4ZKAA

High resolution crystal structure of fox1 rrm
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
83
structure length
83
Chain Sequence
ENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA binding protein fox-1 homolog 1
publication title High Resolution Crystal Structure of Fox1 RRM
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 20
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zkaA01
1Q82T 1URNA 2N3OA 3RW6A 2M9KA 2UP1A 1M5PC 2DGXA 1R8HA 2MQMA 5CYJA 3VAKA 4P6QA 2Q79A 3Q2TC 2RQCA 3UD3P 1R8PA 2HGMA 1SJFA 1N8RT 3CC4S 1X4AA 2XS2A 4BS2A 1WHVA 4QPTA 2LA4A 3SXLA 2GO9A 2FY1A 1FJCA 1KOOA 2MKHA 2RU3A 2KVIA 2MZ1A 1BY9A 3CPWR 1RK8A 5IM0B 1U1LA 2LKZA 2JVRA 1X0FA 2FC8A 4FXWA 3SDEA 5D78A 1UP1A 2M88A 3CXCR 2DGUA 4C7QA 3S8SA 2YWKA 1YI2S 1VQ8S 4LMZA 3S6EA 1OWXA 4Y0FA 3FEXB 2OIHA 2AYMA 2KHCA 1WHXA 2AYBA 5CA5A 1M5OC 1JJHA 2KM8B 1DHMA 3BO3A 2PEHA 3MD1A 3VALA 5LJ5Y 4V19X 1JJ2R 1N54B 2DH9A 4CIOA 3SMZA 2DIUA 2LMIA 4C0OC 3EX7B 3THTA 2MGZB 1U1OA 5LSLA 2LXIA 2MQLA 1ZZNA 1DZ5A 1OO0B 2HGLA 3CMES 1WI8A 2E5IA 2O3DA 3DXBA 2MY7A 1NO8A 4CH0S 2OSQA 3THPA 4PRFA 2J76E 1YITS 5FJ4A 4UY8T 5IM0A 2KXHA 1FHTA 3VAGA 1YWXA 2M2BA 4F26A 3PIPQ 1SXLA 2JVOA 2EK1A 1N52B 1A7GE 1YJNS 1H2TZ 4C4WA 4WF9Q 2LYVA 2DHGA 4J5OA 1YJ9S 3HHNB 3MXHP 1X4FA 2N3LA 2CQDA 2FC9A 4QU6A 1HL6A 2DNRA 5ITHA 1VQ4S 4TU7A 1Q7YT 1WF1A 1SJQA 1WELA 2KRRA 2J8AA 2MGZA 2HGNA 2RRAA 1X4EA 2KRBA 2MSTA 1X5SA 2DHAA 2VODA 1WHYA 2RQ4A 5LSOA 2DNKA 2DH8A 3IWNC 2RT3A 2CQ3A 3NS6A 1M5KC 2DK2A 2MHNA 2DO0A 2RS8A 3CCMS 2DH7A 2LXUA 2CPJA 1P1TA 5DDOC 2DB1A 2DNZA 2DGTA 2CQ1A 1KQSR 4FXVA 2FPHX 3RW7A 1VQ7S 5IQQA 1VC5A 2U1AA 3CCES 2OTLS 2L41A 2CPEA 2CPHA 3ZZZA 1U1KA 2XS5A 2QA4S 3CCSS 2CQ2A 2YH0A 1M90T 1SJ4P 1WG1A 2B0GA 2F3JA 2EK6A 1X4BA 1WEZA 2RNEA 4WCEQ 2XS7A 3LQVA 2ADBA 3VAJA 3UD4P 4IUFA 2VONA 1JMTA 1VC6A 1HA1A 2A3JA 3CMAS 2G0CA 1QVGR 1SJ3P 3S01A 2YTCA 3R27A 2MQPA 3MDFA 2CPFA 1YHQS 3ULHA 4LJMA 2MQOA 2MQNA 1P27B 2MKJA 2EVZA 2BZ2A 1WEYA 1X4GA 2CQPA 5CXTA 5GAGU 4QU7A 1DRZA 2CPIA 1WTBA 1JJ4A 2VOOA 1KOHA 2J0SD 2CQIA 5GMKa 2LEBA 5JVGQ 1OIAA 3UE2A 2KI2A 3NNHA 2G1DA 2E5JA 1WHWA 1U2FA 2G4BA 4ED5A 3FEYB 4LIRA 3MOJB 3MUMP 3CTRA 2XB2D 2KU7A 2E5HA 2D3OR 2DHXA 4WFBQ 5GVQA 4ZKAA 2V94A 1VBZA 1O0PA 3G6ES 2MZSA 4TLQA 1U1QA 2I2YA 3MURP 5LXYA 2E5GA 1NJIT 3B4MA 2L9WA 4UQTA 2PE8A 5LJ3Y 2CQHA 2MSSA 3DLLQ 1AUDA 3U1LA 3I55S 4ERDA 3UCZP 2N82B 2MJUA 2DGQA 2AYGA 2DNYA 5DDQC 5GADU 4M5DB 1WG4A 3UWTA 3J7ZT 1M1KT 5BJRA 2M8DB 1WWHA 1KD1T 2MKCA 1VQ9S 4CQ1A 2DHSA 4F25A 3P5TL 1X5OA 4RU2A 3MD3A 2LCWA 2DNQA 2KFYA 1H2UX 2KXFA 3P49B 2DGVA 3VF0B 3Q2SC 1Q81T 1WG5A 1VQKS 2F9DA 2LECA 2JWNA 2X1BA 2AD9A 2MYFA 4WKRA 2KM8C 2KN4A 3VAIA 2HVZA 2NZ4A 1CVJA 2ERRA 1UFWA 2CQGA 4YUDA 2QEXS 2LQ5A 2M4MA 3G96A 1VC0A 1G2EA 1OPIA 2LA6A 2DITA 1VBYA 2KYXA 1WEXA 1FXLA 1SJRA 2RVJA 3ZZYA 1M5VC 2MKSA 2RRBA 2KG1A 2RS2A 3CF5Q 2CJKA 1F9FA 4A8XA 3TP2A 1DBDA 1U1PA 5MLCV 2DNLA 5DDPC 3G9CA 2DNNA 2MB0B 5GAHU 2KG0A 2DNHA 2X1FA 2JRSA 2CPXA 3S7RA 1NU4A 3SDEB 1S79A 1VBXA 2E44A 2HYIB 1FO1A 4W90B 2CPZA 1HD1A 3NMRA 3P3DA 3V4MA 2MMYA 4YB1P 3CD6S 1HD0A 2DNMA 1IQTA 2KT5A 3UCGA 3JB9k 1FT8A 2DNPA 3G71S 4PR6A 5D77A 2CQCA 1X5TA 3CCLS 4EGLA 2HZCA 4WFAQ 4OZ1A 2DGWA 2MY8A 3H2UB 3B4DA 3EGNA 2DGSA 2LEAA 4U67Q 1L3KA 1X4HA 1UAWA 3CCRS 1YIJS 3R1HA 1B7FA 3US5A 1K73T 3BO2A 1PGZA 2GHPA 4CH1A 4PKDB 3I56S 2M70A 2XSFA 3VAMA 3CCJS 1RKJA 3CC7S 1H2VZ 2N7CA 1UW4A 3L3CA 2ZJPQ 2K3KA 4Z2XA 1WF0A 2DIVA 2DO4A 3BS9A 1H6KX 1ZZFA 3K0JA 4IOAQ 1FJEB 3H2VE 2L08A 1KC8T 1W2BR 2CPYA 1X5PA 3BEGB 3G8SA 5DM7Q 2M52A 1YTYA 3CCQS 5LXRA 2M7SA 3G4SS 4F02A 3CCUS 2J0QD 2KXNB 2F9JA 1VQPS 2U2FA 5IFMA 3U1MA 4QQBA 3CCVS 2OJ3A 1FJ7A 1Q86T 1K9MT 3OW2R 4IO9Q 3TO8A 3VAHA 2X1GA 1K8AT 3NNAA 1QM9A 2FHOB 3TYTA 2DNGA 3CC2S 2MZQA 3BO4A 1N88A 3MI7X 1PO6A 3PIOQ 2AYEA 2XNQA 4W92B 2SXLA 3R1LA 2MZTA 3LPYA 2WBRA 5H1SV 3VAFA 2XNRA 2M0GB 2DISA 2QFJA 2MJNA 2YH1A 1X4DA 5DETA 2ZJRQ 2I38A 5HL7Q 2DNOA 1VQOS 3NNCA 2MQQA 2DGOA 4OZ0A 4IOCQ 3UCUP 1WI6A 1A9NB 4WIIA 1VQMS 1D8ZA 2CQ0A 3P6YC 5DDRC 5HO4A 2KH9A 3D2WA 3CUNA 3CULA 1U6FA 2RUGA 4TU9A 2M8HA 1VQNS 2VOPA 2MKIA 4TU8A 2K8GA 2D9PA 3J7YU 1X4CA 1VQ6S 2ADCA 5JVHQ 1D9AA 2BOPA 4YOEA 1ZH5A 2D9OA 4Y00A 2MZJA 1U1RA 3G8TA 2MZRA 3MUTP 3EGZA 3MUVP 2NLWA 1YJWS 1S72S 2CQBA 3NS5A 2JX2A 1FNXH 5DM6Q 3N9UC 1WF2A 2ZJQQ 2OSRA 3HI9A 2YKAA 2MKKA 1VQ5S 2OTJS 3IRWP 5GAEU 1U1NA 1QVFR 2MPUA 2X1AA 1XN9A 1VQLS 5EN1A 1U6BA 2CPDA 2MXYA 2CQ4A 4WFNQ 1U1MA
chains in the Genus database with same CATH superfamily
5C25B 3QRQA 4RUBA 3CCTA 5J2MB 5CYJA 2R8JA 5IQ6A 2BW2A 4ECZA 2PC6A 2E1RA 4FKYA 5HVGA 1RBLA 3TEHB 1CJVA 1JLQA 4OJHA 3EM1A 4DPTA 2W2MP 1QDUB 2OIHA 3J7AN 2VG5B 3LGMA 1JJHA 3LA0A 2KM8B 2HHTA 1F5AA 1U25A 2E7VA 4DR7F 4O0NA 4QR2A 4F4AA 2UVWA 4QR0A 3NG8A 1LWXA 2D41A 1XR6A 4C0HA 1Q7LB 4DL2A 2XY7A 2JZ5A 4DV1F 3MPYA 1BQMA 4GKKJ 1YWXA 2M2BA 2YY3A 2E66A 4QZVB 3BH7B 2ROPA 1SV5B 1YJNS 1H2TZ 4N8OA 4JI8F 4NCGA 2DY1A 2QE5A 2LLZA 2N3LA 3F41A 1SH2A 5LMNF 2KZZA 3MOZA 1D8YA 4O4GB 1Q7YT 2R3VA 1WKJA 3QPIA 2XCAA 1ZA1B 2DPJA 2B7CB 5LSOA 1LW0A 2E5LJ 4OX9F 2UXCJ 1RAHB 5DDOC 1B64A 3JS9A 1Q8KA 4FYDA 2B51A 3PW4A 4NLOA 4QOTA 4MIWA 3UN5A 2DD8S 4NYZA 3ZFVA 2HS0A 3DMJB 2GHWA 1HNWJ 2ZZMA 3SZ2A 3S01A 2GMJA 2QA1A 2NYHA 4BBYA 3RRKA 4KHPJ 3DDIA 1Y5NB 3FNNA 3C16B 1NH7A 4N8NA 2ZDOA 3CD7A 5DLFA 3W8PA 2AEMA 3OVAA 3NNHA 2G1DA 2IDLA 3PXGa 2E5JA 4F0MA 4LR9A 3MOJB 4DL4A 3OR2B 3H2LA 1IBKJ 4CWBA 3QFWA 4I56A 3MURP 1QE1B 4EO8A 2AWZA 1J5OA 3B4MA 4B3MJ 1HARA 3B54A 3C46A 4JV1A 3HXMA 1KTQA 1LW2A 4CLWA 3G8QA 3J7ZT 2V6AA 2DHSA 2VKZG 3MD3A 3FBEA 4DR6F 2FLLA 3VR1A 3ENAA 3W60A 1XERA 4JV5J 3ETMA 1NJWA 4LF6F 4P73A 5KAKA 1JLGB 3UDEA 3QGGA 5KFMA 1IM6A 1VC0A 3W9JA 3CD0A 1S4FA 3CJ5A 2LP4A 4PXDA 1NK8A 3RAXA 5LMUJ 4YMEA 3DOMB 1ITPA 5DDPC 3BF4A 1SL1A 3T1HJ 5D8HB 2ZBQA 5GAHU 3C3LA 4X66F 3OFGA 1F1BB 2V5HG 3V4IA 5IT9U 4UOCA 2WTFA 1S9FA 1RT7A 3KMSA 4X64J 1O6XA 3I82A 3GIMA 1FT8A 1CS4A 1NKBA 3OVSA 4YFUA 4ED4A 1LEOA 3PNIA 4NLPA 3US5A 4DBQA 1N0VC 1XNRF 5J2NB 4V19J 5BYQA 5I3UA 1SKRA 2YWEA 3QSYB 2QSWA 2NXJA 3KUEA 3L3CA 3JSBA 2ZJPQ 3IGVA 4EZ6A 3MR6A 5HANA 3V6DB 3QJLA 2DO4A 4IOAQ 6FDRA 2C22A 2UV8G 4H4KA 2VD3A 5BYSA 4WBFA 2C3MA 3D3BJ 2J0QD 1NSPA 3U7JA 4USVA 3NAIA 2OPPB 4IO9Q 4DR3J 1C0TB 3UR3C 3VAHA 3H98A 2A6OA 4M5LA 2QC3A 2HRTA 2ZOMA 1WORA 4UOFA 1F9EB 4ZCKA 4K5SA 3LUYA 4F67A 2BE9B 5MAOA 3LP2B 1JLFA 3NNCA 2ZH2A 4ZLNA 4B3OA 5HQLA 3HHDA 2RMLA 3ADAC 2M5YA 2H5EA 4B08A 3K7RA 3H25A 2HHQA 4TU8A 1HHTP 3UVJA 4DL7A 3B6BA 2BOPA 3SCKE 3OLAA 5CD4H 2YWGA 1T9VA 4OYWA 4NLVA 1XJWB 1AW0A 1EP4A 1FNXH 5D0EA 2BYCA 2J5AA 2Y1RI 1E6YB 1YGYA 1U6BA 1UZHA 2CPDA 2NUUG 2CG8A 2JLFA 4A46A 4NLWA 1NHKL 2YX7A 2RDIA 3EDQB 5A8KB 1X31C 5C24A 2HGMA 5HN0A 3CC4S 4ED3A 4R0JA 4CT9A 4O23A 3CPWR 2WB4A 4JI5F 3GG1A 2LKZA 4YHHJ 4ALZA 4ED1A 4N77A 1Z4UA 2XYPB 5B0CA 3RB0A 4H54A 1RTHB 3AD9C 3QT8A 4BHQA 4LBIA 4CIOA 1QUPA 1R31A 3JSMB 2BQRA 2AQ4A 3CMES 1S9GA 5D0RA 1KS2A 1B7YB 1TQLA 4CLZA 1B4SA 4CDIA 2ZNZA 4BLGA 3H7HB 2XO7A 4OX6A 3Q24A 3GIKA 4P2MA 2LYVA 5FDLA 1YJ9S 3VVUA 3DXSX 3QJPA 3MMBA 4GO7X 1X9SA 3OR1B 1HL6A 2RQKA 5ITHA 1KRPA 3PYEA 1WF1A 2W4CA 1ZETA 1WELA 4J9LA 2VQFJ 1QSSA 3KLFA 4DR4F 4IDKA 1RI7A 2W8LA 3M30B 2XMUA 1T0TV 4E2FB 4RPFA 4DS4A 1NLKL 3UO0A 2FJAB 4KB7A 2CJXB 2IFXA 5AJ3J 3J7Z5 1F9HA 1FVSA 4NASA 3J81j 5HVHA 3KLHB 4GMKA 4IUFA 3OTBA 5D4OA 1RYSA 2UXBJ 1K1QA 4J9QA 1IR2A 2A3JA 2UUCF 1U8WA 2MQPA 1N5QA 2CPFA 4TNOA 4LSNB 3P8BB 4UUXA 4M94A 3BV8A 3Q83A 4ZJLA 1GMWA 2NXNA 3FQLA 3A13A 5GMKa 1MWYA 4C8NA 2CUYA 3FMWA 2XI2A 3KLEA 3FEYB 4W4MA 1N34F 2KU7A 3KHHA 2FJEB 9ATCB 3BSAA 4IQMA 4ECWA 2YQ0A 4TLQA 1U1QA 1JLEA 1VRUB 4BWJA 2L9WA 3OXGA 1S6PB 3MR3A 2AYGA 1VQYA 3AODA 5GADU 4WZMA 3EGVA 1M1KT 4X62F 4IO1A 1Q53A 4Q0BA 1X5OA 1KSPA 5F8GA 2DGVA 2BMBA 2YX1A 3BH6B 4X4PA 4M5JA 1VQKS 3M6VA 3T1YJ 4NZ0A 3PO5A 3D6FB 2YNFB 2ERRA 3FMBA 3UR0A 2QJ3A 2CDQA 1RA6A 3OHBA 4ECQA 2IJNA 2AV5A 1Q79A 1F9FA 1XMBA 1KQFB 5KFDA 3N5BA 1FFWB 3I9V9 5IT4A 2DNNA 1RLDA 2F8HA 4B3TJ 2VIHA 5E3PA 1WC0A 3S7RA 3UQSA 2RIJA 2RHQB 4LFCF 3MECA 3P5BP 4J9VA 3IWXA 3CSKA 4P7TA 1OS5A 4OZ5A 3K5LA 1S97A 3I6PA 2DNPA 2RF2B 4JB8B 4J90A 4J9PA 4ELVA 1JKHA 4DPXA 3PM9A 4KJIA 4MFBA 2E9ZA 2GVDA 4AFFA 3RTVA 4MIAA 5KFAA 1M1GA 3AFGA 3CJQA 2YKMA 4DLGA 3AH6A 5A0YA 5KFHA 1KHWA 4LF8F 3JQJA 3I0RA 4IG3A 1VQPS 5CYMB 3CCVS 2XMKA 2V2QA 3TQEA 4PCQA 3TYTA 1KEKA 4Y34A 3EDRB 4C8MA 4W92B 5A2QY 1FA0A 3LPYA 1S5ZA 1IKXB 2ZE2A 2CDRB 1YBTA 2FQQB 3DLHA 2WVFA 1Q5VA 3VGSA 5HO4A 4QWEA 3MM7A 1KP6A 4CM0A 4NRUA 3TVYA 1VQ6S 3GFYA 3FFIB 4ZVSB 1G3OA 3QGPA 4LBPA 1NK4A 4OI0A 1FDDA 3HT3A 1S77D 1FEHA 1QVFR 3NGTA 1HPZA 1UZDA 5F41A 1IN0A 1S9EB 1HQEA 4IKAA 3QNWB 2IRXA 3QZ8A 1HQ2A 4IQXA 2DGXA 1VRQC 3ILLA 1HI0P 3PEHA 4U95A 3HHLA 4R5PA 3I5BA 2IBKA 3MMAA 4ECSA 3A8JA 3FDSA 4MKVA 1I1GA 1RP5A 4K4UA 2M88A 3I4HX 1LW2B 1X8DA 4M5IA 1S12A 2QSFA 2NYIA 3TZXA 2CJQA 3SMZA 2IM0A 1IKWA 2A2CA 3TUIC 2DRAA 4N56A 2WSFC 9RUBA 4U7UD 2O3DA 1IJEB 5CCMA 1I51B 2FJVA 2J6UA 1DQAA 3OL6A 4ZN1A 2KXHA 1LXJA 2AZ3A 4Y2KA 4OYAA 4J9SA 1LKZA 2PIIA 1IR0A 1HR0J 4KR0B 4ZCLA 4P2SA 3Q8PB 2BXJA 3ZZPA 2WONB 1SJQA 3GJSB 2RB7A 3V4IB 3FCVA 4AXIA 3KK2A 3HVAA 1RT7B 4PWDA 1BWEA 2DO0A 1HKAA 4JOUA 4FYVB 4PABA 2AZ1A 3HSDA 4ZCMA 2GZOA 3AXKA 3HVTA 3HK2A 1CS4B 3I5CA 3ZZZA 4E8UA 3SI8A 2BJ7A 1BGXT 2ASYA 5I3UB 2J9CA 3VAJA 4DG1A 1FKOA 2VL1A 4QR1A 1ZM4A 1S7IA 4DOZA 4HI2A 4YP3A 1QLNA 1U2RA 3SIPB 3U1NA 2VPYB 1XR5A 1A0OB 2NXUA 4Z7CA 1WTBA 2CPIA 1C1CA 1H98A 4PXEA 4A48A 4EI2A 1PCAA 1RXOB 5H9FJ 2KI2A 3PRBA 1D3WA 3MUMP 3CTRA 3POTB 2JHEA 3GIJA 5AE1A 2V94A 2ZUAA 4IG0A 3MR7A 2OFHX 2E1MC 5LJ3Y 1T3NA 1RT4B 4IFYB 4B3OB 3IR7B 5KFWA 4F2SA 3CDBA 1TVRB 4DFMA 4ER8A 4U8YA 1H72C 3MM8A 2C1EB 4TY8A 3MEDA 5M2UA 5KFTA 2Q3PA 1J27A 4DX8H 2ZC4A 4L73A 2UUAJ 2VDHA 5BR8J 5J1EA 3ZZOA 4DSEA 4HHUA 1SKUB 3NOCA 5IWAJ 1RWWB 5HBMB 5JMNA 1XMOJ 1VIOA 2AEJA 4DUZJ 1JJCB 2UU9J 2RHSB 1RUSA 3VWSA 3M32A 5E3QA 2KG0A 4QWAA 3LP1A 2EBGA 1ULRA 2BKPA 3IXQA 1NRKA 4M1KA 3T19A 1NBEB 4I69A 4JI0J 5FLXU 3H2UB 1H38A 4I7FB 4DQPA 3CCRS 3NGKA 4JI1F 1SBRA 3D7SB 1QSLA 1JLBA 5HK4A 1TL4A 3RRHA 2M70A 1OY8A 3CIMA 3SSQA 2N7CA 4PG4A 1ZZFA 4ZVHA 1DTTA 1BXNA 1AA1B 3MMBB 2O1PA 4WP3A 1U09A 3PKYA 3WIVA 1GX5A 2D1CA 4QQBA 2OJ3A 3N5FA 4DS5A 3KLFB 1GTHA 2W2PP 3CJRA 3CC2S 1F5BA 3BO4A 2VH7A 3MI7X 4XAKA 2BX6A 2QL9B 4I2PB 4WXOA 4X65J 1RAIB 3T9ZA 3CULA 2HNYA 2HZAA 1YJ7A 2K2PA 3KHLA 4NE9C 5ETQA 1I94J 2YKNB 3I96A 1X4CA 2EFGA 3C8YA 3PEJA 4QBUA 1QY7A 3TJ8A 2BJ3A 4ZHRA 3G8TA 1VISA 5IOLA 2LDYA 3EGZA 3TI0A 3CGIA 4FF2A 3HZGA 3FSXA 4RL1A 3U27A 4NZ7A 4TLRA 2YKAA 3IRWP 4GKKF 2MPUA 1XN9A 6AT1B 1FNOA 3KLEB 3GWCA 3MPUB 1FWPA 2OPQA 4KE5A 1R8HA 5B7WA 3Q2TC 1CLFA 1R8PA 1MW7A 1VDHA 2F1FA 1B70B 4KO0A 4X84A 1HBUB 1R43A 5B0BA 1JLEB 1FJCA 2MKHA 5ETMA 3D9BA 2HQ3A 2RDDA 1BY9A 1U1LA 2VKRA 2E5LF 1WKKA 1FRHA 3OL8A 5D78A 1SVDA 2UXCF 3Q8QB 3RU0A 3WIUA 5D4LA 2MGZB 5ETTA 2J7WA 1BQXA 2DKOB 1V5VA 2MY7A 3OXLA 4WIQA 1RTDA 1HNWF 4M95A 2FB0A 3IRXA 1WSVA 4F26A 4DQRA 2HFVA 2QV6A 4WF9Q 3PVXA 4KHPF 2IHR1 3RJMB 4OYBA 4F0KA 2XLJA 1F5CA 3TRGA 4HTIA 1YVFA 5RUBA 2RT3A 1EQ0A 2RS8A 3MCNA 1IBKF 1N33J 1IBLJ 2DNZA 2GIRA 1VQ7S 2VBXA 4FXDA 4B3MF 3CCES 2ZBRA 1VJQA 2CPHA 2XS5A 2QA4S 4ZVOB 2HVHA 3LGNA 1TKZA 1M90T 2V0NA 3UD5A 4DV3J 4WCEQ 5J1PA 2XS7A 2EKNA 3D3CJ 1UVMA 4USWA 3KK1A 1QAJA 4TVAB 1UFKA 3TUZC 4JV5F 1QUVA 5A0YB 2BJEA 5D0GA 1YHQS 3ULHA 2BANA 3I0RB 4NMXA 4IG3B 4X4RA 2A1BA 1FTRA 3CDEA 3LF0A 2LEBA 3WC2A 1RHQB 3R97A 1WHWA 4I0WA 5KFUA 5LMUF 4ED6A 4ZS6A 3RAQA 1T03B 3PJXA 4ELUA 5GVQA 7AT1B 1N6QB 3AOAA 1O0PA 3T1HF 2ZH8A 1JIHA 4LRCA 4MK8A 1KKHA 2PE8A 4NOHA 4F50A 4CTAB 3A3PB 3MM7B 5CABA 2IJFA 1W7WA 1PJ7A 5BJRA 4A47A 4X64F 3QRPA 3X1LB 4KFBA 4F25A 3O5TB 1H2UX 2IAJA 1UVJA 2CJ9A 3LALA 1U4BA 3MTKA 2JWNA 4OHWA 4DQIA 2C2MB 4DL0C 1F60B 4WK3A 2LDIA 3R5AA 3C14A 1FDNA 3LWMA 3KMQA 2FLPA 4NLGA 2MLZA 1MU2A 3Q23A 3H40A 3MM9A 3HHLB 4R5PB 1REVA 2BKOA 4NL5A 3G9CA 1T9UA 3MMAB 4DR3F 2MB0B 1FFSB 2JRSA 5HJYA 4BC9A 1VBXA 3CO9A 1F2GA 1VMBA 4RX6A 3D6TB 5ETNA 2BQ3A 5DS7A 4DMZA 4HH0A 2KT5A 1FJGJ 5D6GA 3UCGA 3QO9B 4QYZK 3I87A 3GONA 4ED0A 2B8QA 5D3GB 4CNZA 3B4DA 3KOAA 3TW0A 1RU1A 4ECUA 4QYRA 1B7FA 4KH1B 5DZ7A 2ZHOA 3M6UA 1WC1A 1RKJA 2LU1A 3FGVA 3G82A 3AD7C 1HNZJ 4NRTA 4DSIA 4LFBJ 4USUA 2AT1B 5CCLA 4HACA 3M2RA 2U2FA 5IFMA 3U1MA 2E9TA 3RBXA 3TO8A 1RT1A 2C3YA 2DNGA 3SV3A 1R0BG 4PWDB 3RAMA 2AYEA 2DISA 4L6V3 4WTYA 2YBVA 3BREA 4ETZA 4DV4J 2DCLA 4OZ0A 1GAOA 1SH3A 1S0NA 3CJKB 2CQ0A 4KGXB 1N32F 2RUGA 2M8HA 4DG1B 4GRSA 1FKOB 3G2XA 2ASJA 2D9PA 5KFYA 1FXRA 2R8GA 4ANCA 1JLAA 2LFVA 1CEZA 4TYBA 4WYLA 1TK8A 2NLWA 2OO4A 4OZNA 3DHXA 4L75A 1RAEB 2J6SA 2R7SA 4NA3A 1WF2A 4NLRA 3HI9A 2BDPA 4EBEA 5GAEU 1C1CB 4H4MA 2W2QP 3ICLA 3OTDA 4FBTA 4WKYA 1WNEA 1EJ7L 4P6QA 2Q79A 3E8OA 2EXUA 1V9OA 2DXFA 1X4AA 4LVNP 2XS2A 4BS2A 2HK2A 2FY1A 2VQFF 3CDAA 2IVYA 1LFWA 4WFXA 4H4OA 1SQEA 4XDCA 3FBBA 4O4RA 4CLTA 4F0HA 1DHMA 2FGCA 3MM8B 5HQ8A 5AJ3F 1VHIA 3MEDB 3K17A 4H4KC 1WI8A 5C7PA 2PI5A 3BR8A 5F9LA 2H5IB 2FHKA 4V1Ak 1EAYC 1FHTA 2UXBF 3MHYA 2JVOA 2KZMA 1N52B 1YJUA 4I64A 4C9DA 3B8HA 2ATCB 2KVQE 5IC4B 4PUOB 3SFUA 3OXFA 1YJVA 1VQ4S 3C6UA 1LQ9A 1T05B 2HQGA 2XMMA 3M32B 4PZVA 1TUWA 5DGBA 1Q4RA 3TAMB 1HYSA 3GIRA 2BJDA 3NS6A 3C15A 3MEKA 3CCMS 1RWNB 1F3VA 1NSQA 2YKPA 2GMHA 3GSDA 3UFCX 2PFFB 1U1KA 1YJTA 3D1HA 4KY3A 2H4WB 4LF4J 1AB8A 3ISZA 1H74A 4OZ3A 4RWXA 2J7KA 3IM8A 4OV1A 2QN6B 2QX0A 3DLKB 2J8SA 3M8YA 3QAUA 3QLHA 5KFPA 5BYRA 3R27A 3MDFA 1DTTB 1CC7A 2F4FA 4D3HA 4NLDA 3T1YF 1TKTB 2XULA 2O66A 2YPYA 1HWJA 4KH0B 2GJ2A 4ZN3A 3MPWA 1IQZA 4ED5A 1D1UA 1Y3KA 2YPZA 4DV2J 4Q7AA 2J0XA 2RSQA 1S10A 2I2YA 3DOKA 3S1TA 3CEDA 3AXMA 2QLWA 3EXYA 2HNYB 4GVBA 1RTIA 3NCQA 3PDNA 1CULA 3WHIA 3HHEA 1EETB 4KRWA 4ZHRB 2XMAA 5HATA 1QSYA 3ET6A 2ATLA 4WKRA 2IA6A 5F9NA 1U47A 4NA1A 3VAIA 4FDFA 3BKTA 2R2SA 3SYZA 5ETOA 2W24A 1YQHA 1LV5A 3QIDA 3K5OA 3ZZYA 4YDDB 4M5DA 2HIYA 1HWUA 2JJ4D 1R3NA 2AF6A 4KO0B 1KTVA 4URSA 5MLCV 2BE2B 4Q8FA 4EUVA 1KLMA 2DNHA 3DRPB 2OGUA 3IBCB 3AB4B 4LT6A 1CPZA 3PACA 1XR7A 4YB1P 2J6TA 1IQTA 3M4XA 4KGVB 3H90A 5GAGI 1PBAA 1X5TA 5LOQA 4EGLA 5L46A 1FE0A 2RU9A 4TQRA 2AMCB 2B6AA 4WZQA 4DQQA 5HROA 2EEYA 3FBFA 1R6YA 1RTDB 3IRXB 4IH5A 1UW4A 3JAMY 2OH2A 4Z7YA 2N7YA 5D15A 2Q66A 3PYGA 3FK4A 1KC8T 3G8SA 5DM7Q 1YBAA 1LWEA 1O5JA 2IBOA 2KXNB 4O3NA 4K4SA 3Q0AA 2P9CA 3GTYX 1JLCA 3GYNA 3ZTSA 4N47A 1NHVA 3M8QA 1JWWA 1YG0A 1N88A 1PO6A 5KFFA 5F8JA 4MYUA 1B99A 2VBWA 5E3AA 2WBRA 2M0GB 2IMOA 3P4UB 2GS8A 4LFAJ 5D4NA 5EHHA 3VHQA 2LEPA 3P6YC 2B4OA 2KH9A 4NEZA 3CUNA 2ZBCA 1YKWA 2FVQA 3HHLD 1Y0HA 3JTPA 1TMMA 3OFHA 3J7YU 2HFUA 1OJ4A 1QAYA 2Z2LA 2J9EA 1D9AA 2EFVA 1MROB 3SQGA 2BANB 1HI8A 1J5EJ 2HHUA 2OSRA 1S7HA 1U1NA 1I6JA 2B9YA 1VQLS 1Y4ZB 3ZC4A 1MMNA 3RW6A 1M5PC 1HR0F 2WK4A 2B5JB 2R9LA 4P2FA 4DLEA 2P9EA 2MTLA 2IRYA 1GMVA 1TP7A 3DLEB 3M9MB 3AQOA 1VK3A 4HEA9 3S6EA 1OWXA 4JI6J 5IXUA 3EZ5A 3IP0A 4CO5A 3ONQA 3OD2A 3BR9A 3MCOA 1OO0B 2GVZA 2GX8A 2J76E 1U24A 4AQYJ 4C11B 3C14B 2MHEA 1SXLA 2V34A 2W4DA 3GYGA 3HULA 2HWIA 3UNGC 3EUNA 3DRXA 1B3TA 2DNRA 3KJVA 2KRRA 5EGYA 2RRAA 3KK3A 3RB6A 5DQGA 2LQBA 3M8WA 5B0GA 2CYYA 4OIXA 3CD5A 5L1LA 3L9ZA 3MCSA 1Y9OA 3ZZ0A 2FPHX 2V9KA 1ZA2B 3QQCD 3RR8A 2ZWPA 2CPEA 2HHXA 4AD6A 3TJ9A 3NGUA 3ITHA 1OQ3A 5J1NA 4ETXA 5ETRA 1TL1A 4ANEA 2QFIA 3G82B 7FDRA 3R5CA 2AJQA 4F4KA 4ZJOA 3QBCA 2HRYA 3MR2A 3M2RB 1V6HA 1DARA 4MKAA 1CJUA 3SCLE 3HP6A 2UUAF 4EZ9A 2XLKA 5BR8F 1SL0A 1RT1B 1ZYQA 4ELTA 5IWAF 1FRJA 3OL7A 1XMOF 4WU2A 5HAOA 2G0JA 4DUZF 2UU9F 3DMJA 1URRA 1RAGB 2P9GA 4DX7A 3R7BB 4R8UB 4JUZA 1JX4A 5CZVA 2RRNA 2ZH5A 4J9UE 3C16A 3LGHA 2Q1LA 3T41A 5KFJA 3IA0A 3P5TL 4JI0F 4A8SA 3P49B 2Z8QA 1JLAB 2V8GA 2MYFA 1YSJA 1S6OA 4QJVA 5AXKA 1WOOA 2ROGA 4A4JA 2BM0A 4H4MB 1G2EA 1WEXA 1OSDA 2WVDA 4QWDA 4ZVGA 3CF5Q 2QL5B 3DYAB 2J9DA 2CJKA 1ZAWA 3TP2A 1N4LA 3TZWA 2CKWA 2GO8A 4C8OA 2A2DA 4KGKA 1S1WB 3KKFA 2HHPA 4H4OB 2CPZA 5E0OA 3HD2A 3W5XA 1RA7A 1UWAA 3K57A 1H7XA 1NJYA 1HLWA 4NLTA 5IV3A 1NPKA 1B0TA 3M8RA 4X65F 4QWCA 1AZSA 2LEAA 4U67Q 4YR2A 3N79A 1K1SA 3KLIA 1TV6A 3KUGA 1I94F 2DR5A 5DZ6A 3FUYA 1FRKA 2X3GA 5L39A 2KJVA 1Y3JA 4KKOB 3G6YA 3K0JA 1X5PA 2QO3A 4PG8A 3C6UB 5AT1B 4O3RA 1VLYA 4NCAA 3CJ0A 4HLBA 1LK7A 1HYSB 1K8AT 1SIZA 5THWA 3W64A 3C15B 5J2NA 3JTNA 2XHWA 2G2ZA 1RKIA 3DFEA 5C42B 3ZNUA 2WSEC 2QFJA 2YNGA 2FIUA 1U49A 3PX6A 4KYZA 3BSNA 1AFJA 1N5YA 3TWZA 4WFZA 4CT8A 3QLHB 3DRSA 2K06A 4RNHA 5GAHI 3H4DA 2MZJA 2DXDA 1NJZA 5KFQA 2MQ8A 3NS5A 4CH7A 3IBWA 3PX4A 1VQ5S 2MKKA 3T5JA 2M3DA 3C19A 1WDDA 2YNHB 1F6TA 2HNZB 4DI6A 3HSGA 2CJYB 4RUCA 4NLUA 1TL7B 2LA4A 3HT0A 5AE2A 2WVCA 1RJJA 5IM0B 5KFOA 4RW6A 2JVRA 3WDOA 2CNOB 3V2UC 4DPOA 2GQCA 4GVBB 1IR1A 3EJMA 1N33F 4Y0FA 3W63A 2IVMA 1IBLF 1CULB 3T5HA 5CA5A 3KHGA 2HLUA 3IR6B 1P8GA 2QTWA 4V19X 3BQ2A 4OYPA 5A8KA 2VFSA 3NKYA 4DV3F 3IM9A 1Y11A 2A10A 1UA1A 1NO8A 1TUGB 1ZM3A 2DR8A 3CNQP 1K47A 2VHGA 1JB0C 4UT4A 2EK1A 1FDBA 2PMZD 1U2CA 1CJTA 3HHNB 1X4FA 2FC9A 4DN0A 1FI4A 3GQCA 1X5SA 2XG8A 4TQSA 2CQ3A 2DY9A 2V4RA 2MHNA 3H20A 2KYZA 4URQU 4ZVFA 2ZITA 3CO0P 2VA3A 1UEVA 4ZOSA 2E1PA 5B0EA 1I5OB 3HSZA 3T9NA 5DGAA 4CYUA 4X4UA 1SC3B 1P6TA 4DR1J 4OZJA 5HROB 1X4BA 3UD4P 2VC0A 1UVKA 1JMTA 1JK9B 2OMLA 3M30A 5DRKA 2B4PA 2NPIA 1XMQJ 3F56A 3RYLA 1WD6A 1S4EA 4FN5A 1MNEA 1OPZA 4QWBA 1Q8BA 1K44A 3HSJA 3BKFA 3FSIA 2B56A 1OIAA 1JLCB 4ENOA 2W7PA 2D69A 3DGVA 1BHNA 3K5MA 4AT1B 5KTQA 1UCNA 2RE1A 3BDPA 2D3OR 5C5JA 1VBZA 3TAQA 1ELOA 2FJBB 2E5GA 3AD8C 3QYYA 2OP5A 3L7UA 4HTJA 4IRCA 2H3EB 4YEAA 4DR5J 1VQ9S 1FJGF 2V69A 4ZITA 3VCDA 5DQIA 3RUBL 1NKCA 3MM6A 2ZZTA 4CO2A 4DX6A 3R8YA 2HPUA 1VRUA 4YUDA 1HIYA 1HNZF 1M5VC 2VF3A 1BMQB 3KHRA 4LFBF 5J2QA 3GILA 5EX0A 5A76A 4G1QB 4O3PA 4M5MA 2VJVA 1M5HA 2YNIA 4Q44A 4OHVA 2IVFB 1RACB 4DV1J 2GAHC 3JSYA 4YY3J 4DL3A 2YNFA 1C0UA 3ZTOA 4XK8C 1JNRB 3BBCA 2F8EX 3EGWB 5H9EJ 2ZOFA 1TZ0A 5DQHA 1UVLA 4DV4F 1N36J 3F44A 2VFVA 2GVZB 3D67A 1RAJA 3HJVA 4LBHA 2JDJA 1FE4A 3CCWA 4P10A 4RUHA 3IBFB 5DG9A 5LXRA 4RNMA 2RF2A 3CCUS 5GADI 3KJVB 5JUMA 3KK3B 1FJ7A 1Q86T 4NWBA 3OW2R 4JI3J 5U47A 3TA0A 4P52A 3D28A 3GV7B 3GR0A 3D4JA 2YWHA 5H1SV 3HDSA 1MMDA 1RDRA 2PMWA 1LOUA 2AW0A 4RW4A 3BJYA 2D3ZA 3LANA 2FHMA 1VQMS 3ITHB 4L76A 4PYDA 5CYMA 1TL1B 4K4TA 1ZPWX 1NKEA 4CO4A 2HLTA 2Y1JA 3JYTA 2ZC3A 2JH3A 2JX2A 1L3SA 1CJUB 3HKZD 2FVCA 5CQGA 1IKXA 5HSPA 2X1AA 1U02A 1HMVB 2VA2A 3P96A 3TAPA 1S57A 3MEEB 3PX0A 2HFZA 4RW7A 3VAKA 3FFIA 2K3IA 3AHPA 4R25A 1FD2A 3PTWA 1QD1A 1X0FA 2QMWA 2FC8A 1R8AA 3CXCR 4RLEA 1VQ8S 4CNYA 4LMZA 2HIQA 4ZA1A 4DL5A 1M5OC 2E9RX 1S9EA 2RD5C 2R2TA 2FZKB 3LO3A 1ZBTA 4LF4F 3PCOB 4WPAA 4RNOA 3BQ0A 4FPRA 3K5PA 5FJ4A 5SZTA 3TEGA 2GMLA 3NBPA 1S1VA 3J81Y 3NY0A 3GSIA 4FKXA 1RBOB 4WK1A 4K8RA 4UOHA 3G87A 3WZ0A 2ZM6J 3OPKA 5L8RC 4OHXA 1XNRJ 1CQNA 1FFGB 1I3OB 4OYOA 5LT5A 4DV2F 1NK6A 2JLGA 2CPJA 1P1TA 2QMXA 1T94A 5HMZA 4FXVA 1W26A 4FBUA 4MIBA 2LU2A 2L41A 3FC9A 1XNQJ 3Q86A 1AZSB 1U48A 4F4ZA 1XC9A 3KLIB 2WONA 1TV6B 2HURA 2FDNA 1XWLA 5KT6A 2CIMA 5B08A 2CFXA 3CMAS 2G0CA 2R7OA 4OQJA 2W9BA 3BGOP 3B82A 1U0HB 1WACA 3RB4A 4F8RA 2B9WA 4A8WA 2AJ1A 2MKJA 1U6ZA 2PFDA 4WJBA 1JJ4A 4C0BA 5DJBA 2A0FB 1EQMA 4FPIA 2G4BA 1WC3A 1SH0A 4PWUA 2OPSA 3CIZA 2YNGB 4RNNA 1FK9A 4OYMA 3G6ES 3PW5A 4JYAJ 2W01A 2OMOA 2H1YA 1UVNA 3T3FA 2QIFA 4M5KA 1T11A 3SFGA 5G0RB 4C6AA 4ED8A 4BCAA 4Q43A 1N5YB 4PQUA 5DG7A 2HHHJ 1Q0NA 2PEBA 3DRSB 4KAIA 1C2PA 2CNKB 3R2CJ 3VF0B 2AHOB 3POTA 4PPDA 3ISNC 1O8BA 4XPCA 4O3SA 4XO0A 3M2VB 2LA6A 3Q8RB 2DITA 1RT4A 4AYBD 1B0PA 4IFYA 4XPEA 3IS9B 4FYYB 5JXSA 1X9WA 2HBRB 3BKUA 3IO1A 1OYDA 1AT1B 4DF8A 1TVRA 2VFRA 3DN9A 3VV2B 5IZHA 1KN6A 2X51A 4B9UA 1TAQA 5DLGA 2H65B 4RW6B 1T3OA 3I0SB 4OV6A 4ZVTB 5D0HA 4HHJA 3KLGB 2GC8A 2HYIB 4DU7A 2AKWB 4CP5A 8ATCB 1G7CB 1HWIA 1AROP 3NRBA 4LFAF 1GX6A 1NSKL 4HR2A 1QJHA 2CQCA 2DT9A 4OZ2A 4FS2A 5HBMA 4JI2J 1U0SA 3ZTPA 1R89A 2QYCA 4YQWA 2XO6A 3PW2A 4B02A 4KPCA 4AL7A 1G6BA 1RWOB 2H54B 1CJTB 4LRAA 4DSKA 3V5RA 3KJNB 3M9OB 5A8WB 5D4PA 1J5EF 1P9QC 1ZM9A 2IA0A 3G4SS 3UPFA 3WX4A 3OV7A 1UJ6A 1Z1ZA 4C8ZA 2XMVA 4I7FA 4ZMMA 3DRRA 4XDDA 3I31A 3B78A 4O3OA 3OTOJ 2AJFE 2OKQA 1X4DA 2UUTA 3PJWA 3AY0A 4CYUB 1VQOS 2VPZB 3MEGB 1A9NB 2NUHA 1D8ZA 3CMQA 1XEZA 4JI6F 4K5RA 4LSLB 1X60A 5JVHQ 1NH8A 4OI3A 3K89A 3V6HA 2HFNA 5KFXA 2MZRA 4DV7J 4R0EA 2V4QA 2EKYA 1ROFA 3EYZA 5HJXA 4AQYF 4I2PA 2UV8A 2MXYA 4OX7A 3LOUA 3CDWA 1V3RA 3MF5A 1S1UB 1URNA 1MMLA 2UP1A 3IAM9 3HPOA 5ETSA 4N5SA 2CXEA 2YKNA 2P6TA 1VK8A 1N8RT 2F63A 2MZ1A 3D0GE 4USHA 3SDEA 1HNXJ 3M8SA 2WVEA 2YWKA 4IRDA 4LR8A 2FVSA 4F3MA 3VALA 3HCXA 3MM6B 3PFEA 2BUNA 4DCPB 4NMLA 2HGLA 4IR9A 2A18A 1HBUA 2BJ1A 3DXBA 4WE1B 1FX2A 3SQOP 4ZVUB 1RHKB 4NXMJ 2DR7A 3NLCA 2Y1IA 1YRUA 5J2QB 4CLYA 2P6SA 3GJTB 1RT2A 2VG6A 2GNKA 1OQ6A 4WYWA 4S0MA 4P2XA 4B3SJ 1KFDA 1RQ0A 2YNIB 2J8AA 2MGZA 4USKA 3A4TA 5E3RA 4K2XA 2RQ4A 4KHRA 3OUYB 1C0UB 3NWRA 2DK2A 2I8EA 2DH7A 3M8ZA 1HNVA 2V2KA 1SKSA 4WXWA 2QMUB 1GTEA 5KFGA 5CAAA 1HBOA 2FLOA 4QCLA 3JXOA 1TUVA 3GMGA 1SJ4P 5T7LA 1FD8A 1JQGA 2HVEA 4P72A 4A8YA 2NS1B 4HT7A 3PHTA 4ZPWR 3R5DA 2UUWA 5AE3A 2WAQD 2JC0A 2OD4A 3UN3A 3HLUA 2Y8WA 2QYGA 5B0FA 3X3UA 1HFEL 1KOHA 2NZCA 2VJUA 4J9MA 1RHRB 1N5TA 4RW4B 4RU9A 5K8PA 5KFSA 4FF4A 2UUBF 5B09A 4IH7A 3TUPA 2GJIA 2JSXA 4NX9A 4NPOA 1WG4A 2AX1A 2M8DB 1WWHA 1HNIA 3M1VA 1IKVB 1PYOB 4P74A 2IMWP 4QIFA 3JYTB 1T03A 3FQKA 3GFHA 3PJ9A 1N6QA 2KM8C 2ASLA 2KN4A 3VGVA 3EMTA 3LWLA 2LQ5A 4GC7A 3PRVA 3LTOA 3QT6A 4CTAA 3JQKA 3JSRA 1GXUA 1NAQA 1APSA 3Q8UA 4RW7B 3N4WA 5KG0A 4X2BA 4X4SA 3CJSA 1PIEA 2ZH9A 4P7VA 4RNFA 2MLXA 3NP5A 1D09B 3N6MA 4OMFG 3A3NB 1MWZA 1VHFA 4PQAA 3NMRA 3TA1A 3HJFA 3VQSA 2WCXA 2Z58B 2FJXA 3MPVA 1TKDA 3MZIA 4JBCA 3SSRA 2JEFA 2KHDA 4UOGA 3CCLS 2G2YA 4DSJA 1UAWA 5AXMA 2GHPA 3MWBA 4PKDB 4I1TA 4RBUA 4GVLA 4RW8A 2WSCC 3NBPB 1S1VB 2DIVA 3D1OA 3DU5A 1FJEB 3TJAA 4Y28C 3E01B 4K50A 3QO9A 4L3KA 2XLIA 5K8OA 5A8RB 3SEOA 1PAEX 3N28A 4FVMA 3P45B 5D3GA 4DR2J 3N01A 1WC6A 5T14A 5KG1A 3OFFA 1RB0A 4ID5B 3NCPA 5ETKA 2V2VA 1RISA 2C2DA 2JOQA 5KOWA 1PJ5A 1NDKA 1Y5LB 1YBUA 3K59A 3QRRA 1RT5A 5DDRC 1UW9A 1VFJA 1RWVB 1U6FA 5KFZA 2XEXA 2H48B 2G2OA 3NXZA 1S1XB 2HEKA 2HVDA 3DOLA 2W9BB 1EKSA 1LNQA 4F4YA 1YJWS 2GQ2A 1F3FA 4UZBA 4RO0A 2R42A 4LRFA 2X3DA 1DLOA 4ZP8A 3CJKA 2YQ3A 1TFWA 3KG4A 5KT4A 3MCMA 2OPSB 3KYLA 3U02A 1FK9B 2E1CA 2ZKTA 4ZVEA 4QPTA 5LL6d 1RK8A 5ETVA 4PG6A 3HD1A 2R8IA 4EK2A 4WTOB 4B9VA 4Y2IA 1NB7A 2WHOA 4PQUB 3V6JA 5K14A 3L09A 3E3XA 4CO0A 1WC4A 1UKUA 1NB2A 3UDLA 1WDTA 3FEZA 3DDNA 4CI0B 3THTA 5HMYA 1KWMA 2MQLA 3C2PA 1GT8A 3K58A 2VG7A 1AUSL 1KVKA 2OSQA 4ZPVR 3HMJG 1NPPA 2FLNA 3FRYA 3C6TA 4KV8B 4I67A 3FSYA 2QRRA 5E5NA 3V81A 3FJ2A 4LQ9A 1XMQF 2PO4A 5H9FK 4HI1A 4ILLA 4AXJA 1NDPA 2D7SA 4TYAA 2I6WA 1UJ5A 2LQJA 2V68A 3NGSA 2UZAA 4ID8A 3I9ZA 3GFZA 1M5KC 3KLVA 1GEHA 4DPYA 2U1AA 5GAEI 4J37A 3W9HA 4PUOA 2CQ2A 4NI2B 3OVBA 1B0VA 4DR5F 1FRIA 3QGHA 2HW3A 2B0GA 2KFNA 1T05A 3L7OA 2VPXB 2ZBIA 1R0AA 2CAJA 1BWVA 3W9IA 3T6BA 3TAMA 1HA1A 2V4JA 2ZVSA 5K20B 2YXLA 1DTQA 3WX8A 5IT9Y 3GV5B 1F2HA 2VOOA 4RBVA 3GZ7A 3DRRB 4DUYJ 3AOCA 2CZ9A 1R27B 3DLKA 3MTJA 4YB5A 2Z2MA 4J91A 2HHVA 2R4FA 1NJIT 2BBEA 1TKTA 4YY3F 3UCZP 3DLGB 2DGQA 2XMWA 1C4AA 4CQ1A 2CWXA 4NYPA 1TMJA 3A12A 2LCWA 1K0VA 1N36F 2V8VA 3D1QA 2OPRA 3W2VB 1WG5A 3H0PA 1FEEA 1EX8A 2C3UA 2WOMB 3TR5A 2NZ4A 1FRXA 2XZTB 2CVIA 1V3SA 4PAAA 1OPIA 1L3TA 3QJJA 5GMEA 4JI4J 1O51A 2KG1A 1RT6A 3FBCA 5J2PA 1U1PA 1EETA 3ELHA 2XGPA 2ROEA 3MAHA 2OAUA 5KT2A 5M2PA 5CH7B 4JI3F 3Q22A 1R8BA 3SDEB 4Y65A 1AXQA 3VZHA 3D0HE 1XIQA 2DVIA 2HG4A 2DNMA 2W9CA 3DC2A 5A6PA 3UN2A 1X9MA 3G71S 1S0OA 1RGVA 3ISND 2EW9A 2GIFA 1PILA 1HW9A 2BE2A 2R7UA 4DCJB 4CZCA 6FD1A 3DRPA 1SC4B 1GFWB 3V6KA 1H2VZ 1XQIA 4G65A 3QSIA 3LP0A 3EICA 3UNYA 1RT2B 2VG6B 1M1HA 2JC1A 5HLFB 1H3DA 3M2UA 1AFIA 1WTFA 2M7SA 1Q5YA 5FIIA 8AT1B 5LSRA 2I5JA 1K9MT 4KIAA 3W65A 2W9AA 3IG1B 4KSEB 2IC3B 4OFZA 3IC1A 3K5NA 2EG2A 3NAHA 2G13A 2ZOGA 3G6VA 3MPDA 2XNQA 1HNVB 1FWKA 4IOBA 3R1LA 3IMQJ 2XNRA 2YH1A 3O44A 4AL5A 1HBOB 5HL7Q 2DNOA 2V67A 2IPOB 4RUAA 2VB6A 2JL9A 3QATA 5T7LB 1G1XA 1FRMA 4RR5A 2PN6A 3D2WA 3QIPB 3ENVA 2K7JA 1T8EA 3QGIA 1FDAA 3ILIA 2HSEB 4Y6IA 1LXNA 4YOEA 4U8VA 4I2QB 4Y00A 2KDOA 2ABYA 1S72S 2BJ9A 4RWWA 3CT9A 1JXVA 4OLOA 5KFVA 4NYOA 2PSZA 3AB2B 2ZNYA 2HVIA 4MT1A 3QT7A 5EN1A 4I6WA 4LF2A 3KXDA 4LRBA 3NS7B 4KGZB 3H8YA 5HI7A 2RUSA 3DGPB 2P2CB 2ZM6F 2GO9A 1FERA 1MROA 1TKXA 2IYIA 4ZJQA 3BYRA 2C2OB 4DZDA 4C7QA 4DSFA 4OI6A 3GP9A 1IKYB 1HNIB 3M1VB 2AYBA 2V50A 2VBZA 4RBTA 1DFDA 3KG1A 3OJSA 3T5KA 1SUQA 3ENQA 2P8IA 3CJTA 2B5JA 2FY8A 1XNQF 4JI7J 4TXSA 1UVIA 2VV5A 4DQSA 2N4CA 5I3PA 5T41A 4EFAC 2HS3A 3G6XA 4UY8T 4WP9A 2JFDA 2BACA 3PV8A 3DLEA 3N0VA 4LQ3A 2Z2ZA 5KG3A 4J5OA 3MXHP 1FCAA 5EWEA 3D68A 1IBCB 1A6LA 2GQQA 3CVKA 4TKTA 1RWUA 3J7YI 2Q43A 2QGFB 2VODA 2MEWA 1EKRA 2K1RB 4C8YA 4N7TA 1P9YA 2XYGB 3ZTQA 1TELA 2LXUA 4C11A 2W8KA 1VI7A 4QPXA 3O8WA 2RKIB 2AJ2A 1MLAA 4JYAF 4JV2A 2IY5B 4DEZA 3CCSS 1RE1B 2C3OA 4P71A 1PYTA 1RHJB 5IT0A 2HHHF 4A8FA 2ADBA 1S0MA 1VC6A 4RW8B 4ILRA 1SJ3P 3ZXWA 2ZVIA 4U9RA 1D9FA 1OY9A 2MQNA 1XBWA 2CJAA 1Q8IA 3KJFB 4QU7A 4P75A 1PSDA 4RJVA 1N32J 2GHVC 2IM2A 4UZCA 3I4PA 4DPWA 1GNKA 3D6HB 5C2GA 4LIRA 5AXLA 2RQMA 4F3QA 1NK9A 4DXLA 1S76D 1HW8A 3CJ8A 2HMIB 3U1LA 3IGNA 1RT5B 1UL3A 2MJUA 2DNYA 3UWTA 4ICLB 5I42B 1KD1T 4EBCA 2DNQA 3DOLB 1SQGA 3PRDA 4JI2F 1MG7A 1UFLA 1VIXA 1CVJA 4LF9J 4R8UA 4YHHF 1DLOB 3BZQA 3FZBA 4RKUC 1WJ9A 3RR7A 4OX8A 3KG0A 1BQNA 3OSNA 3TX8A 2COLA 3Q8SB 1RADB 2ZH6A 4LSZB 1UA0A 2HAFA 4PXBA 4DV0J 2BEFA 3PG9A 2X1FA 4B9LA 2PA8D 1NU4A 2R8KA 1R6VA 1KBRA 1NMEB 2CZVC 2IRUA 5K14B 3OTOF 4NLYA 4JP8A 2LQ8A 2RDJA 1KFSA 4ANDA 2C3PA 3LW5C 3I5AA 4ATNA 1QAIA 3DYAA 2DRBA 3K2YA 5FD1A 2VG7B 1N56A 4LF5J 2F65A 2Y9HA 2ZWOA 1S1WA 2ZD1A 3C6TB 5B0AA 5EWGA 3VAMA 4EBDA 5CD4A 2EFPA 2JNJA 1WF0A 5KFIA 2BE7D 3EXCX 3V81B 4DV7F 1P1LA 4F3OA 4C2MA 1L5UA 1IBMJ 4TY9A 5HP1A 4U6PA 3H5UA 2HBZB 3DKDA 2OEJA 2H4YB 1FWLA 5C2CA 2X1GA 3MR5A 1QM9A 2ZHAA 4CM2A 4B9MA 3PIOQ 2GCFA 3L95X 3M8PB 2QG9B 2Z0GA 4KKOA 3CCZA 2MQQA 1HNXF 3MMCB 2APOA 2UXDJ 1UPPA 1R0AB 1VJWA 3RBDA 2L9DA 1HHQA 2VBYA 3J80U 5C42A 2V4JB 3UDVA 3PR5B 1VQSA 1PC5A 1DTQB 1CJVB 1JLQB 1HQUA 4UY85 5DM6Q 2NQPA 1FKPA 1TL3A 2B4VA 2A6MA 4NXMF 5CYQA 2BV3A 5K5MA 1YX2A 3PO4A 5HMWA 4O0IA 4F4WA 2NPFA 2CNNB 1FKAF 4B3SF 2HQCA 3GLJA 1CQMA 1PAUB 1KOOA 2XCPA 4CO3A 3PHEA 1YJRA 5M2RA 1NCLA 2LVWA 4ZIWA 4USJC 1QTNB 1BQMB 4QW8A 4FXWA 4ES3A 3T1AA 1GH8A 1N0UA 1YI2S 5F8LA 5L9NA 2NR0A 4NCGB 5CZXA 5E3CA 2FHJA 2PEHA 3MD1A 3OLBA 2EI5A 2YNHA 1JJ2R 2KTQA 1UJ4A 2HNZA 2OPRB 4USIA 1FRLA 2CRLA 1NDCA 4DFKA 2HBYB 1TL7A 1LW0B 4B3TF 4NCBA 1RCOB 3PY8A 2KKHA 1SCJB 5IM0A 2BABA 1A7GE 1RT6B 2DHGA 3LAKA 2OUGA 4ZK7M 5J2PB 1X7VA 4CLPA 4TU7A 1NSAA 1HHSA 3IR5B 4FYWB 1WHYA 1N5SA 2ZH7A 2W9CB 2DB1A 2DGTA 2CQ1A 2I9SA 2ILYA 3K8WA 3RW7A 2CA9A 4FS1A 2PA3A 1L3VA 2YH0A 1PBUA 1KNZA 1WG1A 2EK6A 4PG5A 1V5IB 4MH8A 4KT0C 4FZVA 4J9NA 3PZPA 1RAAB 3LP0B 4I4BA 1IWAA 1IXKA 3FCWA 1RT3A 2HQIA 1Q16B 3SBMA 1J5OB 4ZPBA 1S6UA 1F0XA 3M2UB 2MQOA 3CE8A 2EVZA 1WKLA 2Z4PA 2HRUA 2I5JB 1DRZA 4K2JA 2R7WA 1VRTA 4BWMA 4ECXA 4C98A 2CQIA 3E2EA 1JNZB 5KFCA 5KT3A 1TTHB 4XIUA 2E5HA 4ZKAA 5E2QA 5FLXY 1RZMA 3QZ7A 1RHUB 3FZ2A 2JFKA 5EWFA 4UQTA 3DLLQ 3LH2S 1R7IA 3EPGA 2FZCB 3UW1A 3T5LA 1WOSA 4LF7J 3DCAA 4GO5X 1NEEA 2AD9A 3O1LA 3NGDA 2KT3A 2CJBA 3RGIA 1GXLA 4A8QA 4YR3A 1KVJA 4FF3A 3VVTA 1VBYA 1HBMA 2RVJA 2P5VA 3BGRA 3DLBA 5DO2A 2KB2A 1CSJA 3KDOA 2BW7A 4EYHB 4A8XA 2FVPA 4FYXB 4DL6A 4C97A 1ZTTA 1TKXB 1NZAA 4DR2F 2RH3A 5K8NA 4LVOP 4IR1A 2E44A 1VLOA 4W90B 1PC4A 2R8HA 1VR6A 2F40A 3V4MA 4HVZA 1HD0A 2W25A 4GKJJ 3GCXP 4MK7A 4M5HA 3KFWX 1SUQB 2AU0A 3HFVA 4G1QA 2CZ4A 3EZUA 4EMDA 1L3KA 2XMTA 1OYEA 2NCKL 3GPAA 3TA2A 2R2UA 1GQEA 2L9NA 2X7IA 2O5DA 1NJXA 1XTZA 1H6KX 1SI9A 1JLFB 2CVEA 4ZPDA 4F02A 1NUEA 3R5BA 1LK5A 1HWKA 4WP8A 2NREA 3UVJB 2MZQA 2WBMA 3HFKA 2W4PA 4ECVA 3HO1A 2AGPA 1ZS6A 4HHHA 2F4VJ 3EPIA 1EP4B 3BM7A 4NZ6A 3R9LA 2R2RA 4X4QA 2C2RA 1LWCA 2O01C 4IH6A 4WIIA 1T95A 2I0XA 1MN9A 1W25A 1RAOA 2DR6A 1BUXA 2H51B 2K8GA 5F8NA 1PYSB 5C24B 3GJQB 1EZZB 4G6VB 2VZ9A 5KFRA 1ZM2A 3D0IE 4OJ3A 2ZH1A 2IM1A 3N9UC 3FCHA 2QLXA 4CCHA 3W1YC 3ZZRA 3HZEA 1S99A 2N3OA 3ILOA 2HNDA 2EFOA 3OBIA 3JAMU 2Y8YA 2I1RA 3DU6A 3VGTA 1S9GB 3SXLA 4FNIA 4MKBA 2AGOA 4AUKA 2HKEA 3HHLC 1U26A 2XYHB 1SPBP 4AL6A 4Y3CA 1EIYB 3MAAA 3FEXB 2GFFA 2KHCA 3QWUA 5FDLB 1HMVA 2XMJA 3BO3A 2HWTA 3MEEA 2B43A 4F4XA 4ECTA 2EPIA 2LMIA 4C0OC 5LSLA 2LXIA 3KUHA 1Y10A 1C1BA 4UQGA 4IDKB 4J7CA 3THPA 5EUHA 2B9EA 4DV6J 3BYPA 1YITS 3UDCA 2AEFA 1BQNB 1EB0A 2DCUB 3HKWA 4QU6A 4PG7A 2AX0A 1TL5A 1ZTWA 4UW2A 4MJKA 4C3MA 5JJBA 1UEKA 1X4EA 2KRBA 4DUYF 3BGLA 2ILZA 2YKOA 5CHCB 1KQSR 4A8MP 4QW9A 4J9RA 4B9TA 3JTOA 4NA2A 2BVZA 2C28A 3W5YA 2Z57B 3BBBA 2ZD1B 4Y2CA 2HBQB 1YDLA 4Y2AA 3CJ2A 4E0DA 2Y1LB 3BSOA 2RJZA 3W7BA 4LJMA 2BJ8A 2DXEA 4N76A 5HP1B 1X4GA 4YR0A 5CXTA 4QIGA 3W61A 3RBEA 1T9WA 2V63A 1PKUA 4JI4F 3HM9A 4DCOB 3F0NA 2XSJA 4Q0BB 3D6MB 1MWQA 3M05A 2XB2D 2PT0A 3Q8VA 4I6AA 3H5YA 2JEJA 1Q1KA 2NSCA 3ZNJ1 5LXYA 1U0HA 3O3LA 4X4NA 5GMDA 2RILA 4ERDA 3BPSP 1JXEA 4CLUA 4C8LA 2VFUA 2XY6A 2W2OP 4B3RJ 2XI3A 4C8KA 4RU2A 2KFYA 2KXFA 3MM5A 3TVKA 5E41A 4LF1A 3Q2SC 2F9DA 2LECA 3LPEA 1HQUB 1Q95G 2G1HA 3RRGA 2GIQA 1FKPB 1TL3B 2AGQA 3MECB 2XWYA 5CYQB 1UFWA 2QEXS 4DPUA 2QA4G 5G0RA 3N6LA 4FNHA 2RS2A 1SJ1A 3R3TA 2EC2A 1UPMB 1MSWD 2LXFA 4DFPA 1FNMA 2XC9A 4KPYA 3D66A 2EBEA 2VICA 1JKHB 4YS2A 3QMQA 4MFBB 4WWSA 2GVDB 2V9WA 1TFYA 4F36A 4BDPA 4YN3B 4NXNJ 3A1YG 1FO1A 2YKMB 2VUGA 2W1BA 2UVRA 2Y0SD 3GE9A 3M2VA 3CD6S 4A8OA 1H7WA 3IS9A 3M6XA 3JB9k 3VGUA 4EYIB 3MMJA 4WFAQ 3EGNA 4ECRA 4GC6A 5EX3A 1YIJS 5KOXA 1PGZA 3AA9A 4KQZA 3I0SA 2XSFA 2HHWA 3CCJS 1QAXA 3KLGA 1RWMB 2EFNA 4M63A 2DHHA 1CJKA 2E7XA 2L48A 2ZE2B 1YTYA 1MN7A 1TK0A 3H5XA 1RTJA 1E6VA 5L38A 4OI1A 4K4WA 1IM4A 1ICEB 3ILJA 4DV5J 1FESA 1NHUA 1S6QA 3VAFA 2MJNA 1EARA 4UF4A 5F0WA 1IJFB 2DBBA 4J9OA 1Z2ZA 5A8WA 1HPZB 2D74B 3OL9A 3QFHA 2C2EA 1HQEB 2FZGB 4QYZJ 1RSCA 2VOPA 4HH1A 1S49A 5F3TA 1YZ6A 1ZH5A 4CO1A 1RT3B 4QIVA 3ZO7A 2VQEJ 4JI7F 3AA8A 3EZOA 4MTPA 2YWWA 1RWPB 4K59A 2ZHBA 2OTJS 1VRTB 3M7VA 3MEGA 3W2WA 4Q5VA 3CW2C 5E33A 3J80Y 1BC6A 4ED7A 4WFNQ 4ZP6A 1Q82T 3GIIA 2E1AA 1H0HB 3Q8YA 2QLBB 4LSLA 4BC7A 1IKWB 3PYFA 3DI6A 4HDHA 2H5JB 3GCWP 1SL2A 5KT7A 5HVFA 2DR9A 4L72B 3OJUA 1LFPA 1Y7PA 5KG2A 1G4CA 1UP1A 2B4UA 3S8SA 3IAS9 4OL8A 2QZ8A 2EWHA 1WOPA 2AJ0A 1NXIA 4ZDNA 5K8MA 1S1UA 5LJ5Y 2DIUA 3PW7A 4D3GA 2D3O1 1LWFA 2E5IA 3BQ1A 3KK2B 4TN2A 2EC0A 5AXNA 4LRDA 4K0KJ 1ZPVA 1HBMB 2XY5A 2MDAA 3VAGA 3VZIA 2XBPA 1TAUA 3BGRB 3HVTB 4M5NA 3D54A 1HBNA 1FF2A 1PG5B 2CQDA 4FF1A 1EHWA 3IN5A 2ALYB 1ACMB 4ED2A 4DSLA 2PGCA 1RYRA 4K4ZA 4C48A 2DHAA 4WE1A 2DNKA 2DH8A 3IWNC 4IFVA 2JLEA 5A6WA 1VYAA 4A8KA 4L74A 3RZAA 2XWXA 3N6NA 4HT5A 2OTLS 4DR7J 2WW8A 5F8HA 2D3UA 5B0DA 2VASA 5KFEA 3DLJA 4OLPA 1PJ6A 1UEUA 4OI4A 3G86A 3AJ1A 3OUYA 4Q2LA 1SKWA 1SC1B 1Y5IB 2KL8A 2CG4A 1QVGR 3BGUA 2POKA 2YTCA 4IG0B 2ZH4A 4JI8J 2AJ4A 5LMNJ 1OY6A 4LF9F 2ACMA 3R5JB 2G0IA 1FVQA 2HK3A 4EO6A 4EWTA 5KFKA 5F8MA 1U2FA 4DJBA 3L7PA 4TY8B 3R6LB 3SCJE 4OX9J 2DHXA 3HVRA 1YRXA 1L3UA 5LM7E 4DV0F 1N5VA 3BN4A 1LWCB 2MSSA 3I55S 3TOQA 2IDEA 2LQ9A 2YVSA 5KFNA 5H9EK 5J1EB 5DDQC 3MMCA 3H5SA 4NLSA 5L1IA 8RUCA 4ILMA 2WVBA 3TUJC 2NXCA 3TANA 4U7UK 1CG2A 3LP1B 4LF5F 2HVZA 2KYXA 4DU8A 1SJRA 1BE4A 2RRBA 3TARA 2ASDA 2Q6CA 2B3TB 1GMWD 2HNDB 4RW9A 1IKVA 1IBMF 3NOGA 3HHKA 3TX0A 5KG7A 1JLBB 3HF5A 2CPXA 3NMAA 1NPRA 3IWLA 2FVRA 3MAAB 4UTGA 2V2ZA 3MFHA 1OSCA 4DR6J 2HZCA 1WC5A 2DYAA 4OZ1A 2DGWA 2MY8A 3PYDA 2GAGC 4LF6J 1C1BB 2UXDF 1X4HA 1K73T 2IIHA 3WC0A 1DJ0A 4CH1A 2C2ZB 2OFGX 4ZP7A 1VGYA 4ECYA 3W5ZA 1T9XA 1NK0A 2HZVA 4I6YA 3ZZTA 3H2VE 2CPYA 2JEIA 3BEGB 1GXTA 2ZBPA 2M52A 1R8CA 1UWBA 3CCQS 4ZVPB 1SIWB 2BA9A 1NK7A 2KO1A 4O3QA 4K4VA 5ETPA 1S1TA 1REGX 4F04B 4X66J 2BR0A 3RB3A 3ETOA 1KR4A 1OMSA 3AOBA 1N48A 3DRYA 1GK8A 2ZKUA 2ZJRQ 3W62A 2I38A 5E7OB 2YWFA 2GGPA 4UUWA 4IOCQ 5G4DA 3E01A 2HWHA 5KG4A 5KG6A 5A8RA 2YX4A 2OPQB 1VQNS 3DNCA 5KT5A 2MKIA 3QAEA 1YK9A 2DRDA 2ADCA 5KG5A 5HMXA 2D9OA 1U1RA 4USMA 4ES2A 1SB6A 3MUTP 3MUVP 4ID5A 4DDFA 1RTZA 2GW8A 3NCRA 1T9YA 2FHJD 3BPDA 3RG6A 2XZWA 2XSJB 3E51A 3OQ2A 2CQ4A 1D0EA 1NDLA 2CNLB 3PW0A 3DDKA 3EE3A 1UTAA 3UD3P 1S1XA 1SJFA 3H59A 1RWXB 1CBKA 4ITSA 3AAWB 1WHVA 1Z2LA 2RU3A 2KVIA 4KTQA 4FP9A 4G1PA 1S0VA 2VPWB 1RAFB 2DGUA 4ES1A 3MFIA 5SUHA 2AYMA 1WHXA 2QLJB 2XHCA 3MM5B 3A3OB 2OD6A 2DH9A 2IM3A 3H4BA 1SQFA 2FUG9 4PRFA 2BOAA 3CJ3A 2HHSA 4DF4A 3PIPQ 3M9NB 3ENWA 2B8PA 4C4WA 1U45A 3R2DJ 2K7KA 4LIWA 1TKZB 3W3SA 2HGNA 2ZH3A 3KK1B 2MSTA 2RAQA 1K0TA 3MAQA 1AYEA 4JI5J 2XGQA 4L3NA 1RLCL 2C2KB 2OEMA 1UMJA 3A8KA 1V3ZA 4KV8A 4Q45A 2OI2A 4ZPCA 2DEJA 1BLUA 2AP6A 2WW4A 4OJ1A 1ZAVA 2F3JA 1WEZA 2RNEA 4HKQA 1KVIA 1Y00A 3OFEA 3R6GB 2VONA 5L1KA 4LF7F 3DM2A 4ZPTR 4ZIVA 4Q8EA 1CJKB 2Y0BB 4LR7A 3DHWC 1M0SA 1P27B 2BZ2A 1RTJB 1E6VB 1WEYA 4KBIA 1KDNA 2C2NA 4O44A 2IJRA 4W98A 2YQ1A 2DJWA 4NI2A 2O67A 5JVGQ 4KFBB 3UE2A 2IYGA 5C25A 4B9SA 4DR4J 2IAJB 3ZZUA 3QWPA 5J2MA 3NWGA 3EVOA 1S6QB 2C42A 4WFBQ 3W66A 7FD1A 3CB4A 2MZSA 4OJGA 3J81U 5I3QA 3NGRA 1AUDA 1J2VA 2N82B 2FTRA 4USTA 4WFYA 4GKJF 1MU2B 2MKCA 2VG5A 4U96A 3MM9B 3M6WA 1TK5A 1YRTA 1REVB 2V8HA 1RBAA 5I4MA 1IVZA 4MK9A 2UUCJ 2X1BA 2R7TA 2OLWA 4ZP9A 3R7NB 3W2WB 5HQMA 3G96A 4QIWD 4YB7A 1FXLA 4DZ6A 2GA7A 2J9DE 3GU0A 3K8VA 2KT2A 3DLGA 4NLQA 2NXEA 1SV5A 1ZAXA 1IWGA 3L4BC 3ZTRA 3DI6B 3Q89A 1N34J 2AIRB 2DNLA 4O4GA 3PFOA 3W2VA 1Q78A 4G3IA 3TNVA 3EVMA 2J7UA 3OTEA 1ZOTA 2WOMA 3EVWA 4DHVA 2CWKA 3SCIE 3HFZB 2UVUA 1U8SA 4PWWA 3VTIA 2VC1A 3P3DA 4OYXA 2R7XA 2MKYA 2F4VF 4X62J 2YKQA 4HACB 5D77A 4DWIA 3GV8B 3AQPA 4K7QA 4LUBA 2DGSA 2Z2YB 1LWFB 4DFJA 4QIEA 4Q2MA 3R1HA 4J9KA 4N41A 1KHVA 4AE5A 2HS4A 2ZEJA 1IUJA 4PEOA 3BDEA 1VOMA 2L08A 1W2BR 1FTCA 2ZDPA 1HBNB 1UETA 2CADA 1Q8LA 2FYXA 2ZFHA 3OSPA 3OHAA 1DY3A 4CRJA 2V8DA 2W7OA 1S48A 4K4XA 2FHOB 3KNAA 2VU5A 4IFVB 3W8GA 4LFCJ 2H9ZA 1DQ9A 3AJDA 3I32A 2MZTA 3OR2A 1C4CA 4DX5A 4I68A 2OHDA 3KNGA 1QE1A 5F0UA 5HLFA 2ACYA 1WI6A 3AJ2A 3WBZA 3SSSA 4TU9A 5BXIA 4CLFA 2XZDB 1BD6A 3IG1A 2IC3A 4KHMA 2W7AA 1CC8A 1D9DA 3CWJA 5F8IA 1YZ7A 2CQBA 4RZRA 1DURA 2FD2A 3NEKA 1JLGA 4LF8J 4DV6F 2UUBJ 3RBZA 5KFLA 4IYQA 4ZCIA 4OHYA 3QIPA 3H42A 2M9KA 3FKBA 2MQMA 2BKNA 3GB0A 2RQCA 4MMOA 4F2RA 2E7WA 3DOMA 4B9NA 4M8LA 5ETLA 4K4YA 2JEGA 4I2QA 3TQ1A 2GV1A 1T9TA 1GMUA 2L3MA 3VQTA 1HI1A 4HL9A 1NM2A 2B7BB 1RCXB 2R7RA 4Y2MA 3FRZA 1N54B 2XQCA 4C3LA 3EX7B 1U1OA 3DGPA 1ZZNA 1DZ5A 4DUTA 2PDAA 1VBKA 4CH0S 3EWGA 2BRLA 3R5GA 1T7PA 3IFEA 5IV4A 3TVZA 4PXCA 4P9SA 3CJ4A 2ALZA 3F73A 3V6DA 4ZVRB 3OT9A 1IKYA 3KJQB 1X0PA 4RW9B 2ZUGA 3HVWA 4HDGA 2R7QA 4DN9A 3C66A 3GYXB 2BRKA 3WQPA 1KQKA 2FJDB 2DEIA 2OPPA 4CLSA 4ZLLA 1KQGB 1C0TA 1NZ8A 3BB5A 2WRMA 5L1JA 1YLXA 2EFQA 2XM3A 3KWMA 2VDIA 2Y3YA 2HQFA 2E29A 3O6QA 4URGA 2HFSA 4ZVQB 1VC5A 5IQQA 4CLLA 3NL0A 1SC6A 3O2IA 3LP2A 3KTQA 2HAIA 3UI3A 1VCTA 5ADZA 4E98A 3LQVA 4B3RF 5F3ZA 2Q6BA 3GJRB 2K1RA 2MLYA 4ZPAA 2EG1A 3QT5A 1KONA 2RKIA 3DOKB 1UWBB 1W2IA 1NK5A 4OYZA 1WUUA 2NSBA 5L9XA 3SV4A 2CQPA 5GAGU 4FVCA 1RTIB 4YB6A 1S1TB 2GJFA 4EU0A 2J0SD 1E6YA 4MYTA 4PPZA 2BQUA 2R7VA 1FXDA 2V8PA 3ET6B 5IC6B 3PKMA 2N4DA 3LAMA 2GGPB 4MKYA 2CQHA 2HFOA 4NXNF 5IS2A 4ZLPA 4MAKA 4YDXA 1TU0B 2B9XA 4IRKA 4M5DB 2KJWA 1RABB 3GR1A 2XTJP 3BSCA 2QLFB 5KFBA 1RTHA 2ZZNA 2QA2A 3THVA 2PD1A 2WB1D 3JSMA 1Q81T 1KLMB 4PYAA 3OTCA 1T02A 2DTJA 4OI2A 4KC5A 2HMIA 2CQGA 2J0WA 2M4MA 5DG8A 2HQDA 2MKSA 4U7CA 4ICLA 5I42A 1NNDA 1XK8A 2VFTA 3CDUA 2Z30B 2B6AB 3OR1A 1DBDA 2PI4A 3JQMA 4C3KA 3TZYA 3MGJA 4HYKA 3J7A1 2DPIA 3A8IA 3GFXA 4JV0A 4KGMA 1S79A 1RWKB 3T6JA 1HD1A 4DV5F 4WU3A 4LREA 4EEYA 2MMYA 4G1IA 2KFZA 1LWEB 1S59A 2QL7B 4PR6A 2UVVA 5EDWA 3GG0A 4XTTA 1DQ8A 1KLNA 2FJWA 2WZ1A 4NEYA 3FVYA 3M8QB 3BO2A 3KLHA 3I56S 4OZLA 3CC7S 1R0CB 3R7SB 1FX4A 2K3KA 2FGOA 3PR4A 4Z2XA 1VS3A 2VQEF 3BS9A 4F7VA 1H73A 3BN7A 4X4OA 4LSNA 2F9JA 5A2QU 1DAXA 2OELA 4DR1F 2F7VA 3D5MA 4M5GA 3NNAA 4X4VA 3KDNA 2G9OA 2Z56B 5K9FA 4CLKA 1RHMB 3BBFA 2SXLA 1TR0A 3SQGB 4NLXA 3HX9A 2W2NP 1M5SA 5DETA 1WSRA 2DGOA 3UCUP 1QTMA 1S6PA 1HWLA 4B17A 4ZLJA 4JI1J 1RU2A 3A8EA 3TZZA 2OEKA 4OHZA 2F8MA 3DM2B 4Z37A 2BM1A 3M8PA 2F5GA 2PMHA 1JXLA 1U7LA 2QT7A 2ZJQQ 4O44B 4OYIA 4K0KF 4X4TA 3BGFA 3AT1B 1U1MA
chains in the Genus database with same CATH topology
3HZEA 5C25B 1S99A 1URNA 2N3OA 1MMLA 3CCTA 3IAM9 2UP1A 2HNDA 5J2MB 5CYJA 3HPOA 4P6QA 2Q79A 2R8JA 4N5SA 3E8OA 5IQ6A 2YKNA 2BW2A 1V9OA 2EFOA 2P6TA 1VK8A 3OBIA 1N8RT 1X4AA 2I1RA 4LVNP 2XS2A 3DU6A 4BS2A 1S9GB 4ECZA 2PC6A 3SXLA 2FY1A 2E1RA 4FNIA 2VQFF 2MZ1A 3D0GE 4USHA 4MKBA 3CDAA 2AGOA 1JLQA 4AUKA 4OJHA 3HHLC 2IVYA 1U26A 1LFWA 3SDEA 4WFXA 3M8SA 4H4OA 4AL6A 4Y3CA 1SQEA 4XDCA 2YWKA 4IRDA 3FEXB 2GFFA 2OIHA 2KHCA 3QWUA 5FDLB 2VG5B 4O4RA 1HMVA 3LGMA 1JJHA 2FVSA 2XMJA 4F3MA 2KM8B 1DHMA 3BO3A 2FGCA 2HWTA 2HHTA 3VALA 1F5AA 3MEEA 3MM8B 2B43A 4F4XA 1U25A 5HQ8A 4ECTA 3MM6B 4DR7F 3PFEA 2EPIA 2LMIA 4C0OC 5AJ3F 3MEDB 5LSLA 4QR2A 2BUNA 2LXIA 4NMLA 2UVWA 4H4KC 2HGLA 4IR9A 4QR0A 3NG8A 2D41A 2A18A 1WI8A 1C1BA 1HBUA 1XR6A 4C0HA 3DXBA 4UQGA 4WE1B 4IDKB 1Q7LB 4DL2A 2PI5A 3THPA 2XY7A 3BR8A 5EUHA 2JZ5A 5F9LA 2FHKA 1YITS 3UDCA 4DV1F 3MPYA 1BQMA 1FHTA 2DR7A 2UXBF 3MHYA 1YWXA 2M2BA 2YY3A 2E66A 3NLCA 4QZVB 2JVOA 2KZMA 2ROPA 1SV5B 1N52B 1YJUA 1BQNB 4I64A 2Y1IA 1H2TZ 1YJNS 1YRUA 2DCUB 5J2QB 2P6SA 4N8OA 3B8HA 4JI8F 4C9DA 1RT2A 2VG6A 4NCGA 2GNKA 2QE5A 4PUOB 2LLZA 2N3LA 3F41A 1SH2A 1OQ6A 3HKWA 3SFUA 5LMNF 4PG7A 4QU6A 4WYWA 3OXFA 2AX0A 1YJVA 2KZZA 1VQ4S 1TL5A 1ZTWA 3C6UA 3MOZA 1D8YA 4O4GB 1LQ9A 1Q7YT 1KFDA 4UW2A 4MJKA 1RQ0A 2YNIB 1T05B 2J8AA 4C3MA 5JJBA 2MGZA 2XMMA 3M32B 3QPIA 5E3RA 2XCAA 5DGBA 1X4EA 2KRBA 4DUYF 3BGLA 2DPJA 1Q4RA 2B7CB 4K2XA 2RQ4A 4KHRA 3TAMB 3OUYB 1HYSA 5LSOA 1LW0A 1C0UB 2BJDA 3NS6A 2DK2A 3MEKA 2I8EA 4OX9F 3CCMS 2DH7A 2ILZA 1HNVA 2YKOA 2V2KA 1SKSA 4WXWA 5DDOC 5CHCB 1KQSR 1B64A 4A8MP 1GTEA 2YKPA 5KFGA 1HBOA 2FLOA 2GMHA 4QW9A 4J9RA 3GSDA 3UFCX 4QCLA 4B9TA 2PFFB 1U1KA 1YJTA 3D1HA 3JTOA 1TUVA 3GMGA 4NA2A 3ISZA 2BVZA 2C28A 4FYDA 1SJ4P 2B51A 3PW4A 5T7LA 1FD8A 4NLOA 4QOTA 2J7KA 4MIWA 2DD8S 4NYZA 4RWXA 3ZFVA 4OV1A 2HS0A 4A8YA 2ZD1B 2NS1B 4HT7A 3DMJB 3DLKB 4ZPWR 4Y2CA 2GHWA 3R5DA 2UUWA 5AE3A 2WAQD 3QAUA 2ZZMA 3QLHA 2JC0A 5KFPA 4Y2AA 5BYRA 3SZ2A 3S01A 3R27A 3CJ2A 2GMJA 2QA1A 4E0DA 3MDFA 1DTTB 1CC7A 2OD4A 4BBYA 4D3HA 4NLDA 3RRKA 3T1YF 1TKTB 3BSOA 2RJZA 3W7BA 4LJMA 2XULA 3HLUA 1Y5NB 4N76A 5HP1B 3FNNA 1X4GA 1NH7A 2O66A 4YR0A 5CXTA 4QIGA 5B0FA 4N8NA 2ZDOA 3RBEA 3X3UA 1HWJA 2GJ2A 4JI4F 3MPWA 3CD7A 1HFEL 1IQZA 1KOHA 3HM9A 5DLFA 2XSJA 4Q0BB 3OVAA 3NNHA 2G1DA 3PXGa 2E5JA 4ED5A 1D1UA 3MOJB 3M05A 4J9MA 4DL4A 1Y3KA 2XB2D 2PT0A 3OR2B 3H2LA 4I6AA 4Q7AA 3H5YA 2JEJA 2J0XA 1Q1KA 4I56A 2RSQA 1S10A 2I2YA 2NSCA 1N5TA 3MURP 5LXYA 1QE1B 4EO8A 4RW4B 4RU9A 2AWZA 3O3LA 5K8PA 1J5OA 3B4MA 4X4NA 3DOKA 1HARA 5KFSA 3S1TA 3C46A 4FF4A 2RILA 4ERDA 3CEDA 2UUBF 5B09A 4IH7A 3HXMA 1JXEA 4JV1A 2QLWA 3EXYA 2GJIA 2JSXA 4NX9A 2HNYB 4NPOA 1KTQA 4C8LA 1LW2A 1WG4A 3G8QA 1RTIA 3NCQA 3J7ZT 2AX1A 2M8DB 2VFUA 1WWHA 2XY6A 1HNIA 3PDNA 3M1VA 1IKVB 2DHSA 2XI3A 2VKZG 4RU2A 4C8KA 3MD3A 2KFYA 2KXFA 3HHEA 1EETB 2IMWP 4QIFA 4DR6F 3MM5A 3TVKA 2FLLA 3VR1A 4KRWA 1XERA 5E41A 3JYTB 4ZHRB 3Q2SC 1T03A 1QSYA 2F9DA 3FQKA 2LECA 3GFHA 2ATLA 1NJWA 4LF6F 4WKRA 2IA6A 1N6QA 1HQUB 5F9NA 2KM8C 2ASLA 1U47A 4NA1A 5KAKA 1JLGB 3RRGA 2KN4A 3VAIA 2GIQA 1FKPB 2R2SA 1TL3B 3SYZA 2AGQA 3MECB 2XWYA 5CYQB 1UFWA 3LWLA 2QEXS 2LQ5A 3QGGA 5KFMA 1VC0A 2W24A 1YQHA 1LV5A 3CD0A 1S4FA 3QIDA 4GC7A 3CJ5A 3K5OA 4PXDA 5G0RA 3ZZYA 3N6LA 4CTAA 2QA4G 4FNHA 4YDDB 3JSRA 2RS2A 1NK8A 4M5DA 1GXUA 1NAQA 1SJ1A 1HWUA 1APSA 3R3TA 4RW7B 2JJ4D 3N4WA 5KG0A 1MSWD 1R3NA 4X2BA 3RAXA 2AF6A 2LXFA 4DFPA 4YMEA 4X4SA 1FNMA 4KO0B 1KTVA 2XC9A 4URSA 5MLCV 4KPYA 2EBEA 2BE2B 4Q8FA 5DDPC 3BF4A 4EUVA 1JKHB 2ZH9A 1SL1A 3QMQA 5D8HB 5GAHU 3C3LA 4MFBB 4X66F 1KLMA 2DNHA 3DRPB 2V9WA 3OFGA 4P7VA 4RNFA 2V5HG 3V4IA 1TFYA 4UOCA 4BDPA 2WTFA 3NP5A 3N6MA 3A1YG 4OMFG 1FO1A 1MWZA 1VHFA 3AB4B 4LT6A 2YKMB 4PQAA 1CPZA 1S9FA 3NMRA 1RT7A 2VUGA 3PACA 2UVRA 2Y0SD 3TA1A 1XR7A 3HJFA 3GE9A 3VQSA 3M2VA 4YB1P 3KMSA 3CD6S 4A8OA 1H7WA 2J6TA 2WCXA 1IQTA 3IS9A 3M6XA 3M4XA 3I82A 2FJXA 3GIMA 3JB9k 1FT8A 3MPVA 5GAGI 1TKDA 3MZIA 4JBCA 1NKBA 3SSRA 2JEFA 3OVSA 1X5TA 2KHDA 3CCLS 4EGLA 4EYIB 4YFUA 3MMJA 4WFAQ 1FE0A 2RU9A 4TQRA 2B6AA 3EGNA 4ECRA 3PNIA 4WZQA 4DQQA 4DSJA 4GC6A 5EX3A 1UAWA 5AXMA 5HROA 1YIJS 4NLPA 3US5A 4DBQA 1N0VC 1XNRF 5KOXA 5J2NB 2GHPA 1PGZA 3AA9A 4V19J 1R6YA 3MWBA 5BYQA 4PKDB 5I3UA 1SKRA 1RTDB 2YWEA 4I1TA 3I0SA 4KQZA 2XSFA 2HHWA 2QSWA 3CCJS 3IRXB 4IH5A 1QAXA 3KLGA 1UW4A 3JSBA 3L3CA 4RBUA 2ZJPQ 4RW8A 3IGVA 3JAMY 2OH2A 4EZ6A 2EFNA 2N7YA 2WSCC 1S1VB 3NBPB 2DIVA 4M63A 3MR6A 2DO4A 3V6DB 3D1OA 3DU5A 2Q66A 3QJLA 4IOAQ 1FJEB 6FDRA 1KC8T 2C22A 2UV8G 2E7XA 3G8SA 5DM7Q 2L48A 4H4KA 4Y28C 2ZE2B 2VD3A 1YTYA 3E01B 5BYSA 4K50A 1YBAA 3QO9A 2XLIA 5K8OA 1LWEA 1O5JA 2C3MA 2IBOA 2J0QD 2KXNB 1TK0A 3U7JA 4O3NA 3SEOA 5A8RB 1RTJA 1E6VA 3H5XA 3NAIA 3N28A 4FVMA 5L38A 4K4SA 3Q0A