4ZKAA

High resolution crystal structure of fox1 rrm
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
83
structure length
83
Chain Sequence
ENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structure of Fox1 RRM
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords RNA binding protein fox-1 homolog 1
total genus 20
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zkaA01
3MI7X 2RRBA 2D9OA 1K73T 2DHGA 3NNHA 2LMIA 1WF2A 2RUGA 2LKZA 2MQNA 5GAEU 4YB1P 1CVJA 4CIOA 2EK6A 1FJ7A 5GMKa 1DRZA 3BO3A 1VQ7S 1JMTA 1NJIT 4BS2A 4ED5A 1VQ8S 5DM7Q 4QU6A 2DB1A 1ZZFA 1VQPS 2DGQA 2X1BA 1X4EA 2DGSA 2KT5A 2K3KA 2JRSA 3MUMP 2HGLA 2AYMA 3G6ES 3CMAS 3HI9A 2CQ4A 1WHWA 2FHOB 5JVGQ 2KI2A 5IQQA 2FPHX 3CCMS 5CYJA 3JB9k 2KU7A 3G9CA 3MUVP 2CPIA 2MGZA 1U1KA 1X5PA 2J76E 5JVHQ 2D3OR 3ZZZA 1U6BA 2N3OA 2KXHA 1X5SA 1WHVA 2L08A 3P6YC 2LA6A 2GO9A 1FO1A 4Z2XA 1SJ3P 2CPJA 3G4SS 1FNXH 2K8GA 2VOPA 3IRWP 4PRFA 2V94A 3NMRA 3Q2TC 1YITS 2M70A 1SJRA 4Y00A 5CA5A 2RS2A 1SXLA 3FEYB 2VOOA 1VQ6S 2YH0A 2A3JA 1WHYA 2DISA 1SJ4P 1Q7YT 2DHSA 3B4MA 2DGVA 2BOPA 1RK8A 2RNEA 1X4DA 2DGTA 4F26A 4TU9A 3OW2R 3CD6S 3CCRS 4PR6A 4WF9Q 3N9UC 2U1AA 2FC8A 5DDOC 2DHAA 2DH8A 1H6KX 1YIJS 4LIRA 2CJKA 3TP2A 2MGZB 2CPHA 2G0CA 4CQ1A 1X4BA 1WWHA 4LJMA 1X4AA 1R8PA 2F3JA 5D78A 2QFJA 2DGXA 3UCGA 1KOOA 1YWXA 3MUTP 2MXYA 1QVGR 5EN1A 1BY9A 2AYEA 2DNKA 4WFBQ 1S72S 2MKHA 4W92B 5LJ5Y 3CCLS 1PGZA 5ITHA 5LXRA 2MKSA 2MHNA 1VQMS 2KYXA 3SMZA 2YKAA 2KM8B 5FJ4A 3Q2SC 3CC4S 1WI6A 2XNQA 4C4WA 2KHCA 3VAGA 3CCUS 2MKIA 2MKKA 3BEGB 3R1LA 3NS5A 3B4DA 2X1AA 1U1NA 4IUFA 1U1LA 4F25A 3I56S 2XS7A 3CF5Q 2JWNA 2KXNB 1WHXA 5LSLA 1P1TA 2QEXS 2LEBA 1HL6A 2MQLA 5HO4A 3J7ZT 1VC0A 2OTLS 4ERDA 3RW6A 2O3DA 2ZJQQ 1VQ4S 2F9DA 1WG4A 3U1LA 1R8HA 1U1QA 3CMES 4YOEA 4WKRA 2NLWA 5GAGU 4UQTA 4OZ1A 2HVZA 3PIPQ 3TYTA 1VBXA 2MZ1A 3S6EA 5LSOA 1WG1A 1OWXA 1NO8A 2XS2A 1WEYA 2LA4A 3HHNB 1VBZA 1O0PA 2CPEA 1M1KT 3DXBA 1OPIA 2EK1A 5IM0A 4J5OA 3MURP 2CQ1A 2N82B 2MY7A 2CQIA 2MKCA 5GADU 4WIIA 4CH0S 1URNA 2MQOA 3SDEA 1H2UX 2KRBA 2OSRA 1X5OA 2ZJRQ 4V19X 2CQ3A 5CXTA 1N52B 1HA1A 3MXHP 4FXVA 1N88A 1N54B 3L3CA 4TU7A 2DNNA 2RQ4A 4WFNQ 3S01A 5LXYA 1UAWA 1X4CA 3NNCA 2Q79A 1S79A 2DNLA 2B0GA 3FEXB 2MQQA 4IOCQ 1G2EA 2DH9A 1WG5A 2CQ2A 3UE2A 1RKJA 4TU8A 1JJ2R 3VAFA 1ZH5A 1SJFA 2HYIB 1JJ4A 3CCQS 1UP1A 2KRRA 4PKDB 1M5OC 2FY1A 2RVJA 2MYFA 1A7GE 5IFMA 2JVOA 1FXLA 1OO0B 1HD0A 2MMYA 2E5IA 4F02A 3LPYA 1U1MA 2DGOA 3BO4A 1VQOS 2HGMA 3VAHA 2KN4A 2MKJA 3CUNA 4W90B 2CQGA 1YTYA 1YHQS 5DDQC 1N8RT 3US5A 2E5JA 2DNZA 1M5VC 2DGWA 2M7SA 3MD3A 1DBDA 2DNYA 2DNHA 2RS8A 2KG1A 3H2UB 1PO6A 4IOAQ 2GHPA 4UY8T 1P27B 2CQHA 4WCEQ 1FHTA 1OIAA 2DNQA 2CPXA 1U1RA 1ZZNA 4EGLA 2MSTA 3S7RA 3MOJB 3R27A 2LXIA 2L9WA 4TLQA 3RW7A 3THTA 2LYVA 2LECA 5HL7Q 5DM6Q 2JVRA 2PEHA 4M5DB 1UW4A 1YJ9S 1VQ5S 2M9KA 4QQBA 1VC5A 3TO8A 2MJNA 2RQCA 3DLLQ 5DDPC 2XSFA 3G8SA 2KFYA 1D9AA 3MD1A 1WTBA 5GVQA 3D2WA 2KH9A 2ADCA 1FJCA 1X4GA 2RRAA 2VODA 1YI2S 3VALA 2DNPA 2KM8C 2J8AA 3CPWR 1Q81T 4QU7A 3P5TL 1VQKS 2N7CA 2MQMA 1Q82T 2HZCA 3K0JA 3UD3P 2MZQA 1AUDA 2M4MA 2HGNA 1B7FA 2MZRA 2QA4S 3MDFA 2RT3A 3CCES 1KQSR 2XB2D 3EX7B 2DNOA 2JX2A 3G8TA 1K9MT 1K8AT 2CPYA 2DO4A 3VAKA 1FT8A 2LCWA 2OSQA 2OIHA 2ZJPQ 5DETA 3CTRA 1X4FA 1YJNS 1D8ZA 1U2FA 3H2VE 2VONA 1FJEB 3J7YU 4FXWA 2DNGA 2E44A 4ZKAA 1VQ9S 3UD4P 1U1PA 4U67Q 2CPFA 2MPUA 4A8XA 1QVFR 3THPA 1WELA 4WFAQ 1UFWA 4C0OC 2YH1A 2J0SD 2MZSA 5BJRA 1U6FA 2E5HA 2MQPA 1H2VZ 2YTCA 3SDEB 1WI8A 2DIVA 2CQBA 2CQCA 2DITA 2MB0B 2DIUA 3ULHA 1JJHA 1KD1T 2CQDA 1WF0A 1X5TA 2CPZA 2FC9A 3CCVS 2EVZA 3EGZA 1W2BR 2YWKA 4C7QA 2D9PA 2CPDA 1M90T 2M2BA 3ZZYA 1U1OA 3S8SA 5D77A 3CCJS 3VAMA 1M5PC 3VAJA 3NS6A 4YUDA 2DO0A 5DDRC 2M8HA 3BS9A 1M5KC 3I55S 2L41A 1Q86T 3CULA 2MZTA 3G71S 2E5GA 4RU2A 2X1FA 4OZ0A 3SXLA 1IQTA 4IO9Q 1VBYA 2AYBA 2DHXA 2I38A 1QM9A 2X1GA 2MJUA 1WEXA 2U2FA 2LQ5A 1WF1A 3UCUP 3CC7S 2BZ2A 2M0GB 1SJQA 2ADBA 1F9FA 2N3LA 5LJ3Y 2CQPA 3VF0B 5MLCV 1DHMA 2WBRA 2J0QD 3UCZP 2XS5A 1L3KA 2LEAA 2SXLA 2XNRA 4LMZA 3P49B 1WEZA 1HD1A 3G96A 2PE8A 4P6QA 2M52A 1XN9A 2M8DB 3BO2A 3R1HA 1DZ5A 2G4BA 2DGUA 3IWNC 3NNAA 2I2YA 4CH1A 1NU4A 1VQLS 2AYGA 5H1SV 1VQNS 5GAHU 1KOHA 2UP1A 2ERRA 2KXFA 4Y0FA 5IM0B 1KC8T 2LXUA 3CXCR 2MSSA 3PIOQ 2DH7A 2DNMA 3CC2S 2MY8A 1VC6A 3U1MA 2OJ3A 2DNRA 2MZJA 2F9JA 2KVIA 3LQVA 3VAIA 2OTJS 2AD9A 3V4MA 1X4HA 2CQ0A 2RU3A 2NZ4A 1X0FA 2KG0A 1A9NB 4QPTA 2M88A 3CCSS 3EGNA 2DK2A 1H2TZ 3P3DA 1YJWS 2G1DA 3UWTA
chains in the Genus database with same CATH superfamily
2VG6A 2ZZTA 3A8IA 5J2QB 3BBBA 1UVKA 2XYPB 4FDFA 2RHSB 5DGAA 2MQNA 2RUSA 1CVJA 2B5JA 4RBTA 3BGOP 2JOQA 1S1WA 4LF5J 2VFVA 4JYAF 3R2DJ 2QYCA 3RU0A 2HURA 3UVJB 4EYIB 4NLUA 1JWWA 2XCPA 3TARA 1IWAA 2CNKB 3NGUA 2QL5B 5DM7Q 2WOMA 1VQ8S 3CDAA 3MM6B 3QLHB 3T6BA 1FFWB 4QU6A 4WZMA 1R0AA 1EKRA 2AEJA 1C2PA 3QLHA 4FVMA 2MHEA 4RW6B 5F9LA 5F8JA 1RZMA 3I96A 4WYWA 3H40A 1VJQA 3QJLA 2KT5A 2K3KA 4PYAA 2DVIA 5G0RA 3MUMP 2CJAA 1GX6A 3GJSB 2B6AA 3M6WA 3HI9A 1ZAWA 1WACA 4MJKA 3NMAA 1WHWA 3E3XA 2FHOB 2Y1RI 3H59A 4HR2A 1Q5VA 5IQQA 3HVWA 4TY9A 4JV1A 1BWEA 5CYJA 2VQFF 3G9CA 2YBVA 4AL6A 2AJ2A 2DEJA 5E3AA 2W8LA 2G2ZA 4OYWA 2XM3A 2CPIA 3KK3A 2NXCA 3PNIA 3MM6A 3QFHA 2MGZA 2AQ4A 4K7QA 5C5JA 1KN6A 1U0HB 2MLYA 1UJ4A 2HS3A 3LW5C 6AT1B 5KFJA 2D7SA 1FD2A 4M1KA 1VCTA 5ETVA 3P6YC 1WUUA 4G1IA 1ROFA 1FO1A 4F4YA 2V9KA 5HP1A 2V2ZA 4ZPBA 5HROA 4E98A 3P96A 5FDLA 3L7UA 4CI0B 2VOPA 5J1EA 1ZYQA 4YY3J 1T9XA 5FLXY 5LMUJ 2HBYB 2JDJA 3W2WA 6FDRA 2CADA 2XEXA 1SXLA 3AXMA 1NRKA 3DDKA 3FEYB 2V8HA 1S9EB 2VIHA 2A3JA 3KWMA 4R0JA 4K4WA 3GR1A 1NHVA 3W7BA 1VRTA 2AGOA 1U45A 1X9WA 2UZAA 3T1YJ 3BV8A 1FDNA 2BOPA 2KL8A 4RLEA 2RNEA 1T05B 2DGTA 1AUSL 2YQ3A 3FDSA 4DG1B 1Z4UA 1JLCB 1IUJA 4IDKB 3DOKB 4WF9Q 3KJFB 2LQJA 3MAHA 4DMZA 2XO6A 2FC8A 5C2CA 2PI5A 3JTOA 1GMWD 2IYIA 4UUWA 4DDFA 1VQYA 1HQUB 2OLWA 1KVKA 1K47A 4M8LA 4A47A 4NA1A 4CM2A 2CJKA 4LVNP 4R25A 1RSCA 4DFKA 1AB8A 2W7AA 4LJMA 1R8PA 1ICEB 1U09A 5D0RA 1C1BB 3LTOA 4UOHA 2DGXA 3MM9B 3UCGA 3ZTOA 2B4OA 2B6AB 3MUTP 2ALYB 2R7QA 3BKTA 2MXYA 3J7Z5 3B8HA 1V5IB 2JFKA 5HJXA 3FBFA 1QVGR 3FSXA 5EN1A 3VZIA 5I3QA 5L1KA 3G82B 1AZSA 3D1HA 1OSDA 3BPDA 3T9ZA 3BREA 3M32B 5LJ5Y 4TLRA 5ITHA 2RQMA 3CJRA 5AJ3F 5DQHA 1IN0A 3H8YA 5ETMA 1RU2A 1RTHA 1MWZA 1YVFA 2KYXA 1KNZA 3OLBA 3PX0A 3Q86A 1N56A 4FBUA 4NI2A 2HHUA 3GV7B 3SSSA 1BQXA 1S4FA 2GVZA 2YKAA 3MM9A 3TVKA 1B0TA 1VIOA 5A8WA 2ASDA 5FJ4A 2GVZB 2XNQA 3PRDA 5KG5A 3LALA 2R4FA 4Z7YA 2BQUA 3CCUS 4JV2A 2DEIA 4MMOA 3H0PA 3NS5A 4USIA 2YX1A 4C8NA 2IY5B 2CRLA 1RACB 4M5IA 3K5NA 2XS7A 2BBEA 1AZSB 2EBGA 5AXNA 2KXNB 1HLWA 1FEEA 4J9UE 4DS4A 4NZ6A 5HO4A 4DR2F 2ZH3A 2DD8S 4ED3A 4K0KF 1BUXA 3HX9A 2NPFA 3J81Y 2XMWA 3PYGA 2ZJQQ 1HFEL 1T9UA 3VWSA 4RW7A 4Y3CA 2F9DA 3OL7A 2IM2A 4QR0A 2IC3B 1U1QA 3Q8PB 1R8HA 3NBPA 4B9VA 1EQ0A 4WKRA 1X60A 4OZ1A 5G4DA 3JTNA 4EBEA 1FNOA 2OPRA 1VBXA 3HCXA 4DR7J 2UXDJ 3D66A 5LSOA 1OWXA 1NO8A 4HDHA 4RBUA 5DZ6A 2H5IB 2PMZD 5LT5A 1NK6A 1VBZA 1XNRF 3N6NA 9ATCB 1M1KT 3DXBA 1HQEB 1M5HA 4OZ2A 3WC0A 5J2NB 5IM0A 1RTJB 3PDNA 5HVGA 4P71A 5C24A 1H98A 1SUQB 3CJKA 3SQGA 3GWCA 4O44B 3AA9A 3JSRA 3CJKB 1HNVB 2QT7A 4BWMA 4ANEA 2CQIA 2BW2A 3CT9A 1T95A 3GU0A 4ILRA 3Q0AA 4ZOSA 2XMAA 2DRDA 4ZVFA 3R5JB 1IBKF 3FK4A 3FQKA 3I6PA 4KGZB 4M5NA 1H2UX 2OSRA 4RW4A 2C22A 1HBOB 2VBYA 4C3MA 4BHQA 3QQCD 3VVUA 5F8IA 1HI0P 4ZN3A 1Z2ZA 3H90A 2ZWPA 1N5SA 2CQ3A 2XBPA 3ETOA 4V19X 2ZH4A 4OFZA 3FJ2A 3QMQA 2FJDB 4EK2A 4PUOB 4B08A 3KHRA 4FXVA 1RWWB 3LF0A 2D3ZA 2UXBF 4O44A 2EKNA 3I0RA 2HEKA 2DTJA 5ETNA 2LFVA 4IOBA 2YWWA 4OI6A 5AT1B 3VGTA 2OUGA 4TU7A 3CD5A 2RQ4A 3MEEA 1Q95G 4E0DA 3S01A 5LXYA 2RIJA 1CULA 1ELOA 4ECZA 1FDDA 2FQQB 2GQ2A 4BC9A 4ZVHA 4DR4J 1URRA 2DH9A 2EXUA 2CQ2A 1E6YB 1R31A 5GADI 2YNGB 3V6DB 1FJGF 2I5JA 4TU8A 2X7IA 1JJ2R 3VAFA 1P8GA 3TX8A 2R8IA 2E66A 3L95X 1AT1B 2GCFA 3E01A 2KRRA 2CZ4A 3R7BB 3BQ1A 5FD1A 2R7XA 3E01B 5CZVA 3CJSA 2ZC4A 3KLFA 1KR4A 4OX6A 2RVJA 2KYZA 4DR5J 2FLLA 1PYSB 2FY1A 2XLIA 1H73A 3HSGA 4IFVB 4O4GA 2V8VA 4HHHA 2JVOA 4FNIA 3OHBA 4AUKA 4MK8A 3V6DA 1OO0B 1VK3A 4H4MB 2C42A 4ELUA 2PO4A 4ELVA 3PHEA 1S1TA 1ZA2B 2PIIA 2WW8A 4RW8A 1HNZJ 3PG9A 3T6JA 3OTOJ 3PYDA 4LFAF 3OR2A 5K8OA 3GJRB 2HQGA 4OLPA 3FZ2A 1TVRA 4CLPA 3C6UA 2HGMA 1UA1A 3VAHA 1IBMJ 4A4JA 2MKJA 4Q0BB 3K8VA 4JP8A 1FVSA 4WFYA 3NCQA 4ZPDA 4FVCA 3CD7A 4Q2MA 1YHQS 2AX1A 5DDQC 2E5JA 2VPZB 2UU9F 5LMUF 1TKTA 3BKUA 2DGWA 4K5RA 1JLBA 3MD3A 3H5UA 3RBZA 3RB4A 4WTOB 2R7SA 3D68A 1YJ7A 3TQEA 3H4BA 2QSFA 2K1RA 3NCPA 2KG1A 5D4PA 2JEJA 2IPOB 1HBOA 1DURA 4UW2A 4ZN1A 4QJVA 5KFXA 3RAMA 4KO0B 1SKSA 1PO6A 4EZ6A 1GMWA 2V2QA 3DLKB 1GEHA 4K2XA 2CIMA 2LDYA 2WB1D 4WJBA 1GTHA 1OIAA 2RF2B 1UZHA 1WOSA 2ZEJA 4G1PA 3S7RA 4V19J 1KBRA 4DSEA 1UZDA 4ID5A 4OL8A 1F2GA 2K7KA 4OI3A 1ZM3A 3CDEA 3VHQA 5KFGA 4DUTA 2BE2B 3NEKA 2MKYA 4B3OA 2JVRA 2K1RB 2AGQA 3HHKA 1VQ5S 2XMJA 2HZVA 2M9KA 3IM8A 2IAJA 1VC5A 4PPDA 2IM3A 2ZNZA 2DYAA 4C2MA 2MJNA 4C48A 1REGX 2EFVA 2R8HA 2N7YA 2XSFA 2GZOA 3CWJA 2BA9A 2Z2MA 2I0XA 4O3RA 4ZA1A 3G6XA 4NLSA 3RB6A 4IR1A 2V34A 4LUBA 1WD6A 3D2WA 1Q79A 3WHIA 1GMUA 1S1UA 1XIQA 1A0OB 4NZ7A 3HLUA 5A0YB 2RRAA 2JEGA 1Y4ZB 3D6HB 4AXJA 2NQPA 5H9FK 1T0TV 3BGUA 4WKYA 1QAJA 2J8AA 4ECUA 1TKZB 1TUVA 4USHA 4R5PB 3DOLA 4CO4A 1PYTA 3UD3P 2V8GA 1LWXA 3PKMA 1B7FA 1MROB 4O3QA 3SV4A 3KHGA 3V4IB 2RT3A 2XY7A 2W4PA 3OXGA 1BGXT 3GE9A 4ZMMA 4X65F 5ETSA 3GIMA 4LFCF 2DNOA 3IBWA 3BBCA 4OLOA 1K9MT 3D6MB 1K8AT 1TL4A 3QRQA 2CPYA 2ZWOA 3Q8VA 3VAKA 1RWOB 2FVQA 4J9KA 4WTYA 4B3RF 1GNKA 8ATCB 2ZJPQ 4RWWA 2ZVSA 3CJ2A 2RMLA 3MMAB 4DV1J 3CJ0A 4CLUA 3CTRA 4GVBB 4NYZA 3GILA 1TKZA 1YJNS 1L3TA 1CLFA 4BCAA 3OJSA 4HI2A 3MECB 5HVHA 2I6WA 3L7PA 4GMKA 2BJEA 2N4DA 2P9EA 2YKNB 4QIWD 9RUBA 5T14A 2YNHB 1TL3B 2DNGA 2J7UA 4WU3A 3HK2A 1NZ8A 1YLXA 4TVAB 2IMOA 3MM8A 1VQ9S 1LXNA 3IWLA 3QIDA 3UW1A 2RF2A 1DY3A 4CLZA 4CO2A 4LF8J 1NDCA 1RKIA 2MPUA 3M30B 4L74A 2IMWP 2GNKA 4KYZA 3TJ9A 4DV7F 1HBNB 1MU2B 1Q16B 2ZC3A 3PY8A 2A6MA 1DARA 4LSZB 3D28A 5D15A 5A2QY 2W9BB 1H2VZ 3GP9A 3DCAA 1RT3A 3SDEB 3BYRA 5IT4A 1P9YA 5L9NA 3BH6B 4PQUA 1G1XA 1WI8A 3BPSP 1VYAA 1U8WA 3LOUA 1UEVA 1HPZB 2B9XA 1OS5A 3T1AA 3U7JA 1S1XB 4UZBA 3KLHA 1FTCA 2DIVA 3B78A 2EFQA 3I32A 2BQ3A 3FVYA 3R3TA 2Z57B 2MB0B 4J9MA 4C11B 2ZZMA 5HMZA 4DV3J 4I69A 2R8GA 5B0BA 1JJHA 1KD1T 3KK1A 2C1EB 2OPPB 2G0IA 3DYAA 4NYPA 3FKBA 4O3PA 2UUAF 3DMJB 4OJHA 1GX5A 5J1NA 4IRCA 1WF0A 3ILJA 4ZPTR 5KFNA 1Q5YA 2FZKB 4TY8A 4ZVSB 5E3QA 3R6GB 3RBDA 5AXLA 2ZD1A 1VIXA 2CJ9A 3EGVA 5KOXA 3ZZYA 3M4XA 1UPMB 2VPYB 1U1OA 2A2CA 2YNIB 4O4RA 3JQJA 4OX8A 2HQ3A 3ITHA 1YQHA 3QT6A 5KT2A 3CCJS 3B54A 1VDHA 3MCMA 2FLNA 1M5PC 3PZPA 3DRYA 3VAJA 3M7VA 4PWDA 2IVMA 3A13A 2QG9B 1JLAB 3HT0A 4HDGA 4FKYA 1IBMF 2DR7A 2HW3A 2FJEB 3EMTA 3AOAA 5KT4A 1YDLA 4UOFA 2XGPA 2ZH1A 4LF9F 4QYZK 2IRYA 2X51A 3OFGA 1U2RA 1T8EA 3JSBA 4OYMA 4YMEA 2NXEA 3NLCA 1IBLF 2MZTA 3D54A 2C2EA 2E5GA 2BM0A 1RWUA 5LL6d 3MR7A 4IO9Q 5HP1B 4M5GA 1X7VA 2EWHA 3EVOA 3EDQB 4N56A 3UVJA 4LR8A 1CC8A 4DX8H 2AYBA 1S9GA 2HRUA 4ZVRB 3M2RB 5F3ZA 3LWMA 3QIPA 3UR3C 4AT1B 1WC6A 3A1YG 1NH7A 3O1LA 3MFHA 2H65B 3H42A 2YNFA 4NI2B 4DCJB 3RAQA 1BMQB 2ZH5A 3M8ZA 3CC7S 4K4VA 2ZDPA 1RADB 2HBZB 3BKFA 3QBCA 4ZVTB 4LF8F 3MPYA 1B7YB 2GJFA 3NS7B 4QYRA 3AT1B 3PX6A 4DL4A 2VH7A 4PXDA 4ENOA 3KLIA 1IKYA 3VGSA 4B3SF 4X4VA 1NHKL 2MLXA 5DJBA 4IDKA 2R3VA 3IWXA 2GMLA 4DG1A 2K3IA 3N5BA 2J6UA 3ZFVA 1NCLA 5A8KB 5LOQA 3P49B 2W4DA 1FKAF 3DI6A 1HD1A 4DV2F 1RAGB 2PE8A 3QFWA 3KDNA 4S0MA 3BGRA 1IQZA 2XULA 3PYEA 4KGMA 3M8PA 5E2QA 3KHLA 2VASA 3C14B 4C8KA 3AQPA 4ANDA 1R8CA 2LVWA 4YR3A 3C19A 1SV5B 3HT3A 1VK8A 1DQ8A 5IWAF 4FKXA 1RI7A 1N48A 2I2YA 4CH1A 2BW7A 1MMNA 3V6JA 2WVDA 2EG1A 4MTPA 3PRBA 4USUA 3U1NA 2E1RA 2AYGA 1VQNS 4DR3F 4DV7J 4KRWA 3I82A 4ES3A 3ITHB 3HKWA 4ZJLA 1JXVA 3LAKA 3QAEA 5L8RC 3OUYA 2ERRA 2KXFA 5D3GB 1J5OA 2QMUB 4C8MA 1VLYA 3CXCR 2MSSA 4MKAA 3T1YF 1XNQF 1YBUA 5CABA 3IR7B 3KHHA 3CC2S 1PJ6A 1RP5A 2GAHC 4I68A 4EI2A 1S9EA 5F8MA 2MY8A 2E1MC 1N6QB 3W9JA 2YX4A 1VC6A 2I8EA 4F7VA 2UVWA 1VRUA 2Q6BA 4ZVPB 5IT0A 1TK0A 2FVCA 1UTAA 3DMJA 4CLSA 3OSNA 1S6PA 4IYQA 5IV3A 1KVJA 1Q0NA 1FF2A 4ICLA 4DFPA 2FVSA 2LDIA 2LLZA 4C8OA 4JI4J 4Q8EA 4CDIA 4IH7A 1QE1B 4FPRA 2IDLA 1GT8A 1Y7PA 4KPCA 4V1Ak 5FDLB 5KT3A 4DSJA 1IM4A 2JLFA 2IJRA 3DC2A 4ITSA 2IDEA 4AE5A 1MWYA 4CO1A 2BABA 2KG0A 3D0IE 2Q3PA 3DDNA 2Q43A 4NXMF 1S0MA 1CS4B 3FFIA 1U25A 1FFGB 3AA8A 3B82A 1DTTA 3MOZA 4QPTA 5I42B 5SZTA 3EGNA 5HBMB 2AJQA 4C9DA 2QA4G 4NLVA 4GKKF 5HMWA 2EFGA 4RNFA 3RB0A 3OLAA 4Z37A 1S6UA 1K1QA 3LGHA 2G1DA 4DPYA 1N54B 3IC1A 1V9OA 3MR3A 2KVQE 2RRBA 3R5BA 4ED8A 3WC2A 1K73T 2DHGA 2FLOA 2A0FB 2W2MP 1WF2A 1Y5IB 2CJQA 2RUGA 3D4JA 2LKZA 1NBEB 3GFZA 3H7HB 3IXQA 4CO3A 4EMDA 1S1WB 5GAEI 4CIOA 2Z30B 3E8OA 3ELHA 5GMKa 1DRZA 3BO3A 4N8NA 1LWCA 1Q8BA 1VQ7S 1XNRJ 1JMTA 4ED5A 3KXDA 3OXLA 3TJAA 2DB1A 2VG7B 4WBFA 2H4WB 4KIAA 2D1CA 4ED4A 2HQIA 1VQPS 1S9FA 3AJ1A 4USKA 3DLBA 2JRSA 1NK7A 2HGLA 3TX0A 4QPXA 5HK4A 5L1IA 2XC9A 2FIUA 4B9TA 4B9LA 1S76D 1UL3A 3CMAS 4ZLPA 4KTQA 2F63A 2OEMA 2QJ3A 2YXLA 3BYPA 3POTA 4NRTA 2XG8A 4UOCA 5JVGQ 5B0DA 2BKOA 2MEWA 3KJVB 1GAOA 4DHVA 3JB9k 1HWKA 2PA8D 2NSCA 2VJUA 5B0AA 2XY6A 2CXEA 4B3MF 3HHLD 1OQ6A 4A8FA 2P9CA 3N5FA 4FZVA 4AFFA 1LK5A 1RA7A 1S6OA 4DBQA 3EZUA 2VDIA 2VG7A 2ZZNA 3G6VA 1ZPVA 4RUHA 1PILA 2PFFB 3PJXA 1YRTA 2RH3A 3LP2B 5JVHQ 2AT1B 2D3OR 3MCSA 1UVNA 3O6QA 1U6BA 2N3OA 2KXHA 3KUEA 1YK9A 3PKYA 2HHHF 1JNZB 1AA1B 2H3EB 3DLJA 4AXIA 2BQRA 3UO0A 2YVSA 1SJ3P 3MWBA 2HLTA 2ZOMA 3ISZA 1XR5A 1FNXH 1NPKA 2K8GA 4OZLA 3VR1A 2F8HA 1TV6B 3GFXA 4RBVA 3UPFA 5DGBA 1T05A 2R8KA 4I56A 2EKYA 3DM2A 3PM9A 4URQU 3DOKA 5IQ6A 4NE9C 3TAQA 2C2DA 1FJCA 1SJRA 3LWLA 3TW0A 1YG0A 4Q8FA 4NLQA 3SCJE 2NR0A 2EPIA 1RGVA 1RXOB 1KRPA 1J5OB 1YRXA 3DHXA 1HR0F 1ZPWX 1S1VA 2HNDA 3LP2A 1KTVA 1XTZA 4N47A 2W2NP 4RKUC 4TQRA 2W2PP 1JJCB 3CEDA 1SJ4P 4H4KA 5A76A 2XLJA 1EX8A 2ZE2B 3NBPB 2DXEA 2A6OA 3BR9A 4RU9A 4G3IA 1RK8A 2ZE2A 3QATA 1X4DA 2UUCF 3MCOA 1UMJA 4CZCA 1RAIB 3TEHB 4KHPF 4ICLB 3CD6S 3P5BP 4PR6A 3TWZA 4FPIA 2PI4A 2RHQB 2PN6A 5JXSA 1WNEA 1S1TB 2B43A 2DHAA 1NSQA 1H6KX 2L3MA 2XWYA 4RPFA 1SC1B 4DSIA 4USVA 3QGHA 4FYYB 5D4NA 5L39A 4CNYA 2V8PA 3M2VA 2AZ1A 1WWHA 4WIQA 4X4TA 3LANA 2VQFJ 2GA7A 3NOCA 1FERA 1JLFB 4HVZA 1KOOA 3UDLA 4RZRA 4LF4J 1RAJA 1YWXA 4LQ3A 1HNZF 2WVBA 2X3DA 4PG4A 1XQIA 1NJWA 1JXLA 3OTCA 4CWBA 2HVIA 2Q6CA 2DNKA 2BJDA 2I5JB 2MKHA 4J9LA 1S72S 1SL2A 2YY3A 1GXLA 4P10A 4RR5A 1E6YA 4BLGA 4X62J 2AHOB 2CVEA 4OHWA 1PGZA 1RHMB 4NPOA 1SKRA 4DPOA 3QT5A 1AFIA 1VQMS 1EKSA 1Q1KA 4MT1A 1YBTA 3PR4A 4UOGA 5KFLA 3GIIA 3LPEA 3HSJA 1YJRA 4LBPA 1S0NA 4USTA 2FGOA 1S7IA 1JLFA 2KM8B 4DV0F 3Q2SC 3HFKA 5T7LA 3ENVA 4QW8A 1WI6A 5F8HA 4M63A 2E9TA 1EP4B 2ZUAA 1XBWA 3BEGB 1BE4A 2WVCA 4DV3F 2UUBJ 1TUGB 4MYUA 4IUFA 3QJJA 5I3UA 1U1NA 3L4BC 5HMYA 5C25A 2Y8WA 2UV8G 1FE4A 1ZTTA 1RB0A 2GQCA 4P72A 1DTQB 1BC6A 1TL1A 2ZBRA 3NAIA 2FLPA 4YHHF 2IVFB 1HKAA 2F5GA 3CCZA 1CJVA 4JI7J 1HL6A 2OFGX 2IBOA 1M1HA 2OTLS 1C1CA 4KKOA 4U96A 4XPCA 2ZNYA 5F8GA 2F1FA 4F3MA 3HJVA 1G3OA 1Q8LA 2XMUA 5L38A 4HYKA 3SZ2A 1VQ4S 1HWJA 5DS7A 5CH7B 2XHWA 3U1LA 1F9HA 3FC9A 3R5DA 1M1GA 5GAGU 4JV5F 3PIPQ 2HK3A 1S49A 3DFEA 3NG8A 3S1TA 3S6EA 1U48A 2RSQA 5ETLA 1WG1A 2OI2A 3DRRA 4X2BA 2C2RA 2LA4A 2ZITA 3KNAA 4QOTA 4J9SA 4OYAA 1UETA 4X4UA 2NUHA 1B0PA 1FRLA 4DR2J 2A10A 1EQMA 3IM9A 4L75A 1NSKL 3WX8A 2N4CA 4ID5B 2N82B 4ILMA 3HHDA 3M1VA 2MKCA 3F56A 4ZHRA 5GADU 2DR6A 4WIIA 3HP6A 2JLGA 2VHGA 4Y34A 4EFAC 1FX2A 3KTQA 2CUYA 1C0UA 3Q8QB 3TRGA 2J0WA 1KS2A 1LV5A 4JI6J 5EX3A 2KRBA 4NLDA 2XMVA 1X5OA 2IA0A 1CJUA 2HNYA 2HFZA 3W5ZA 3D6FB 4ED0A 2CDRB 2EC0A 4ED1A 2RAQA 2YKPA 1IKVA 2V4JB 4PG8A 4QZVB 3QAUA 5K5MA 1N52B 1LW0A 3K5OA 4DSLA 4HKQA 1NPRA 1TKXA 3M1VB 4ZP6A 3MXHP 3MM8B 4Q0BA 2FUG9 2KO1A 3I5AA 3AJDA 3MM5A 3BQ0A 4OX7A 3L3CA 1I94F 2P5VA 2RKIB 5D4OA 1B70B 3ZZTA 4CT9A 4QBUA 3OJUA 1UVLA 1UAWA 2EFOA 1GQEA 2Q79A 1RT3B 5KFYA 5KT6A 4G1QA 1S79A 2DNLA 4WFZA 2MQQA 4IOCQ 4C6AA 3AXKA 3CO9A 4NCBA 2UXDF 4J91A 4K4SA 1WG5A 4CRJA 1EJ7L 1VRQC 3EM1A 4Q44A 2HHQA 1MROA 5HLFA 3CJ8A 4WE1B 3BM7A 2DY9A 1ZH5A 1SIWB 4GO7X 4PXCA 5E3CA 5KG4A 3FGVA 3ZNUA 2CNNB 1JJ4A 3EWGA 1S0VA 3V2UC 4AYBD 3FSYA 3W61A 3CIMA 3DRXA 1FK9A 2WVEA 4LF7F 1NEEA 1RT1B 2RKIA 3MEDB 3EXYA 5GMDA 1M5OC 3Q22A 1HBUA 2WK4A 4CLWA 4IG3A 4JI5J 5CYMA 3N79A 4PZVA 1N32F 2MYFA 2VG6B 3CJ5A 1LOUA 3NAHA 4PXEA 1FRXA 5T41A 1FXLA 1RT6A 1ZS6A 1T3OA 1WC0A 2VFRA 3MMCA 1ZTWA 1YZ6A 2HBQB 2MMYA 3MTJA 4MKVA 3W2VB 2VBWA 3SQOP 4CLYA 4QIVA 2E5IA 2W9CA 3QPIA 4Y2CA 3FBEA 3ZZUA 3TZXA 2V8DA 4F02A 4C8ZA 1R27B 5DZ7A 2DGOA 3OL8A 1CQNA 1MWQA 3BO4A 4DPXA 1Q8IA 5L1JA 4KHPJ 5AE1A 4I7FA 2QEXS 5A6PA 1UKUA 5EUHA 2ZH2A 4OZ3A 1SQEA 3OL6A 2V2KA 2CQGA 2V69A 1YTYA 3US5A 1RWXB 1D0EA 3DLGA 4O3OA 3FRZA 3L09A 2VPXB 4A8SA 5KG0A 4WYLA 4QCLA 4R5PA 1UPPA 1L3VA 1RDRA 3I87A 3KLHB 4F50A 3EGWB 3SCKE 2HVHA 4PWUA 4U8VA 3TANA 2J9EA 3RGIA 2GJ2A 4WP3A 2B4PA 5KT5A 4Y2AA 1NK5A 2GFFA 1LWEB 1W26A 1HNXF 5B08A 1X9SA 4CLFA 3A8KA 3LUYA 4C11A 2CQHA 4J37A 2IYGA 4P9SA 1N5YA 3RR7A 1O8BA 1CPZA 5L9XA 1K0TA 3IA0A 1U1RA 5HVFA 3MOJB 4NZ0A 1QY7A 1REVA 4LFCJ 2EFPA 5E3PA 2AKWB 1LNQA 5E5NA 5KG7A 4TLQA 3K59A 3THTA 2R7OA 4JB8B 4I67A 1K0VA 1RTZA 1SVDA 1PKUA 2UUWA 1UW4A 3ILIA 2IIHA 3DN9A 3O8WA 4M5DB 4L73A 4NASA 4CNZA 3JSMA 4C0HA 5I4MA 4QQBA 5A8KA 5J1EB 4NOHA 4QWBA 3D1QA 1BWVA 4DX6A 3MF5A 1NDLA 4I6YA 4A8MP 4HACB 4H54A 3OR1B 2UVVA 1UFLA 5D0GA 1U02A 3EXCX 1WTBA 4YB5A 3KUHA 1H38A 2E5LJ 1SQGA 4D3GA 3CMQA 3OTBA 4F4ZA 5A6WA 3W9HA 2J6TA 4F4KA 2VODA 4YS2A 3ZZOA 1TUWA 3WZ0A 3MR6A 5E7OB 4QU7A 4DQIA 2KFZA 3T5JA 3JTPA 1Y00A 4DQPA 3UDCA 2MZQA 4EBCA 3POTB 3Q8YA 4KV8B 3M6UA 2KJWA 4G1QB 4DUYJ 5JUMA 3PW2A 4DU7A 5LSRA 2R7RA 5B0CA 4HI1A 2QA4S 1JLGA 3T9NA 1SCJB 3W65A 5BYSA 3LP0B 4Q5VA 2XCAA 4ECYA 1TAUA 4GO5X 3HSZA 1HARA 2K7JA 4LR7A 4CO0A 4DCPB 5EDWA 4YQWA 3AJ2A 4WP9A 1PSDA 1B0VA 2GMHA 5GMEA 4Y2MA 3DKDA 3DRSB 3F41A 1RT5B 5DETA 4LSNB 5M2RA 1HBUB 3MEDA 4MKYA 2IBKA 4RNMA 3TAMB 5A2QU 4G65A 2D41A 2IA6A 5AE3A 3MPWA 1FJEB 2H9ZA 2YX7A 1NM2A 5L1LA 2BYCA 2VD3A 2DR8A 1CS4A 1RWMB 2E5LF 5DG7A 4GC7A 4I2QB 4ANCA 3RUBL 3DRPA 1U1PA 4U67Q 3PR5B 2CPFA 2YKOA 1G6BA 5MAOA 2HQCA 2COLA 2H1YA 3R7SB 4TXSA 2LXFA 2OPSB 3EE3A 5HBMA 3WBZA 1SKWA 3IS9A 1D9FA 3THPA 1WELA 2E1AA 1YZ7A 4OYBA 4WFAQ 1CJKB 2NCKL 2XMMA 2YH1A 5H9EJ 2NREA 3L9ZA 3OXFA 1S6PB 2E5HA 3Q8SB 3M9MB 2BEFA 2FJAB 2C3OA 1FRHA 4KHRA 2HIYA 5BYQA 2OEKA 1NB2A 1C0TB 2XMTA 3EZOA 4ED7A 1I1GA 4RX6A 4K4TA 3THVA 3A12A 3OT9A 2CQCA 2DITA 2YNIA 3BSCA 3V81A 3TZYA 2DIUA 3DI6B 4DF4A 3PO5A 3V81B 4CT8A 4WZQA 3ULHA 1LWFB 3LGMA 3HSDA 2ALZA 2VL1A 5KFTA 2VG5B 1B3TA 1RCXB 1ZM4A 2AZ3A 4TY8B 4DEZA 3GPAA 1J27A 1Q8KA 4KH1B 3JS9A 2EVZA 2V50A 3GCXP 1CJKA 1FDBA 1KQFB 3ENAA 4X66J 4C7QA 2F4FA 4B3TJ 1WC3A 3TUPA 2CPDA 3K5MA 1ZAVA 3V6KA 3TVYA 2HG4A 3MTKA 5D77A 1RTIB 3HVAA 1APSA 3K8WA 2C3YA 1Z1ZA 2LQ8A 2OP5A 2OPQB 2QA1A 4MIBA 4WXWA 3SFGA 3I9V9 1RWPB 4YUDA 4HH1A 2Y9HA 2DT9A 5J2NA 4PAAA 2ZBCA 4PWWA 1N6QA 3M8PB 2R2RA 1U24A 2L41A 4C3KA 3W66A 1L5UA 1NSPA 2VC1A 3HPOA 5E0OA 2FD2A 3N6MA 4DX5A 3T3FA 3SFUA 2HK2A 4M5MA 2R2TA 1VJWA 1J5EJ 2GW8A 4OZ0A 2HBRB 1S5ZA 2BJ3A 3W1YC 6FD1A 4X65J 1VQSA 4YR2A 1PCAA 1T9VA 1QSLA 2HNZA 3M32A 4IG0A 4XPEA 2I38A 3UN2A 3QIPB 4N8OA 2ZM6F 2X1GA 3GSDA 2J6SA 1TFYA 1WDTA 3ZTRA 2B9YA 3LO3A 3UCUP 5CAAA 1L3UA 4GC6A 3MZIA 3OVAA 1NJZA 1BQNA 3JSYA 5D8HB 1FKPB 2VU5A 2WSEC 1F9FA 4K8RA 4MIAA 2NSBA 4CCHA 3HJFA 2O01C 2WONA 5MLCV 2ZH8A 1U6ZA 3MEEB 4X66F 3T1HJ 1SL1A 2DR9A 3BSAA 4Q45A 3SCLE 1L3KA 3G86A 2F8MA 2SXLA 1EHWA 1FWPA 1YKWA 4IQMA 1PIEA 1R8BA 4C97A 2LU2A 4LMZA 5IV4A 2NS1B 3D9BA 3KFWX 4YB7A 3I4HX 3SEOA 2XQCA 2ASLA 2R2UA 1HI8A 5KG6A 1VISA 3G96A 3C6TA 3HHEA 4IH5A 3IO1A 4UQGA 4ZS6A 4EUVA 1N32J 1IBKJ 1QAIA 3NRBA 3K17A 3BO2A 2QFIA 3HHLA 2GQQA 5KFEA 1DZ5A 2HHSA 3NKYA 3N6LA 3OHAA 2YWEA 3O3LA 1MW7A 2UUBF 4P73A 1QSSA 2F7VA 1NU4A 1LKZA 1RT2A 3WQPA 4ECSA 4LIWA 1MNEA 2FDNA 5SUHA 5JJBA 1HMVB 1R0CB 2W7OA 4P2XA 3OUYB 3A4TA 3W8GA 1N4LA 1KOHA 3PYFA 5IXUA 5IM0B 3DNCA 4EBDA 1H3DA 1KC8T 1DQAA 5C2GA 3PIOQ 5JMNA 4YR0A 1XMQF 3BGFA 2E29A 1QUPA 5DG9A 2FJXA 2OJ3A 1IVZA 5B7WA 4KSEB 2MZJA 4HL9A 1UWBA 2AJ1A 4DSKA 2YKQA 1D1UA 1S97A 1CQMA 1PJ5A 4LF1A 4WFXA 1W7WA 1RAAB 2NZ4A 3QRRA 3R97A 2RDDA 3TZWA 4NCAA 2ACMA 2VUGA 1SJ1A 2XZDB 4NWBA 5E41A 4N41A 1HQEA 5LMNF 3HHLC 2H48B 4F04B 2G13A 1HNWF 4KKOB 3EJMA 3BB5A 3UWTA 2VA3A 2HS0A 1GXTA 3SCIE 3KLFB 2HFNA 1QD1A 2L9WA 3ZTPA 3R5GA 5KFSA 1CEZA 4M5HA 4KR0B 2DBBA 1SH2A 1HNWJ 1TK5A 3R9LA 2R8JA 2CNOB 5GAEU 1F3FA 1SH3A 4DV2J 4FS1A 2EK6A 1FJ7A 2UXCF 4RW8B 4KHMA 4DPWA 4BS2A 2LQ9A 3PJWA 3GONA 5J2MB 5KFHA 1NJIT 2DRAA 3I9ZA 4RUBA 1RLCL 4O3SA 4O3NA 4I6AA 2R2SA 1WC5A 1NXIA 1OY6A 3J80Y 1S12A 4NLPA 1ZZFA 4OI0A 4MFBB 2X1BA 1X4EA 2DGSA 3N28A 4HLBA 1YJTA 2RU9A 1TAQA 4RUAA 2EG2A 2C3UA 3NCRA 4HTIA 4NYOA 4XO0A 2UXBJ 1AROP 2AYMA 1YBAA 4W98A 3G6ES 4GRSA 1F6TA 4L3NA 4DU8A 4JV0A 3W60A 3LP1A 4ZK7M 1F5AA 3CCWA 3AHPA 1OYEA 1UJ6A 4OZNA 3ZZRA 3MR5A 5THWA 2RE1A 1F2HA 2FPHX 3CJTA 4KFBB 2KU7A 4LRAA 2MTLA 4P7TA 4F0MA 4RNNA 3MUVP 4A46A 1SUQA 3DLHA 2C2ZB 1X5PA 4ZJQA 4OYXA 2PC6A 3JQKA 3UN5A 2DPJA 4F3QA 1IKWA 4MAKA 2RILA 4NEYA 2GV1A 3VQSA 1MMDA 3I0SB 4F36A 1X5SA 2F8EX 3C15B 2AJ4A 2WAQD 3CNQP 2JJ4D 1WTFA 2HFOA 2LA6A 2WSFC 3I0RB 3Q83A 2GO9A 3TUJC 5ADZA 2B8PA 3OVSA 3H25A 2CPJA 4JI5F 2IAJB 2KZZA 4PYDA 3ZO7A 3IRWP 4PRFA 2HKEA 2V94A 1LWEA 3NMRA 1IKVB 2HPUA 2V4JA 4N7TA 7FDRA 3H2LA 1H7XA 2M70A 1HHSA 4P75A 4ZJOA 4Y00A 5CA5A 3D5MA 4URGA 1JLAA 4RUCA 2L48A 2GHVC 2ZBPA 3I0SA 1IBCB 2VOOA 2YH0A 4JV5J 2HHXA 1WHYA 3I5CA 1FWLA 2AW0A 3OSPA 1FRIA 1HYSA 1Q7YT 2DHSA 2XHCA 1OMSA 2CNLB 3HF5A 4CLTA 1SC4B 3QJPA 1OY9A 3MM7B 4EO8A 5KFMA 3ADAC 1UVIA 2Q66A 1VI7A 3LAMA 1NDPA 4F26A 4TU9A 4OHXA 3PACA 3PW5A 2MLZA 1AYEA 3OW2R 4URSA 4OHZA 4X4PA 4DZDA 3N9UC 3W9IA 4AQYJ 1HWIA 3AOCA 4Y6IA 4IRDA 3GIRA 3TR5A 4JI0F 2GIFA 2YQ0A 3D6TB 2OGUA 2G1HA 3R6LB 3VV2B 4QWDA 2G0CA 5D4LA 3D67A 1U49A 3VQTA 5ETOA 1X4BA 5ETQA 3MMAA 4LREA 5CCLA 1X4AA 2F3JA 2HFSA 2IM1A 2YPYA 3BDEA 4Q43A 1HBMB 4I7FB 1FK9B 1H72C 4YDXA 1TK8A 2KB2A 1CG2A 4PQUB 2V4QA 1MSWD 4ZVGA 1HNIB 3RBEA 4H4MA 3GB0A 1BY9A 1FCAA 3NGRA 2BMBA 3IGNA 4WE1A 1JQGA 3PW0A 4EZ9A 2C3MA 3HD1A 1GK8A 2DCLA 4M5JA 5DQGA 3CCLS 4DWIA 2HS4A 3FQLA 4PXBA 4ZIWA 2V4RA 1TL1B 4RJVA 2MKSA 2MHNA 3VZHA 3BQ2A 1XMQJ 2KKHA 1IM6A 5DLGA 3IG1A 3C6UB 2UVUA 3EPGA 5D0EA 2EBEA 3DHWC 3TA2A 3CC4S 4ZIVA 2D69A 4LQ9A 4C4WA 4DR5F 4DQQA 2MKKA 2ZHBA 1Q81T 2J9DE 2P9GA 3KYLA 2R42A 3M8QB 3R1LA 4HEA9 4TYAA 3PFEA 1P1LA 2QMXA 1S59A 2QLJB 2ZHOA 3B4DA 3HDSA 2GVDA 4DV5F 1JX4A 3PJ9A 4A8WA 1N33F 2DJWA 1TP7A 2IRUA 5D0HA 1JKHB 1SI9A 3MAAB 5LSLA 1P1TA 3QT8A 5KFDA 1SC6A 1S9GB 4ERDA 3SIPB 1PG5B 2B51A 5BXIA 1RHQB 1KDNA 1REVB 1HW9A 1V3RA 3DGPA 2Q1LA 3AD8C 4DR1F 3HKZD 4TN2A 1CJTA 1RQ0A 2O66A 3TUIC 5J2QA 3TQ1A 2Z4PA 4UQTA 5DO2A 2HVZA 2H54B 3FSIA 1QE1A 3CE8A 4YEAA 5KAKA 1N0UA 3ENQA 4N76A 2D74B 5DLFA 2PD1A 4DSFA 2XS2A 1WEYA 4UUXA 1RLDA 1RBAA 1Q53A 2GC8A 3FBBA 3BJYA 1OPIA 2EK1A 3Q89A 1NDKA 1KQGB 4J5OA 5KFVA 2CQ1A 3MURP 3BSOA 4DR1J 2FYXA 4B9NA 1LWFA 1VHIA 2J0XA 3GFYA 4TQSA 3FRYA 2YQ1A 2ASYA 2KT2A 2JC1A 1O5JA 5B0GA 5HN0A 1NH8A 1JXEA 2VBXA 1B4SA 2BJ9A 2W7PA 4DL6A 4K0KJ 4QR1A 3W5YA 3GR0A 4RW9A 3IBCB 4USJC 4ES1A 1N34J 1P9QC 1CJTB 4CH0S 1URNA 4LF7J 1WORA 3BGLA 4OYOA 5IZHA 2RB7A 3UN3A 1RT6B 3RRGA 1VGYA 1S48A 3RZAA 4DV0J 4F4XA 1J5EF 1OY8A 4DR6J 3HFVA 1Y9OA 2KT3A 2R7VA 2VV5A 2YNFB 1GMVA 3I4PA 5CXTA 2HHWA 3PVXA 1RWKB 3TZZA 2L9NA 5H9EK 1N88A 1QUVA 2BV3A 4I2PB 1R0BG 3V5RA 3EPIA 1HR0J 2DNNA 3DRSA 3IAS9 4TKTA 2FTRA 3RTVA 4BDPA 1X4CA 4RWXA 4F8RA 5J1PA 4C0BA 3OFFA 3SYZA 3NNCA 1LEOA 1IKYB 1E6VA 2YKMB 1F3VA 3FEXB 4K4YA 2F4VJ 1G2EA 5B0EA 1R6VA 1JLGB 4ZVQB 3UR0A 2QLBB 1YSJA 2DY1A 2RD5C 4F4AA 1RKJA 2XYHB 1SC3B 1TL3A 2QO3A 1SJFA 1PAEX 2HYIB 3QT7A 4FF2A 4ECTA 2P8IA 2P6SA 3HVTA 3PW4A 3GYXB 3HD2A 3M2UB 4B3RJ 3JYTB 2VFUA 3JQMA 3PXGa 3GG0A 5KFQA 4KBIA 3JYTA 4OZ5A 1TMMA 1IKXB 5M2PA 4UTGA 1O6XA 2NXNA 5HSPA 4IKAA 3SSQA 2HZAA 1TKDA 1RAEB 1WC1A 2IJNA 2PT0A 2M5YA 3KJNB 1HHQA 4DOZA 2VPWB 5IFMA 4X4OA 2AX0A 5BR8J 4DV4F 2PMWA 4F2SA 1WKLA 2QMWA 2BANB 4GVLA 2DPIA 2IHR1 3HVTB 3TJ8A 3KK1B 2OMLA 1DFDA 1ZAXA 2H5JB 3UI3A 3T5LA 1VQOS 3B6BA 4JI8J 4UF4A 5F0UA 2KN4A 4QWAA 1X8DA 3DLEB 5CQGA 1S99A 3CUNA 4W90B 4OYZA 3H5SA 3CDBA 2VDHA 1N8RT 4FYWB 1CSJA 3E51A 1UEKA 2D3UA 2FHMA 3GJTB 3MPVA 3GQCA 2ZD1B 1M5VC 3OD2A 1N0VC 2M7SA 2C2OB 1RT2B 4X84A 4M5DA 2VICA 3G82A 1DBDA 3AFGA 3NWGA 1JLCA 2DNHA 2NZCA 3EICA 2RS8A 1YX2A 3EUNA 3MGJA 3RBXA 1GXUA 2RJZA 3H20A 4DPUA 1DLOB 3Q23A 3H2UB 3FFIB 2W1BA 3CDUA 5KG1A 1I5OB 2GHPA 4UY8T 1NK0A 3OR1A 1FHTA 4NX9A 4PG6A 2DNQA 2GJIA 3G2XA 4MK9A 3W5XA 3T5KA 2XY5A 3KLGB 3DOMA 4EGLA 2MSTA 5FLXU 3R27A 2JLEA 4LVOP 1WSVA 3JAMU 4I0WA 2GHWA 4NXNF 4ZPVR 1UFKA 3MAQA 3RW7A 2EW9A 3DGVA 2HSEB 3FCHA 1FDAA 2LECA 2PFDA 5HL7Q 2ROGA 2WB4A 4FF3A 2MQ8A 2PEHA 2GGPB 1YJ9S 2LEPA 2PA3A 3GYGA 3X3UA 5CYQB 3QSYB 3TO8A 1PJ7A 1NPPA 1FRKA 2HVEA 3O2IA 2W2OP 2PGCA 4OYIA 3KK3B 1MN7A 3G8SA 3DLLQ 4JI1F 2CVIA 3KLVA 3PFOA 1RTJA 1D9AA 3MD1A 2IC3A 3M2UA 4OIXA 4WK1A 3ICLA 2CG8A 2HFVA 4JI8F 5EHHA 2J9DA 4RW7B 1C4CA 1HBNA 1J2VA 2WZ1A 1X4GA 3CW2C 3D0HE 3G87A 2DHHA 2GAGC 3MPDA 3N4WA 3QGGA 4ID8A 2DNPA 2W4CA 5HQ8A 1YJUA 2KM8C 3VALA 1EZZB 1D9DA 3IRXB 5GAHI 1VQKS 4ECWA 1RBLA 2MQMA 2HZCA 3D7SB 5DG8A 2UUAJ 3IRXA 5KFRA 5KFCA 5C25B 1AUDA 4OX9J 4NLWA 4CTAB 2Y3YA 3A8EA 4NRUA 1E6VB 1YGYA 2YKMA 4DI6A 1LWCB 2QYGA 3GG1A 4EYHB 3MDFA 4LSLA 3CCES 4J9NA 4K4UA 1XERA 3H5YA 2JX2A 1FT8A 1XR6A 2LCWA 3A3PB 4DL2A 2XI2A 1C1BA 2G2OA 5KG2A 4RL1A 5EWEA 1OSCA 3GMGA 1PC5A 3K7RA 4QIEA 2HAIA 1VFJA 2ZFHA 3AH6A 3GFHA 1KQKA 1RHRB 5KTQA 1U2FA 1F5CA 3HM9A 2L9DA 2KDOA 3H2VE 4HHUA 5KFOA 1I94J 1QAXA 4FXWA 4C8LA 2J5AA 4ZDNA 4MKBA 4FP9A 2YNGA 3QZ7A 4LFAJ 2DXDA 2E44A 3KLEB 1RTHB 3ISNC 4RNOA 4QWEA 4I4BA 4NL5A 1RA6A 5HQLA 3D3CJ 1ZA1B 2CKWA 4P52A 4ZPCA 1Y3KA 5KFZA 4ZHRB 4Z7CA 1VMBA 1NHUA 1UFWA 3A8JA 1VRUB 3FCVA 1HYSB 2J0SD 4D3HA 2MZSA 4CLLA 2HHHJ 2HVDA 1FA0A 1U6FA 2NXJA 1UWBB 2F40A 4NXMJ 3JAMY 1KTQA 1X0PA 1C0UB 3BBFA 4NMXA 4NLOA 4LFBF 3H5XA 2E7XA 4XAKA 1RABB 7AT1B 4K4ZA 1CC7A 2AIRB 2HRTA 2WHOA 2JSXA 1BQMA 5F8LA 2Z56B 2R7WA 2XTJP 1BD6A 2Y1IA 1NJYA 4B9UA 2Y8YA 3J81j 2JEIA 4F2RA 3CCVS 4CO5A 3EGZA 4CYUA 1W2BR 3IMQJ 4OX9F 1V6HA 1SQFA 2JFDA 3KDOA 1K44A 5J2PA 4KGKA 1TKTB 3TOQA 1JLBB 3W64A 1KVIA 2M2BA 2Z58B 2ZDOA 3CO0P 4NLTA 3NY0A 1TV6A 1RYSA 3HO1A 4JI4F 1FRJA 1VR6A 3T1HF 4A48A 3OPKA 2GS8A 1R3NA 1TVRB 3PRVA 2ROPA 1C1CB 2VZ9A 3NS6A 4LF2A 4OV1A 2DO0A 3OR2B 3ZC4A 5RUBA 1JNRB 3PEHA 2M8HA 3CB4A 4A8YA 4ECVA 4IRKA 1XNQJ 1M5KC 4GKJF 1SBRA 3I55S 2B9WA 1N36J 1XMOF 2PDAA 1Q86T 3C15A 4E2FB 5CD4H 4DL5A 1Q4RA 3IR5B 3MMJA 5T7LB 1IKWB 1T7PA 2HMIA 3PO4A 3CULA 4ZP7A 3D1OA 1YJVA 4IG3B 1QTNB 1NUEA 3SXLA 5K14A 4Y28C 1WDDA 1H74A 1LFPA 4DN0A 3KJVA 3M9NB 1UEUA 4KFBA 4CP5A 5J2MA 1RISA 3N01A 2MDAA 4LT6A 3PV8A 3GZ7A 5D6GA 2H51B 3RYLA 3I5BA 3MAAA 4ZPWR 5EX0A 4KQZA 1TFWA 3C3LA 1OJ4A 2MJUA 5ETRA 1WEXA 2U2FA 3FCWA 2JL9A 1WF1A 5IC6B 1IR2A 3C6TB 1LW2B 2GIRA 1N5TA 4X4NA 3UDEA 3A3OB 1KEKA 1SJQA 2HIQA 1RAHB 4OYPA 2ADBA 3VVTA 2GO8A 2N3LA 3CJ4A 5LJ3Y 2CQPA 3GLJA 1TU0B 5IC4B 2WSCC 3VF0B 2CWKA 2WBRA 2XO7A 2ASJA 4DV6F 4IR9A 3C2PA 4KT0C 4XDCA 2XI3A 4LF5F 2LEAA 2ATCB 4BWJA 1AXQA 1IJEB 2WBMA 1RHJB 4OJGA 5CZXA 2EFNA 4YP3A 3SI8A 4B9SA 1EIYB 3EDRB 2ZM6J 3QRPA 3O5TB 1WEZA 5HLFB 2QL7B 1OQ3A 2Y0BB 5HMXA 4JI6F 1XN9A 1PAUB 4OJ1A 3HXMA 2M8DB 4DR6F 2Z0GA 3AAWB 2C28A 3IWNC 2BE2A 1HBMA 2BKNA 1VQLS 3WDOA 1T03A 1TQLA 4J90A 5H1SV 3IN5A 2AU0A 4R8UA 1S4EA 1BXNA 4X64J 4L3KA 2XYGB 3PX4A 1NLKL 1GH8A 3CJQA 4H4OA 1VBKA 1RWVB 1U2CA 2QIFA 4JOUA 4KO0A 2HRYA 4KAIA 3RJMB 4F0HA 3R2CJ 2XZTB 4C3LA 1B64A 1JLEB 1Y0HA 3U02A 2DH7A 1IR1A 3K5PA 2B9EA 1OYDA 3LA0A 3G8QA 4A8QA 3U1MA 1XWLA 4ZVUB 1NK4A 1VS3A 1NJXA 4R0EA 3KOAA 2F9JA 1T94A 2Y1LB 1UA0A 3LQVA 3VGVA 1NK9A 1KSPA 4XK8C 3PW7A 2OPRB 2XGQA 2AD9A 1W25A 3V4MA 2OTJS 2CQ0A 1S57A 2FJBB 4RO0A 5I3UB 2W9CB 5HI7A 3TNVA 3BF4A 4JBCA 4USMA 4JI2F 3W2VA 3RR8A 4CM0A 1XR7A 1N34F 1CJVB 1HIYA 3EZ5A 2VQEJ 4K50A 4TNOA 4HHJA 3CCSS 2BR0A 2DK2A 4WP8A 2FHJA 2AGPA 1YJWS 1SL0A 2CJXB 4DL0C 1FX4A 2B8QA 2KJVA 3P8BB 3OTDA 1HI1A 4NEZA 3NL0A 1RT1A 2R7UA 2VKZG 4MIWA 3MI7X 3TUZC 3K5LA 1IBLJ 2D9OA 1F9EB 3NNHA 1EP4A 2LMIA 5GAGI 2VQEF 5KFBA 1Z2LA 2AJFE 2G9OA 4YB1P 3M8QA 1PYOB 2BJ8A 2YKNA 4J9VA 5K14B 1SPBP 2X1FA 3W62A 3QNWB 1GFWB 3K57A 4ZP9A 4MK7A 4ES2A 2UU9J 2CDQA 1Y3JA 2C2MB 2IRXA 4L6V3 4MFBA 4DCOB 2DGQA 1WKKA 2B4VA 3AB2B 4USWA 3MMBA 5AJ3J 5KT7A 3QZ8A 1G7CB 2HQFA 5DRKA 4U7UD 1WOOA 5G0RB 5ETTA 2ABYA 1HNIA 1U0SA 4NMLA 2CQ4A 4P7VA 2RDIA 2VB6A 3U27A 2B5JB 3C16A 5F8NA 2KI2A 4NXNJ 1AFJA 1S10A 3CCMS 2XLKA 2WOMB 3M05A 5LM7E 2A18A 2ZVIA 2WTFA 4ZCLA 1HW8A 2V67A 2I9SA 2QL9B 3AQOA 4ECRA 1U1KA 1BLUA 2J76E 1DJ0A 4LFBJ 4DUYF 1KLMB 1S6QA 2XMKA 1TZ0A 3A3NB 3ZZZA 5HQMA 3IFEA 1WHVA 5HATA 2L08A 2JHEA 4JUZA 2R9LA 4Z2XA 3KMQA 1WC4A 1R43A 1ACMB 2HWTA 2I1RA 4J7CA 3AD7C 4RW9B 5DQIA 2W9BA 3G4SS 2FY8A 3MM7A 4KV8A 4OZJA 8AT1B 1UVMA 1RTIA 3QO9B 4IQXA 2PSZA 4F0KA 1FRMA 1HWLA 1ULRA 4O0IA 4HT5A 1RT4B 4DQSA 1YITS 3Q2TC 1S77D 1F1BB 3KKFA 1U0HA 3CIZA 4Y2IA 2RQKA 3UFCX 2RS2A 3TAPA 2FVRA 2OKQA 1VQ6S 4U9RA 4M95A 3DYAB 4NCGB 2DISA 4JI1J 2CYYA 2BKPA 3B4MA 2E9ZA 1VRTB 1DQ9A 1O51A 5KFIA 2DGVA 3GTYX 3T19A 3UQSA 3J81U 2CAJA 3DLGB 4DUZJ 3ONQA 2BDPA 2NPIA 3BDPA 1H0HB 1TL5A 1NMEB 2FB0A 3CCRS 1HPZA 1KHWA 2WW4A 3MECA 2W24A 2U1AA 5DDOC 3HZGA 3IGVA 2DH8A 1C0TA 3NGTA 1FTRA 3TA0A 2NYHA 3WX4A 4WU2A 1YIJS 1RT4A 4LIRA 3GV5B 1NKEA 3TP2A 5LMNJ 2MGZB 2CPHA 2VBZA 3KG4A 4DLEA 2LQBA 1HNXJ 2E1PA 4ZITA 4FBTA 4KGVB 4U7UK 3IAM9 4CQ1A 1XEZA 4LR9A 1CBKA 3M30A 3H98A 2GX8A 5D78A 2OPSA 2QFJA 5C7PA 1RTDA 5CYMB 4DR3J 1FKOB 2X3GA 2V2VA 3C46A 1TTHB 3EVMA 2WRMA 2F65A 3KLIB 4Y65A 4X4SA 1I6JA 1WKJA 3QGPA 2AYEA 4CTAA 2V0NA 4X4RA 1FE0A 1V5VA 2AF6A 3CCTA 4WFBQ 4YN3B 4W92B 2QLWA 1UJ5A 4M94A 4MH8A 3QYYA 4U95A 3K58A 2H4YB 2HQDA 5A8RA 4ZLNA 5LXRA 3AY0A 1QAYA 1R0AB 1FESA 1EARA 1MG7A 1IKXA 3SMZA 1LK7A 1FKOA 1RT5A 4ZVOB 3M8RA 3IP0A 3PCOB 3RRHA 4NLYA 3LH2S 1NKBA 2BOAA 4RW6A 1RTDB 2J7KA 4JYAJ 2KHCA 2Z2YB 2FHKA 2MKIA 3VAGA 4ZLJA 3RAXA 1RT7A 3E2EA 1D09B 4J9RA 4QW9A 4P2SA 4AL5A 3W8PA 2X1AA 2WCXA 2KHDA 1R8AA 3ET6B 4O23A 4F25A 3Q8RB 4ECXA 3I56S 1U1LA 4OHYA 3EVWA 4C8YA 2VA2A 1NSAA 3RB3A 2BXJA 1QLNA 1JIHA 3CF5Q 2JWNA 1DTTB 2W9AA 5I42A 1WHXA 1HQUA 1Q78A 1XJWB 2OAUA 3R5AA 1SH0A 1TELA 2MQLA 1RE1B 5FIIA 2UUTA 3QWPA 3J7ZT 2LEBA 1S7HA 1VC0A 2O3DA 2E1CA 2UUCJ 3M2RA 3RW6A 2WVFA 3D0GE 2VG5A 3DOMB 1SB6A 4K4XA 4I2PA 4ATNA 5C42B 2AMCB 4NA3A 4WPAA 1WG4A 2H5EA 4PG7A 3QWUA 4M5LA 3NXZA 1UW9A 4WXOA 2VJVA 2NLWA 5F3TA 1U4BA 3CMES 4YOEA 2HAFA 5CCMA 2ZOGA 4OJ3A 3TYTA 4CH7A 2MZ1A 1UVJA 1DLOA 2IVYA 3M8WA 5F41A 4DV6J 1S0OA 2Z2ZA 2GGPA 3FNNA 2BRKA 4QIFA 3HHNB 2M3DA 2W25A 2C3PA 1O0PA 2CPEA 2EEYA 3W2WB 3BN7A 2QC3A 4OMFG 4DQRA 5D3GA 2UXCJ 1P6TA 4F67A 2IJFA 3GIKA 3C14A 4LF6F 4ZCIA 2MY7A 3BGRB 3CD0A 2HWHA 3NP5A 4KE5A 1MU2A 4FN5A 5HANA 4ED6A 1SIZA 4NCGA 4EWTA 3VCDA 5HROB 2Z8QA 4TYBA 4J9OA 5KFAA 5J2PB 2MQOA 4IFYB 3RG6A 3SDEA 2CZVC 2KTQA 4LF6J 1X9MA 2OEJA 3DM2B 3WIVA 4AQYF 3TEGA 2IM0A 4DS5A 2JH3A 1HMVA 5AE2A 4PG5A 3NGKA 3TA1A 7FD1A 2ZJRQ 1HA1A 3CSKA 2OO4A 2O5DA 4FYXB 1PC4A 3BR8A 4I1TA 5E3RA 4DL7A 2NUUG 2KFNA 3T5HA 4B3SJ 3HMJG 5A8WB 3VGUA 4WFNQ 4YFUA 3TVZA 1SKUB 4U7CA 1T02A 2A1BA 1KP6A 2V68A 3DDIA 4HT7A 2B0GA 3MCNA 1IXKA 4OHVA 3ET6A 1QDUB 2UV8A 2AEFA 3OFHA 4LSLB 4YY3F 1L3SA 2UVRA 5IS2A 2J9CA 3UE2A 4LF4F 5A8RB 3W3SA 2OMOA 3I31A 4F3OA 1NKCA 2G0JA 4DPTA 1FVQA 2DXFA 4JI0J 3HFZB 3CCQS 4EO6A 1UP1A 4L76A 1W2IA 1FEHA 2CG4A 3KMSA 2CA9A 4NLGA 3MHYA 3ENWA 3KJQB 4PKDB 2XWXA 4PEOA 3HVRA 3GSIA 3FMWA 1A7GE 1FFSB 1ZBTA 2ZKUA 3R7NB 3AOBA 4XDDA 1NB7A 1AW0A 4RW4B 3JSMB 1PBAA 4JI2J 1UCNA 4PABA 1HD0A 2OELA 4W4MA 2HNZB 4IG0B 1I51B 4QWCA 4WK3A 4ZP8A 4DLGA 1ITPA 2V6AA 3D3BJ 1BHNA 3LPYA 3N0VA 1U1MA 4X62F 4OQJA 2AWZA 3KK2A 3O44A 1RYRA 1NK8A 2ATLA 1F60B 2ACYA 2FZGB 5M2UA 1GTEA 4MYTA 3ILLA 3DXSX 1JK9B 2POKA 1T9WA 5KFKA 5KFFA 4B02A 2DNZA 3FUYA 1X31C 2FGCA 4CYUB 1FXDA 3BN4A 4ECQA 1RU1A 5HAOA 4NLRA 3V6HA 1ZETA 3VTIA 1T03B 2DNYA 1G4CA 3IR6B 1FXRA 3AODA 3MFIA 2DR5A 2OH2A 1LXJA 4KB7A 3ZZ0A 1R6YA 4DFJA 3KK2B 4DFMA 3T41A 2HHPA 4YDDB 4DX7A 4IOAQ 1P27B 1ZM9A 4WCEQ 3KLGA 1I3OB 1Y5NB 2CPXA 3MEGA 4OI4A 1KKHA 5KG3A 4DV5J 1ZZNA 4LRDA 3CGIA 1KLNA 1N5VA 1HNVA 5AXKA 3BZQA 2NXUA 1VOMA 2LXIA 2QRRA 2ROEA 5C24B 3SQGB 2P2CB 3PHTA 5IT9U 2LYVA 4LF9J 4M5KA 5EWGA 4DF8A 5DM6Q 4IFYA 1DAXA 2ZBIA 2ZBQA 3TAMA 3GV8B 2P6TA 4B3OB 2ZHAA 3GIJA 1R89A 3MMCB 2XZWA 2GMJA 1JLQB 5CD4A 1DTQA 2FZCB 1D8YA 2RQCA 4G6VB 4ED2A 4DR4F 5DDPC 4ILLA 1F0XA 3KLEA 2KFYA 1Y11A 4I2QA 2VF3A 2DRBA 1XK8A 2CZ9A 1KHVA 3C66A 3DRPB 5B0FA 4XIUA 1S1VB 2HNDB 2VC0A 3IG1B 1VLOA 3M9OB 5GVQA 3OV7A 2VFSA 4JI3F 4K2JA 3ISND 2D3O1 2ADCA 5BR8F 1YI2S 2WONB 4PQAA 2QA2A 3FEZA 1BQNB 3CPWR 4DV1F 2K06A 3HHLB 1FKPA 2O1PA 3OQ2A 3P5TL 4KC5A 2N7CA 1Q82T 3K0JA 3CDWA 3NGSA 1IJFB 2FVPA 1RAOA 2M4MA 8RUCA 3DU6A 2HGNA 3GCWP 3OTEA 3R5CA 4JI7F 3ZNJ1 5F0WA 2JNJA 2MZRA 2OD6A 1UWAA 4KGXB 1KQSR 2XB2D 3EX7B 2XSJB 2Y1JA 2HLUA 3M6XA 3P45B 3G8TA 1N5QA 3J7A1 4Y2KA 5K8PA 3NWRA 1FD8A 5B09A 2DO4A 4CLKA 2OSQA 2CWXA 3NOGA 4QYZJ 2R7TA 1FJGJ 2OIHA 3KUGA 4Q2LA 4O0NA 1LW2A 3ZXWA 2HMIB 4YB6A 4KJIA 3KNGA 3CVKA 2BVZA 4DZ6A 1RUSA 2F4VF 3PEJA 1FNMA 4IFVA 1X4FA 2VKRA 2QE5A 4K5SA 2PEBA 4O4GB 3WIUA 4ZLLA 1CJUB 1D8ZA 1RJJA 2HNYB 2ZUGA 3L7OA 3J7YI 1QSYA 4DN9A 1QTMA 1T9YA 2E9RX 2VONA 4J9PA 4X4QA 3J7YU 3EYZA 2QTWA 3SV3A 4GKKJ 2E7VA 2KH9A 4PUOA 2KZMA 4DR7F 4ZKAA 1Y10A 5BYRA 3UD4P 3AB4B 2HFUA 1OPZA 1V3ZA 4LRCA 4P2FA 3C8YA 1U7LA 1HQ2A 4I64A 4A8XA 4FS2A 1QVFR 3ZZPA 5K8MA 3ILOA 3M2VB 1RHUB 3OL9A 3OVBA 4C0OC 3MPUB 2W8KA 2W01A 5BJRA 4RNHA 5EGYA 5K8NA 2YTCA 2MQPA 2BX6A 3TI0A 2CJBA 2J7WA 1CULB 2B7CB 1R7IA 2C2NA 3K89A 4K59A 4P2MA 1H7WA 5EWFA 2ZH7A 4UY85 1KWMA 2DCUB 4N5SA 3DRRB 2FHJD 1RWNB 1Y5LB 1NAQA 3UNYA 1BQMB 1JLQA 1WJ9A 2CQBA 2B7BB 4NLXA 1JLEA 1WOPA 2YWGA 5IWAJ 4I6WA 3DLKA 3SBMA 1T11A 2APOA 4H4KC 2AJ0A 2NYIA 2AEMA 2AV5A 5ETPA 3MEGB 4QR2A 4LSNA 1M0SA 3SSRA 3BSNA 1T9TA 1XC9A 4DUZF 2CQDA 2JZ5A 1X5TA 2FJWA 2CPZA 2FC9A 1XMBA 2W2QP 3DGPB 2BE7D 2J8SA 5U47A 4BBYA 3J7AN 4C98A 2YWKA 4JI3J 2OFHX 2LU1A 4U6PA 2HWIA 3OBIA 1F5BA 1V3SA 1EAYC 3IBFB 2D9PA 1M90T 2QX0A 3F44A 1U26A 5I3PA 4FXDA 4PPZA 3S8SA 2V9WA 4IO1A 1S1XA 2LP4A 2YNHA 3LGNA 2BJ1A 2VFTA 2HHVA 2C2KB 2V5HG 4HTJA 3OTOF 3VAMA 2ZOFA 4ER8A 4FYDA 4ELTA 3QGIA 3BH7B 4DV4J 5DDRC 3RRKA 4J9QA 5L46A 2RRNA 1Q7LB 3BS9A 3Q8UA 1KONA 5K9FA 2ZH6A 4ZPAA 3QSIA 1N5YB 4DXLA 4ETXA 3FMBA 4OI2A 2BE9B 1KLMA 2QGFB 4B17A 1EB0A 1MN9A 5KFPA 3G71S 4FYVB 4RU2A 2GVDB 2QV6A 2QLXA 1JB0C 3DOLB 3OFEA 4XTTA 4E8UA 1IQTA 1RAFB 1HHTP 2B3TB 4Q7AA 3GYNA 1VBYA 1K1SA 4R8UB 1ZOTA 3LP1B 3M8SA 4B3MJ 5CHCB 2BUNA 3AD9C 5KFWA 2K2PA 2DHXA 4ALZA 2CFXA 3V4IA 1KFSA 1QM9A 2IFXA 2XSJA 2CJYB 1FWKA 4LBHA 3Q24A 5ETKA 4ETZA 4OV6A 5KFUA 5F9NA 2LQ5A 2Z2LA 4KH0B 2BM1A 4DJBA 1LFWA 2BZ2A 2M0GB 3MEKA 3MMBB 1QJHA 4QIGA 2O67A 5A0YA 5E33A 3UDVA 3JXOA 4PCQA 5KOWA 1M5SA 1DHMA 3FBCA 2BRLA 4LRFA 3F73A 1T3NA 3UCZP 1U47A 1FI4A 2J0QD 2XS5A 2JC0A 2GIQA 2ILZA 2BACA 3UNGC 2XNRA 3W63A 1NNDA 4F4WA 2OPQA 1A6LA 2JEFA 3LP0A 4HACA 2ZH9A 3P4UB 3H4DA 1MMLA 2E7WA 4ZVEA 4B9MA 3X1LB 1TKXB 4HH0A 4PWDB 4ZCKA 3R8YA 4YHHJ 2RDJA 4FF1A 1HWUA 1LW0B 4P6QA 1RCOB 5IT9Y 1PBUA 2M52A 2Y0SD 3DU5A 2ZKTA 2YWHA 1YRUA 4FF4A 3ETMA 1S1UB 2OHDA 4EEYA 3MM5B 3R1HA 1TR0A 2G4BA 2DGUA 3J80U 1IR0A 2B56A 5IOLA 3NNAA 3HULA 3HZEA 5H9FJ 1C4AA 1U8SA 3QO9A 4IH6A 1ZM2A 1XMOJ 1EETA 1TL7B 5GAHU 3M8YA 4GKJJ 1WSRA 4L72B 4H4OB 4WWSA 5CYQA 4UT4A 2HHTA 3M6VA 2B4UA 2UP1A 4AL7A 4DL3A 4Y0FA 2QN6B 2LXUA 4UZCA 1KFDA 3CJ3A 4A8OA 2DKOB 4FNHA 2DNMA 2EI5A 2QSWA 1RBOB 2YPZA 1S6QB 3UD5A 3MR2A 2ILYA 4KY3A 1SV5A 2DNRA 4GVBA 3ZTSA 2OD4A 3IS9B 3DLEA 1D3WA 4OI1A 2KVIA 1N36F 1NZAA 4U8YA 3VAIA 3GJQB 1RHKB 3K2YA 5AXMA 2G2YA 4LBIA 1LQ9A 2AP6A 3PTWA 1TMJA 1RT7B 1X4HA 4P74A 4B3TF 2A2DA 2QZ8A 3C16B 1VHFA 1EETB 1TL7A 2QLFB 3ZTQA 2RU3A 3G6YA 2BANA 3KG1A 1B99A 4LRBA 1MLAA 4A8KA 1X0FA 3F0NA 5HJYA 2YWFA 4X64F 3KG0A 2FJVA 1A9NB 5K20B 2PMHA 4N77A 1JKHA 2M88A 4KPYA 2BJ7A 2V63A 1N33J 2EC2A 4AD6A 1H2TZ 3P3DA 4BC7A 4EU0A 2OPPA 4ZCMA 5C42A 1IWGA 4NA2A 3NGDA 3FZBA
chains in the Genus database with same CATH topology
2VG6A 5J2QB 1UVKA 5DGAA 2MQNA 1CVJA 2B5JA 4RBTA 2JOQA 1S1WA 2VFVA 4JYAF 2QYCA 3RU0A 4EYIB 4NLUA 1JWWA 2XCPA 3TARA 1VQ8S 5DM7Q 4QU6A 2WOMA 3CDAA 3MM6B 3QLHB 3T6BA 4WZMA 1R0AA 3QLHA 1C2PA 4FVMA 2MHEA 4RW6B 5F9LA 5F8JA 3I96A 4WYWA 3H40A 3QJLA 2KT5A 2K3KA 2DVIA 5G0RA 3MUMP 2CJAA 1GX6A 2B6AA 3M6WA 3HI9A 1ZAWA 1WACA 4MJKA 3NMAA 1WHWA 3E3XA 2FHOB 2Y1RI 3H59A 5IQQA 4JV1A 1BWEA 3HVWA 4TY9A 5CYJA 2VQFF 3G9CA 4AL6A 5E3AA 2W8LA 4ELTA 3KK3A 2CPIA 3PNIA 2MGZA 3MM6A 2AQ4A 1KN6A 5C5JA 1UJ4A 2HS3A 3LW5C 5KFJA 2D7SA 1FD2A 4M1KA 3P6YC 4G1IA 1ROFA 1FO1A 4F4YA 2V9KA 5HP1A 4ZPBA 5HROA 4E98A 3P96A 5FDLA 4CI0B 2VOPA 5J1EA 1ZYQA 5FLXY 2JDJA 3W2WA 6FDRA 2XEXA 1SXLA 1NRKA 3DDKA 3FEYB 2V8HA 1S9EB 2A3JA 3KWMA 4R0JA 4K4WA 3GR1A 1NHVA 3W7BA 1VRTA 2AGOA 1U45A 1X9WA 2UZAA 1FDNA 2BOPA 4RLEA 2RNEA 1T05B 2DGTA 2YQ3A 3FDSA 4DG1B 1Z4UA 1JLCB 1IUJA 4IDKB 3DOKB 4WF9Q 2LQJA 3MAHA 4DMZA 2FC8A 2PI5A 3JTOA 2IYIA 4UUWA 4DDFA 1VQYA 1HQUB 2OLWA 4M8LA 4A47A 2CJKA 4NA1A 4LVNP 4R25A 4DFKA 2W7AA 4LJMA 1R8PA 1U09A 1C1BB 2DGXA 3MM9B 3UCGA 2B4OA 2B6AB 3MUTP 2R7QA 2MXYA 3J7Z5 3B8HA 2JFKA 1QVGR 5EN1A 3FSXA 3VZIA 5I3QA 5L1KA 3D1HA 3T9ZA 1OSDA 3BREA 3M32B 5LJ5Y 4TLRA 5ITHA 2RQMA 5AJ3F 5DQHA 1IN0A 3H8YA 1RTHA 1MWZA 1YVFA 2KYXA 1KNZA 3OLBA 3PX0A 1N56A 4FBUA 2HHUA 3GV7B 3SSSA 1BQXA 1S4FA 2YKAA 3MM9A 3TVKA 2ASDA 1B0TA 1VIOA 5A8WA 5FJ4A 2XNQA 3PRDA 5KG5A 3LALA 2R4FA 2BQUA 3CCUS 4JV2A 4MMOA 3NS5A 4USIA 2YX1A 4C8NA 2CRLA 3K5NA 2XS7A 2BBEA 2EBGA 5AXNA 2KXNB 1FEEA 4DS4A 4NZ6A 5HO4A 4DR2F 2ZH3A 2DD8S 4ED3A 4K0KF 3HX9A 2NPFA 3J81Y 2XMWA 2ZJQQ 1HFEL 3VWSA 4RW7A 4Y3CA 2F9DA 3OL7A 2IM2A 4QR0A 2IC3B 1U1QA 3Q8PB 1R8HA 3NBPA 4B9VA 4WKRA 4OZ1A 5G4DA 3JTNA 4EBEA 1FNOA 2OPRA 1VBXA 5LSOA 1OWXA 1NO8A 4HDHA 4RBUA 2PMZD 5LT5A 1NK6A 1VBZA 1XNRF 3N6NA 1M1KT 3DXBA 1HQEB 1M5HA 3WC0A 5J2NB 5IM0A 1RTJB 3PDNA 5C24A 1H98A 1SUQB 3CJKA 3SQGA 3GWCA 4O44B 3AA9A 3JSRA 3CJKB 1HNVB 2QT7A 4BWMA 2CQIA 2BW2A 3CT9A 1T95A 4ILRA 3Q0AA 4ZOSA 4ZVFA 1IBKF 3FQKA 3I6PA 1H2UX 2OSRA 4RW4A 2C22A 1HBOB 2VBYA 4C3MA 4BHQA 5F8IA 1HI0P 1Z2ZA 4V19X 1N5SA 2CQ3A 2XBPA 3ETOA 2ZH4A 4OFZA 3FJ2A 3QMQA 2FJDB 4PUOB 4B08A 3KHRA 4FXVA 3LF0A 2D3ZA 2UXBF 4O44A 3I0RA 2DTJA 3F73A 4OI6A 4IOBA 4TU7A 3HJFA 3CD5A 2RQ4A 3MEEA 4E0DA 3S01A 5LXYA 2RIJA 1ELOA 4ECZA 1FDDA 2GQ2A 4BC9A 4ZVHA 1URRA 2DH9A 2CQ2A 1E6YB 1R31A 5GADI 2YNGB 3V6DB 1FJGF 2I5JA 4TU8A 1JJ2R 3VAFA 1P8GA 3TX8A 2R8IA 2E66A 3L95X 2GCFA 3E01A 2KRRA 2CZ4A 3BQ1A 5FD1A 2R7XA 3E01B 5CZVA 2ZC4A 3KLFA 1KR4A 4OX6A 2RVJA 2KYZA 2FLLA 2FY1A 2XLIA 4IFVB 4O4GA 2V8VA 2JVOA 4FNIA 3OHBA 4AUKA 4MK8A 3V6DA 1OO0B 1VK3A 4H4MB 2C42A 4ELUA 2PO4A 4ELVA 3PHEA 1S1TA 2PIIA 2WW8A 4RW8A 3T6JA 4LFAF 3OR2A 5K8OA 4OLPA 3FZ2A 1TVRA 1UA1A 3C6UA 2HGMA 1KFSA 3VAHA 4Q0BB 4A4JA 2MKJA 3K8VA 1FVSA 4WFYA 3NCQA 4ZPDA 4FVCA 3CD7A 4Q2MA 1YHQS 2AX1A 5DDQC 2E5JA 2VPZB 2UU9F 5LMUF 1TKTA 4K5RA 2DGWA 1JLBA 3MD3A 3H5UA 3RB4A 2R7SA 3H4BA 2QSFA 2K1RA 3NCPA 2KG1A 5D4PA 2JEJA 1HBOA 1DURA 4UW2A 4QJVA 5KFXA 3RAMA 4KO0B 1SKSA 1PO6A 4EZ6A 4K2XA 3DLKB 4WJBA 2CIMA 2WB1D 2LDYA 1GTHA 1OIAA 2RF2B 4G1PA 3S7RA 4V19J 4DSEA 4ID5A 4OL8A 1F2GA 2K7KA 4OI3A 1ZM3A 3CDEA 5KFGA 2BE2B 4B3OA 2JVRA 2K1RB 2AGQA 3HHKA 1VQ5S 2XMJA 2M9KA 2IAJA 1VC5A 4PPDA 2IM3A 2ZNZA 4C2MA 2MJNA 2R8HA 2EFVA 2N7YA 2XSFA 3CWJA 2BA9A 2Z2MA 2I0XA 4O3RA 4ZA1A 3G6XA 4NLSA 3RB6A 4IR1A 4LUBA 1WD6A 3D2WA 1Q79A 1S1UA 5A0YB 1FJCA 4NZ7A 3HLUA 2JEGA 2RRAA 1Y4ZB 4AXJA 2NQPA 3BGUA 4WKYA 1QAJA 2J8AA 4ECUA 1TKZB 1TUVA 4USHA 4R5PB 3DOLA 4CO4A 3UD3P 2V8GA 3PKMA 1B7FA 1MROB 4O3QA 3SV4A 3KHGA 3V4IB 2RT3A 2XY7A 2W4PA 3OXGA 1BGXT 3GE9A 4ZMMA 4X65F 3GIMA 4LFCF 2DNOA 3IBWA 1K9MT 4OLOA 1K8AT 1TL4A 2CPYA 3VAKA 2FVQA 4J9KA 4WTYA 4B3RF 1GNKA 2ZJPQ 4RWWA 2ZVSA 3CJ2A 2RMLA 3MMAB 3CJ0A 3CTRA 4NYZA 1CLFA 3GILA 1TKZA 1YJNS 1L3TA 4BCAA 3OJSA 4HI2A 3MECB 3L7PA 4GMKA 2BJEA 2N4DA 2P9EA 2YKNB 4QIWD 5T14A 2YNHB 1TL3B 2DNGA 2J7UA 4WU3A 3HK2A 2IMOA 3MM8A 1VQ9S 1LXNA 3IWLA 3QIDA 3UW1A 2RF2A 4CO2A 1RKIA 2MPUA 3M30B 2IMWP 2GNKA 4DV7F 1HBNB 1MU2B 1Q16B 2ZC3A 3PY8A 1DARA 5A2QY 3D28A 1H2VZ 5IT4A 3DCAA 1RT3A 3SDEB 1G1XA 5L9NA 4PQUA 1WI8A 3LOUA 1UEVA 1HPZB 1OS5A 2B9XA 3T1AA 3U7JA 1S1XB 3KLHA 2VA3A 1FTCA 2DIVA 3B78A 2EFQA 3I32A 2BQ3A 3FVYA 3R3TA 2MB0B 4J9MA 4C11B 2ZZMA 5HMZA 4I69A 2R8GA 5B0BA 1JJHA 1KD1T 3KK1A 2OPPB 4O3PA 3DYAA 4NYPA 2UUAF 3DMJB 5J1NA 1GX5A 4IRCA 1WF0A 4ZPTR 5KFNA 4TY8A 5E3QA 3RBDA 5AXLA 2ZD1A 1VIXA 2CJ9A 5KOXA 3ZZYA 3M4XA 2VPYB 1U1OA 2A2CA 2YNIB 4O4RA 4OX8A 5KT2A 2HQ3A 3ITHA 1YQHA 3CCJS 2FLNA 1M5PC 3PZPA 3DRYA 3VAJA 4PWDA 2IVMA 2DR7A 1IBMF 1JLAB 4HDGA 2HW3A 2FJEB 5KT4A 2XGPA 2IRYA 2X51A 3OFGA 1U2RA 1T8EA 3JSBA 4YMEA 1IBLF 3NLCA 2MZTA 3D54A 2C2EA 2E5GA 2BM0A 1RWUA 5LL6d 4IO9Q