA 4CQMB 1O6ZA 2DVMA 1XU7A 4B7XA 1WMAA 1T1RA 2GERA 3E18A 3GT0A 3P2OA 4B7UA 1EBFA 1BWSA 4N18A 4R54A 2GPTA 3RC7A 5U4QA 2JFHA 2Y68A 3OM9A 5COBA 2ZCVA 2I76A 2WMDA 2J3HA 5T64A 2BKAA 1EE9A 1YS4A 2NVUB 4IS3A 2PGLA 1P31A 3DZBA 4E2XA 4R1UA 2QW8A 1WLYA 4AICA 1CETA 2Y1GA 4R01A 1LJ8A 4J43A 1F06A 1D7OA 1E0DA 4XDZA 5G0SA 5K6AC 1C14A 2IXBA 3KYCA 5I7EA 1YXMA 2R00C 2IYPA 2GUGA 3QSGA 1FXSA 2DPHA 1Q7CA 2RIRA 1R4NB 2XF8A 2CZCA 3WQRA 5CDGA 1PZEA 2D59A 1NVMB 3WGYA 4ZJUA 1YDEA 2D1YA 3NTOA 5H82A 1R66A 3F1KA 4NBTA 2NVBA 1RWBA 1U28A 5IG2A 2O3JA 4WKGA 4XA8A 1K3TA 4KDEA 1D4FA 3KBOA 4Q3AA 3ZWXA 2NWQA 4CPDA 5DNAA 3S2IA 4DPMA 2BF7A 4NK5A 3DBLA 4G65A 1ZKMA 1ADFA 1WMBA 4FW8A 4UUMA 5JPIA 4J2OA 1A27A 4I1IA 4NU5A 3HDQA 3WMWA 3I9KA 3OICA 1GV0A 3GVXA 4BQRA 2Q2QA 4W82A 4E32A 4I8XA 4IJWA 1Q2XA 1IL0A 3AU8A 2D4AA 5IZCA 1HETA 2YHUA 1UP6A 4J90A 5G0VA 3QQPA 1P1JA 2DTXA 1UAYA 4OQZA 4IIVA 3JQBA 3KRTA 2CDBA 4PG6A 4QO7A 4YJFB 3INGA 3D5QA 1ONPA 4UUPA 1SEVA 4XDYA 3OIGA 4ND5A 4HFJA 4ZA2A 4CM4B 3TRIA 5IDQA 3ST7A 4EUEA 4BKUA 1DRUA 2GZ2A 3MJVA 4BB5A 3AUAA 4DQXA 1K6XA 5FEUA 2P2SA 3PJDA 4B79A 3G79A 1KERA 4DBZA 1HF3A 1RYDA 4GSKA 4RORA 1DPGA 5HBRA 3VKVA 3NKLA 4E6PA 1QXSA 4YAGA 4YJDA 4BNFA 3MZ0A 4WE3A 3LYLA 4WEQA 1HDXA 4P22A 4R51A 2HMTA 2B4RO 2QRLA 4DIFA 5AYVA 4CLOB 1JKJA 3WS7A 1Z7EA 4DWVA 4QT0A 4IS2A 5KKCA 1ZIDA 5G4LA 3B1KA 3QW2A 5TX7A 5L4LA 4JBGA 5JYEA 2H1SA 2FRDA 2HK7A 4ZHSA 3BMQB 3ZHXA 4ZQHA 3VDRA 3HDHA 2DPGA 1UXIA 3WQQA 4E2WA 3UW3A 4RVSA 5F1KA 4ZRNA 2P4QA 4PG4A 3C7AA 4NDNE 1T24A 1GUFA 5IXSA 1VC2A 2SCUA 1ENPA 2QHXA 4E33A 2EP5A 1ZK1A 3DXFA 1Y9EA 5GMOA 1H6DA 2AEJA 4IXWA 5BSEA 4BO9A 3ENNA 3LC1O 3KZVA 1NAHA 3QWHA 3JYOA 3WTCA 2C0CA 4S3MA 4MVJD 5TRTA 3ADPA 3DO5A 4HX5A 4B4VA 4DREA 3PYMA 1H94A 4GL4A 4O63O 4I5EA 2DUUA 1QYVA 3M2PA 1UZLA 3ZV5A 4IUYA 1MGOA 3Q11A 2YFQA 4IJUA 1ZBQA 2Y1EA 5L51A 4FGWA 4Z9FA 3PWZA 4OOEA 1SO8A 3RC2A 1HDOA 2YJZA 3PGJA 2C7GA 4LVCA 5L95A 4B4OA 2X9GA 1CRWG 4EW6A 1NQAO 4ZQBA 1J0XO 4E21A 3BTOA 1NX6A 3NGLA 3NUGA 3X2FA 4AJEA 3LLVA 3RBXA 4CR7A 4YXFA 2I99A 3OH8A 4L9RA 3GGGA 4YB8A 5F1PA 3W1VA 2O3QA 1SZJG 2PTGA 1KVQA 1Z6ZA 3D4PA 3GC6A 4EI2A 1TT5A 2JCYA 4RVUA 2A35A 2Q4BA 1ZK3A 2WD7B 4KUHA 2P91A 4BL5A 4K6CA 3CE6A 3S2FA 3JQBC 3TJRA 1P45A 1ONNA 2VTDA 4ZQEA 1IUKA 1BXGA 1E3LA 3HJAA 2VT2A 4GH5A 4OSOA 3QVWA 4YQYA 2QZZA 3QVXA 5FYDA 5DBFA 1YWGO 4CV3A 3D64A 3JQGA 4UVIA 3PEFA 3PHJA 1SMKA 3JQAD 1G6KA 3PWSA 3E9QA 3RUDA 3H2ZA 4M86A 1JWAB 2J3JA 3VH1A 3HADA 3MEQA 3NYWA 1EFLA 1JVSA 3UICA 4GLOA 4UULA 4IDAA 3CINA 4KTTE 1HE4A 3FNFA 5I7SA 1PGNA 3EHEA 1J49A 2GASA 3DR3A 3RC1A 1HE2A 4NBVA 2YDXA 4UAGA 3ZV6A 1A9YA 1TVEA 2O4CA 3DBLB 5JCJD 1SEPA 3KV3O 1H0KA 3WR5A 4H3VA 4NFSA 1BXGB 2Y0EA 1V3UA 3BTVA 4IDFA 2POQX 1YGYA 3BAZA 3RUAA 4CMJA 3U9LA 1NR1A 2RH4A 1PQPA 2AMFA 3ROKA 1EVIA 2Y0DA 2I66A 4LSWA 3IQDB 4N5NA 1GY8A 4OM8A 5B1YA 3OJOA 1LDMA 4W9NC 4CQLA 1I24A 4BNGA 4YA6A 3IP1A 5GY7A 4CR6A 3WGGA 2OHXA 5MDHA 4GPD1 3A4VA 3GR6A 1KVSA 4U6SA 4R5MA 1LLUA 3KYCB 3RUHA 3FWNA 5AXBA 2ILTA 3ZWAA 5L53A 1LTHR 3ETDA 4M87A 4WOJA 3VAZA 4UVDA 1UAGA 3E9MA 2E49A 4BKOA 2JCXA 3E5RA 4HWKA 4RVGA 3WMXA 1A5ZA 3HWRA 3INRA 1XG5A 3V1TC 4DLAA 4YCAA 4TVOA 1JKFA 3RVDA 1J6UA 1KVRA 4CM8B 1DSSG 1I2CA 4QQRA 1PQUA 1V3VA 1QORA 3DZGA 3VTFA 4BNZA 3GAZA 2O2YA 5F21A 4Z3KA 3JQCA 2IEDA 5MGBA 4TKLA 4P8RA 1EFKA 4Y67A 3PFWO 2VRBA 2ZTLA 5KWEA 3AM4A 4I5FA 1UP7A 2Z5LA 1R12A 3BHJA 3UF0A 3LF1A 4XYMA 3H8VA 1HRDA 2PV7A 4MKXA 1MLDA 5IN5A 1T2DA 3FNGA 3L4BA 5FFFA 2QQ5A 4TZKA 2O2SA 2VWGA 1BVUA 4XYGA 4GQAA 1WZIA 1PJSA 1H2BA 1YVEI 2CSUA 4OMUA 2JAPA 1T26A 4RVDA 4HV4A 1XKQA 2VCYA 3L9XA 4TQGA 1TLTA 5CDUA 4WNCA 2B5VA 1JQBA 4K1LA 2Y05A 1WP4A 1LDNA 3GK3A 3QLJA 4FFPA 5B37A 1H9BA 3GNSA 4W6ZA 3FCOA 4F6CA 1ORRA 4JJFA 4BO4A 1B14A 4Y9DA 5THKA 5C7IO 1IE3A 3TZHA 3U62A 3WSVA 3RKUA 1NR7A 1PJCA 1QLHA 4R5HA 5DOZA 1ENYA 3VZQA 3Q0EA 1U4SA 2HSDA 3JD4A 3ZU3A 4GGOA 1ARZA 4TRMA 1NHGA 2WTBA 2AQ8A 4NFHA 4ALLA 2OUIA 2EHDA 2RCYA 3WJAA 1EDOA 1GUZA 3QV1A 1ML3A 1TXGA 2EG9A 2OMEA 3LU1A 5A9SA 1WXDA 1ULSA 3NV9A 1XDWA 4MVJI 4BNUA 3JQFA 3BTSA 3DEYX 4JGBA 5EN4A 3D4NA 3KO8A 4AJ2A 1A4UA 2AG8A 2C5EA 4DL9A 1IPEA 1OZAA 4Y6RA 3EC7A 1GCOA 2HO5A 4JJGA 1GU7A 3WX0A 2UDPA 1L7DA 1LNQA 3PLNA 4NI5A 3K8ZA 2WEKA 4YJFA 3R1IA 4FIZA 3JD0A 1DIHA 3SLKA 3GMSA 3ASVA 1QP8A 3AI3A 1QYCA 1V3TA 2QZ9A 5JBIA 1V8BA 3LLSA 3AOEA 1ZSYA 3CIFA 4GKBA 4Z0HO 1JVBA 4MVJE 3GG9A 4MKRA 3DFZA 4I08A 1SC6A 1XCBA 1BXZA 2AXQA 2G0TA 3LC7O 5CP8A 5EMHA 3JTMA 3ULKA 3K2EA 5IZCC 3GZNA 2X0IA 3U3XA 1U3WA 4CV1A 1B8VA 3NT5A 3RWBA 3VH4A 1ISHA 4M49A 1ISGA 1F0YA 2WJPA 4IDGA 4E4YA 1ISMA 1Y9AA 4E5PA 5A04A 1MC5A 2Y1DA 4CLXA 3GEGA 4LW8A 1DBVO 3MJEA 1Y1PA 1HE3A 5TC4A 1CYDA 4PGFA 4XKJA 3C8MA 3W8DA 1Q1NA 4N5LA 4YT2A 1AUPA 3WTBA 1K6IA 1CJCA 3FR7A 4ND2A 2NACA 1U4OA 4DIOA 2ZJ0A 3DONA 4GKVA 4J91A 4PG7A 4XIYA 3MWDB 2PD6A 3PDUA 2GO1A 5GZ3A 4LGVA 4DC0A 4PLPA 4FFRA 2OFPA 3G1UA 1M67A 3HZZA 1GQ2A 5A4DA 2G17A 3S1LA 2AE1A 3ZWNA 3C7DB 1C1XA 3ZZNA 4HNHA 3P2YA 1ZK0A 2ZK7A 3H3FA 5BQFA 1NFQA 1MFZA 3KVOA 4MP3A 1E1MA 2HJSA 2FSVA 2VHWA 1OC2A 2VYVD 4CQMA 3L07A 3MWEB 4IQGA 2F1KA 2ZYDA 1PEDA 4GWKA 5ENVA 4ND1A 4LSMA 3SX2A 1DIRA 4CMIB 3ICPA 3FPLA 3Q9UA 5G2OA 2OGUA 1MG5A 2O3UA 1OC4A 4OXNA 3H3JA 3PTZA 5A9SB 3UGKA 2IZ1A 2BI8A 1VM6A 4Q3NA 4TSKA 4DBVO 4AJHA 3LT4A 4MVJM 2X86A 4FFMA 4KQXA 1W8DA 1EUCA 3QY9A 2B37A 3NEPX 5JE8A 4NNJA 2YQ5A 1EK6A 1EBUA 1RJWA 1LDGA 4S1VA 3KHUA 1T2FA 1XU9A 3EVNA 4KDFA 3UUWA 5BNTA 5JCXA 5JAMA 1XR3A 1UXJA 3PHGA 4FCCA 2EKLA 3OBBA 1AHIA 4OH1A 4XD2A 4DXHA 3IL2A 1Y8RB 5HM8A 4E5MA 3LDHA 3L6OO 4JP3A 4YAEA 1KY4A 3DZIA 2JJYA 3OQ6A 1ZVMA 4IGFA 1P77A 3WBFA 2VHZA 3VC7A 1UP4A 1E6WA 3ETGA 1PQWA 3M1AA 1V0JA 2BI7A 4XGNA 4K28A 3IUSA 3K2BA 4CUKA 4YRBA 4D41A 1T1SA 3VZSA 4I9HA 4AFNA 4ND4A 4BNTA 2BFPA 3FF4A 3H5AA 4YRDA 4XWYA 2H9IA 2VYNA 4IBOA 1HL3A 1U9JA 1Q7GA 3JQ8A 3OJLA 4HFRA 5U1PA 5G4KA 5TT0A 2YUTA 4WLNA 4IGEA 3GGPA 2JHFA 4Q9NA 1OAAA 2GN4A 3DZJA 1LDYA 4BOYA 2WYUA 2PA3A 3S2GA 4FB5A 4DMLA 2HCTA 2OP0A 4D46A 1XHLA 2YZ7A 3DQPA 3R0IA 4R16A 1HDYA 1C1XB 2JFFA 3DDNA 4CM8A 1BW9B 4W7HA 2AQHA 3FBTA 4RLSA 1P3DA 5DZSA 1CEQA 2C5AA 4GI2A 4UUNA 4UVHA 5I7FA 4UVGA 3AJRA 1EVYA 1JTVA 4H7PA 2VWPA 3ZU2A 1DIGA 1M75A 2B83A 4RZIA 1NPTO 2W4QA 4Z3DA 5L7WA 1DFHA 5EPOA 5DT9A 4E31A 4DLBA 3PDJA 2NU6A 4OOFA 3R3JA 3EAGA 3AUUA 3GUYA 5JAZA 1PJ2A 1PS8A 5CDSA 2B5WA 3FHLA 2EW2A 3KM0A 4N54A 3O8QB 2YV1A 4O0LA 4PLCA 5EL0A 4FS3A 3FBGA 4CMHA 2VUTA 2FR0A 1LC0A 3K5PA 3KTDA 1T4DA 2IODA 3M6IA 4W4TA 2C07A 2P5YA 3D3EA 4BNNA 1HDCA 2QYTA 3UCXA 3E5MA 4FFNA 3SC6A 2PLAA 3W4IA 4OQYA 2O23A 4FGSA 1VSUA 4MO2A 3VPXA 4XR9A 4BGEA 4AJPA 4PLWA 1GUYA 3LF2A 4CV0A 3OSUA 1UR5A 3AWDA 2NQTA 3R3SA 4HUJA 3S55A 4BMVA 1R37A 4C7KA 3ENKA 3C24A 4CMBA 4NIMA 1YBAA 1O8CA 1IZ9A 5IJZA 5JAQA 1IOLA 4R1NA 4Z9XA 5K9ZA 1QSGA 4HXYA 2EV9A 3PQEA 1F8FA 2C7VA 2H63A 2LDBA 2WM3A 4IZIA 2IE0A 4NBRA 2VT3A 3GLQA 4KWIA 1QMGA 1VE9A 2QIOA 3NDJA 3F47A 5ICSA 1UDBA 1W73A 2VOEA 1PJ4A 2AHRA 3OA2A 4R1SA 3RU7A 4BQPA 1U1IA 3H2SA 4ZN6A 1EUDA 2GYYA 3C1OA 4U0KA 1H6AA 5EESA 3WGOA 1NAIA 1LUAA 1PU2A 5TSDA 3GZ4A 4RF3A 2WD7A 4KZPA 2J3KA 4EBFA 4P4NA 2W2KA 1DC5A 4IDBA 4YBZA 4WLUA 5ER9A 3LK7A 4FBGA 2ZB7A 3VZPA 3NRCA 4AJ4A 4CM9A 1ADBA 3CUKA 4NFYA 2PH3A 2VQ3A 3KYDB 3ONEA 2BELA 2C2XA 2VWQA 3PZRA 5LCXA 3AY7A 2I9PA 5TF4A 3UHAA 3TDKA 4YAKA 1ZZEA 4BNHA 3ANNA 3PJGA 2GGSA 5CHEA 2GD1O 3FNEA 1Z45A 1QG6A 3K31A 2Y1FA 2HRZA 4L8VA 4XJSA 5T5QA 5FI3A 1HEUA 1QYWA 1Z74A 3FSRA 2GZ3A 3PWKA 2Z1NA 3GDOA 3GHYA 3IAHA 4MIOA 4OIMA 1R4MA 2W90A 1LRLA 1PS9A 2Y67A 3HHPA 4KQWA 4J6FA 3ZDFA 5I8ZA 1I8TA 4URFA 4JLWA 4CM6A 3GZNB 2AEFA 2DBVO 1GQQA 4LK3A 1B16A 1G1AA 3HG7A 3I6IA 4U8GA 3GA0A 4YJHB 1I2BA 3DMYA 1NWHA 1P1KA 4IMRA 3D5TA 3DZKA 3HB4X 4F6LA 1MB4A 1IZ0A 2DLDA 2AG5A 1FDSA 4ILKA 2FP4A 1DO8A 2VNSA 3L6DA 3PI7A 1MFPA 2DKNA 1Z82A 1OMOA 1VPDA 2NTJA 2Y0CA 1YH3A 2PH5A 4YACA 4B3JA 4TWRA 3BMOA 1PJQA 2HK9A 3ZHYA 3EDMA 3CH6A 1UXKA 3BMQA 2I3GA 3WGHA 4DIBA 4F45A 3TOXA 3D4OA 4MINA 3QA9A 5A5FA 1NP3A 4Q3DA 4NH4A 1KS9A 3KUXA 3QVSA 2BFOA 5A3VA 4R3WA 3RC9A 5TJHA 2YV2A 2OOSA 9LDBA 3T7CA 4XR4A 2R00A 4TRRA 4UUOA 2FR1A 5K6AA 1PR3A 3H9UA 3TZCA 1H9AA 2CVOA 4YRAA 1HWYA 5JMWA 4PIVA 4WLVA 2I5PO 1DIAA 3IUPA 1V35A 4M1QA 4D42A 4DA9A 4II3A 4A10A 5FF9A 1N2SA 2X22A 2QG4A 3G3EA 1IYZA 1BRMA 2UUOA 1T4BA 1VL6A 2AEMA 1WNTA 2CUKA 4EDFA 2Y1CA 5IAAA 2YHIA 4GSLA 5AOVA 1LDBA 4BGVA 4EEZA 4NU6A 5I7VA 2GN8A 1HSZA 3FTPA 3PVZA 4BMSA 1GAEO 2YY7A 2NLOA 4XYBA 4J4TA 2UVDA 4A27A 4CM5A 1I3NA 3O38A 4CM4A 4CL8A 4R1TA 4TVBA 4CMKA 4HKTA 4K26A 3IC5A 4J9VA 3WFIA 3CKYA 4Y8VA 2V6MA 3ABIA 3OF2A 2A94A 2EERA 1I0ZA 5IDXA 3MCVA 1E6EA 4Q3BA 1ISFA 2J5KA 2ZQZA 5JY6A 3NT2A 4PZDA 3VH2A 1LRKA 4BB6A 4NBUA 1LQUA 1HZZA 4QTZA 4NK4A 1HXHA 2IYOA 2TMDA 4HFMA 3ZHBA 3VPFA 1HYEA 1WW8A 4WEOA 3VVBA 2OP1A 2W2LD 2VRCD 2GLXA 1B3BA 1GDHA 3BTUA 3G0OA 1ZMOA 4P4GA 1DRWA 4PZEA 1A7KA 1DIBA 1CWUA 1X7GA 4RPKA 1RM0A 1NASA 4AL4A 3F4BA 4MVJA 3OJEA 4UVEA 4R4JA 4GLLA 4RQUA 4INAA 4QUKA 4Z6KA 2VHYA 1E1NA 3RUCA 4B3IA 1RM3A 3CZRA 4W7IA 1N7HA 5L3ZA 2NSDA 2YV3A 3AM5A 3EW7A 4CODB 3GGOA 4FJ1A 1CQJA 1LXCA 4L74A 3CPSA 1J5PA 1NVTA 1R15A 1P1IA 3OQBA 3QE3A 4EGFA 2FZWA 2OORA 2RBEA 2VHVA 1DHRA 5DULA 5TIIA 4L76A 2Q4EA 3HFSA 2W98A 4PLVA 1X15A 2FR8A 5G0WA 4XGIA 3DZFA 1ZEJA 3I4CA 3KEQA 3ZNOA 5B12A 1UDAA 5EINA 2CF5A 3JD1A 1OI7A 1ZO8A 5LC1A 2ET6A 1DDOA 3ZNNA 1LRJA 5ITVA 3SC4A 4FFOA 5H83A 5KTKA 4QSMA 1U3VA 2JL1A 1TT7A 1M6HA 3OQ1A 3NJ8A 4FC7A 4FDAA 3TWOA 4IPTA 3DBHB 3DMTC 5BSHA 2EWMA 2JD1A 3GPDG 4IQ8A 4L4XA 4I5GA 4J1QA 4OSPA 4BO1A 1BXKA 2Q45A 3KYBA 3DBVO 2FN7A 5JC1A 3FPCA 3W6UA 1PIWA 1Q0QA 4BNWA 1ZH8A 1KEUA 1UDCA 3HDYA 1RM5A 1PZHA 5EERA 4CJXA 4ZRMA 3TF5A 6LDHA 5DN9A 1U2DA 1B7GO 4FOOA 2Q49A 2FY8A 3DFUA 2EGHA 1X14A 3ZNPA 4CUZA 4MVJF 1DEHA 2HK8A 2O7QA 1U3TA 3LT0A 4NR0A 3TZQA 2WE7A 2NVWA 2X9NA 2ZB4A 1A71A 4PLGA 3C3XA 1E7RA 2C2YA 1ZXBA 2H5LA 2Y93A 5KJEA 1F14A 2ZIZA 4RPGA 4X54A 4YWJA 1N8KA 2BD0A 4GMFA 1GFSA 1YKFA 3F4LA 3OHSX 1KETA 4A2CA 3FNHA 5TJ9A 3ANLA 4ALJA 4BIIA 3W8FA 5H81A 1C0KA 3PPIA 2HDHA 1HT0A 4GAEA 3NTRA 2NQ8A 4RPLA 4D79A 4ZU3A 1LLCA 1K2WA 1L7EA 3M2TA 3GN1A 1ZXLA 5DCUA 3WLEA 5KNLA 1Q0LA 4D45A 5A06A 3FRJA 3W6ZA 4AJLA 2EKQA 5C7OO 3AFNA 5I9NA 1E77A 5CFZA 1GZ6A 1M66A 2X5OA 4EJ0A 1LI4A 4NJOA 4MP8A 4BUCA 3IIEA 2CDCA 4WLEA 2B69A 3HSKA 1E7YA 2DFVA 4JIGA 3U49A 4J2HA 2X0RA 4GX5A 1Z75A 3VPGA 3AK4A 3ETEA 2DQ4A 4QECA 3RJ9A 2ZJ1A 5BNFA 1YL6A 1YL7A 3PHIA 2H6EA 4L4SA 2ZCUA 4XB1A 5L7YA 3I52A 2VZ8A 5A02A 2D0IA 4BHTA 5AXAA 1SOWA 5JAIA 1GYPA 3C1AA 5CPFA 3QVTA 4PLHA 3RFTA 3F3SA 1EMDA 3VTZA 3Q1LA 2D5AA 1WDKA 3E8XA 3F46A 4E2YA 3V1YA 5JO0A 2CVQA 5AXDA 4DYVA 1MC4A 1AE1A 3QRWA 1SB9A 3GRKA 4BNLA 2J6IA 2NM0A 3P19A 1XIVA 2LDXA 3I9LA 3EK2A 4BKPA 2PNFA 5JC8A 1OOEA 3LVFO 4YJGB 3BHIA 3DTTA 5AQ1A 3VVCA 1YQXA 2HMVA 1ZSVA 2O3TA 1BTOA 1A4IA 1CDOA 1KVTA 2HKIA 2VHXA 1RKXA 3ZI0A 3O8QA 5HS6A 1GEGA 1PZFA 5IDYA 3RFVA 4E2ZA 1UUFA 3E6AA 2B0JA 5A3JA 4OKIA 3ZHZA 1TEHA 4IDCA 7ADHA 3HN7A 3TFQA 4RL6A 2CMDA 1N9GB 1ZK4A 4WOKA 2Q50A 5C5IA 4PLTA 4JN6B 2IZZA 1LDEA 4BO6A 1V9LA 4BKRA 2UUPA 2P5UA 4G81A 3Q9NA 2X23A 3NDIA 1VKOA 8LDHA 3I1JA 1Y81A 5F5LA 2J5RA 4GMGA 3W4JA 4L73A 1WAMA 3E48A 1BW9A 1LLQA 3DL2A 3DOOA 3WIEA 4RCVA 1NBOA 4Y98A 1YONA 3NGXA 4E3ZA 1C1DB 2HLPA 2W2KB 2VN8A 1P0CA 2D2IA 1QR6A 2PGDA 4YVFA 4NG5A 1YOVB 4LVUA 4WK6A 3ZU5A 3L9WA 4BO8A 3BXXA 1DRVA 5KJ1A 2B4TO 3Q2IA 2XXBA 4TKMA 1Z73A 1NFFA 4J1SA 2CNBA 3RUFA 4O1MA 4U0JA 3INTA 1DXYA 3K30A 1C0LA 1PGOA 5JS6A 4XGKA 3EYWA 1QRRA 2BGMA 3K96A 4MIEA 4OXYA 3ITKA 2VUSA 2XOXA 2WE8A 2BFAA 4MKZA 3WG9A 5T8KA 4RDHA 3DOCA 1PJBA 1G0OA 1A72A 4UEOA 5F3RA 4J1TA 1ZNQO 3PP8A 4JK3A 3H7AA 3I9MA 3RROA 3WJ7A 2I67A 3PIIA 1SB8A 3V8BA 1BDMA 3EZLA 1ZW1A 3NX4A 4BO2A 4XYLA 3EZYA 3NDRA 5A9TA 4PRLA 2B4QA 2C82A 2RAFA 3PGXA 1B8UA 1KOLA 4PVDA 4E5YA 1WZEA 2Q2WA 3WOHA 5A9RA 1DFIA 3FTNA 9LDTA 3D1LA 5JDIA 1NQTA 4DQUA 1HDZA 1R4NA 1UH5A 4KWHA 3RAJA 5FI5A 4CMEC 2EW8A 1ONOA 3QWBA 5IFLA 3DAPA 3KETA 3B1JA 3SJ7A 1KC3A 1U8FO 1PS0A 1YJ8A 3F1LA 1XWFA 4LMRA 4YQZA 1BDBA 5ILOA 1VKNA 3AI1A 4AG3A 2A92A 1W6UA 5COQA 3GY0A 5JXWA 4Q39A 3IDSA 3UN1A 5A5EA 1IULA 4BNXA 4JBIA 1LLDA 1FDWA 3I23A 4H15A 4JP2A 4RF5A 2X4GA 3GNTA 2VZ9A 3KSZO 4BO7A 4G5HA 3GVCA 4RPHA 2P9CA 2CF6A 1DJNA 1SBYA 3ONFA 3A1NA 2HRBA 1X0VA 4FN4A 3RUEA 4AJKA 4D44A 3VDQA 2OZPA 4AJNA 1XELA 1UXGA 2YFHA 3JQFC 3BIOA 3H9EO 3Q6IA 2Q2VA 1AXGA 1K0UA 2DU8A 3K92A 4KUEA 4CLRB 1MV8A 3N58A 4KP7A 4YAJA 3CEAA 2VTEA 3JYQA 1PL6A 3OJ0A 3ON5A 4QXMA 3WQSB 2XPCA 2CDAA 3VOSA 5B4UA 1O0SA 1H5QA 1YB1A 3WGTA 4J4BA 4E0BA 2XXJA 5T6BA 3ZV4A 2DM6A 3DHYA 3U09A 1O5IA 1LSOA 4YJHA 3HE3A 4LN1A 5LDHA 3PHHA 1KEVA 5DBIA 3L0DA 1N1EA 4ID9A 4UREA 5CG1A 3QWAA 3NAQA 2D8AA 2GN9A 1DHTA 1Q7BA 4ND3A 4CR8A 4WLFA 4DLLA 2IZ0A 1VSVA 4WPGA 1GZ3A 2D5CA 4WECA 4EJ6A 3H9JA 5JDCC 4C4OA 3W4KA 1R0LA 3GQVA 2B36A 4RVFA 2FSSA 1N1GA 4XZ3A 3ADOA 3GMDA 4MP6A 1Y8RA 2VWHA 1B2LA 3AY3A 4YT5A 1FDUA 3PLRA 4FJ2A 4IM7A 4ALIA 4U7WA 1T2AA 1A7AA 1K5HA 4M54A 4U5QA 5KJ6A 3L4BC 2EP7A 1ZCJA 1TA4A 3OFSA 2O3RA 4J49A 4OHUA 5KVQA 3D3WA 5JW6A 1PJLA 7MDHA 2GSDA 4MDHA 2F00A 1VL0A 1JKIA 1PWZA 1U5AA 4OGWA 1SPXA 3IKTA 3RU9A 2VYND 3WNVA 1VL8A 2JFGA 5CEJA 4B8WA 4EUFA 3F6YA 1D1SA 3NT4A 2IXAA 1E3EA 3FD8A 3TPCA 4XIJA 4CLDA 3GG2A 2O3SA 3AI2A 4AVYA 2V6FA 3PK0A 2V6GA 1ISJA 2UV8A 3AY6A 2GF2A 1C1DA 2AW5A 1NXQA 3DHNA 3ROQA 2G1UA 2YDYA 1JAXA 3E03A 1AXEA 2ZTVA 4MVJG 4NPCA 4D43A 4IY1A 5CAEA 5JLAA 2JHGA 2G5CA 1GTMA 4XEHA 5BSFA 4DQVA 4II2A 3JYPA 2JD0A 3TL2A 3ANMA 3HNPA 3T7EA 1NTOA 4NHEA 3GFGA 1IPFA 4PRKA 4WUVA 4B7CA 1LU9A 2CY0A 3UXYA 1LSJA 4XJTA 4MVJP 4I5DA 1IHXA 4L75A 1W4ZA 1Q0HA 4WCFC 3BHMA 3HUDA 3L77A 1DFGA 3Q3CA 2D3TA 4JCOA 3WYCA 1GZ4A 3RQSA 2OBYA 1BG6A 3EY4A 4ZD6A 1I10A 1P1RA 2R2GA 4H16A 2IEBA 4QO8A 2VOJA 2X5JO 3COSA 5JFOA 4RDIA 3IP3A 4CV2A 1RM4A 4BO3A 1HZJA 3C7CB 6ADHA 3GOHA 3IJRA 1JN0A 4EITA 3V2HA 4E13A 3PJEA 2JCVA 1GV1A 4CLRA 3HFGA 3FN4A 3RASA 3WYBA 2YYYA 2AQKA 4IINA 4M55A 1H2HA 4U6QA 4UEKA 4Y6PA 5DBGA 4CMGA 4DPLA 4GX1A 3H5NA 3ONDA 2I6TA 4F46A 3OEWA 4LRTB 3VKUA 4B3HA 3ORFA 2AA3A 1QYXA 5ENDA 4EUHA 1X1EA 1DAPA 1DAOA 2PR2A 3BZUA 3LT1A 1PL7A 3K6JA 5AXCA 4D7AA 1QV7A 3JQ8B 4IMPA 4ZQFA 1BSVA 2P4HX 1GYQA 3ZGYA 1YRLA 4TROA 1MP0A 1E5QA 1B8PA 4CM9D 1DC3A 4UEJA 1Z7BA 2C59A 1YL5A 4PCVA 1BGVA 4D3DA 4ITUA 3DC2A 3DWFA 3DB2A 4Q3EA 4L0QA 3UCFA 3WLFA 3BMNA 5BNIA 1MA0A 4YPOA 3C85A 1K6JA 3PFFA 3AW9A 2DFDA 4FQ8A 3EVTA 3G1TA 5KJCA 5U9CA 3A28A 4OL9A 2J8ZA 1FDVA 5BT9A 1MXFA 3H6KA 4M89A 5JSFA 4FJ0A 5HRUA 3ZH2A 2HMWA 5EIOA 4HBGA 5TGDA 5JDIC 1E3IA 4FSHA 3QJ5A 5TNXA 3I9JA 2EGGA 2B35A 1LC3A 1Y8QA 3PQFA 5HWSA 1PSDA 1PWXA 2WSBA 5KIAA 5L9AA 1GADO 5C7LO 2X9VA 3PXXA 2E6UX 5T57A 1ID1A 1GQYA 3PYLA 3GDFA 5F1OA 5LDGA 3F9IA 4RVHA 2C54A 3B20A 3ZCXA 3DMTA 5T8KC 1XQ6A 3DBRB 4A73A 1M2WA 2BFMA 1EQ2A 3HB5X 3JQ7A 4CMIA 1GL3A 4IIUA 1EDZA 4JROA 1KIFA 2GR9A 2BHLA 1BHSA 3GAFA 2I3AA 3H9GA 3MJSA 3ROMA 4A5OA 1YBVA 5B4VA 4GVLA 1E3WB 3C1TA 3H65A 5DDIP 1V6AA 1D1TA 3G49A 2PKRA 2HJRA 4OAQA 1K89A 4D3SA 3VPHA 5TS3A 3IS3A 3QHAA 4IDEA 5DP2A 5DOVA 1GEEA 3JQ9A 3ZW9A 1HYGA 3A14A 2NU7A 1HKUA 3WNQA 3UH1A 1GD1O 4J7CA 8ADHA 4NQZA 3ZWCA 1SNYA 4L4RA 1CIVA 5JY1A 2R6JA 2HMSA 1N9GA 1X7HA 3GN2A 3ICCA 3SJUA 1FF9A 1ENZA 2ZKLA 2Y99A 3TQHA 3UOGA 1P1HA 5ITWA 1EVZA 4FR5A 2VZ0A 4CLEA 4XCVA 1GCUA 1NPYA 5IZ4A 3GNQA 3U4CA 3W8EA 3ZN2A 4MVJH 1E7WA 1T2EA 4YTEA 1EZ4A 4DRYA 5J23A 4CQLB 1PGQA 3HQ4O 4GX0A 4GWGA 1MUUA 1E3WA 3PZBA 4CMCA 1NYTA 2HU2A 4J16A 1VI2A 2GN6A 1EQUA 3DHEA 1PJ3A 2QYSA 2X58A 4O6VA 1IY8A 1PL8A 1WPQA 4ESOA 1I30A 2BGLA 4E5KA 1YB4A 2X8LA 4YEDA 5C37A 4EZBA 5I8WA 4QFCA 4NJMB 3O03A 2EKPA 5ER6A 3SXPA 4BMNA 3DBRA 1Y7TA 1M76A 2EJWA 1CQIA 4MIYA 4BNKA 3VH3A 4E5NA 1KEWA 5CDTA 1QLJA 1NPDA 2X0NA 3RBZA 2W8ZA 4J7XA 3TNLA 1JAYA 3KXDA 3JQGB 5AVOA 5CG2A 2VRCA 1Y8QB 2I65A 1OFGA 1H6CA 2V6BA 2ZATA 3WFJA 3LZ6A 1N5DA 2CFCA 3F5QA 3DOJA 5HTOA 3GRPA 4DUPA 3PYXA 2FMUA 1U3UA 1EVJA 2O4UX 3KOUA 3H9QA 4BNVA 3U4HA 4ONEA 4BNIA 1R6DA 3UCEA 5IF3A 4LRSB 3U4IA 4YAIA 3GVHA 2IRWA 5KVVA 4XYEA 3PRJA 4PVCA 2PK3A 3ZWVA
chains in the Genus database with same CATH superfamily
1XTTA 4C76A 2V1UA 4JVSB 2AH5A 3IAM1 4OD0A 5JHHB 2PGJA 3G2HA 3DHVA 2X1VA 5C34B 1UMKA 2LCFA 4NZ9A 3W5SA 1BS2A 1NQXA 2HU7A 2XOKA 4Y6SA 2O8FA 1F7VA 1LSSA 1N2CE 3A7DA 5FQNA 2FQQA 1X1RA 1I3KA 2CFRA 2FPKA 2M9MA 2PFGA 4GGPA 2D74A 4R8KA 4EGCB 1H22A 1IK6A 1RLOA 1NUPA 1QZ3A 3K8OE 4U2KA 4OSEA 1UXHA 4GHWA 1OLUA 5BVHB 5JAOA 3UHFA 2XSZD 1E2BA 5T67A 2G9RA 3HUEA 1K8ZB 2V03A 1DLJA 3L6CA 4FZVA 4NZMA 4G0PA 5HQ3A 2OXIA 1IUPA 6CHYA 4DDVA 4L0CA 3U81A 4M8SA 1XROA 2P8JA 3IILA 3WGUA 2FKNA 3GD5A 3UH0A 1G5RA 3K9WA 4LOAA 5AOCA 4CG2A 4BX3A 2QI9F 3RE1A 4MYRA 2QD1A 3I0NA 5UKDA 5JTUA 1P29A 2HDNB 2WYWA 2YQ4A 3NGMA 4BKQA 2ZE6A 4ER0A 2PZAA 3JQDA 1IUOA 1ZI9A 3LQRA 4MW7A 4OQDA 1DOHA 1EX6A 2HWKA 2UAGA 1G63A 1ZM4A 1U3FA 2NU9A 2W6MA 3USZA 1P0MA 4EW1A 4S35A 5G0TA 3G2JA 3FUWA 1ULUA 2ETXA 1MXHA 2N9UA 2O59A 3EG5A 4PPGA 4YK7A 5ALWA 1JH9A 3HEBA 4NJMA 5JCJA 4KI0A 2QIPA 4YUAA 5DK4A 4BO5A 4KBFA 5ICGA 3MCTA 4CL0A 5FBVB 1G4HA 1NXOA 4MEJA 4V0RA 4EJSC 2CNKA 1XB2A 1QV9A 4AJIA 2QYHA 2YXPX 2DH6A 4JC4A 4KSYA 5LIRA 2JLCA 1JEJA 1J2YA 3CX8A 3DZHA 5BUSA 2IDZA 2W6NA 1ZVJA 1SKYE 1FJHA 2C7PA 2XMGA 3VTKA 5KX5A 3DV0A 2G9NA 1IIRA 2HL6A 1JPUA 1EA5A 4MRAA 4GICA 2O2CA 3EIEA 3TBKA 4YT8A 5B6PA 3FCYA 1QS0A 5BV2P 1M2NA 1I1HA 3BFKA 4X7PA 5D01A 1JLRA 4C0JA 3J81k 2N75A 1T91A 3FTDA 3PNPA 1TTQB 3F7NA 3LBIA 3NVAA 3FOAA 3OO0A 3RRFA 2I71A 1RE1A 1C3XA 3OP4A 3R5XA 5ALXA 3W9UA 4YR9A 2IJGX 2QXTA 3CJQA 1ZOOA 3L7NA 4P2GA 4MAMA 3W2TA 3FPEA 3K0CC 2F8LA 4OHBA 4ZU1X 3JWPA 2IY8A 3K0AB 4YLYA 1ZN7A 3S7ZA 4KAFA 1QHSA 2J3IA 3D2AA 3UXEA 3HL4A 4YR7A 4XPZA 3I4LA 1A9TA 2EBFX 4RLFA 1OIVA 2JAHA 4ER5A 4G5FA 1UAAA 2EIHA 1QGOA 4RADA 1L5RA 2Y2VA 1KNXA 1E7SA 2V0NA 3R2JA 3JZDA 4DT1B 1NVUQ 3SXUA 3OLXA 3L49A 4RJTA 1CSEE 4ZZ0A 3A1CA 3WIDA 4A23A 1M2OB 5FLKA 2O7VA 5IU6A 2VP6A 1QG0A 1WA5A 4IIXA 1TAUA 1KMCA 1OCEA 1GGMA 2W83A 1VLZA 2PX4A 1FXUA 3KXKA 1OBCA 3JSAA 1KFKB 5L4NA 1DC7A 1U0EA 2W2OA 1XLTA 4RFSA 3T0FA 4E03A 2J9GA 3V4FA 1T2CA 5EKSA 4C03A 2MDTA 2Y66A 3FGNA 3HBJA 1E1CA 2CYCA 1CUJA 2XCUA 4W8GA 1GZUA 3A6JA 4NF2A 3ZDYB 5BSGA 3NJ4A 3AU9A 3CV3A 1KYVA 2QMUA 1ECJA 2DBRA 1KL7A 1DINA 5TS2A 4CMEA 3LNCA 2BBTA 4ZCTA 1MB9A 1N33B 2Q5HA 1EFPA 1Z8HA 3A9WA 2PUEA 3SR4A 3F8WA 1GNPA 2V9PA 2ZRDA 3CLRD 1AA9A 3JQRA 1QCDA 1G3UA 4HB0A 1RWNA 4OYRA 4WUTA 3IALA 5IKOA 2J5QA 3GLIA 4WCFB 3COVA 2VRWA 3CG0A 2B6NA 3TQTA 2GD0A 5LQAA 4M0LA 1Y37A 4ZAWA 2PLRA 4RLHA 2WWRA 3CUUA 4HAIA 1E58A 3OECA 4TTRA 3V7NA 2P9EA 5I9LA 4A0RA 2F43B 4EPRA 5IJ0A 1K5PA 2BSAA 1QNFA 3VYVA 2YHIB 1XU4A 3VXKA 2HAEA 3BMNB 1FTNA 4QG3A 3ZWQA 1E9BA 4YCDA 3GLUA 2BGIA 1JWBB 4D6YA 5K4HA 2NNWB 3D3JA 1F60A 4RO0A 2DJIA 2ZGVA 4F5WA 4ENQA 5LM3A 1P60A 3C8UA 2QZJA 2NU6B 4KYTA 3AOGA 3H6HA 4YAFA 2FE4A 1MF7A 2B8JA 5I4CA 1PG2A 2YX1A 4IV0A 2IP1A 3MQFA 4G5XA 4QFBA 5CNKA 3F0TA 4COOA 1Z6PA 2G0AA 2IEIA 2PZMA 4MA0A 1IM2A 4Q21A 2Q8QA 4EVIA 3D8RA 2GFIA 2GXUA 3BE4A 3KOXA 4C43A 4U02A 1KY5A 3AL3A 4JR1A 2IXTA 4B8YA 1WXHA 4J75A 3RHZA 3W7AA 1VL5A 1ADGA 3EAFA 1J8QA 3QFFA 4MQEB 4NE2A 2O1EA 2OG1A 1QZUA 1QONA 1YDWA 1TB4A 4B1FA 3PIDA 1WD7A 1L7QA 1YI0A 3CTPA 4BV2A 1HORA 1X1TA 3E9ZA 3JV7A 3MJTA 1NBME 2JI8A 3EXHC 4OQ4A 3NYQA 3GDHA 3ESAA 2FHPA 1A8HA 1X74A 3QNWA 5CPBA 4QARA 5HJ5A 4LRYA 2IIVA 4I9NA 1KI6B 1WXGA 2NNLD 1U0NA 3N6VA 4H2DA 3KG2A 4B45A 1YKGA 4AX4A 4EFLA 3IFSA 4WOBA 1VGQA 3SIWA 1YZHA 2FW9A 4L3OA 3EZXA 4M21A 2R11A 5L7TA 4LRUA 2Q99A 1AGNA 1Q5PA 2RGEA 1OPXA 2WSYB 3FPFA 3MOIA 2ZUVA 3NIBA 1TYAE 1XSEA 2EDCA 1Z2PX 4DA8A 4DA4A 1Y5RA 1C3OA 3BN3A 3DE1X 5CT4A 1RXVA 3HCAA 3UJ9A 2NSHA 2BFNA 3NI2A 4OJNA 3EDCA 4GVXA 1YAJA 4M0EA 2B3DA 3RNOA 3V4RA 2BN4A 5EIWA 4B4UA 3JQAB 3BJRA 1AKEA 5FOXA 1ZR2A 2W6IA 1H8HA 5F5NA 3RSFA 5ED4A 2BMAA 3GWGA 1JU4A 4R9RA 5DF1A 2QTMA 1NQUA 2N0SA 4RAQA 4PYMA 2VTKA 2ZYGA 3I1FA 1K7SN 4GW3A 4JB8A 2CXUA 3O4FA 2IVFA 5TLSA 1K08A 1Y48E 5DHAA 4ZQIA 5SZHB 4JL5A 4DV3B 5CFQA 4LXGA 2YXLA 3KB6A 2EZ9A 2X0EA 4KR6A 3PDHA 1HURA 5KVSA 1IRXA 2IXFA 3K5HA 4JI4B 2BFCB 4HUQA 5DCYA 1R1DA 4FLFA 5KS2A 2MMGA 4IIYA 2IL1A 3I92A 4ZMSA 1MIOB 1GR1A 4LJ7A 1PT9A 2K7ZA 3H4MA 4I9UA 3RSGA 3D7NA 3B51X 2A9FA 1HLDA 1PHRA 3MG9A 4M7RA 4F3YA 3ENWA 2VQ6A 3K2IA 5KYXB 3CB4A 1FUKA 2WU8A 4L4ZA 4R1QA 1NULA 1S3IA 2ZTUA 4DSOA 2GKGA 2WZCA 4DMMA 3EMKA 2PYDA 1AN9A 4S0ZA 2ZVDA 2QLFA 3QLUA 1VLLA 4EVRA 1A9PA 2I2XB 4GP7A 4TZTA 4D8VA 4NAHA 1WMSA 4WNAA 5AESA 1TUEA 1L7OA 1OXMA 1UWKA 3ELUA 1P9NA 3K0HA 3R0VA 1PL0A 3HI4A 2IYAA 1VFPA 4JLBA 1GTSA 2X4DA 1FDIA 2WG1A 2Z57A 3IULA 3ND6A 1M8PA 2IDKA 1YCFA 1HO3A 1NSYA 1P1CA 3BFJA 1JYEA 2QUHA 4PQFA 2XE6A 3MTJA 1QH8A 1JR3E 1BJKA 4TRNA 2IEYA 3EZ2A 4UZFA 1GZHB 2FEXA 2EF1A 5CB4B 3VTAA 1V8DA 1FLAA 5DTMA 1JNXX 3JD3A 4MHTA 4K9QA 1FLNA 3A9TA 4G1CA 3WE7A 1D1PA 1EB8A 3AIOA 3CVUA 1EWVA 2YJ6A 2FFHA 1G21B 2LCQA 1VG1A 1T29A 4YCCA 4QUBA 4TM7A 4HC4A 5KZMB 3G85A 2JAUA 3P2IA 3KJEA 5CT9A 3ACCA 4ZICA 3C6XA 4GZ3A 2I3DA 4JLDA 2HBYA 4EB6A 4F85A 4RZ3A 2C20A 2FUKA 2XB6A 5IABA 4XB2A 1F17A 1J90A 1FUUA 1TECE 2Q46A 2WPDA 3IOYA 3KJFA 3SZ3A 4PNEA 1KEPA 3OCWA 1SIWA 4ZAGA 1BRTA 1NKVA 3SC2A 3FIUA 2PZ8A 4O4HF 4FGLA 5ADHA 4M8NE 3GPIA 1BQEA 1GGNA 2P8SA 3SDSA 4D0GA 4XRRA 1CY7A 1VYTA 3BD8A 3I3OA 1G66A 3VRHA 4C20A 1ZJZA 3C48A 1WUIS 1HYQA 4Z86A 5HIIA 1ZX1A 1PZGA 2WFLA 4JHLA 2BSQA 4EOGA 2KPOA 4Q47A 4BFCA 1YMUA 4OI4A 3ASYA 1I4DD 3RKRA 1P7CA 1I01A 1BE8A 4REOA 1YASA 2DPXA 2F8SA 3C15C 1M2GA 2R7AA 3RBAA 1SD1A 1C5KA 2VK2A 3M6VA 3G8DA 1B76A 2DUWA 1YQGA 3DYBA 2BZ0A 4ITRC 4QTUB 5F2KA 5KCMA 4PRZA 1E92A 4F91B 4RPCA 2JB9A 3M33A 3MSCA 5M04A 4LFBB 4PXAA 3FLAA 2C58A 2BY4A 4B83A 2QGFA 1RJGA 4J4HA 1L7BA 1DCFA 4G1EB 3GDGA 1SAYA 3D8UA 4MVXA 2PA0A 4JU8A 2ZW9A 5JWOA 1ZD8A 5FYQA 1JDBB 1V4VA 3C7KA 3EBPA 1J0AA 4ZCLA 3VU9B 3PJFA 2ATIA 2R85A 3HO6A 1QAMA 3OE4A 1PR4A 2FW8A 4PZZA 4WK0B 5EIAA 4CM3A 2X1MA 3IA7A 3LPAA 3OTWA 4W5QA 1XJQA 1SCIA 4TLBA 3L8YA 2FWBA 2WDPA 3G5AA 4UU7A 3TLEA 4TV9F 5I51A 3WLKX 2CXSA 3AF2A 4UUQA 3D0KA 1L4KA 1LSUA 2PAAA 1CR0A 1H65A 1OVMA 1K7EB 2P1DA 4KLNA 4YBRA 4ECAA 1YQUA 4Y6QA 3TZ6A 4CN9A 3OETA 1VJRA 3D7LA 3K0CA 2A5DA 1Q44A 1WF6A 2YNMD 4OMDA 3AL0C 1WXWA 2NTVA 3AP3A 5TQVA 4G3XA 2OCLA 2AE2A 2BR3A 4ZVSA 4CMAA 3IMKA 1M33A 5CLQA 3Q2KA 3SBXA 3T7IA 5AUPB 2Q3LA 4MRVA 4UOEA 2X1LA 3FKQA 1TK2A 5YASA 3A06A 5DM4A 3EDQA 1OU0A 3CIOA 4K8RB 2RHTA 1EM8B 4GM0A 4I4TA 4KOAA 2E4AA 4UHKA 1JPVA 1PTJA 2RSLA 3GJ0A 4IOLA 1DC4A 2FMFA 2JI6A 2Y1XA 5DX1A 3TSOA 4C6TB 3WGZA 4IQ4A 3AF6A 1I4LD 3O7WA 4YMLA 2B34A 1U65A 1DJQA 3CG4A 3GRYA 1AQIA 1RXUA 4I19A 1RAGA 3MWFA 4IDDA 3A25A 5BYAA 3AONB 4J7UA 4LJ9A 3KAPA 3ANXA 2H7VA 3PDWA 2CW5A 2FPIA 4PS0A 1S2DA 3HZOA 5ILGA 3RCBA 4D80A 1XTBA 1NW7A 3C0KA 3ZWBA 4IRUB 3AUTA 3MOGA 4EW3A 2W2LA 4EMUA 5D86A 1QK3A 1GTVA 4MA4A 4QX6A 1M1NB 5K5EA 1YC5A 1NM5C 1NZFA 2PS9A 1ABEA 2DT5A 2PPVA 1QQAA 1RWWA 2REQB 4GX2A 3R6DA 4IIJF 2D1QA 5B1HA 5DEOA 4B33A 1XXLA 3DAFA 1VYVA 4KPEC 3ZX5A 4B34A 3NTUA 1P5JA 3LO5A 1EE2A 1ZJYA 4BNJA 3FOEC 4MV6A 1E3JA 2WWWA 5C8YF 5IXYA 3TOZA 2P27A 3A1WA 4G01B 2FX2A 3B9RA 1RYZA 2GEVA 3PFIA 4KQ6A 4XRGA 2Y76A 3BL8A 1JR3D 4MPPA 2VAVA 5CDYA 3JWIA 2I1LA 3FJ1A 2XXAA 4HDAA 4LMPA 2GEUA 5ALGA 5H02A 3W3AA 3W2GA 3L1UA 4C7BA 2FPPA 1W36D 2ZE8A 1IHDA 2WYVA 5EZYA 3A3KA 4PNZA 1OZGA 2L19A 1JSCA 1O6ZA 2FYTA 2PUHA 1WMAA 3R4VA 1QR2A 4B7XA 4EFNA 4CQNA 2WHPA 3GT0A 3V4OA 4FYYA 3HWSA 3EDRA 1NVKA 3T1QA 1NUQA 2ON6A 4GNRA 3KSBC 5DTJA 2NUBA 4KQ9A 4JBNA 1YR8A 2ZS9A 2QM0A 4LBVA 5EEGA 5SYMA 1EE9A 1E9VA 1XCPA 1XYVA 1YS4A 5A6SA 1P31A 3DJFA 3DZBA 2XB4A 4MHOA 2XCOA 4J0HA 1RZRA 3C3MA 1WLYA 2VPPA 3AHHA 3B9BA 1T5LA 2Y1GA 4DV7B 4R01A 1LJ8A 4K3UA 1A9SA 1F06A 1Q6ZA 4Q3KA 4YRJA 1YZNA 3OTGA 4P2BA 4RUKA 5K6AC 1XYYA 4I8DA 1BH6A 3PXGA 1YXMA 2JGKA 2IYPA 3IEUA 2QT1A 3D81A 4LI3X 3TYXA 5GINE 3PC8C 1FPQA 1RC0A 1TKAA 2AFVA 3DE2X 4MRPA 2FQ1A 3WKCA 1PZEA 2G04A 3WGYA 3KCNA 4V2UA 4MUBA 4C22A 3NTOA 5H82A 1D2GA 2FK7A 2WF8A 1L7VC 1V37A 2NVBA 1RWBA 5IG2A 2I4RA 3TK1A 4V1CI 3RS2A 4XA8A 1K3TA 3DKRA 1MOPA 4DPMA 3INNA 4P7BA 4RANA 3S2IA 2DY1A 3EA4A 4Y1EA 2HLDA 2AD1A 1ZH4A 2VJCA 3LTEA 5JPIA 4H3KB 5A0VA 1FYVA 2RK3A 1IZ8A 5DEIA 2IXGA 3HJNA 4O4JF 4LHVA 4D0NA 4DMFA 3THYB 5JBNA 1FRZA 3TVDA 4ZRDA 1JWLA 1GDDA 3OICA 4YRNA 4Z54A 2J9FA 4JLAA 2GWHA 2CNDA 2GCEA 2I7VA 1W34A 4BQRA 3LBNA 4RM3A 4QRDA 3FG9A 5LBTA 1XBTA 4E32A 1ND5A 5HKKA 1IB0A 4I8XA 2I2FA 4BJ1A 3AU8A 4MR7A 4MWCA 2WNHA 4JLOA 5LQUA 5AMXA 2JIMA 1SK8A 2Q1XA 5C5EA 4PEVA 1IN5A 2L17A 1JLKA 4OQZA 3KRTA 4PPYA 5FI0B 4ZEWA 1E8MA 1SXJE 4GMXA 2C9DA 3JQPA 3PSHA 4BV3A 4D3ZA 5B36A 3UAVA 3QPVA 1WKBA 4QUHA 4GC5A 1ONPA 4WY2A 4NZYA 4BMOB 2RBKA 1T8SA 4B3DA 3EMDA 4HWPA 4WZ6A 4ZA2A 3QI7A 2SHKA 3K5WA 4K9OA 4LDAA 2MR6A 4EUEA 4PPQA 4XD7D 4F4HA 4QLOA 3V42A 1V11B 3N28A 3VX4A 4BKUA 3MMSA 2H16A 1DV2A 3BXOA 4DR4B 5HZHA 2H9AA 4DQXA 1K8XB 5LP6C 3PJDA 1UBSB 2AWOA 1KERA 2SECE 4I1YA 3WNBA 4DBZA 1RWOA 4FB4A 1QO0D 1IZZA 2ZUEA 3I28A 4L08A 4Z0NA 5GGYA 4LXUA 2YCBA 3T5MA 4R40A 3PA8A 1O54A 3TTWA 4GC9A 3F78A 2FZ4A 5FPKA 1NOJA 1FDRA 4NCNA 2JJ8A 5KYXA 4UBIA 4MJ7A 2A4MA 4DLYA 5LFAA 5DNYB 2VK4A 1SIOA 2PLNA 4HN2A 4R51A 5FUBA 2VJKA 1GZDA 3E22B 2NZWA 2QD3A 3F73A 3OTOB 3CLUD 2J3LA 1P7PA 1WXEA 2OBMA 3U3RA 2B4RO 4ZOEA 4DEVA 1MO2A 4O4IB 4B3CA 3MB8A 3VGJA 1JKJA 3P4XA 2PUAA 3QBTA 1T5OA 4O02B 3FZEA 4IS2A 4HK4A 2WWTA 2PRJA 4TSFD 3RS3A 3EZ7A 3QW2A 1I2MA 2ZYVX 5TX7A 4WZBA 3IAFA 2H1SA 1A0OA 1J06A 3BF8A 4IICA 1CUAA 2OV2A 4COKA 2G77B 4ZHSA 4KU4A 1OBOA 4Y2TA 4KFTA 2DPGA 2AUMA 1GU1A 1QE0A 4K9NA 4E5VA 3CBGA 2FX3A 2PZFA 4RVSA 2QB5A 1NJ6A 3OE7D 4ZRNA 2GZRA 4NDNE 4TZ6A 3EE6A 1T24A 2E2WA 1M6YA 2QVGA 2V7QD 1VC2A 1VXRA 1GTJ1 2SCUA 3B3FA 3OT1A 3VPCA 4OJMX 5KTPA 1EGHA 1LW6E 3DXFA 1U1CA 4JI6B 2YMMA 4O2AA 4BLPA 4NL4H 4BO9A 5EJ5A 3EIUA 1J33A 3Q7PA 3R74A 4G24A 4O2AB 1IOZA 1TF7A 1AKTA 3GEHA 1NYRA 3MINB 4A2QA 1ZD4A 2CXHA 3R4CA 4S3MA 4F7WA 3C14C 4UCQA 3ESYA 2C78A 3HCBA 5TRTA 3OFNA 1PR1A 3K9FC 4AUEA 1NW3A 4HX5A 3H6GA 2B1QA 4KR9A 4B4VA 4OK3A 2CVHA 1H94A 3A6LA 3PYMA 5AIAA 4O63O 2HADA 3HPRA 1RXYA 2OQRA 2XVAA 2DUUA 3B9QA 3E4CA 1QYVA 1G42A 3F8TA 5I5GA 3TS1A 3EHDA 1Y3IA 2ZJ5A 2R2AA 3KR9A 1COWA 2YFQA 3TLBA 4IJUA 4CBVA 1Z5UA 3I45A 3GGSA 1TD1A 2A0YA 3D6VA 4CT4B 4EF5A 5TF0A 2H2WA 1GQRA 3EGCA 3NFRA 3SOPA 3GELA 2H4JA 2GBGA 2Z5GA 1S0UA 1FP2A 2XWQA 4LNAA 5IEBA 5IKPA 1HDOA 4O4LA 5DI9A 2CL7X 1MT0A 3HNRA 3HWWA 2VKTA 4QFMA 2B7CA 5L95A 1DRKA 3ZK9A 4KHPB 4MW9A 2O8FB 4C78A 2ZT8A 1ZNWA 3A0UA 1CRWG 3EEBA 1NQAO 2ROQA 3V4PB 1IN1A 3NRBA 4E21A 1KI7A 1DS6A 4AJEA 2QMEA 3MIIA 2ZUWA 4ETIA 3GLFB 4RY9A 4ZI2A 2BGGA 1VSBA 1Y7PA 3OH8A 2IELA 2PMDA 4M1OA 3CRMA 1KVQA 3D4PA 3R77A 2QM7A 2JCYA 4RVUA 3K8QA 2PKWA 1GDTA 1BHO1 2PZBA 3HGMA 4HVAA 4PNHA 4TQ9A 4K6CA 4URUR 4ZDWA 1S2MA 2BOVA 2ODEA 2VNHA 2DWOA 2HCFA 3QPWA 3TJRA 4MV8A 5ICFA 3AEKA 4TYQA 4GH5A 4OSOA 2R66A 2COUA 2VS1A 1VDZA 2MSDB 2VP9A 3CVWA 4IEIA 3DDZX 1EIWA 1SC4A 4NZOA 1FRFS 5FYDA 2PYZA 1S3FA 1Q92A 4U7HA 1NOKA 3L02A 3PEFA 1K98A 1SMKA 4LZPA 1RVDA 1G8HA 5HE8A 4ITVA 1ZHOA 2Z09A 1VLQA 4LGCA 1D4ZA 3CO0S 3UANA 1ZGCA 4RESA 1KIMA 3LWBA 3NU1A 5M29A 4FHEA 4IDAA 4UHCA 3MD9A 4MQ5A 5H70A 3SNKA 3FNFA 1O96B 5I7AA 5LQSA 4GYWA 2V74B 4YRTA 4FMPA 3UWSA 2M1ZA 3GUZA 3LSTA 3RC1A 1A50B 1Q1AA 3A9UA 2XMZA 3ZV6A 1TVEA 1W75A 4AQDA 1MZPA 3KV3O 1ECBA 1H0KA 1NVFA 4NFSA 4EYSA 3AEKB 1VMIA 2I4TA 3M4XA 1V3UA 2VF2A 4IDFA 4DT1A 2R6GA 3A2LA 3RUAA 5F5XA 2IW1A 5HMLA 1PQPA 1LWNA 1TCBA 2A9VA 1UEIA 2O20A 3MPUA 4G4SO 1Z07A 2JHPA 3IQDB 4I2VA 4LSWA 4N5NA 4OJYA 4WQMA 3ZY4A 1LDMA 4CQLA 1QRTA 2YZGA 1M5UA 4BEWA 3MCAA 3H04A 2IKQA 4QTTB 4CR6A 5GJBA 2OHXA 3CLKA 1TM1E 3LFTA 4ER6A 5MDHA 2H9YA 3A4VA 1KVSA 3GR6A 5C8DA 5LYJB 3DOHA 1GCAA 1ESCA 4J8PA 5AXBA 1QWSA 3IQFA 3SFTA 3ZWAA 2WP0A 1H4VB 2QRZA 4IV5A 2V7XA 1UAGA 3BWVA 3M34A 5CK5A 5AVUA 4K9PA 2PUBA 2YKGA 3QUAA 3E5RA 4HWKA 5DHTA 3WMXA 1MAVA 2GVNA 1G1MA 2JGMA 1MR3F 3H1EA 5TGTA 5K8IA 1NVWQ 2XD9A 2ZLBA 3I0ZA 3D0RA 4TMZA 4XPIB 4YCAA 5GOZA 3V6LA 2K7FA 1PJRA 4FE3A 1KVRA 2ZI3A 1I2CA 3L1KA 3WC4A 3TI9A 3DZGA 1RLJA 2FN4A 3GAZA 4QIHA 1TO1E 2O2YA 4BAZA 3WQBA 2N1BA 5E2BA 4BQEA 2OZVA 1Z35A 2HYIC 4OYHA 1M1YA 2R6HA 2BJHA 2IEDA 3BDAA 2E1PA 3GRVA 3BERA 4EGQA 4P8RA 1MBZA 4M88A 1QKKA 1WPGA 4AMGA 2VRBA 2YY6A 4N6OA 1RWXA 3OKAA 4JKOA 3TRKA 1SCAA 3V7YA 3BGWA 2Z5LA 1BFDA 3BHJA 1N34B 1L9KA 5IMBA 4EKGA 2X7JA 5D87A 2RHGB 1ORVA 1W5FA 5LPNA 1GXSB 3G9XA 1MLDA 5K20A 5IN5A 3FNGA 4KXXA 4LXXA 3R40A 4MRSA 2AOTA 3CWZA 3FWHA 2O2SA 3NYIA 1BVUA 2WHEA 4XYGA 2OBXA 2REQA 4U2CA 1IN6A 2GBIA 2QP3A 1YVEI 5FUMA 2CSUA 1Q0PA 3AZOA 1T26A 3PWTA 4HMPA 4RVDA 1XKQA 1L6RA 5KWSA 2QMQA 1JLHA 4G89A 4PAQA 4HVCA 5CDUA 2RFLA 2WC1A 4WNCA 3T9BA 3FDZB 9ABPA 1NJFA 3CLSC 3H1BA 3N0XA 3QLJA 1JZTA 3OOHA 2EEPA 1CUHA 3V7WA 3RFCA 3VR4A 2WU3A 2QXUA 1ZPDA 4QHYA 4W6ZA 2M6KA 1FU7A 5G1PA 2WIGA 1UADA 4F6CA 5KVAA 3QNMA 3U7JA 4CDMA 1B14A 4OQMA 3FPBA 4Y9DA 5IXJA 1EDEA 2BM1A 4DLNA 4V0ME 1IE3A 3O95A 3O2JA 3EEOA 1JKJB 1C4XA 5SV2A 1PJCA 5J2TF 1ZOLA 5C8VA 4C6TA 3NKVA 5E7IA 2H7CA 1U4SA 4AP9A 4JYAB 3JD4A 4B6PA 4UC0A 4WN9A 3SKYA 4GPTA 4BJ6A 5EHXA 1XAJA 4M22A 2IYRA 8MHTA 2J45A 4B43A 4XSGA 1MX9A 3FMVA 4H7IA 3VR5D 4EAAA 2BE7A 3ZGZA 3R0ZA 2KX7A 4LXTA 4YAUA 4WWHA 3WJAA 1EE1A 1DKQA 3QV1A 3VO9A 4F1WA 3ZDBA 2HA6A 2OMEA 2LP4Y 4UQLA 1WS6A 4LZJA 3NV9A 3S81A 2AC2A 4MVJI 3NVKI 2I2WA 3KQMA 2HA7A 3DLTA 3NVDA 1X7ZB 3JQFA 2Z1DA 3PSAA 2LR0A 1EFUA 4NOJA 4BNUA 2NT3A 2PKEA 3A1SA 3MD0A 1Z9BA 2C5EA 4WIAA 4DL9A 3IT3A 4FNMA 2G7ZA 1OZAA 2Q29A 1VKZA 2X41A 3ROTA 4DARA 4FFBA 1MOZA 3EC7A 4D9BA 3JWHA 4MDEA 4LC0A 4QYSA 2CBGA 3DF7A 1T36B 5AJYA 1A8SA 1LNQA 3QU5A 4IMJB 2XOEA 3RUPA 3VU9A 1MX5A 4R6XA 1IAVA 4HEA1 3ZCVA 1EFDN 1DIHA 3G88A 3RU2A 2C4WA 4RSGA 1QP8A 1UINA 1GCIA 2QZ9A 1V3TA 3GA5A 4ZAVA 5JBIA 3LLSA 4EK9A 5DK6A 3AOEA 1ZSYA 1G6Q1 3EBOA 1QIDA 4M0KA 4MVJE 4MKRA 3HJFA 3F98A 2P2YA 2VNIA 3S8EA 1SC6A 3EIHA 1AD2A 1U7UA 2J7KA 4YC7A 3LC7O 2VPQA 3NM6B 3AEUB 3F6RA 1O94C 1NL3A 3QX8A 4QICA 2W4MA 3WV4A 3VR2A 1HT2E 1XD8A 2X0IA 3FXAA 4DQ0A 5HIKA 2H5JA 1B8VA 1JNYA 5KNCA 3S29A 1KEEA 4LOIA 1S2NA 2Z2KA 4TTQA 4IXDA 4XI9A 3ZXSA 4E5PA 4ZEMA 2WFLB 2H48A 4MMYB 3NBZC 3LQ4A 3ORSA 4ZV9A 4B6QA 4UU0A 4CIAA 4NXNB 3MBOA 1DBVO 1F4LA 1XZKA 2G1KA 2GCPA 3MJEA 2FI1A 2O2HA 3PFHA 4MSUA 5TC4A 3W8DA 1RQ2A 4YFYA 1GO2A 1YZVA 4H1TA 4YT2A 1AUPA 1NLFA 1O77A 2ZSAA 3LIIA 1SQ5A 3FR7A 1A5BB 1U4OA 2PGAA 1IFXA 3N70A 1JR2A 1N0VC 1PD1A 2RC6A 4J91A 4RYDA 3AEUA 4C01A 3MWDB 4X60A 4X92A 1QGUA 4F3TA 4DC0A 1US8B 1JGTA 1FVHA 3IRUA 4FFRA 4LHYA 3I30X 4A8JB 4ZHQF 1AU9A 3G1UA 2B82A 3LWZA 3TEMA 3WLQA 1AUQA 2DPLA 1LX7A 3HZZA 3KKQA 3OG9A 3W6NA 3BCUA 4D4IA 3R7SA 3KZNA 5A4DA 5E2IA 2R87A 1CJVC 2J3DA 3C7DB 3ZZNA 4W5RA 3P2YA 4I55B 4EECA 5DSXA 621PA 5EUCA 2IPXA 4JI0B 1DBQA 4QDZA 4M9CA 1E1MA 3QEKA 4FEGA 5EQJB 4BZWA 3CY6A 3X2SA 1OC2A 4DSAA 4Y7DA 3IKMB 4R83A 3HMQA 3L07A 3USES 3QOXA 3MWEB 2HA3A 2JFQA 2FPPB 5KAPA 3FCAA 4X24A 3FB4A 3X3HA 2PUGA 3W05A 2QJWA 1B1CA 1PEDA 1RQLA 1F2VA 3OEEA 3OWXA 5ENVA 1DIRA 4CMIB 3ICPA 3L4KA 2BEWA 1AOXA 2ZG6A 3LBAA 3Q9UA 4QGHA 4TMYA 1XKXA 2W93A 4TXNA 1JRLA 1MG5A 3WLIA 4AW9A 1ONSA 3ZHTA 3PTZA 2H1FA 4RHFA 1K6MA 2WJZB 3I1YA 5LA6A 1VHWA 1KE1A 4Q3NA 3EIXA 4TSKA 4RELA 3LGSA 4DBVO 2FGKA 3VISA 1AURA 5JARA 1K1EA 4OK6A 1YZQA 3WMFA 1I7PA 4TL7A 4B4KA 1O03A 3AYXB 3HR4A 4G26A 3UO8B 4Z1OA 4EJ2A 2QNBA 4PIPA 4G9EA 1CJTC 1KQ3A 3WWEA 3HXPA 3MMXA 4BEBA 1T3GA 3KHUA 2FPIB 4KDFA 5KQLA 2Q28A 2R9VA 4QPCA 5LOVB 3LRPA 4BNYA 4K0RA 2QL5A 4DIKA 1UBTS 4B6JA 4V02A 3D5EA 3T6KA 4BU1A 2XB2A 4UE2A 3OBBA 4XD2A 3KZKA 1G21E 1OA1A 2ZJ7A 3IL2A 2JGIA 3N2GA 4LPKA 5LJIA 2HHCA 4MV9A 1Z16A 2RGNC 2E85A 1L5QA 2WF7A 4B2LA 1OX5A 2IUYA 2QD4A 4ASUD 3TG8A 4QM7A 2QTLA 1ZVMA 3K0FB 4R7TA 3SAJA 5LYJF 4GUAA 1FQOA 1WEHA 1JR3A 2FQWA 1L1QA 2PO7A 2QJRA 2VA8A 4JYZA 2NP6A 1E6WA 4RPIA 5DRTA 3BXEA 3M1AA 5IAKA 3G2KA 3W2IA 3IUSA 2C3OA 2VF4X 3WL5A 1G5TA 4AFNA 1ES9A 1F0PA 3QENA 5HILA 3FAKA 2XUAA 2BFPA 3T54A 1AKYA 1LTKA 1P4AA 1EVQA 3HKEA 5ALZA 4C9BA 2H9IA 3ODPA 2BJWA 3P9IA 5ILQA 2AF3C 3I3SR 4RNDB 2Z4RA 4QTYA 1U9JA 3OJLA 1F0KA 2G0NA 2A57A 2ARKA 3A6HA 4BTEA 4G0WA 3PS9A 4BX9A 3S68A 4HYYA 4IGEA 2JHFA 3K9BA 4TLDA 3TR5A 3UAOA 2GN4A 4L27A 5ADUS 1EVLA 1LDYA 4BOYA 4L2IB 4YONB 3PXAA 5BURA 5F76A 1JIVA 4FB5A 3FB1A 1KZ4A 1SHLA 2GZSA 3FTEA 2YZ7A 1OWOA 2JZNA 4LZOA 5T7BA 4LYJA 3VDXA 2JFFA 1D7AA 1UANA 2R6AA 3IXQA 3MTAA 4IKEA 1BW9B 3U3DA 5A3QA 3NOOA 4RTNA 4XPIA 5DZSA 2R7MA 1YHZA 2ZIXA 3HL0A 1RAEA 4MEBA 1XLVA 4UUNA 1VOTA 2OGWA 1AKUA 3AJRA 1NKSA 2VWPA 1P19A 5KPJA 4HYQA 2W4QA 1DFHA 1GAJA 3UJ6A 5KWVA 3NBQA 4OI1A 3CRZA 4POOA 2NU6A 4PYOA 2JK0A 1GRVA 3CW2A 3A58B 1BDJA 3GUYA 3G8BA 1X77A 2QWXA 1EFCA 3S99A 4ILEA 4K40A 5E2AA 1GAQA 3KM0A 3T9DA 4N54A 1RKQA 4FS3A 1LNSA 3C3JA 4MI9A 4FYKA 1AKRA 3CZCA 3PHCA 3W2FA 3R9XA 1LC0A 3MTIA 1T4DA 3M6IA 4X41A 4OJKA 4W4TA 5H9VA 2C07A 4MLPA 4YAOA 3D3EA 4NAVA 1HDCA 3E4DA 5BXQC 5AW8A 1EWKA 3E5MA 4XOUA 3D6TB 4M1WA 3EXFA 3VHXB 1YJBA 5KNCH 1JMKC 4P53A 4KB5A 3L1VA 2ZSHA 1CQZA 3E8SA 3OSUA 3R3SA 4MWDA 4Y9UA 4HUJA 5P21A 3S55A 4E6EA 4EB6B 4TXHA 3RYCB 2G06A 3W34A 3LDFA 2QLLA 6NULA 4B84A 5I3CA 4B3TB 4XD7A 2J48A 3O73A 5EWJB 5H4HA 4JEMA 3PA6A 1KIAA 2ALJA 1O8CA 1ST3A 2PUCA 1I4WA 4NU8X 3LLMA 4Z9XA 4RSHA 5K9ZA 1QSGA 4HXYA 1Z8FA 3GX1A 5JSZB 1F8FA 2LDBA 2GM5A 2HMAA 4IZIA 2OVFA 4B87A 4AMBA 4OTZA 1JXQA 1QMGA 2QIOA 4KWIA 3NDJA 3F47A 1WBDA 1TU4A 3DEZA 4WGFA 4FX2A 5A4MS 3KKNA 1R3UA 3ZIAD 2AR7A 3OA2A 1ZH2A 1VB3A 3KVRA 1U1IA 1NATA 4GGMX 2V5AA 3R44A 5C53B 1G7TA 4E5SA 4HTFA 3RVLA 2JJ1D 3L7OA 4EVSA 5FI1B 3I04A 2PMFA 2PMKA 4MV7A 4RF3A 4F97A 4Z7QB 4RKFA 2J3KA 2ZJFA 1MX1A 4FK8A 4EBFA 3KWLA 2W2KA 3OZAA 4Q6WA 1OYOA 5K0JA 4IDBA 1L4MA 2ZZMA 3A6GA 1DE0A 2FVXA 5ER9A 4BRUA 2DFTA 4UHEA 4FBGA 4TN1A 3JZFA 3I62A 3I37X 3ONVA 1C7IA 3EVGA 3I2GA 5TPWA 5FWYA 1SUIA 2C2XA 1RBYA 2XYHA 3PZRA 3BWBA 3L7MA 4OFBA 5LCXA 3GLIE 1AQ6A 3EZ6A 4NHOA 3UHAA 1ZZEA 4BNHA 3ANNA 2EL9A 2BCEA 1VA4A 2CZQA 1IQPA 3WB2A 4EY6A 1Z45A 4Q7MB 4NV1A 1UKYA 4DEYA 4GM1A 2BFCA 1QG6A 4Y2HA 5TQ0B 3ZBTA 3FZQA 1G8FA 4XJSA 5JADA 5IRCD 2WFZA 4W63A 3PUVA 1HEUA 1VGRA 3LX5A 2O05A 4LPSA 4MV5A 4PICA 2FOXA 2QMHA 5SY4A 1Z74A 1ZU5A 2YBDA 4ZC1A 2WWVD 1OAOA 1W2HA 3O84A 3PWKA 3WKEA 4F11A 4HN4B 4MYUA 5K2OA 4ZEVA 3NPMA 4XJVA 3OO1A 3LQYA 4OIMA 1UFKA 2Z58A 4TMVA 3OPMA 2W90A 2IYZA 2WF9A 4XDHA 1DX4A 2Y67A 1EHCA 3DEFA 5BVGB 1XZEA 2KI5A 1DG1G 2KBFA 3O6VA 1DAHA 1I8TA 1L8OA 3I6BA 2NT4A 4JLWA 4LY0A 2HA0A 4P54A 4URFA 5E4FA 4Y2GA 3G13A 3GZNB 3LWNA 4M9RA 4RKWA 4JXZA 3ZQKA 1CUBA 3MINA 3DXXA 3NCTA 4D6XA 3I6IA 1ZYUA 1CVIA 2W2QA 3C87A 4Z49A 3VKGA 2ZBEA 4ZVMA 1NXXA 3D5TA 3HB4X 5GAJA 4GBGA 5TARA 1W7AA 1SU7A 3V55A 4JITA 4BPBA 5IJWA 3CS3A 2ZIVB 1NV8A 2VNSA 3L0CA 3QPUA 4CI9A 2YTZA 1Z82A 4WCVA 5EFZA 2CDRA 4LE0A 3UT5B 1V5IA 2NTJA 1L5LA 1ZUNB 1YH3A 2PH5A 2Y0CA 2JGJA 3C6ZA 4L7VA 5C8XA 5AK6A 3P2JA 1XMJA 5FEMA 4C4XA 1H4QA 3L06A 1T6NA 2C7BA 4G1VA 5KQRA 2IOHA 3TRDA 1ZD9A 3QU7A 1QE3A 2I3GA 5JCOA 1B23P 3HKDA 1R4AA 3TOXA 3TR0A 1FSPA 3DO6A 3HYRA 1TEZA 5HQ3B 3QVSA 3KUXA 1PTKA 4AZTA 2P4UA 3HRIA 2YV2A 4O29A 4GU5A 9LDBA 5D3MA 3WAJA 5DO9A 3GT7A 1BC5A 2WWIA 2WY2D 2FR1A 3QFHA 2DLNA 2PKCA 1QGYA 3R3WA 3H9UA 3R6WA 4HQRA 3T4UA 3WLRA 4QJIA 3SJZA 8ATCA 3OCYA 3UWKA 2VXOA 1A98A 4RVCA 2XYPA 3W7BA 3QGMA 2EBWA 3IUPA 4DA9A 2JK1A 4FYIA 2Y71A 2FW0A 3R20A 1H2WA 3FCEA 4EB8A 4XEUA 4CTMA 2WBLC 1FB5A 1GSHA 4M9XA 4OGGA 1TRHA 4DCSA 1BFUA 1IWBB 5KSZA 1L1RA 2C0PA 4GBED 4L85A 4V2IA 1BQ3A 1BRMA 1W29A 2UUOA 3BQNB 1YZLA 5AI9A 1T4BA 4GKAA 3HVKA 1SVWA 1UT5A 2AN9A 1J99A 1KQOA 2IUTA 2Y1CA 2YHIA 3PVSA 4L3WA 1IBCA 1LDBA 2YVLA 2AMYA 3JX9A 2CJPA 4JAVC 3EX7C 1VIVA 1LK5A 5JZOA