4ZKBB

The chemokine binding protein of orf virus complexed with ccl3
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
57
structure length
49
Chain Sequence
TACCFSYTSRQIPDYFETSSQCSKPGVIFLTRQVCADPSEEWVQKYVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemokine binding protein
publication title Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity.
pubmed doi rcsb
source organism Orf virus (strain nz2)
molecule tags Viral protein/cytokine
total genus 1
structure length 49
sequence length 57
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zkbB00
2DY8A 2Q8RE 1CA5A 2K05A 1RTNA 1KNAA 3D6WA 4CJ0B 2FFKB 1JICA 1PFBA 1O7YA 1RTOA 2DY7A 1F9PA 4O42A 3GV6A 2RA4A 1IKLA 1WD1A 5EQ0A 1XX8A 1BO0A 1HHVA 1EIGA 1ILQA 5D14A 4XT1B 2L9HA 4ZKCB 4RAUC 1G2SA 1DOMA 1B3AA 5DNFA 1PDQA 1WTPA 4QUFA 5EPJA 1SSOA 5EPKA 3Q6SA 4R8IA 2EOTA 4X3UA 2K04A 1NR2A 2J7ZA 3I91A 4IUQA 3R93A 1F2LA 1O80A 4LMQD 1G6ZA 2EPBA 1IKMA 4R9WA 2N88A 2KVMA 1A15A 2NZ1D 2L4NA 2H1EA 2HDLA 1WTOA 1MI2A 1PFNA 1WVLA 1U4MA 2B2WA 4ZAIA 2MPMA 1AZQA 5CBEE 2KOLA 1HUNA 1F9SA 1B50A 4MN3A 1U4PA 2N55A 5CMDA 2K1BA 2X6LA 4ZKBB 1MGSA 1GUWA 1JE4A 2FINB 4ZK9B 2CVRA 2HDMA 1HUMA 4CJ2C 2RVLA 4ZLTF 4IUVA 2NYZD 4NW2A 1ESRA 4QUCA 1Q3LA 5E4XA 1PLFA 3FPUB 2MGSA 2KEDA 4X3TA 3P7JA 3SVMA 2BDNA 5T1GA 1WTRA 1AP0A 4UAIA 1E0BA 1C8CA 2HCCA 3G7LA 1VMCA 1EIHA 1AZPA 2Q8TA 4IUTA 1CA6A 1BNZA 3GV3A 4XDXA 1XYIA 3F2UA 3DM1A 4IUPA 4OIKA 5AFWA 1WTXA 1RHPA 4HEDA 1HA6A 3IL8A 1MSGA 3UI2A 1QE6A 1HRJA 2X69A 1EOTA 4RWSC 1RODA 5COYA 1CM9A 1MSHA 2B2VA 2K03A 2B2TA 1M8AA 2B2WC 1QG7A 2B2YA 2D9UA 2EE1A 2JP1A 4X3KA 5CBAE 5JJZA 3I90A 3HP3A 3IFDA 2RSNA 4HSVA 2B2UA 1ICWA 1KNEA 4HCSA 5CORA 1SDFA 2KEEA 1B53A 1J8IA 1F9QA 1EL0A 4CJ1B 1G91A 2HUGA 3TZDA 2KUMA 3DEPA 2HCIA 1VMPA 4U68A 3KUPA 2RSOA 2FJ2A 4OIJA 1B2TA 4IUUA 2B2UC 5EJWA 4DN4M 2L11A 1TVXA 1NAPA 1NCVA 1HFGA 3N52A 4MHEA 1U4RA 2JYOA 4X3SA 3KBXA 1WD0A 1X32A 1DONA 5EPLA 3TN2A 3MTSA 2SDFA 3I3CA 1WTWA 2MJ8A 1U4LA 2IL8A 2VXWA 2X6GA 2XIWA 3H91A 5D65A 1WTVA 1BBXC 5T1IA 1G2TA 2M2LA 1DOLA 4RA8A 1QNKA 1ZXTA 2FHTA 1HFNA 5E4WC 3QO2A 4HAEA 2MP1A 2R3ZA 1ILPA 1DZ1A 1LV9A 1SAPA 1RJTA 1BF4A 3DEOA 1IL8A 1O7ZA 3FDTA 2FMMA 3LWEA 1X3QA 2KECA 1PFMA 2L1BA 3MWYW 2B2VC 1EQTA 4IURA 1B4OA 2B2TC 2NWGA 1J9OA 2B2YC 2K28A 1S4ZA 1ML0D 1X3PA 2L12A 3I8ZA 1WTQA 5EKIA 1F9RA 1NR4A 2K01A 1DOKA 3ONAB 4XT3B
chains in the Genus database with same CATH superfamily
3A5ZB 3GTOH 1IBLL 4DV7L 3F1ZA 1TU2B 1TWFH 2Z4HA 3U9SA 4B3TQ 4NXML 5FLMG 1YZ6A 4HIMA 3E6ZX 4K6LA 3IKJA 5DNFA 4EGVA 1O78A 4R8IA 4GOPA 3J80i 4LF9Q 3MEHA 1YITA 3ULLA 5C0XI 1N33Q 1I94Q 1JOQA 2F0JA 2ALYB 3SHLA 4C3HH 1WTOA 1A62A 3ZYYX 3RN2A 5JJKA 1MBYA 1B9MA 1BOSA 1UE1A 4DR4L 5A35A 4OGQC 4PMWA 4DR2L 1VCIA 1GUWA 4ZQ3A 1STBA 5C3EB 3EQLC 4CHTB 4JI7L 4G7ZC 1YHBA 5JVG3 3F2BA 1JWUD 1XMOQ 4KHPL 4A3DB 2PQEA 1AP0A 4DAYA 4KD4A 4KJOA 1U5KA 4ME5A 1VQLA 2VQFQ 3GV3A 1BNZA 3T56B 4IOAA 1MSGA 5CGKA 1IBML 2JA8H 1HRJA 5I9OA 3U4VA 3EJIA 4L5QA 3H15A 1E2ZA 3AQQA 1ET9A 4NDXA 2EYPA 2OCEA 2F0KA 4X62Q 5JJZA 4YWLA 2E2HH 3GTOB 1G6PA 3PMFA 4OEMB 4RGNA 2JA6G 3QOJA 1G291 1X32A 2KCCA 4MIUA 3J81j 3AMUA 5HY6A 4C3JG 4GLAC 4A3GH 4YWMA 5BN4A 2PMZB 3MC0B 1PH2A 4LK1C 5LMNL 2MQHA 1PZID 1KLGD 3K81C 2R3ZA 2UXDQ 2F0MA 2Z1CA 2WB1G 4C3HB 3S2DH 4Q0FA 1G91A 1L0XB 2F0NA 1SJHD 2L12A 1TY2A 5A2QL 1NR4A 1AW7A 2ENBA 3ONAB 5C0XJ 1CQVA 1O7YA 5KIXA 3EA6A 2KHJA 3HKSA 2D5DA 1HHVA 1KABA 2D62A 4KTAA 2RBMA 2VY3A 3E0EA 5DEHA 4DF7A 4HJAA 2PZUA 4BBSG 1YJ9A 3MXNB 5D3IB 2EYHA 1VQNA 5LMUL 4OWXB 5FO7B 4JI4Q 2JA8B 2AMCB 3AYHB 4DV3L 4IFDI 1MIUA 3A7LA 2F0DA 4JOIA 1PRTB 5IGBA 3T1YQ 3WOFA 4GKKQ 2RHSB 2VB2X 1XWEA 1V1OA 3KDFB 3C3LA 2E2HB 2A68C 1D6EC 2LSSA 1TS4A 1ESRA 3MXNA 2OQKA 5EAYA 3VR3A 3MA2B 2G9HD 4YHHL 1UNSA 4N9PA 1QZGA 1SYDA 1P16A 2EVBA 1S72A 4GOPC 1HNXL 5LL6S 2XRQD 4IPHA 3I4LA 3KDFA 5I2YA 2NVQB 3TP7A 1QE6A 4LF8L 4L6TB 4NXNL 1EOTA 4DGZA 1Q86C 3S2DB 3UDXA 2IT1A 2ZTEA 4H44C 5K36H 1EL0A 2DUDA 5J22A 2A1AA 2UXDL 1SFOH 1CQFA 1FYCA 5FJ8G 1V1PB 4A3EG 2EYJA 4PQXA 1E1TA 3BZCA 1Y1VH 4K0KL 1GUTA 1CSPA 3TS2A 3H6MA 1Z7TA 4AQYL 1HFNA 4GN5A 3PIO3 4YCWA 4YY3Q 1I5FA 1CTMA 2O4XA 1XNQQ 4LUZA 4RGMA 4PZ6A 2F0EA 5IYBG 1MJEA 4GNXB 4BBRG 4JI4L 4A3MG 2QEXA 1SR3A 2ZJPA 3D6WA 2AQ2B 2EJFC 4LFCL 4DKAC 2QW7A 4DUZQ 3PUXA 5IE8A 4ZKCB 3PIOA 2F0WA 3GO5A 2UUCQ 3S14H 2FMCA 4X65L 4RKBA 4LF4L 2I5LX 1OXSC 1Q1BA 4A76A 3R93A 1LTTD 4RCOA 4GNXA 3M9BA 3BU2A 2F0VA 1Z6HA 2ZM6Q 5TSSA 2ID0A 2GA4B 4P75A 1X56A 2B2WA 4UP8A 5IWAL 1STHA 4QJFA 5IT9c 3NP8A 4LF6L 3V05A 1S5ED 5CMDA 4DV1L 2X6LA 3GTGH 2QF7A 5M5YB 3FRPB 1G51A 3DHQA 4XQNA 1KD1C 1GKHA 3H3VH 1Y1VB 1C8CA 4P2CB 4NKLA 5C44B 3NWSA 2A6EC 1VQ5A 4K5VA 1VF7A 4KY5A 4C1NI 3DM1A 4IUPA 2E2JH 4O0AA 3J7A5 1KL9A 1R4QB 2JE6I 2L15A 2IPKD 2VB3X 1BQQT 2PYKA 4DAMA 4JOIC 1N32Q 1CZGA 2B2TA 3VYTA 3CCLA 1JWSD 3D4WA 5M5WH 1HJPA 1J8IA 3T16A 4JG2A 4YY3L 3CPFA 4OONA 5CV8A 3CD6A 3N6RA 3PUVA 4DR5Q 2RSOA 1TR5A 4I7ZC 3RLOA 3KLSA 5JJIA 4OHJA 1T9HA 2JYOA 5CV4A 3S14B 1EYAA 2O2LD 1S5BD 4J1MA 2MJ8A 3P1HA 1PRTC 1HA5A 5DM63 4PMCA 1VQDA 2VNUD 1SE3A 4I7AA 5E4WC 2F03A 3MXPA 3I4NH 2DNEA 4DNTB 3QJYA 5C3EG 1Q90A 2IHFA 2GVBA 2C5CA 4A3DG 1ML0D 5ELDA 4A3IH 1XPOA 2F1MA 3KF6B 2F0UA 5C3XA 3GTGB 4FVMA 1EQRA 1VQKA 1M4VA 3JAML 1JB7A 5EKKA 1XXGA 3CPWA 1YJWA 1EYCA 4QY7A 1SYGA 1IZ6A 3SR1A 3T1HQ 5FK9C 5FOBB 1YNNC 3HS0C 4BA1I 4GLVB 5C3WA 1O80A 3OW2A 1N36L 1TQOA 4LUVA 4FF2A 1W6JA 1MKHA 1KQSA 3K80C 1BCPB 4NPSA 1VQHA 2D0OA 2MPMA 4NB3A 1STAA 1EIFA 1IW7D 2P5ZX 2UUBL 5M5WB 3CKIB 4XIGS 2ZTDA 2CQAA 2KENA 4LFAQ 2IY5B 4KKTA 4NW2A 4KV6A 1TWCH 1Q3LA 4RKLA 4B9XA 2SNSA 1VQAA 1SE8A 1YNJC 3K5OA 5T1GA 2H5XA 3L3OC 3VA7A 2I5HA 1SNCA 2F0FA 4C3HG 2HCCA 3B6YA 2UUAL 1YBYA 3NTKA 1WTXA 1RHPA 4A4IA 2MUYA 2JSOA 1C48A 1I4QA 1EWIA 3K7UC 3UI2A 1I6HB 4B3ML 2F3WA 3BDLA 3HOYH 5BR8Q 2XSCA 4RCNA 1EU3A 5M5XH 2B2WC 4JI1Q 4CDDC 2VUMH 4A3IB 1SNDA 4IZ8A 5D3DA 5LL6X 2HHHQ 5CR3A 2C9OA 5JPNC 5M3FB 5EBCA 1HNWL 1LTRD 2GN5A 3L2PA 3NELA 2E75C 2Z4IA 4X3SA 5ELOA 2JA8G 1LT5D 1QILA 5FJ8H 4R4OA 1EWCA 3I72A 3G71A 1U4LA 1E3PA 1F2MA 2CCZA 4JI0Q 2M9VA 5GADC 1JCKB 1A63A 5JPMC 4MZ9A 1SEBD 2CH4W 2F0IA 4HIOA 1Y1WH 1ILPA 1STNA 2F0LA 3DEOA 1D7QA 1JOOA 3K58A 2B2TC 2K28A 2EXZA 3RZOB 4QB4A 4O1NA 1ZYRC 1EIYB 4UY8C 1S5CD 2F0PA 1FJGQ 1GHJA 4LF5Q 1PH4A 2EYFA 3GTMH 1SROA 3RLNA 4A3GG 3U4ZA 2EYLA 1TWCB 2K5HA 2UXCL 1D2BA 4A93B 3A8KE 1WD1A 5EQ0A 3SDZA 5C4XH 3OOCA 4DR7L 3OMCA 2OEOA 1EIGA 2E5LQ 4J15A 1B3AA 1I3QH 3KYHC 3BVZA 3MEFA 4DK0A 1PV4A 5BN3A 5LMNW 2IX1A 1KRSA 1IKMA 1EOVA 2NB0A 4K5XA 2E2IH 2H1EA 2R92H 3HOYB 2PMZE 1BDOA 1F2YA 1PFNA 4B3RQ 5M5XB 1U4MA 2NZOA 1HUNA 2VUMB 4H0LC 1KDBA 3CAMA 3CMEA 1JE4A 4CJ2C 2NYZD 2BE5C 5E4XA 1EWHA 1IHZA 5BR8L 1LACA 1JE5A 5ISRA 2IJ0A 2QGQA 3P7JA 3K5MA 2JA9A 1DM0B 3D31A 3LWUA 1IBLQ 1CKNA 4DV7Q 3F2UA 4EQPA 3FKIB 1HZBA 3HOZH 1Y1WB 2NN6H 2PPBC 4NXMQ 5M3MH 3NQIA 5C4ZA 1TWAH 2RHQB 5FLXL 4OO1I 2KA7A 3S1RH 1I4HA 2PO4A 4HCSA 4DNRB 3GTMB 3P75A 3TP8A 4CJ1B 3EVQA 5DAUA 5NUCA 2B2UC 2PCFB 1NAPA 1NCVA 1GUGA 4DR4Q 2A69C 3MTSA 4DR2Q 4JI3L 1QVGA 4LFBL 1BCPC 2KCMA 3UDFA 4DV0L 3PCOB 2M2LA 4JI7Q 4R4TA 1R4PB 1A2TA 4DR3L 2ICIA 3V2TA 4KHPQ 5K36G 1LTLA 2E74C 1S3OA 3UDGA 2R92B 1PVOA 1RCVD 4POFA 2FMMA 1X3QA 1PFSA 2KECA 1UE6A 5AJ3L 3CRKC 1I4GA 1Z47A 1A3UA 5IGCA 1Y1VG 4A75A 1LTBD 5C44G 4A3DH 1IBMQ 1AEXA 4LAAA 4K6DA 1PFBA 1X54A 4P74A 3CCSA 5GAGC 2QILA 2BA1A 3TSSA 1RF2D 1E22A 1HR0W 1ILQA 4HJ9A 1QB5D 1MD2D 2F0QA 2E76C 1X55A 4UHVA 3ND9A 2K04A 5JEAJ 3G6EA 3PQIA 2QKIC 2Q2TA 3HOZB 4GOPB 1GUSA 1M1KC 5M3MB 2NVYH 2HDLA 4L63B 5J3BA 2B3GA 1TWAB 4WFN3 4ID6A 2K50A 1IBKL 2NVTH 2Q8IB 4MN3A 5IP9H 1GVPA 3S1RB 3K57A 1PH9A 2CH4A 1RKNA 4ZKBB 2AQ1B 5LMNQ 4K14A 1N34L 2SEBD 4H02A 1N8RC 4GLXA 1ASYA 4V190 1EY5A 2XWJB 3STBC 4X3TA 1O7IA 1JT8A 2K5DA 1VQGA 1CT1D 1K28A 2F3IA 4KD3A 1VMCA 4C3IB 4DAYB 4JBJA 1S5DD 3JC66 2PI2A 4R8NA 4L5SA 4X6AH 5C0XH 1F2ZA 1EZ8A 1EQVA 3CCEA 3MXUA 1P8LA 4L8JA 2QDBA 1A8VA 2ES2A 1EYDA 1STEA 3BS1A 4K2LA 5LMUQ 2JJQA 5FLXc 4A3JH 4Q5VA 1PZJD 3G6JB 4DV3Q 3WWVA 3KUPA 1D1IA 1K8GA 1O7LA 2D2CC 1KAAA 2EIFA 3TP6A 2AHOB 1TVXA 2YTXA 1EY6A 1WD0A 3MFYA 4HR7B 3JAME 1VQPA 2ICEC 1J6QA 2ZTCA 2IHEA 2UU9L 1BBXC 3ZJYC 5IYCH 3CP0A 3G48A 2WAQB 5ELBA 3QO2A 4YHHQ 2MP1A 2NVYB 1RJTA 2WKDA 1UUPA 3E9HA 1VF5C 3FDTA 4O2DA 1PFMA 2HT1A 3HOUB 2NVTB 3I8ZA 1S4ZA 4DK3C 1WTQA 1HNXQ 4XT3B 3BZKA 4ALPA 3HKZE 4LF8Q 4NXNQ 2LXKA 2DY7A 3Q8DA 5JVH3 5HGTA 2AKWB 2KJXA 2LXJA 4ZUJA 3S17H 1I4PA 3H94A 1B7YB 4X64L 3I4NG 1RD9D 1SSOA 2NVQH 3Q24A 2A5HA 3S1NH 1NR2A 1QWYA 2J7ZA 3I91A 3P20A 3J81L 4A3IG 3BYYB 4GN4B 3PV0A 4R9WA 5CV6A 4IOCA 2QDLA 5M3FG 3QOLA 3A8IE 3SK4A 4K8JA 3GTQB 1A6XA 1DCZA 2DNCA 3W2DA 4K0KQ 1U0LA 2N55A 4KHZA 1ICFB 5EGTA 1V1QA 4AQYQ 1MGSA 2M00A 1TWHH 1VQJA 3OTOL 4A3JB 2F4VL 2PW5A 3HZXA 3TS0A 3SGIA 5J1ZA 4F7XA 3MZ5A 1PZKD 3OHXC 4B3SL 4BXXH 1IW7C 1E0BA 1S5FD 4DUYL 1EY9A 1E2VA 5DM73 5IT9L 4PG3A 3HOVB 4LFCQ 2F0HA 5GQOA 1XMQL 1Y8NB 2L0CA 1WI5A 3ERSX 4IFDH 4ODGA 2WP8J 1MSHA 2K5WA 2MO1A 4X65Q 1KXLA 2J4XA 2JP1A 2XWBB 3AU7A 4LF4Q 3IAYA 1KNEA 1RDPD 2RKSA 2VL6A 1BR9A 2HUGA 3OWFA 1B2TA 1B8AA 5EJWA 3S17B 1HFGA 3N52A 5G3LD 5IWAQ 2Y0SB 5C5LA 2NZHA 4LF6Q 3CHBD 3VR4A 4DV1Q 3HOYG 1VQCA 3D8GA 1YEZA 3JAMi 3S1NB 3D4DA 3MVVA 2F0SA 2VUMG 1NMFA 3NBIA 2Q2HA 1PH1A 3BG3A 4EQ5A 3AFQA 5ELCA 3MXGA 3NBHB 3LWEA 4CKBA 4DA2A 2Z6BA 1EQTA 5M5YH 1EEFD 3M85A 4A3FB 2Z0SA 1DOKA 3O13A 1B9NA 4ULLA 4ZUIA 1TWHB 1IYUA 4KI0A 5JAVA 4BA2I 1HR0L 1RTOA 2CQOA 1EQQA 2OQ0A 3FKIG 5C44H 1K73C 1CK1A 4LNQA 1Y1WG 4XT1B 4EQNA 1PA6A 3E5SA 1CHQD 1PDQA 2GVAA 3NBHA 4XYOA 3M4YA 2CW0C 1EY0A 2DJFC 2EYMA 1QVCA 1I4XA 4LUOA 3DWAA 4HTHA 2BH2A 1A15A 1ZEQX 1K83H 1SNQA 3J81c 1H95A 1L1OC 5C4XG 1K9MC 4DV4L 3KFUA 1K8OA 2Q2IA 3KLSX 1TWGB 3A55A 2BDOA 1WTRA 4JK1C 5FO9B 1UE7A 2K32A 4R4IA 1PTOC 3PF5A 1H9MA 2R92G 2EY6A 3MHBA 3X3MA 1XYIA 2B29A 4JC0A 5I2XA 1Q46A 5I6WA 3IL8A 3C2PA 3TMEA 4HIDA 4RWSC 1RODA 4N8X1 1VQEA 3QIAA 4CDCC 1M8AA 2B2YA 3RN5A 1W6KA 1BBWA 1N36Q 1QCBD 3VDYA 3KF8B 1PTOF 3OYYA 3I4MH 2XRSD 1SJED 4DN4M 4MHEA 3HOZG 2NN6G 5M3MG 2UUBQ 5FO8B 1T5EA 3ND8A 2LY7A 4S3SA 2IL8A 1GXDC 2K6AA 2VZAA 1JB3A 1QUQB 1TIID 2TSSA 2QA4A 1VQ7A 2K75A 4RA8A 2MNAA 4UP7A 3HKZB 3BJUA 4DU9A 4HAEA 3T13A 2G5DA 2RF4A 4F8MA 1KIXA 1K83B 1VQ4A 3KF8A 4IJHA 1N9WA 2L1BA 1X3FA 3MWYW 4N8FA 1JOKA 2UUAQ 3NEMA 1NTGA 4LWCA 3M7GA 3PUYA 1QUQA 3A7AB 4DV5L 4B3MQ 2JA7H 3BZDB 2EYOA 2JEAI 3S16H 4WJWA 1JJCB 3X3NA 1D5ZC 2A6HC 2YTVA 1C9OA 1OXVA 3VYUA 5H1SE 3I73A 1OXUA 1Q81C 1YNXA 4WORA 5CV7A 1I6HH 1HNWQ 1VQMA 3VYSA 4YIJA 2WINB 3J80c 2EPBA 4FO2A 2XVSA 3F2CA 3H0GH 4BY7H 4KKSA 2N8NA 4KY7A 4YCVA 5M3FH 2KCNA 1DYQA 1NUCA 1JQYD 1FNWA 4OXPA 2FINB 3U50C 4BY1H 1R9TH 3I4MB 4QUCA 4IQZA 4DK1A 3S2HH 2WAQG 1J5EL 4C1NK 3L9AX 4L5RC 1IYVA 2XGTA 1DXMA 3G7LA 4G7OC 4PV1C 1XPUA 3KLRA 3HOUG 4CDFC 5IOCA 2OT2A 5IP9G 4XDXA 3NXWA 2UXCQ 1OXXK 3CCRA 4WJ4A 4OX9L 4DR7Q 3K0XA 1LLRD 1Z9FA 3RZOH 3UE0A 1CM9A 2R7ZH 2DGYA 2B2VA 1QVFA 1SNMA 2AWNA 4A93H 2B2UA 3GTJB 3R2TA 1B53A 5KNCA 3R8BA 3TDQA 1LTSD 2JA7B 1E24A 2PQAA 2PI2E 3S16B 2CWAA 5C0XG 1KTKA 1B3QA 3OWEB 1RIPA 1EEID 2Z9HA 3TZUA 3MFGA 2VQEL 3M4OB 2F52A 5J39A 5T1IA 4GN3B 4JI5L 3URYA 1ZXTA 1H9KA 3I2ZA 2N49A 3H0GB 1NBWA 1DZ1A 4A3JG 4BY7B 2MFIA 2TMPA 4FXDA 4IURA 5EKIA 2FXQA 2A68D 1J9OA 2B2YC 5A2QE 2OWOA 1LT4D 1C4QA 1CKMA 2E8GA 2B8FA 2KHSA 4G7HC 4BY1B 1R9TB 3A5UA 2FFKB 2H4OA 2I5MX 4UPAA 5IYCG 1F9PA 3KK7A 3GV6A 4R4QA 3S2HB 4KN7C 3KJPA 1A0IA 4HJ8A 4JBWA 3HRZC 1II3A 1H9SB 4L5TA 4QIWB 4HJ5A 3FKIH 3C1EA 4PNYA 3W5OA 2UXBL 3DXJC 4QUFA 3S15H 4B9WA 5E7NA 1W2BA 1KRTA 2Q2UA 5IT9E 3NENA 2KHIA 1EY4A 4DPGA 1YIJA 2L4NA 4DR1L 4QF4A 2R7ZB 1VDZA 3AEVA 4A3BH 1AZQA 5CV9A 5C5MA 2WAQE 4JI3Q 4LFBQ 1Q1EA 4M1UB 4DV0Q 2Y0SG 4APVA 1X9NA 4LJZC 1H9SA 4BBSB 2HQEA 4DR3Q 4ZLTF 2HDMA 1K8AC 3EN2A 5KGUA 3DUZA 3GP7A 2RCNA 3NHHA 1AN8A 2AWOA 4ABNA 4DV2L 3SVMA 5AJ3Q 3HOXH 4JI2L 4KMUC 1K8MA 4M8AA 4QL5A 2A8VA 3QR8A 1MHWC 4IUTA 1HTLD 2R93B 4HEDA 1HZAA 3VR5A 1AH9A 1CKNB 2RDHA 2XN9C 4TVAB 1SN8A 1NSNS 4X66L 1NNXA 3SE0A 2G9DA 1C7YA 4BXXG 3I90A 5E1FA 3SEBA 1ICWA 2JA5H 4JW0A 1SDFA 4LF7L 4YCUA 5JEAH 3E9IA 3I4OA 1D8LA 1IBKQ 3KBXA 2ATWA 1HTPA 4IFDG 1DONA 3NQTA 3TN2A 2QEJC 3I3CA 4HMIA 2WFWA 4GKJL 1N34Q 5IIFA 1CZWA 1NMGA 5D65A 3A54A 3NTIA 3S15B 2SNMA 3D0FA 1NE3A 1QNKA 1HPCA 3CU7A 2NVXH 3E3XA 4HIKA 3C46A 4BS9A 1E7ZA 1LV9A 1ENFA 4RGTA 4QGUA 1O7ZA 4A3BB 2B2VC 4JBMA 5K5PA 4OO1H 1SMXA 4AYBB 1K3BC 4FNFA 2BH8A 1YVCA 3H09A 1I50H 2OTJA 1KNAA 3R3OA 4PZ7A 1JICA 4DNIA 3CC4A 4AH6A 3GD7A 2RA4A 1IKLA 3CC7A 2A6ED 1QNUA 1ENCA 1SBBB 4C3IH 3OW7A 2A74C 3HOXB 1ET6A 2K5NA 4JI8L 5KYLA 2K14A 2L5TA 2V1CC 4RAUC 3WOEA 3TBIB 4IALA 4ILWA 5G3LF 4KLKA 4XTCS 5IGGA 4A3KH 4KHVA 1TY0A 4KN4C 2Y0SE 1F2LA 4A3MB 1X3EA 4DAVA 1DD2A 3NWTA 1HZ9A 4KY6A 4RG1A 3DMUA 2EY5A 1LTGD 1F9SA 2UU9Q 3HEJA 3MAQA 2JA5B 3Q0AA 2KCTA 4HMJA 3PIP3 2RVLA 1FNUA 1ESFA 4DXFA 4Y7NH 1PLFA 1SXTA 4CGYB 5C4JH 1G8ZD 3HKZG 1PRTD 3TRZA 1CKOA 2PNRC 1SYCA 1PTOH 1FGUA 1HNZL 4DR6L 1ZKOA 1EUJA 2RQXA 5AFWA 4PZ8A 2NVXB 1L0YB 3HOUH 2ZXPA 5L37A 4X64Q 3AFPA 4JCVE 2ZT9C 3PIPA 1DGSA 2A73B 3K7AH 1PMRA 3FP9A 3RUZA 3HP3A 2RSNA 4GZYC 1PYBA 5E3FA 1I50B 2O5JC 1VQ8A 4A3CH 4MTKA 3A56A 3ULJA 4JYAL 4K8IA 3SK6A 4OIJA 3T53B 1D5XC 1FVIA 5GROA 4TKOB 1YNND 2CKZB 4IUNA 3J7ZC 4ZYSA 4DFAA 2LFNA 4FF3A 4FXGC 2VXWA 4J6HA 4A3KB 1SE2A 3LGJA 3NK9A 1BVSA 3OTOQ 1WTVA 2JN4A 2F4VQ 1GOZA 2JQOA 1GJXA 3D3RA 2CWPA 3GTQH 4U673 4B3SQ 2K5QA 2I46A 2VS1A 3CCJA 4KJNA 4DUYQ 3I4MG 1NJIC 4JVZA 2NWGA 1X3GA 1E1OA 1X3PA 5IP7H 1L1OB 1VQIA 1PYWD 1CI3M 5IGDA 3BVGA 2KQ3A 2Q8RE 1XMQQ 1CA5A 1YNJD 1TT2A 3QG1A 1XNRL 2F4IA 1EFID 3KJOA 3J7AF 4Y7NB 1XTDA 4P71A 4C56C 4MNOA 5C4JB 1BO0A 1V8QA 3HOVH 3HG9A 4CKCA 3CCUA 2B63H 3I70A 5IGFA 3Q6SA 1PTOB 3OIQA 4IUQA 4RMFA 1L1OA 4JBKA 1FGBD 1GHKA 1GUOA 3BDCA 2DJGC 4DAPA 1L0WA 2I0QA 3FPPA 2JA7G 3PO2H 4P73A 3L7ZC 2EZVA 5CBEE 2F0OA 3K7AB 1M90C 1E2WA 1EYGA 3NPPA 3BYTB 4IPGA 3K0YA 1BBUA 3BVMA 2KBNA 2BDNA 4KK7A 5I9PA 4JV5L 3H0GG 3CRLC 4JI6L 1TWFB 3I56A 4BY7G 1GO3E 1EIHA 4DV6L 3HOWH 3J7YW 4YWKA 1HR0Q 3TQYA 4OIKA 1C0AA 2EY1A 1KDAA 1WCMH 4BY1G 1ZYRD 4WRDA 4A3FH 1PH5A 1PXUA 2HIVA 4B3TL 3KLWA 2D0PA 4NP5A 2E2DC 4HSVA 1Q8KA 3AB9A 3ICEA 1XJVA 1I6VC 1D1KA 4LF9L 4HN7A 1N33L 2PW7A 2WKCA 1I94L 3CW2C 1U4RA 2B63B 1JJ2A 4DV4Q 2R7ZG 4CDEC 3RZDH 1GD7A 1SE4A 1DOLA 5HURA 3G4SA 4A93G 3QWNA 3VR2A 4XXEA 1LABA 1F77A 3PO2B 1XMOL 1B4OA 1TS5A 4EVOA 2BE5D 2JXMB 2K01A 3A74A 5CV5A 1TWGH 2J0TD 3PO3H 4CBVA 1DJRD 2VQFL 5KEEA 4QMGA 4O42A 2R93G 1BKBA 3K59A 1XX8A 5ELNA 1HZCA 3NTHA 1DOMA 2NTTA 3C1FA 5BN5A 4FYDA 4X62L 5EPJA 5EPKA 3HOWB 2EOTA 1BUVT 1FNVA 1G6ZA 1A3TA 4A3GB 1WCMB 2F0GA 2R6GA 2K5VA 5ELFA 3EROA 3HFZB 2KOLA 1HQMC 1AE3A 1SMYD 3D4RA 2A69D 4A3LH 4N9TA 1WJJA 3J80L 5LHY1 2R7DA 2MGSA 4H7BA 1TKWB 1BCPD 4UAIA 3DLLA 2K7VA 2K33A 1Q8IA 4TSSA 3S24A 4F87A 4A3BG 1UEBA 3RZDB 3CC2A 3FVQA 4DV5Q 2WB1E 4AYBG 5C4HA 3I55A 1LTAD 2ZJQA 4QIWE 1YJNA 3TP5A 1H9JA 2X69A 3CXCA 5IYDH 1KAWA 1STGA 4FP5D 5FLXE 4MTNA 3UE1A 2D9UA 2OXPA 2EE1A 5CBAE 2YYZA 3HOXG 2HD3A 3PO3B 3NSWA 1F9QA 1V1PA 2KUMA 4POGA 2I07B 3I7FA 1JC7A 2FJ2A 4LW1A 3M3YH 1MJCA 3A8JE 1X65A 2L11A 3A0JA 2L55A 3FEWX 2V4DA 3LNNA 3EIVA 4CKEA 4IFDJ 2SOBA 5KNBA 2LKVA 4JPBW 1PH6A 3CF5A 3H91A 3T1YL 1K0SA 4GKKL 1WTHA 1KDCA 2ZXRA 5C6AA 2B8GA 3EFXD 3SXHA 2FHTA 3BDOA 2JA5G 2AQ3B 3PF4A 5FLMH 1ENAA 4WJ3M 1K3RA 1J5EQ 1SYEA 1BF4A 2N78A 5JEAG 3S9WA 1VQFA 5D14A 4J8QA 1F9RA 1Q7YC 1LUZA 1U9RA 3ITPA 3STBD 5IY0A 2DY8A 2K05A 3F2DA 4OX9Q 1RTNA 2EJGC 4RHRA 3CCMA 1LTID 1SFOB 2AUJD 2L9HA 4FF4A 3H3VI 3PUWA 1GUNA 5KRUA 1WTPA 4FDBA 5EKLA 3GTLH 3GQBA 1WOCA 4OO1G 2NUCA 2WV6D 5M9OA 4HJ7A 1ONLA 3OPOA 3IFTA 3KBGA 1QJOA 1CUKA 4P72A 3GTJH 3K8AA 4C3IG 2VQEQ 1B50A 2EJMA 2BOSA 2WACA 1X6OA 4JI5Q 2K1BA 4FXKC 5FKAC 1V9PA 4A3KG 1VQBA 4IUVA 1BXTA 5I6YA 1SNPA 3M3YB 4AYBE 1AE2A 3M4OH 3NE5B 1UAPA 4C2MH 2RDGA 4TRDA 3TREA 1XNQL 3CCVA 4XQJA 1QZHA 1AZPA 2EY2A 1A2UA 2YV5A 2JA6H 2JEBI 3CCQA 1B1ZA 3ER0A 1EY8A 4C3JH 4DUZL 2UXBQ 3IRBA 3GDEA 1VS0A 1PH7A 4TQUS 4RHSA 2BCOA 1TS2A 3IFDA 2UUCL 4I65A 2KEEA 2LMCB 1I4RA 2HCIA 4RFBA 4U68A 4DR1Q 4F88A 4IUUA 2Z6KA 1EZ6A 2PQAB 3HGBA 2ZM6L 4IPCA 3OMGA 3GTLB 2X6GA 1PRTF 2OF1A 4KKUA 5IGEA 3QB3A 2RCFA 2ZXOA 4XYQA 1G2TA 3U9OA 1IL2A 3FMCA 1KLUD 4OELB 4DV2Q 4A3CG 1UWVA 3PUZA 4JI2Q 1IL8A 3GTKH 2E2JB 4QCLA 3KF6A 4BBSH 1OXTA 3S1MH 2F3VA 3KOJA 2YTYA 4AIMA 3V96A 1PYSB 3WDNA 4RH6A 2HIXA 2QCPX 4E6IA 4BWGB 4UDUC 3Q22A 2NTSA 3M4QA 3ERQA 3E0JA 3SK5A 1YHQA 4ZCKA 3DM3A 4X66Q 4C2MB 1XPRA 2R93H 1SRUA 1N32L 2BA0A 4LF7Q 1Q12A 3EBEA 1EY7A 3J81E 4X3UA 5IP7G 2JA6B 2CFMA 2N88A 5I4DA 2KVMA 1VQ6A 4C3JB 4DR5L 2XTIA 1FD7D 1LT6D 2R61A 1JWMD 1SLJA 4GKJQ 4ZAIA 5ELEA 4GNXC 3I4NB 4Y52H 4EQOA 1U4PA 3HOVG 1JMCA 5KNDA 3CMAA 2B63G 1ASZA 4IO9A 4ZK9B 2WB1B 1IXRA 1HUMA 3RMHA 2MO0A 2WIIB 1LT3D 5CC4A 1TS3A 1EU4A 1JJGA 3RR5A 3F8TA 3R2IA 2OTLA 3PO2G 1A3VA 1CA6A 4GS3A 1B44D 3DWPA 4K5WA 3GTPH 5GAEC 2K4KA 4A3EH 2YU9H 1PH3A 4JI8Q 3GTKB 1HXYD 2K03A 5GAHC 3S1MB 1QG7A 4X3KA 3RD4A 1OO9B 3W3AA 2MHVA 3T1HL 5CORA 1HH2P 3S1QH 3CQZH 1FR3A 1YI2A 1VMPA 1JR0D 3RNUA 5EBDA 3HOWG 4FF1A 3RLFA 2CW0D 4XQQA 4EX5A 5IYBH 1WCMG 1SYBA 1LO5D 4A3FG 4R4CA 4BBRH 1WYDA 1JORA 3T4AC 1SYFA 2A19A 2XIWA 2AUKA 3NUCA 4R1JA 4DXGA 4A3MH 4Z9CB 1RL2A 1EFWA 3JAMc 1CFMA 4DK6C 1IYJB 2NBFA 4LFAL 2DN8A 1SAPA 2RDFA 1XTCD 2CHBD 4ME3A 3DWQA 4IPDA 1GM5A 3J7AV 1KHIA 4IJLA 4NMZA 1HQRD 1HNZQ 4DR6Q 5JJLA 1UEAB 2C35B 3M4PA 4CJ0B 3PGZA 4RGOS 3L0OA 1PTOD 3TEHB 1Y8OB 2Z6KC 4IN3A 1KC8C 4H13C 3J80E 1G2SA 4JI1L 2JK8A 5CYUA 3FHWA 1CSQA 3GTPB 1UE5A 2HHHL 4JYAQ 2VW9A 4A3EB 4LMQD 1PHJA 3PO3G 2YU9B 2NN6I 3UDIA 2NZ1D 3J81i 1LYLA 1Y8PB 1MI2A 1WVLA 5JOBA 3LX0A 3M7NA 4V0BA 4OWWB 2LS01 3S1QB 3CQZB 2CVRA 4ZRZA 4OL7A 4UP9A 5DLQE 4G4KA 3VA5A 4JI0L 1V43A 1AFPA 1H9RA 3OSOA 3U58A 3FPUB 3T51B 3H3VC 2KEDA 2F0TA 2IW3A 2Z8LA 4G57A 3VR6A 1HCZA 2K52A 4HSPA 2IX0A 2ASBA 4BBRB 1W3SA 3K6OA 5C4XB 2EXDA 1SMYC 3Q23A 1TXYA 2Q8TA 4QQBX 1LM0A 1XNRQ 1YHAA 1WFQA 3PSIA 3OIPA 1S40A 5HGQA 4LF5L 2HQLA 1I3QB 5F2DA 1FJGL 1HA6A 4PMBA 2N3SA 1PH8A 2R7FA 5IODA 1Y69U 4OWTB 5COYA 2IWHA 4A3LG 1L2FA 1FL0A 1SNOA 2E2IB 1VQ9A 2PZWA 2E5LL 1B70B 2ZJRA 1K0RA 3TZDA 3DEPA 2A6HD 5C3EH 3K5NA 2B39A 2PZTA 1D5MC 1Y14B 5EPLA 5IYDG 3VYRA 2SDFA 4B3RL 1WTWA 3W1GA 1BCPF 1STYA 3D6CA 2EQSA 3ULPA 2EDGA 2IX3A 4HCEA 5KYIA 1VQOA 1Q82C 4JV5Q 4JI6Q 4K2KA 2PNHA 2XNAC 1QOHA 2O5IC 3W1BA 1T5XD 4DV6Q 3K5LA 4B08A 1NY4A 3SK8A 1CHPD 1OTCA
chains in the Genus database with same CATH topology
1TU2B 2Z4HA 3U9SA 3E6ZX 4K6LA 3IKJA 5DNFA 4EGVA 1O78A 4R8IA 3MEHA 5C0XI 1JOQA 2F0JA 3SHLA 1WTOA 3ZYYX 1MBYA 1B9MA 1BOSA 5A35A 4OGQC 4PMWA 1VCIA 1GUWA 4ZQ3A 1STBA 5C3EB 3EQLC 4CHTB 4G7ZC 5JVG3 1JWUD 4A3DB 2PQEA 1AP0A 4DAYA 4KD4A 4KJOA 4ME5A 1BNZA 3GV3A 3T56B 1MSGA 5CGKA 1HRJA 5I9OA 3EJIA 1E2ZA 1ET9A 4NDXA 2EYPA 2F0KA 5JJZA 3GTOB 3PMFA 4RGNA 3QOJA 1G291 1X32A 2KCCA 4MIUA 3AMUA 4C3JG 5BN4A 2PMZB 3MC0B 4LK1C 1PZID 1KLGD 2R3ZA 2F0MA 2Z1CA 4C3HB 4Q0FA 1G91A 1L0XB 2F0NA 1SJHD 2L12A 1TY2A 5A2QL 1AW7A 1NR4A 2ENBA 3ONAB 5C0XJ 1CQVA 1O7YA 5KIXA 3EA6A 2D5DA 1HHVA 1KABA 2D62A 4KTAA 2RBMA 4DF7A 5DEHA 2PZUA 5D3IB 2EYHA 5FO7B 2JA8B 4IFDI 3A7LA 2F0DA 1PRTB 5IGBA 3WOFA 2VB2X 1XWEA 1V1OA 3C3LA 2E2HB 2A68C 1D6EC 1TS4A 1ESRA 3MXNA 3VR3A 3MA2B 2G9HD 1UNSA 4N9PA 1SYDA 2EVBA 5LL6S 2XRQD 3I4LA 5I2YA 2NVQB 3TP7A 1QE6A 4L6TB 1EOTA 4DGZA 3S2DB 2IT1A 4H44C 5K36H 1EL0A 5J22A 1CQFA 1FYCA 1V1PB 2EYJA 4PQXA 1GUTA 1Z7TA 3H6MA 1HFNA 3PIO3 1CTMA 2O4XA 4RGMA 2F0EA 3D6WA 2AQ2B 2EJFC 3PUXA 4ZKCB 2F0WA 3GO5A 2FMCA 4RKBA 1OXSC 1Q1BA 3R93A 1LTTD 4RCOA 2F0VA 1Z6HA 5TSSA 2ID0A 2GA4B 2B2WA 1STHA 3NP8A 3V05A 1S5ED 5CMDA 2X6LA 2QF7A 5M5YB 3FRPB 3DHQA 4XQNA 1Y1VB 1C8CA 4P2CB 4NKLA 5C44B 3NWSA 2A6EC 4K5VA 1VF7A 4KY5A 4C1NI 3DM1A 4IUPA 1R4QB 2JE6I 2IPKD 2VB3X 1BQQT 2PYKA 1CZGA 2B2TA 3VYTA 1JWSD 3D4WA 1J8IA 3T16A 5CV8A 3N6RA 3PUVA 2RSOA 1TR5A 4I7ZC 3KLSA 4OHJA 2JYOA 5CV4A 3S14B 1EYAA 2O2LD 1S5BD 4J1MA 2MJ8A 3P1HA 1PRTC 1HA5A 5DM63 4PMCA 2VNUD 1SE3A 5E4WC 2F03A 3MXPA 2DNEA 4DNTB 3QJYA 1Q90A 2C5CA 1ML0D 5ELDA 2F1MA 2F0UA 5C3XA 3GTGB 4FVMA 1M4VA 3JAML 5EKKA 1XXGA 1EYCA 1SYGA 3SR1A 5FK9C 5FOBB 1YNNC 3HS0C 4BA1I 5C3WA 1O80A 4FF2A 1TQOA 1W6JA 1BCPB 2MPMA 1STAA 1IW7D 5M5WB 3CKIB 4XIGS 2CQAA 4KKTA 4NW2A 4KV6A 1Q3LA 4RKLA 4B9XA 2SNSA 3K5OA 1YNJC 5T1GA 3L3OC 3VA7A 1SNCA 2F0FA 4C3HG 2HCCA 3NTKA 1WTXA 1RHPA 2MUYA 2JSOA 1C48A 1I4QA 1I6HB 3UI2A 2F3WA 3BDLA 2XSCA 4RCNA 1EU3A 2B2WC 4A3IB 1SNDA 4IZ8A 5D3DA 5LL6X 5CR3A 2C9OA 5JPNC 5M3FB 5EBCA 1LTRD 2E75C 2Z4IA 4X3SA 1LT5D 1QILA 1EWCA 3I72A 1U4LA 1F2MA 2M9VA 1JCKB 5JPMC 1SEBD 2F0IA 1ILPA 1STNA 2F0LA 3DEOA 1JOOA 3K58A 2B2TC 2K28A 2EXZA 3RZOB 4QB4A 4O1NA 1ZYRC 1S5CD 2F0PA 1GHJA 2EYFA 2EYLA 1TWCB 1D2BA 4A93B 3A8KE 1WD1A 5EQ0A 3SDZA 3OOCA 3OMCA 2OEOA 1EIGA 1B3AA 3BVZA 4DK0A 5BN3A 2IX1A 1IKMA 2NB0A 4K5XA 2H1EA 3HOYB 1BDOA 1F2YA 1PFNA 5M5XB 1U4MA 1HUNA 2VUMB 4H0LC 1KDBA 1JE4A 4CJ2C 2NYZD 2BE5C 5E4XA 1EWHA 1IHZA 1LACA 5ISRA 2IJ0A 3P7JA 3K5MA 1DM0B 3D31A 3LWUA 3F2UA 4EQPA 3FKIB 1Y1WB 2NN6H 2PPBC 3NQIA 5C4ZA 5FLXL 4OO1I 2KA7A 1I4HA 2PO4A 4HCSA 4DNRB 3GTMB 3P75A 3TP8A 4CJ1B 3EVQA 5DAUA 5NUCA 2B2UC 2PCFB 1NAPA 1NCVA 1GUGA 2A69C 3MTSA 1BCPC 2M2LA 1R4PB 1A2TA 2ICIA 3V2TA 5K36G 2E74C 2R92B 1RCVD 2FMMA 1X3QA 2KECA 3CRKC 1I4GA 1Z47A 1A3UA 5IGCA 1LTBD 1AEXA 4LAAA 4K6DA 1PFBA 2QILA 2BA1A 3TSSA 1RF2D 1ILQA 1QB5D 1MD2D 2F0QA 2E76C 3ND9A 2K04A 5JEAJ 2QKIC 3HOZB 1GUSA 5M3MB 2HDLA 4L63B 1TWAB 4WFN3 4ID6A 2Q8IB 4MN3A 3S1RB 3K57A 1RKNA 4ZKBB 2AQ1B 4K14A 2SEBD 4V190 1EY5A 2XWJB 4X3TA 2K5DA 1CT1D 4KD3A 1VMCA 4C3IB 1S5DD 4R8NA 5C0XH 1F2ZA 1EZ8A 1EQVA 3MXUA 4L8JA 2QDBA 1EYDA 1STEA 3BS1A 4K2LA 4Q5VA 1PZJD 3G6JB 3KUPA 1D1IA 1O7LA 2D2CC 1KAAA 3TP6A 1TVXA 1EY6A 1WD0A 3MFYA 4HR7B 3JAME 2ICEC 1BBXC 2WAQB 5ELBA 3QO2A 2MP1A 2NVYB 1RJTA 2WKDA 1UUPA 1VF5C 3FDTA 1PFMA 3HOUB 2NVTB 3I8ZA 1S4ZA 1WTQA 4XT3B 2DY7A 5JVH3 5HGTA 2KJXA 4ZUJA 1I4PA 3H94A 1RD9D 1SSOA 3Q24A 2A5HA 1NR2A 1QWYA 2J7ZA 3I91A 3P20A 3J81L 3BYYB 3PV0A 4R9WA 5CV6A 3QOLA 3A8IE 3SK4A 4K8JA 3GTQB 1A6XA 1DCZA 2DNCA 3W2DA 5EGTA 2N55A 4KHZA 1MGSA 2M00A 4A3JB 2PW5A 3HZXA 5J1ZA 4F7XA 3MZ5A 1PZKD 3OHXC 1IW7C 1E0BA 1S5FD 1EY9A 1E2VA 5DM73 5IT9L 3HOVB 2F0HA 1Y8NB 2L0CA 4IFDH 4ODGA 2WP8J 1MSHA 2K5WA 2J4XA 2JP1A 2XWBB 3AU7A 3IAYA 1KNEA 1RDPD 2RKSA 1BR9A 2HUGA 3OWFA 1B2TA 5EJWA 3S17B 1HFGA 3N52A 5G3LD 2Y0SB 5C5LA 3CHBD 3VR4A 3D8GA 3S1NB 3D4DA 3MVVA 2F0SA 3NBIA 3BG3A 5ELCA 3MXGA 3LWEA 4CKBA 4DA2A 1EQTA 1EEFD 3M85A 4A3FB 1DOKA 3O13A 1B9NA 4ULLA 4ZUIA 1TWHB 1IYUA 4KI0A 5JAVA 4BA2I 1RTOA 1CK1A 4XT1B 4EQNA 3E5SA 1CHQD 1PDQA 3NBHA 4XYOA 3M4YA 2CW0C 1EY0A 2EYMA 1I4XA 3DWAA 4HTHA 1A15A 1ZEQX 1SNQA 1K8OA 3KLSX 1TWGB 3A55A 2BDOA 1WTRA 4JK1C 5FO9B 2K32A 1PTOC 1H9MA 2EY6A 3MHBA 3X3MA 1XYIA 5I2XA 5I6WA 3IL8A 3C2PA 3TMEA 4RWSC 1RODA 3QIAA 1M8AA 2B2YA 1W6KA 1QCBD 1PTOF 2XRSD 1SJED 4DN4M 4MHEA 2NN6G 5FO8B 1T5EA 3ND8A 2LY7A 4S3SA 2IL8A 1GXDC 2K6AA 1JB3A 1TIID 2TSSA 4RA8A 3HKZB 4DU9A 4HAEA 3T13A 4F8MA 1K83B 3KF8A 2L1BA 3MWYW 1JOKA 3M7GA 3PUYA 3A7AB 3BZDB 2EYOA 2JEAI 4WJWA 3X3NA 1D5ZC 2A6HC 1OXVA 3VYUA 3I73A 1OXUA 4WORA 5CV7A 3VYSA 4YIJA 2WINB 2EPBA 4FO2A 2XVSA 4KKSA 4KY7A 2KCNA 1DYQA 1NUCA 1JQYD 1FNWA 2FINB 3I4MB 4QUCA 4IQZA 4DK1A 4C1NK 3L9AX 1IYVA 1DXMA 3G7LA 4G7OC 4PV1C 3KLRA 5IOCA 2OT2A 4XDXA 3NXWA 1OXXK 1LLRD 1CM9A 2B2VA 1SNMA 2AWNA 2B2UA 3GTJB 3R2TA 1B53A 5KNCA 3R8BA 3TDQA 1LTSD 2JA7B 3S16B 5C0XG 1KTKA 3OWEB 1EEID 3TZUA 3MFGA 3M4OB 5J39A 5T1IA 3URYA 1ZXTA 1H9KA 3H0GB 1DZ1A 4BY7B 2TMPA 4FXDA 4IURA 5EKIA 2A68D 1J9OA 2B2YC 5A2QE 1LT4D 1C4QA 2B8FA 2KHSA 4G7HC 4BY1B 1R9TB 2FFKB 2H4OA 1F9PA 3KK7A 3GV6A 3S2HB 4KN7C 4JBWA 3HRZC 1II3A 1H9SB 4QIWB 3C1EA 4PNYA 3DXJC 4QUFA 4B9WA 5IT9E 1EY4A 2L4NA 2R7ZB 4QF4A 1VDZA 1AZQA 5CV9A 5C5MA 1Q1EA 4M1UB 4LJZC 1H9SA 4BBSB 2HQEA 4ZLTF 2HDMA 5KGUA 3DUZA 3GP7A 3NHHA 1AN8A 2AWOA 4ABNA 3SVMA 4KMUC 1K8MA 4M8AA 4IUTA 1HTLD 2R93B 4HEDA 3VR5A 2RDHA 2XN9C 1NSNS 3SE0A 2G9DA 3I90A 5E1FA 3SEBA 1ICWA 1SDFA 5JEAH 3KBXA 1HTPA 4IFDG 1DONA 3NQTA 3TN2A 2QEJC 3I3CA 4HMIA 3S15B 5IIFA 1CZWA 5D65A 3A54A 3NTIA 2SNMA 1QNKA 1HPCA 3CU7A 3C46A 4BS9A 1LV9A 1ENFA 4RGTA 1O7ZA 4A3BB 2B2VC 5K5PA 4OO1H 4AYBB 4FNFA 3H09A 1KNAA 3R3OA 1JICA 3GD7A 2RA4A 1IKLA 2A6ED 1QNUA 1ENCA 1SBBB 3OW7A 2A74C 3HOXB 1ET6A 5KYLA 2L5TA 4RAUC 3WOEA 3TBIB 4IALA 4ILWA 5G3LF 4XTCS 5IGGA 4KHVA 1TY0A 4KN4C 1F2LA 4A3MB 4DAVA 1DD2A 3NWTA 4KY6A 3DMUA 2EY5A 1LTGD 1F9SA 3HEJA 3MAQA 2JA5B 3Q0AA 4HMJA 3PIP3 2RVLA 1FNUA 1ESFA 4DXFA 1PLFA 1SXTA 4CGYB 1G8ZD 1PRTD 2PNRC 1SYCA 1PTOH 1ZKOA 5AFWA 2RQXA 2NVXB 1L0YB 2ZXPA 2ZT9C 2A73B 1PMRA 3RUZA 3HP3A 2RSNA 4GZYC 5E3FA 2O5JC 1I50B 3A56A 4K8IA 3SK6A 4OIJA 3T53B 1D5XC 4TKOB 1YNND 4IUNA 4ZYSA 4DFAA 2LFNA 4FF3A 4FXGC 2VXWA 4J6HA 4A3KB 1SE2A 3NK9A 1WTVA 1GOZA 1GJXA 3D3RA 4U673 2K5QA 2I46A 4KJNA 2NWGA 1X3PA 1PYWD 1CI3M 5IGDA 3BVGA 2KQ3A 2Q8RE 1CA5A 1YNJD 1TT2A 3QG1A 2F4IA 1EFID 3J7AF 4Y7NB 4C56C 5C4JB 1BO0A 1V8QA 3HG9A 4CKCA 3I70A 5IGFA 3Q6SA 1PTOB 3OIQA 4IUQA 1FGBD 1GHKA 1GUOA 3BDCA 4DAPA 3FPPA 3L7ZC 2EZVA 5CBEE 2F0OA 3K7AB 1E2WA 3NPPA 3BYTB 3K0YA 3BVMA 2BDNA 4KK7A 5I9PA 3CRLC 1TWFB 1EIHA 3J7YW 4OIKA 2EY1A 1KDAA 1ZYRD 4WRDA 1PXUA 4NP5A 2E2DC 4HSVA 3AB9A 1I6VC 1D1KA 4HN7A 2PW7A 2WKCA 1U4RA 2B63B 1SE4A 1DOLA 5HURA 3QWNA 3VR2A 4XXEA 1LABA 1F77A 3PO2B 1B4OA 1TS5A 4EVOA 2BE5D 2JXMB 2K01A 5CV5A 2J0TD 4CBVA 1DJRD 5KEEA 4QMGA 4O42A 3K59A 1XX8A 3NTHA 1DOMA 2NTTA 3C1FA 5BN5A 4FYDA 5EPJA 5EPKA 3HOWB 2EOTA 1BUVT 1FNVA 1G6ZA 1A3TA 4A3GB 1WCMB 2F0GA 2R6GA 5ELFA 3EROA 2KOLA 1HQMC 1SMYD 3D4RA 2A69D 4N9TA 3J80L 5LHY1 2MGSA 4H7BA 1TKWB 1BCPD 4UAIA 2K7VA 2K33A 1Q8IA 4TSSA 4F87A 3RZDB 3FVQA 5C4HA 1LTAD 3TP5A 1H9JA 2X69A 1STGA 4FP5D 5FLXE 2D9UA 2OXPA 2EE1A 5CBAE 2YYZA 3PO3B 3NSWA 1F9QA 1V1PA 2KUMA 2I07B 1JC7A 2FJ2A 3A8JE 2L11A 2L55A 3FEWX 2V4DA 3LNNA 4CKEA 4IFDJ 2SOBA 5KNBA 2LKVA 3H91A 1KDCA 2ZXRA 5C6AA 2B8GA 3EFXD 3SXHA 2FHTA 3BDOA 2AQ3B 1ENAA 1SYEA 1BF4A 5JEAG 3S9WA 5D14A 4J8QA 1F9RA 1U9RA 3ITPA 2DY8A 2K05A 1RTNA 2EJGC 4RHRA 1LTID 1SFOB 2AUJD 2L9HA 4FF4A 3PUWA 1GUNA 5KRUA 1WTPA 5EKLA 3GQBA 4OO1G 2NUCA 2WV6D 5M9OA 1ONLA 3OPOA 3IFTA 3KBGA 1QJOA 4C3IG 1B50A 2EJMA 2BOSA 2WACA 2K1BA 4FXKC 5FKAC 4IUVA 1BXTA 5I6YA 1SNPA 3M3YB 3NE5B 1UAPA 2RDGA 4TRDA 4XQJA 1AZPA 2EY2A 1A2UA 2JEBI 1B1ZA 1EY8A 4TQUS 4RHSA 2BCOA 1TS2A 3IFDA 4I65A 2KEEA 2LMCB 1I4RA 2HCIA 4RFBA 4U68A 4F88A 4IUUA 1EZ6A 3HGBA 3OMGA 3GTLB 2X6GA 1PRTF 2OF1A 4KKUA 5IGEA 3QB3A 2ZXOA 4XYQA 1G2TA 3U9OA 3FMCA 1KLUD 3PUZA 1IL8A 2E2JB 4QCLA 1OXTA 2F3VA 3V96A 3WDNA 4RH6A 2QCPX 4E6IA 4BWGB 4UDUC 3Q22A 2NTSA 3ERQA 3E0JA 3SK5A 4C2MB 2BA0A 1Q12A 1EY7A 3J81E 4X3UA 2JA6B 2N88A 5I4DA 2KVMA 4C3JB 1FD7D 1LT6D 2R61A 1JWMD 4ZAIA 5ELEA 3I4NB 4EQOA 1U4PA 5KNDA 4ZK9B 2WB1B 1HUMA 3RMHA 2WIIB 1LT3D 5CC4A 1TS3A 1EU4A 3R2IA 1A3VA 1CA6A 1B44D 3DWPA 4K5WA 3GTKB 1HXYD 2K03A 3S1MB 1QG7A 4X3KA 3RD4A 1OO9B 3W3AA 2MHVA 5CORA 1FR3A 1VMPA 1JR0D 5EBDA 4FF1A 3RLFA 2CW0D 4XQQA 1SYBA 1LO5D 1JORA 3T4AC 4DXGA 1SYFA 2XIWA 2AUKA 3NUCA 4Z9CB 1CFMA 2NBFA 2DN8A 1SAPA 2RDFA 1XTCD 2CHBD 3DWQA 3J7AV 4NMZA 1HQRD 1UEAB 4CJ0B 4RGOS 1PTOD 1Y8OB 4IN3A 4H13C 3J80E 1G2SA 5CYUA 3GTPB 4A3EB 4LMQD 2YU9B 2NN6I 2NZ1D 1Y8PB 1MI2A 1WVLA 5JOBA 3LX0A 3M7NA 4V0BA 2LS01 3S1QB 3CQZB 2CVRA 4ZRZA 4OL7A 3VA5A 4G4KA 1V43A 1AFPA 1H9RA 3OSOA 3FPUB 3T51B 3H3VC 2KEDA 2F0TA 3VR6A 2IW3A 2Z8LA 4G57A 1HCZA 4HSPA 2IX0A 4BBRB 3K6OA 5C4XB 1SMYC 3Q23A 2Q8TA 3OIPA 1HA6A 1I3QB 5F2DA 4PMBA 5IODA 1Y69U 5COYA 2IWHA 1SNOA 2E2IB 2PZWA 3TZDA 3DEPA 2A6HD 3K5NA 2B39A 2PZTA 1D5MC 5EPLA 3VYRA 2SDFA 1WTWA 1BCPF 1STYA 3D6CA 2EDGA 2IX3A 4HCEA 5KYIA 4K2KA 2XNAC 1QOHA 2O5IC 1T5XD 3K5LA 4B08A 3SK8A 1CHPD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DY8 A;  2Q8R E;  1CA5 A;  2K05 A;  1RTN A;  1KNA A;  3D6W A;  4CJ0 B;  2FFK B;  1JIC A;  1PFB A;  1O7Y A;  1RTO A;  2DY7 A;  1F9P A;  4O42 A;  3GV6 A;  2RA4 A;  1IKL A;  1WD1 A;  5EQ0 A;  1XX8 A;  1BO0 A;  1HHV A;  1EIG A;  1ILQ A;  5D14 A;  4XT1 B;  2L9H A;  4ZKC B;  4RAU C;  1G2S A;  1DOM A;  1B3A A;  5DNF A;  1PDQ A;  1WTP A;  4QUF A;  5EPJ A;  1SSO A;  5EPK A;  3Q6S A;  4R8I A;  2EOT A;  4X3U A;  2K04 A;  1NR2 A;  2J7Z A;  3I91 A;  4IUQ A;  3R93 A;  1F2L A;  1O80 A;  4LMQ D;  1G6Z A;  2EPB A;  1IKM A;  4R9W A;  2N88 A;  2KVM A;  1A15 A;  2NZ1 D;  2L4N A;  2H1E A;  2HDL A;  1WTO A;  1MI2 A;  1PFN A;  1WVL A;  1U4M A;  2B2W A;  4ZAI A;  2MPM A;  1AZQ A;  5CBE E;  2KOL A;  1HUN A;  1F9S A;  1B50 A;  4MN3 A;  1U4P A;  2N55 A;  5CMD A;  2K1B A;  2X6L A;  4ZKB B;  1MGS A;  1GUW A;  1JE4 A;  2FIN B;  4ZK9 B;  2CVR A;  2HDM A;  1HUM A;  4CJ2 C;  2RVL A;  4ZLT F;  4IUV A;  2NYZ D;  4NW2 A;  1ESR A;  4QUC A;  1Q3L A;  5E4X A;  1PLF A;  3FPU B;  2MGS A;  2KED A;  4X3T A;  3P7J A;  3SVM A;  2BDN A;  5T1G A;  1WTR A;  1AP0 A;  4UAI A;  1E0B A;  1C8C A;  2HCC A;  3G7L A;  1VMC A;  1EIH A;  1AZP A;  2Q8T A;  4IUT A;  1CA6 A;  1BNZ A;  3GV3 A;  4XDX A;  1XYI A;  3F2U A;  3DM1 A;  4IUP A;  4OIK A;  5AFW A;  1WTX A;  1RHP A;  4HED A;  1HA6 A;  3IL8 A;  1MSG A;  3UI2 A;  1QE6 A;  1HRJ A;  2X69 A;  1EOT A;  4RWS C;  1ROD A;  5COY A;  1CM9 A;  1MSH A;  2B2V A;  2K03 A;  2B2T A;  1M8A A;  2B2W C;  1QG7 A;  2B2Y A;  2D9U A;  2EE1 A;  2JP1 A;  4X3K A;  5CBA E;  5JJZ A;  3I90 A;  3HP3 A;  3IFD A;  2RSN A;  4HSV A;  2B2U A;  1ICW A;  1KNE A;  4HCS A;  5COR A;  1SDF A;  2KEE A;  1B53 A;  1J8I A;  1F9Q A;  1EL0 A;  4CJ1 B;  1G91 A;  2HUG A;  3TZD A;  2KUM A;  3DEP A;  2HCI A;  1VMP A;  4U68 A;  3KUP A;  2RSO A;  2FJ2 A;  4OIJ A;  1B2T A;  4IUU A;  2B2U C;  5EJW A;  4DN4 M;  2L11 A;  1TVX A;  1NAP A;  1NCV A;  1HFG A;  3N52 A;  4MHE A;  1U4R A;  2JYO A;  4X3S A;  3KBX A;  1WD0 A;  1X32 A;  1DON A;  5EPL A;  3TN2 A;  3MTS A;  2SDF A;  3I3C A;  1WTW A;  2MJ8 A;  1U4L A;  2IL8 A;  2VXW A;  2X6G A;  2XIW A;  3H91 A;  5D65 A;  1WTV A;  1BBX C;  5T1I A;  1G2T A;  2M2L A;  1DOL A;  4RA8 A;  1QNK A;  1ZXT A;  2FHT A;  1HFN A;  5E4W C;  3QO2 A;  4HAE A;  2MP1 A;  2R3Z A;  1ILP A;  1DZ1 A;  1LV9 A;  1SAP A;  1RJT A;  1BF4 A;  3DEO A;  1IL8 A;  1O7Z A;  3FDT A;  2FMM A;  3LWE A;  1X3Q A;  2KEC A;  1PFM A;  2L1B A;  3MWY W;  2B2V C;  1EQT A;  4IUR A;  1B4O A;  2B2T C;  2NWG A;  1J9O A;  2B2Y C;  2K28 A;  1S4Z A;  1ML0 D;  1X3P A;  2L12 A;  3I8Z A;  1WTQ A;  5EKI A;  1F9R A;  1NR4 A;  2K01 A;  1DOK A;  3ONA B;  4XT3 B; 
#chains in the Genus database with same CATH topology
 3A5Z B;  3GTO H;  1IBL L;  4DV7 L;  3F1Z A;  1TU2 B;  1TWF H;  2Z4H A;  3U9S A;  4B3T Q;  4NXM L;  5FLM G;  1YZ6 A;  4HIM A;  3E6Z X;  4K6L A;  3IKJ A;  5DNF A;  4EGV A;  1O78 A;  4R8I A;  4GOP A;  3J80 i;  4LF9 Q;  3MEH A;  1YIT A;  3ULL A;  5C0X I;  1N33 Q;  1I94 Q;  1JOQ A;  2F0J A;  2ALY B;  3SHL A;  4C3H H;  1WTO A;  1A62 A;  3ZYY X;  3RN2 A;  5JJK A;  1MBY A;  1B9M A;  1BOS A;  1UE1 A;  4DR4 L;  5A35 A;  4OGQ C;  4PMW A;  4DR2 L;  1VCI A;  1GUW A;  4ZQ3 A;  1STB A;  5C3E B;  3EQL C;  4CHT B;  4JI7 L;  4G7Z C;  1YHB A;  5JVG 3;  3F2B A;  1JWU D;  1XMO Q;  4KHP L;  4A3D B;  2PQE A;  1AP0 A;  4DAY A;  4KD4 A;  4KJO A;  1U5K A;  4ME5 A;  1VQL A;  2VQF Q;  3GV3 A;  1BNZ A;  3T56 B;  4IOA A;  1MSG A;  5CGK A;  1IBM L;  2JA8 H;  1HRJ A;  5I9O A;  3U4V A;  3EJI A;  4L5Q A;  3H15 A;  1E2Z A;  3AQQ A;  1ET9 A;  4NDX A;  2EYP A;  2OCE A;  2F0K A;  4X62 Q;  5JJZ A;  4YWL A;  2E2H H;  3GTO B;  1G6P A;  3PMF A;  4OEM B;  4RGN A;  2JA6 G;  3QOJ A;  1G29 1;  1X32 A;  2KCC A;  4MIU A;  3J81 j;  3AMU A;  5HY6 A;  4C3J G;  4GLA C;  4A3G H;  4YWM A;  5BN4 A;  2PMZ B;  3MC0 B;  1PH2 A;  4LK1 C;  5LMN L;  2MQH A;  1PZI D;  1KLG D;  3K81 C;  2R3Z A;  2UXD Q;  2F0M A;  2Z1C A;  2WB1 G;  4C3H B;  3S2D H;  4Q0F A;  1G91 A;  1L0X B;  2F0N A;  1SJH D;  2L12 A;  1TY2 A;  5A2Q L;  1NR4 A;  1AW7 A;  2ENB A;  3ONA B;  5C0X J;  1CQV A;  1O7Y A;  5KIX A;  3EA6 A;  2KHJ A;  3HKS A;  2D5D A;  1HHV A;  1KAB A;  2D62 A;  4KTA A;  2RBM A;  2VY3 A;  3E0E A;  5DEH A;  4DF7 A;  4HJA A;  2PZU A;  4BBS G;  1YJ9 A;  3MXN B;  5D3I B;  2EYH A;  1VQN A;  5LMU L;  4OWX B;  5FO7 B;  4JI4 Q;  2JA8 B;  2AMC B;  3AYH B;  4DV3 L;  4IFD I;  1MIU A;  3A7L A;  2F0D A;  4JOI A;  1PRT B;  5IGB A;  3T1Y Q;  3WOF A;  4GKK Q;  2RHS B;  2VB2 X;  1XWE A;  1V1O A;  3KDF B;  3C3L A;  2E2H B;  2A68 C;  1D6E C;  2LSS A;  1TS4 A;  1ESR A;  3MXN A;  2OQK A;  5EAY A;  3VR3 A;  3MA2 B;  2G9H D;  4YHH L;  1UNS A;  4N9P A;  1QZG A;  1SYD A;  1P16 A;  2EVB A;  1S72 A;  4GOP C;  1HNX L;  5LL6 S;  2XRQ D;  4IPH A;  3I4L A;  3KDF A;  5I2Y A;  2NVQ B;  3TP7 A;  1QE6 A;  4LF8 L;  4L6T B;  4NXN L;  1EOT A;  4DGZ A;  1Q86 C;  3S2D B;  3UDX A;  2IT1 A;  2ZTE A;  4H44 C;  5K36 H;  1EL0 A;  2DUD A;  5J22 A;  2A1A A;  2UXD L;  1SFO H;  1CQF A;  1FYC A;  5FJ8 G;  1V1P B;  4A3E G;  2EYJ A;  4PQX A;  1E1T A;  3BZC A;  1Y1V H;  4K0K L;  1GUT A;  1CSP A;  3TS2 A;  3H6M A;  1Z7T A;  4AQY L;  1HFN A;  4GN5 A;  3PIO 3;  4YCW A;  4YY3 Q;  1I5F A;  1CTM A;  2O4X A;  1XNQ Q;  4LUZ A;  4RGM A;  4PZ6 A;  2F0E A;  5IYB G;  1MJE A;  4GNX B;  4BBR G;  4JI4 L;  4A3M G;  2QEX A;  1SR3 A;  2ZJP A;  3D6W A;  2AQ2 B;  2EJF C;  4LFC L;  4DKA C;  2QW7 A;  4DUZ Q;  3PUX A;  5IE8 A;  4ZKC B;  3PIO A;  2F0W A;  3GO5 A;  2UUC Q;  3S14 H;  2FMC A;  4X65 L;  4RKB A;  4LF4 L;  2I5L X;  1OXS C;  1Q1B A;  4A76 A;  3R93 A;  1LTT D;  4RCO A;  4GNX A;  3M9B A;  3BU2 A;  2F0V A;  1Z6H A;  2ZM6 Q;  5TSS A;  2ID0 A;  2GA4 B;  4P75 A;  1X56 A;  2B2W A;  4UP8 A;  5IWA L;  1STH A;  4QJF A;  5IT9 c;  3NP8 A;  4LF6 L;  3V05 A;  1S5E D;  5CMD A;  4DV1 L;  2X6L A;  3GTG H;  2QF7 A;  5M5Y B;  3FRP B;  1G51 A;  3DHQ A;  4XQN A;  1KD1 C;  1GKH A;  3H3V H;  1Y1V B;  1C8C A;  4P2C B;  4NKL A;  5C44 B;  3NWS A;  2A6E C;  1VQ5 A;  4K5V A;  1VF7 A;  4KY5 A;  4C1N I;  3DM1 A;  4IUP A;  2E2J H;  4O0A A;  3J7A 5;  1KL9 A;  1R4Q B;  2JE6 I;  2L15 A;  2IPK D;  2VB3 X;  1BQQ T;  2PYK A;  4DAM A;  4JOI C;  1N32 Q;  1CZG A;  2B2T A;  3VYT A;  3CCL A;  1JWS D;  3D4W A;  5M5W H;  1HJP A;  1J8I A;  3T16 A;  4JG2 A;  4YY3 L;  3CPF A;  4OON A;  5CV8 A;  3CD6 A;  3N6R A;  3PUV A;  4DR5 Q;  2RSO A;  1TR5 A;  4I7Z C;  3RLO A;  3KLS A;  5JJI A;  4OHJ A;  1T9H A;  2JYO A;  5CV4 A;  3S14 B;  1EYA A;  2O2L D;  1S5B D;  4J1M A;  2MJ8 A;  3P1H A;  1PRT C;  1HA5 A;  5DM6 3;  4PMC A;  1VQD A;  2VNU D;  1SE3 A;  4I7A A;  5E4W C;  2F03 A;  3MXP A;  3I4N H;  2DNE A;  4DNT B;  3QJY A;  5C3E G;  1Q90 A;  2IHF A;  2GVB A;  2C5C A;  4A3D G;  1ML0 D;  5ELD A;  4A3I H;  1XPO A;  2F1M A;  3KF6 B;  2F0U A;  5C3X A;  3GTG B;  4FVM A;  1EQR A;  1VQK A;  1M4V A;  3JAM L;  1JB7 A;  5EKK A;  1XXG A;  3CPW A;  1YJW A;  1EYC A;  4QY7 A;  1SYG A;  1IZ6 A;  3SR1 A;  3T1H Q;  5FK9 C;  5FOB B;  1YNN C;  3HS0 C;  4BA1 I;  4GLV B;  5C3W A;  1O80 A;  3OW2 A;  1N36 L;  1TQO A;  4LUV A;  4FF2 A;  1W6J A;  1MKH A;  1KQS A;  3K80 C;  1BCP B;  4NPS A;  1VQH A;  2D0O A;  2MPM A;  4NB3 A;  1STA A;  1EIF A;  1IW7 D;  2P5Z X;  2UUB L;  5M5W B;  3CKI B;  4XIG S;  2ZTD A;  2CQA A;  2KEN A;  4LFA Q;  2IY5 B;  4KKT A;  4NW2 A;  4KV6 A;  1TWC H;  1Q3L A;  4RKL A;  4B9X A;  2SNS A;  1VQA A;  1SE8 A;  1YNJ C;  3K5O A;  5T1G A;  2H5X A;  3L3O C;  3VA7 A;  2I5H A;  1SNC A;  2F0F A;  4C3H G;  2HCC A;  3B6Y A;  2UUA L;  1YBY A;  3NTK A;  1WTX A;  1RHP A;  4A4I A;  2MUY A;  2JSO A;  1C48 A;  1I4Q A;  1EWI A;  3K7U C;  3UI2 A;  1I6H B;  4B3M L;  2F3W A;  3BDL A;  3HOY H;  5BR8 Q;  2XSC A;  4RCN A;  1EU3 A;  5M5X H;  2B2W C;  4JI1 Q;  4CDD C;  2VUM H;  4A3I B;  1SND A;  4IZ8 A;  5D3D A;  5LL6 X;  2HHH Q;  5CR3 A;  2C9O A;  5JPN C;  5M3F B;  5EBC A;  1HNW L;  1LTR D;  2GN5 A;  3L2P A;  3NEL A;  2E75 C;  2Z4I A;  4X3S A;  5ELO A;  2JA8 G;  1LT5 D;  1QIL A;  5FJ8 H;  4R4O A;  1EWC A;  3I72 A;  3G71 A;  1U4L A;  1E3P A;  1F2M A;  2CCZ A;  4JI0 Q;  2M9V A;  5GAD C;  1JCK B;  1A63 A;  5JPM C;  4MZ9 A;  1SEB D;  2CH4 W;  2F0I A;  4HIO A;  1Y1W H;  1ILP A;  1STN A;  2F0L A;  3DEO A;  1D7Q A;  1JOO A;  3K58 A;  2B2T C;  2K28 A;  2EXZ A;  3RZO B;  4QB4 A;  4O1N A;  1ZYR C;  1EIY B;  4UY8 C;  1S5C D;  2F0P A;  1FJG Q;  1GHJ A;  4LF5 Q;  1PH4 A;  2EYF A;  3GTM H;  1SRO A;  3RLN A;  4A3G G;  3U4Z A;  2EYL A;  1TWC B;  2K5H A;  2UXC L;  1D2B A;  4A93 B;  3A8K E;  1WD1 A;  5EQ0 A;  3SDZ A;  5C4X H;  3OOC A;  4DR7 L;  3OMC A;  2OEO A;  1EIG A;  2E5L Q;  4J15 A;  1B3A A;  1I3Q H;  3KYH C;  3BVZ A;  3MEF A;  4DK0 A;  1PV4 A;  5BN3 A;  5LMN W;  2IX1 A;  1KRS A;  1IKM A;  1EOV A;  2NB0 A;  4K5X A;  2E2I H;  2H1E A;  2R92 H;  3HOY B;  2PMZ E;  1BDO A;  1F2Y A;  1PFN A;  4B3R Q;  5M5X B;  1U4M A;  2NZO A;  1HUN A;  2VUM B;  4H0L C;  1KDB A;  3CAM A;  3CME A;  1JE4 A;  4CJ2 C;  2NYZ D;  2BE5 C;  5E4X A;  1EWH A;  1IHZ A;  5BR8 L;  1LAC A;  1JE5 A;  5ISR A;  2IJ0 A;  2QGQ A;  3P7J A;  3K5M A;  2JA9 A;  1DM0 B;  3D31 A;  3LWU A;  1IBL Q;  1CKN A;  4DV7 Q;  3F2U A;  4EQP A;  3FKI B;  1HZB A;  3HOZ H;  1Y1W B;  2NN6 H;  2PPB C;  4NXM Q;  5M3M H;  3NQI A;  5C4Z A;  1TWA H;  2RHQ B;  5FLX L;  4OO1 I;  2KA7 A;  3S1R H;  1I4H A;  2PO4 A;  4HCS A;  4DNR B;  3GTM B;  3P75 A;  3TP8 A;  4CJ1 B;  3EVQ A;  5DAU A;  5NUC A;  2B2U C;  2PCF B;  1NAP A;  1NCV A;  1GUG A;  4DR4 Q;  2A69 C;  3MTS A;  4DR2 Q;  4JI3 L;  1QVG A;  4LFB L;  1BCP C;  2KCM A;  3UDF A;  4DV0 L;  3PCO B;  2M2L A;  4JI7 Q;  4R4T A;  1R4P B;  1A2T A;  4DR3 L;  2ICI A;  3V2T A;  4KHP Q;  5K36 G;  1LTL A;  2E74 C;  1S3O A;  3UDG A;  2R92 B;  1PVO A;  1RCV D;  4POF A;  2FMM A;  1X3Q A;  1PFS A;  2KEC A;  1UE6 A;  5AJ3 L;  3CRK C;  1I4G A;  1Z47 A;  1A3U A;  5IGC A;  1Y1V G;  4A75 A;  1LTB D;  5C44 G;  4A3D H;  1IBM Q;  1AEX A;  4LAA A;  4K6D A;  1PFB A;  1X54 A;  4P74 A;  3CCS A;  5GAG C;  2QIL A;  2BA1 A;  3TSS A;  1RF2 D;  1E22 A;  1HR0 W;  1ILQ A;  4HJ9 A;  1QB5 D;  1MD2 D;  2F0Q A;  2E76 C;  1X55 A;  4UHV A;  3ND9 A;  2K04 A;  5JEA J;  3G6E A;  3PQI A;  2QKI C;  2Q2T A;  3HOZ B;  4GOP B;  1GUS A;  1M1K C;  5M3M B;  2NVY H;  2HDL A;  4L63 B;  5J3B A;  2B3G A;  1TWA B;  4WFN 3;  4ID6 A;  2K50 A;  1IBK L;  2NVT H;  2Q8I B;  4MN3 A;  5IP9 H;  1GVP A;  3S1R B;  3K57 A;  1PH9 A;  2CH4 A;  1RKN A;  4ZKB B;  2AQ1 B;  5LMN Q;  4K14 A;  1N34 L;  2SEB D;  4H02 A;  1N8R C;  4GLX A;  1ASY A;  4V19 0;  1EY5 A;  2XWJ B;  3STB C;  4X3T A;  1O7I A;  1JT8 A;  2K5D A;  1VQG A;  1CT1 D;  1K28 A;  2F3I A;  4KD3 A;  1VMC A;  4C3I B;  4DAY B;  4JBJ A;  1S5D D;  3JC6 6;  2PI2 A;  4R8N A;  4L5S A;  4X6A H;  5C0X H;  1F2Z A;  1EZ8 A;  1EQV A;  3CCE A;  3MXU A;  1P8L A;  4L8J A;  2QDB A;  1A8V A;  2ES2 A;  1EYD A;  1STE A;  3BS1 A;  4K2L A;  5LMU Q;  2JJQ A;  5FLX c;  4A3J H;  4Q5V A;  1PZJ D;  3G6J B;  4DV3 Q;  3WWV A;  3KUP A;  1D1I A;  1K8G A;  1O7L A;  2D2C C;  1KAA A;  2EIF A;  3TP6 A;  2AHO B;  1TVX A;  2YTX A;  1EY6 A;  1WD0 A;  3MFY A;  4HR7 B;  3JAM E;  1VQP A;  2ICE C;  1J6Q A;  2ZTC A;  2IHE A;  2UU9 L;  1BBX C;  3ZJY C;  5IYC H;  3CP0 A;  3G48 A;  2WAQ B;  5ELB A;  3QO2 A;  4YHH Q;  2MP1 A;  2NVY B;  1RJT A;  2WKD A;  1UUP A;  3E9H A;  1VF5 C;  3FDT A;  4O2D A;  1PFM A;  2HT1 A;  3HOU B;  2NVT B;  3I8Z A;  1S4Z A;  4DK3 C;  1WTQ A;  1HNX Q;  4XT3 B;  3BZK A;  4ALP A;  3HKZ E;  4LF8 Q;  4NXN Q;  2LXK A;  2DY7 A;  3Q8D A;  5JVH 3;  5HGT A;  2AKW B;  2KJX A;  2LXJ A;  4ZUJ A;  3S17 H;  1I4P A;  3H94 A;  1B7Y B;  4X64 L;  3I4N G;  1RD9 D;  1SSO A;  2NVQ H;  3Q24 A;  2A5H A;  3S1N H;  1NR2 A;  1QWY A;  2J7Z A;  3I91 A;  3P20 A;  3J81 L;  4A3I G;  3BYY B;  4GN4 B;  3PV0 A;  4R9W A;  5CV6 A;  4IOC A;  2QDL A;  5M3F G;  3QOL A;  3A8I E;  3SK4 A;  4K8J A;  3GTQ B;  1A6X A;  1DCZ A;  2DNC A;  3W2D A;  4K0K Q;  1U0L A;  2N55 A;  4KHZ A;  1ICF B;  5EGT A;  1V1Q A;  4AQY Q;  1MGS A;  2M00 A;  1TWH H;  1VQJ A;  3OTO L;  4A3J B;  2F4V L;  2PW5 A;  3HZX A;  3TS0 A;  3SGI A;  5J1Z A;  4F7X A;  3MZ5 A;  1PZK D;  3OHX C;  4B3S L;  4BXX H;  1IW7 C;  1E0B A;  1S5F D;  4DUY L;  1EY9 A;  1E2V A;  5DM7 3;  5IT9 L;  4PG3 A;  3HOV B;  4LFC Q;  2F0H A;  5GQO A;  1XMQ L;  1Y8N B;  2L0C A;  1WI5 A;  3ERS X;  4IFD H;  4ODG A;  2WP8 J;  1MSH A;  2K5W A;  2MO1 A;  4X65 Q;  1KXL A;  2J4X A;  2JP1 A;  2XWB B;  3AU7 A;  4LF4 Q;  3IAY A;  1KNE A;  1RDP D;  2RKS A;  2VL6 A;  1BR9 A;  2HUG A;  3OWF A;  1B2T A;  1B8A A;  5EJW A;  3S17 B;  1HFG A;  3N52 A;  5G3L D;  5IWA Q;  2Y0S B;  5C5L A;  2NZH A;  4LF6 Q;  3CHB D;  3VR4 A;  4DV1 Q;  3HOY G;  1VQC A;  3D8G A;  1YEZ A;  3JAM i;  3S1N B;  3D4D A;  3MVV A;  2F0S A;  2VUM G;  1NMF A;  3NBI A;  2Q2H A;  1PH1 A;  3BG3 A;  4EQ5 A;  3AFQ A;  5ELC A;  3MXG A;  3NBH B;  3LWE A;  4CKB A;  4DA2 A;  2Z6B A;  1EQT A;  5M5Y H;  1EEF D;  3M85 A;  4A3F B;  2Z0S A;  1DOK A;  3O13 A;  1B9N A;  4ULL A;  4ZUI A;  1TWH B;  1IYU A;  4KI0 A;  5JAV A;  4BA2 I;  1HR0 L;  1RTO A;  2CQO A;  1EQQ A;  2OQ0 A;  3FKI G;  5C44 H;  1K73 C;  1CK1 A;  4LNQ A;  1Y1W G;  4XT1 B;  4EQN A;  1PA6 A;  3E5S A;  1CHQ D;  1PDQ A;  2GVA A;  3NBH A;  4XYO A;  3M4Y A;  2CW0 C;  1EY0 A;  2DJF C;  2EYM A;  1QVC A;  1I4X A;  4LUO A;  3DWA A;  4HTH A;  2BH2 A;  1A15 A;  1ZEQ X;  1K83 H;  1SNQ A;  3J81 c;  1H95 A;  1L1O C;  5C4X G;  1K9M C;  4DV4 L;  3KFU A;  1K8O A;  2Q2I A;  3KLS X;  1TWG B;  3A55 A;  2BDO A;  1WTR A;  4JK1 C;  5FO9 B;  1UE7 A;  2K32 A;  4R4I A;  1PTO C;  3PF5 A;  1H9M A;  2R92 G;  2EY6 A;  3MHB A;  3X3M A;  1XYI A;  2B29 A;  4JC0 A;  5I2X A;  1Q46 A;  5I6W A;  3IL8 A;  3C2P A;  3TME A;  4HID A;  4RWS C;  1ROD A;  4N8X 1;  1VQE A;  3QIA A;  4CDC C;  1M8A A;  2B2Y A;  3RN5 A;  1W6K A;  1BBW A;  1N36 Q;  1QCB D;  3VDY A;  3KF8 B;  1PTO F;  3OYY A;  3I4M H;  2XRS D;  1SJE D;  4DN4 M;  4MHE A;  3HOZ G;  2NN6 G;  5M3M G;  2UUB Q;  5FO8 B;  1T5E A;  3ND8 A;  2LY7 A;  4S3S A;  2IL8 A;  1GXD C;  2K6A A;  2VZA A;  1JB3 A;  1QUQ B;  1TII D;  2TSS A;  2QA4 A;  1VQ7 A;  2K75 A;  4RA8 A;  2MNA A;  4UP7 A;  3HKZ B;  3BJU A;  4DU9 A;  4HAE A;  3T13 A;  2G5D A;  2RF4 A;  4F8M A;  1KIX A;  1K83 B;  1VQ4 A;  3KF8 A;  4IJH A;  1N9W A;  2L1B A;  1X3F A;  3MWY W;  4N8F A;  1JOK A;  2UUA Q;  3NEM A;  1NTG A;  4LWC A;  3M7G A;  3PUY A;  1QUQ A;  3A7A B;  4DV5 L;  4B3M Q;  2JA7 H;  3BZD B;  2EYO A;  2JEA I;  3S16 H;  4WJW A;  1JJC B;  3X3N A;  1D5Z C;  2A6H C;  2YTV A;  1C9O A;  1OXV A;  3VYU A;  5H1S E;  3I73 A;  1OXU A;  1Q81 C;  1YNX A;  4WOR A;  5CV7 A;  1I6H H;  1HNW Q;  1VQM A;  3VYS A;  4YIJ A;  2WIN B;  3J80 c;  2EPB A;  4FO2 A;  2XVS A;  3F2C A;  3H0G H;  4BY7 H;  4KKS A;  2N8N A;  4KY7 A;  4YCV A;  5M3F H;  2KCN A;  1DYQ A;  1NUC A;  1JQY D;  1FNW A;  4OXP A;  2FIN B;  3U50 C;  4BY1 H;  1R9T H;  3I4M B;  4QUC A;  4IQZ A;  4DK1 A;  3S2H H;  2WAQ G;  1J5E L;  4C1N K;  3L9A X;  4L5R C;  1IYV A;  2XGT A;  1DXM A;  3G7L A;  4G7O C;  4PV1 C;  1XPU A;  3KLR A;  3HOU G;  4CDF C;  5IOC A;  2OT2 A;  5IP9 G;  4XDX A;  3NXW A;  2UXC Q;  1OXX K;  3CCR A;  4WJ4 A;  4OX9 L;  4DR7 Q;  3K0X A;  1LLR D;  1Z9F A;  3RZO H;  3UE0 A;  1CM9 A;  2R7Z H;  2DGY A;  2B2V A;  1QVF A;  1SNM A;  2AWN A;  4A93 H;  2B2U A;  3GTJ B;  3R2T A;  1B53 A;  5KNC A;  3R8B A;  3TDQ A;  1LTS D;  2JA7 B;  1E24 A;  2PQA A;  2PI2 E;  3S16 B;  2CWA A;  5C0X G;  1KTK A;  1B3Q A;  3OWE B;  1RIP A;  1EEI D;  2Z9H A;  3TZU A;  3MFG A;  2VQE L;  3M4O B;  2F52 A;  5J39 A;  5T1I A;  4GN3 B;  4JI5 L;  3URY A;  1ZXT A;  1H9K A;  3I2Z A;  2N49 A;  3H0G B;  1NBW A;  1DZ1 A;  4A3J G;  4BY7 B;  2MFI A;  2TMP A;  4FXD A;  4IUR A;  5EKI A;  2FXQ A;  2A68 D;  1J9O A;  2B2Y C;  5A2Q E;  2OWO A;  1LT4 D;  1C4Q A;  1CKM A;  2E8G A;  2B8F A;  2KHS A;  4G7H C;  4BY1 B;  1R9T B;  3A5U A;  2FFK B;  2H4O A;  2I5M X;  4UPA A;  5IYC G;  1F9P A;  3KK7 A;  3GV6 A;  4R4Q A;  3S2H B;  4KN7 C;  3KJP A;  1A0I A;  4HJ8 A;  4JBW A;  3HRZ C;  1II3 A;  1H9S B;  4L5T A;  4QIW B;  4HJ5 A;  3FKI H;  3C1E A;  4PNY A;  3W5O A;  2UXB L;  3DXJ C;  4QUF A;  3S15 H;  4B9W A;  5E7N A;  1W2B A;  1KRT A;  2Q2U A;  5IT9 E;  3NEN A;  2KHI A;  1EY4 A;  4DPG A;  1YIJ A;  2L4N A;  4DR1 L;  4QF4 A;  2R7Z B;  1VDZ A;  3AEV A;  4A3B H;  1AZQ A;  5CV9 A;  5C5M A;  2WAQ E;  4JI3 Q;  4LFB Q;  1Q1E A;  4M1U B;  4DV0 Q;  2Y0S G;  4APV A;  1X9N A;  4LJZ C;  1H9S A;  4BBS B;  2HQE A;  4DR3 Q;  4ZLT F;  2HDM A;  1K8A C;  3EN2 A;  5KGU A;  3DUZ A;  3GP7 A;  2RCN A;  3NHH A;  1AN8 A;  2AWO A;  4ABN A;  4DV2 L;  3SVM A;  5AJ3 Q;  3HOX H;  4JI2 L;  4KMU C;  1K8M A;  4M8A A;  4QL5 A;  2A8V A;  3QR8 A;  1MHW C;  4IUT A;  1HTL D;  2R93 B;  4HED A;  1HZA A;  3VR5 A;  1AH9 A;  1CKN B;  2RDH A;  2XN9 C;  4TVA B;  1SN8 A;  1NSN S;  4X66 L;  1NNX A;  3SE0 A;  2G9D A;  1C7Y A;  4BXX G;  3I90 A;  5E1F A;  3SEB A;  1ICW A;  2JA5 H;  4JW0 A;  1SDF A;  4LF7 L;  4YCU A;  5JEA H;  3E9I A;  3I4O A;  1D8L A;  1IBK Q;  3KBX A;  2ATW A;  1HTP A;  4IFD G;  1DON A;  3NQT A;  3TN2 A;  2QEJ C;  3I3C A;  4HMI A;  2WFW A;  4GKJ L;  1N34 Q;  5IIF A;  1CZW A;  1NMG A;  5D65 A;  3A54 A;  3NTI A;  3S15 B;  2SNM A;  3D0F A;  1NE3 A;  1QNK A;  1HPC A;  3CU7 A;  2NVX H;  3E3X A;  4HIK A;  3C46 A;  4BS9 A;  1E7Z A;  1LV9 A;  1ENF A;  4RGT A;  4QGU A;  1O7Z A;  4A3B B;  2B2V C;  4JBM A;  5K5P A;  4OO1 H;  1SMX A;  4AYB B;  1K3B C;  4FNF A;  2BH8 A;  1YVC A;  3H09 A;  1I50 H;  2OTJ A;  1KNA A;  3R3O A;  4PZ7 A;  1JIC A;  4DNI A;  3CC4 A;  4AH6 A;  3GD7 A;  2RA4 A;  1IKL A;  3CC7 A;  2A6E D;  1QNU A;  1ENC A;  1SBB B;  4C3I H;  3OW7 A;  2A74 C;  3HOX B;  1ET6 A;  2K5N A;  4JI8 L;  5KYL A;  2K14 A;  2L5T A;  2V1C C;  4RAU C;  3WOE A;  3TBI B;  4IAL A;  4ILW A;  5G3L F;  4KLK A;  4XTC S;  5IGG A;  4A3K H;  4KHV A;  1TY0 A;  4KN4 C;  2Y0S E;  1F2L A;  4A3M B;  1X3E A;  4DAV A;  1DD2 A;  3NWT A;  1HZ9 A;  4KY6 A;  4RG1 A;  3DMU A;  2EY5 A;  1LTG D;  1F9S A;  2UU9 Q;  3HEJ A;  3MAQ A;  2JA5 B;  3Q0A A;  2KCT A;  4HMJ A;  3PIP 3;  2RVL A;  1FNU A;  1ESF A;  4DXF A;  4Y7N H;  1PLF A;  1SXT A;  4CGY B;  5C4J H;  1G8Z D;  3HKZ G;  1PRT D;  3TRZ A;  1CKO A;  2PNR C;  1SYC A;  1PTO H;  1FGU A;  1HNZ L;  4DR6 L;  1ZKO A;  1EUJ A;  2RQX A;  5AFW A;  4PZ8 A;  2NVX B;  1L0Y B;  3HOU H;  2ZXP A;  5L37 A;  4X64 Q;  3AFP A;  4JCV E;  2ZT9 C;  3PIP A;  1DGS A;  2A73 B;  3K7A H;  1PMR A;  3FP9 A;  3RUZ A;  3HP3 A;  2RSN A;  4GZY C;  1PYB A;  5E3F A;  1I50 B;  2O5J C;  1VQ8 A;  4A3C H;  4MTK A;  3A56 A;  3ULJ A;  4JYA L;  4K8I A;  3SK6 A;  4OIJ A;  3T53 B;  1D5X C;  1FVI A;  5GRO A;  4TKO B;  1YNN D;  2CKZ B;  4IUN A;  3J7Z C;  4ZYS A;  4DFA A;  2LFN A;  4FF3 A;  4FXG C;  2VXW A;  4J6H A;  4A3K B;  1SE2 A;  3LGJ A;  3NK9 A;  1BVS A;  3OTO Q;  1WTV A;  2JN4 A;  2F4V Q;  1GOZ A;  2JQO A;  1GJX A;  3D3R A;  2CWP A;  3GTQ H;  4U67 3;  4B3S Q;  2K5Q A;  2I46 A;  2VS1 A;  3CCJ A;  4KJN A;  4DUY Q;  3I4M G;  1NJI C;  4JVZ A;  2NWG A;  1X3G A;  1E1O A;  1X3P A;  5IP7 H;  1L1O B;  1VQI A;  1PYW D;  1CI3 M;  5IGD A;  3BVG A;  2KQ3 A;  2Q8R E;  1XMQ Q;  1CA5 A;  1YNJ D;  1TT2 A;  3QG1 A;  1XNR L;  2F4I A;  1EFI D;  3KJO A;  3J7A F;  4Y7N B;  1XTD A;  4P71 A;  4C56 C;  4MNO A;  5C4J B;  1BO0 A;  1V8Q A;  3HOV H;  3HG9 A;  4CKC A;  3CCU A;  2B63 H;  3I70 A;  5IGF A;  3Q6S A;  1PTO B;  3OIQ A;  4IUQ A;  4RMF A;  1L1O A;  4JBK A;  1FGB D;  1GHK A;  1GUO A;  3BDC A;  2DJG C;  4DAP A;  1L0W A;  2I0Q A;  3FPP A;  2JA7 G;  3PO2 H;  4P73 A;  3L7Z C;  2EZV A;  5CBE E;  2F0O A;  3K7A B;  1M90 C;  1E2W A;  1EYG A;  3NPP A;  3BYT B;  4IPG A;  3K0Y A;  1BBU A;  3BVM A;  2KBN A;  2BDN A;  4KK7 A;  5I9P A;  4JV5 L;  3H0G G;  3CRL C;  4JI6 L;  1TWF B;  3I56 A;  4BY7 G;  1GO3 E;  1EIH A;  4DV6 L;  3HOW H;  3J7Y W;  4YWK A;  1HR0 Q;  3TQY A;  4OIK A;  1C0A A;  2EY1 A;  1KDA A;  1WCM H;  4BY1 G;  1ZYR D;  4WRD A;  4A3F H;  1PH5 A;  1PXU A;  2HIV A;  4B3T L;  3KLW A;  2D0P A;  4NP5 A;  2E2D C;  4HSV A;  1Q8K A;  3AB9 A;  3ICE A;  1XJV A;  1I6V C;  1D1K A;  4LF9 L;  4HN7 A;  1N33 L;  2PW7 A;  2WKC A;  1I94 L;  3CW2 C;  1U4R A;  2B63 B;  1JJ2 A;  4DV4 Q;  2R7Z G;  4CDE C;  3RZD H;  1GD7 A;  1SE4 A;  1DOL A;  5HUR A;  3G4S A;  4A93 G;  3QWN A;  3VR2 A;  4XXE A;  1LAB A;  1F77 A;  3PO2 B;  1XMO L;  1B4O A;  1TS5 A;  4EVO A;  2BE5 D;  2JXM B;  2K01 A;  3A74 A;  5CV5 A;  1TWG H;  2J0T D;  3PO3 H;  4CBV A;  1DJR D;  2VQF L;  5KEE A;  4QMG A;  4O42 A;  2R93 G;  1BKB A;  3K59 A;  1XX8 A;  5ELN A;  1HZC A;  3NTH A;  1DOM A;  2NTT A;  3C1F A;  5BN5 A;  4FYD A;  4X62 L;  5EPJ A;  5EPK A;  3HOW B;  2EOT A;  1BUV T;  1FNV A;  1G6Z A;  1A3T A;  4A3G B;  1WCM B;  2F0G A;  2R6G A;  2K5V A;  5ELF A;  3ERO A;  3HFZ B;  2KOL A;  1HQM C;  1AE3 A;  1SMY D;  3D4R A;  2A69 D;  4A3L H;  4N9T A;  1WJJ A;  3J80 L;  5LHY 1;  2R7D A;  2MGS A;  4H7B A;  1TKW B;  1BCP D;  4UAI A;  3DLL A;  2K7V A;  2K33 A;  1Q8I A;  4TSS A;  3S24 A;  4F87 A;  4A3B G;  1UEB A;  3RZD B;  3CC2 A;  3FVQ A;  4DV5 Q;  2WB1 E;  4AYB G;  5C4H A;  3I55 A;  1LTA D;  2ZJQ A;  4QIW E;  1YJN A;  3TP5 A;  1H9J A;  2X69 A;  3CXC A;  5IYD H;  1KAW A;  1STG A;  4FP5 D;  5FLX E;  4MTN A;  3UE1 A;  2D9U A;  2OXP A;  2EE1 A;  5CBA E;  2YYZ A;  3HOX G;  2HD3 A;  3PO3 B;  3NSW A;  1F9Q A;  1V1P A;  2KUM A;  4POG A;  2I07 B;  3I7F A;  1JC7 A;  2FJ2 A;  4LW1 A;  3M3Y H;  1MJC A;  3A8J E;  1X65 A;  2L11 A;  3A0J A;  2L55 A;  3FEW X;  2V4D A;  3LNN A;  3EIV A;  4CKE A;  4IFD J;  2SOB A;  5KNB A;  2LKV A;  4JPB W;  1PH6 A;  3CF5 A;  3H91 A;  3T1Y L;  1K0S A;  4GKK L;  1WTH A;  1KDC A;  2ZXR A;  5C6A A;  2B8G A;  3EFX D;  3SXH A;  2FHT A;  3BDO A;  2JA5 G;  2AQ3 B;  3PF4 A;  5FLM H;  1ENA A;  4WJ3 M;  1K3R A;  1J5E Q;  1SYE A;  1BF4 A;  2N78 A;  5JEA G;  3S9W A;  1VQF A;  5D14 A;  4J8Q A;  1F9R A;  1Q7Y C;  1LUZ A;  1U9R A;  3ITP A;  3STB D;  5IY0 A;  2DY8 A;  2K05 A;  3F2D A;  4OX9 Q;  1RTN A;  2EJG C;  4RHR A;  3CCM A;  1LTI D;  1SFO B;  2AUJ D;  2L9H A;  4FF4 A;  3H3V I;  3PUW A;  1GUN A;  5KRU A;  1WTP A;  4FDB A;  5EKL A;  3GTL H;  3GQB A;  1WOC A;  4OO1 G;  2NUC A;  2WV6 D;  5M9O A;  4HJ7 A;  1ONL A;  3OPO A;  3IFT A;  3KBG A;  1QJO A;  1CUK A;  4P72 A;  3GTJ H;  3K8A A;  4C3I G;  2VQE Q;  1B50 A;  2EJM A;  2BOS A;  2WAC A;  1X6O A;  4JI5 Q;  2K1B A;  4FXK C;  5FKA C;  1V9P A;  4A3K G;  1VQB A;  4IUV A;  1BXT A;  5I6Y A;  1SNP A;  3M3Y B;  4AYB E;  1AE2 A;  3M4O H;  3NE5 B;  1UAP A;  4C2M H;  2RDG A;  4TRD A;  3TRE A;  1XNQ L;  3CCV A;  4XQJ A;  1QZH A;  1AZP A;  2EY2 A;  1A2U A;  2YV5 A;  2JA6 H;  2JEB I;  3CCQ A;  1B1Z A;  3ER0 A;  1EY8 A;  4C3J H;  4DUZ L;  2UXB Q;  3IRB A;  3GDE A;  1VS0 A;  1PH7 A;  4TQU S;  4RHS A;  2BCO A;  1TS2 A;  3IFD A;  2UUC L;  4I65 A;  2KEE A;  2LMC B;  1I4R A;  2HCI A;  4RFB A;  4U68 A;  4DR1 Q;  4F88 A;  4IUU A;  2Z6K A;  1EZ6 A;  2PQA B;  3HGB A;  2ZM6 L;  4IPC A;  3OMG A;  3GTL B;  2X6G A;  1PRT F;  2OF1 A;  4KKU A;  5IGE A;  3QB3 A;  2RCF A;  2ZXO A;  4XYQ A;  1G2T A;  3U9O A;  1IL2 A;  3FMC A;  1KLU D;  4OEL B;  4DV2 Q;  4A3C G;  1UWV A;  3PUZ A;  4JI2 Q;  1IL8 A;  3GTK H;  2E2J B;  4QCL A;  3KF6 A;  4BBS H;  1OXT A;  3S1M H;  2F3V A;  3KOJ A;  2YTY A;  4AIM A;  3V96 A;  1PYS B;  3WDN A;  4RH6 A;  2HIX A;  2QCP X;  4E6I A;  4BWG B;  4UDU C;  3Q22 A;  2NTS A;  3M4Q A;  3ERQ A;  3E0J A;  3SK5 A;  1YHQ A;  4ZCK A;  3DM3 A;  4X66 Q;  4C2M B;  1XPR A;  2R93 H;  1SRU A;  1N32 L;  2BA0 A;  4LF7 Q;  1Q12 A;  3EBE A;  1EY7 A;  3J81 E;  4X3U A;  5IP7 G;  2JA6 B;  2CFM A;  2N88 A;  5I4D A;  2KVM A;  1VQ6 A;  4C3J B;  4DR5 L;  2XTI A;  1FD7 D;  1LT6 D;  2R61 A;  1JWM D;  1SLJ A;  4GKJ Q;  4ZAI A;  5ELE A;  4GNX C;  3I4N B;  4Y52 H;  4EQO A;  1U4P A;  3HOV G;  1JMC A;  5KND A;  3CMA A;  2B63 G;  1ASZ A;  4IO9 A;  4ZK9 B;  2WB1 B;  1IXR A;  1HUM A;  3RMH A;  2MO0 A;  2WII B;  1LT3 D;  5CC4 A;  1TS3 A;  1EU4 A;  1JJG A;  3RR5 A;  3F8T A;  3R2I A;  2OTL A;  3PO2 G;  1A3V A;  1CA6 A;  4GS3 A;  1B44 D;  3DWP A;  4K5W A;  3GTP H;  5GAE C;  2K4K A;  4A3E H;  2YU9 H;  1PH3 A;  4JI8 Q;  3GTK B;  1HXY D;  2K03 A;  5GAH C;  3S1M B;  1QG7 A;  4X3K A;  3RD4 A;  1OO9 B;  3W3A A;  2MHV A;  3T1H L;  5COR A;  1HH2 P;  3S1Q H;  3CQZ H;  1FR3 A;  1YI2 A;  1VMP A;  1JR0 D;  3RNU A;  5EBD A;  3HOW G;  4FF1 A;  3RLF A;  2CW0 D;  4XQQ A;  4EX5 A;  5IYB H;  1WCM G;  1SYB A;  1LO5 D;  4A3F G;  4R4C A;  4BBR H;  1WYD A;  1JOR A;  3T4A C;  1SYF A;  2A19 A;  2XIW A;  2AUK A;  3NUC A;  4R1J A;  4DXG A;  4A3M H;  4Z9C B;  1RL2 A;  1EFW A;  3JAM c;  1CFM A;  4DK6 C;  1IYJ B;  2NBF A;  4LFA L;  2DN8 A;  1SAP A;  2RDF A;  1XTC D;  2CHB D;  4ME3 A;  3DWQ A;  4IPD A;  1GM5 A;  3J7A V;  1KHI A;  4IJL A;  4NMZ A;  1HQR D;  1HNZ Q;  4DR6 Q;  5JJL A;  1UEA B;  2C35 B;  3M4P A;  4CJ0 B;  3PGZ A;  4RGO S;  3L0O A;  1PTO D;  3TEH B;  1Y8O B;  2Z6K C;  4IN3 A;  1KC8 C;  4H13 C;  3J80 E;  1G2S A;  4JI1 L;  2JK8 A;  5CYU A;  3FHW A;  1CSQ A;  3GTP B;  1UE5 A;  2HHH L;  4JYA Q;  2VW9 A;  4A3E B;  4LMQ D;  1PHJ A;  3PO3 G;  2YU9 B;  2NN6 I;  3UDI A;  2NZ1 D;  3J81 i;  1LYL A;  1Y8P B;  1MI2 A;  1WVL A;  5JOB A;  3LX0 A;  3M7N A;  4V0B A;  4OWW B;  2LS0 1;  3S1Q B;  3CQZ B;  2CVR A;  4ZRZ A;  4OL7 A;  4UP9 A;  5DLQ E;  4G4K A;  3VA5 A;  4JI0 L;  1V43 A;  1AFP A;  1H9R A;  3OSO A;  3U58 A;  3FPU B;  3T51 B;  3H3V C;  2KED A;  2F0T A;  2IW3 A;  2Z8L A;  4G57 A;  3VR6 A;  1HCZ A;  2K52 A;  4HSP A;  2IX0 A;  2ASB A;  4BBR B;  1W3S A;  3K6O A;  5C4X B;  2EXD A;  1SMY C;  3Q23 A;  1TXY A;  2Q8T A;  4QQB X;  1LM0 A;  1XNR Q;  1YHA A;  1WFQ A;  3PSI A;  3OIP A;  1S40 A;  5HGQ A;  4LF5 L;  2HQL A;  1I3Q B;  5F2D A;  1FJG L;  1HA6 A;  4PMB A;  2N3S A;  1PH8 A;  2R7F A;  5IOD A;  1Y69 U;  4OWT B;  5COY A;  2IWH A;  4A3L G;  1L2F A;  1FL0 A;  1SNO A;  2E2I B;  1VQ9 A;  2PZW A;  2E5L L;  1B70 B;  2ZJR A;  1K0R A;  3TZD A;  3DEP A;  2A6H D;  5C3E H;  3K5N A;  2B39 A;  2PZT A;  1D5M C;  1Y14 B;  5EPL A;  5IYD G;  3VYR A;  2SDF A;  4B3R L;  1WTW A;  3W1G A;  1BCP F;  1STY A;  3D6C A;  2EQS A;  3ULP A;  2EDG A;  2IX3 A;  4HCE A;  5KYI A;  1VQO A;  1Q82 C;  4JV5 Q;  4JI6 Q;  4K2K A;  2PNH A;  2XNA C;  1QOH A;  2O5I C;  3W1B A;  1T5X D;  4DV6 Q;  3K5L A;  4B08 A;  1NY4 A;  3SK8 A;  1CHP D;  1OTC A; 
#chains in the Genus database with same CATH homology
 1TU2 B;  2Z4H A;  3U9S A;  3E6Z X;  4K6L A;  3IKJ A;  5DNF A;  4EGV A;  1O78 A;  4R8I A;  3MEH A;  5C0X I;  1JOQ A;  2F0J A;  3SHL A;  1WTO A;  3ZYY X;  1MBY A;  1B9M A;  1BOS A;  5A35 A;  4OGQ C;  4PMW A;  1VCI A;  1GUW A;  4ZQ3 A;  1STB A;  5C3E B;  3EQL C;  4CHT B;  4G7Z C;  5JVG 3;  1JWU D;  4A3D B;  2PQE A;  1AP0 A;  4DAY A;  4KD4 A;  4KJO A;  4ME5 A;  1BNZ A;  3GV3 A;  3T56 B;  1MSG A;  5CGK A;  1HRJ A;  5I9O A;  3EJI A;  1E2Z A;  1ET9 A;  4NDX A;  2EYP A;  2F0K A;  5JJZ A;  3GTO B;  3PMF A;  4RGN A;  3QOJ A;  1G29 1;  1X32 A;  2KCC A;  4MIU A;  3AMU A;  4C3J G;  5BN4 A;  2PMZ B;  3MC0 B;  4LK1 C;  1PZI D;  1KLG D;  2R3Z A;  2F0M A;  2Z1C A;  4C3H B;  4Q0F A;  1G91 A;  1L0X B;  2F0N A;  1SJH D;  2L12 A;  1TY2 A;  5A2Q L;  1AW7 A;  1NR4 A;  2ENB A;  3ONA B;  5C0X J;  1CQV A;  1O7Y A;  5KIX A;  3EA6 A;  2D5D A;  1HHV A;  1KAB A;  2D62 A;  4KTA A;  2RBM A;  4DF7 A;  5DEH A;  2PZU A;  5D3I B;  2EYH A;  5FO7 B;  2JA8 B;  4IFD I;  3A7L A;  2F0D A;  1PRT B;  5IGB A;  3WOF A;  2VB2 X;  1XWE A;  1V1O A;  3C3L A;  2E2H B;  2A68 C;  1D6E C;  1TS4 A;  1ESR A;  3MXN A;  3VR3 A;  3MA2 B;  2G9H D;  1UNS A;  4N9P A;  1SYD A;  2EVB A;  5LL6 S;  2XRQ D;  3I4L A;  5I2Y A;  2NVQ B;  3TP7 A;  1QE6 A;  4L6T B;  1EOT A;  4DGZ A;  3S2D B;  2IT1 A;  4H44 C;  5K36 H;  1EL0 A;  5J22 A;  1CQF A;  1FYC A;  1V1P B;  2EYJ A;  4PQX A;  1GUT A;  1Z7T A;  3H6M A;  1HFN A;  3PIO 3;  1CTM A;  2O4X A;  4RGM A;  2F0E A;  3D6W A;  2AQ2 B;  2EJF C;  3PUX A;  4ZKC B;  2F0W A;  3GO5 A;  2FMC A;  4RKB A;  1OXS C;  1Q1B A;  3R93 A;  1LTT D;  4RCO A;  2F0V A;  1Z6H A;  5TSS A;  2ID0 A;  2GA4 B;  2B2W A;  1STH A;  3NP8 A;  3V05 A;  1S5E D;  5CMD A;  2X6L A;  2QF7 A;  5M5Y B;  3FRP B;  3DHQ A;  4XQN A;  1Y1V B;  1C8C A;  4P2C B;  4NKL A;  5C44 B;  3NWS A;  2A6E C;  4K5V A;  1VF7 A;  4KY5 A;  4C1N I;  3DM1 A;  4IUP A;  1R4Q B;  2JE6 I;  2IPK D;  2VB3 X;  1BQQ T;  2PYK A;  1CZG A;  2B2T A;  3VYT A;  1JWS D;  3D4W A;  1J8I A;  3T16 A;  5CV8 A;  3N6R A;  3PUV A;  2RSO A;  1TR5 A;  4I7Z C;  3KLS A;  4OHJ A;  2JYO A;  5CV4 A;  3S14 B;  1EYA A;  2O2L D;  1S5B D;  4J1M A;  2MJ8 A;  3P1H A;  1PRT C;  1HA5 A;  5DM6 3;  4PMC A;  2VNU D;  1SE3 A;  5E4W C;  2F03 A;  3MXP A;  2DNE A;  4DNT B;  3QJY A;  1Q90 A;  2C5C A;  1ML0 D;  5ELD A;  2F1M A;  2F0U A;  5C3X A;  3GTG B;  4FVM A;  1M4V A;  3JAM L;  5EKK A;  1XXG A;  1EYC A;  1SYG A;  3SR1 A;  5FK9 C;  5FOB B;  1YNN C;  3HS0 C;  4BA1 I;  5C3W A;  1O80 A;  4FF2 A;  1TQO A;  1W6J A;  1BCP B;  2MPM A;  1STA A;  1IW7 D;  5M5W B;  3CKI B;  4XIG S;  2CQA A;  4KKT A;  4NW2 A;  4KV6 A;  1Q3L A;  4RKL A;  4B9X A;  2SNS A;  3K5O A;  1YNJ C;  5T1G A;  3L3O C;  3VA7 A;  1SNC A;  2F0F A;  4C3H G;  2HCC A;  3NTK A;  1WTX A;  1RHP A;  2MUY A;  2JSO A;  1C48 A;  1I4Q A;  1I6H B;  3UI2 A;  2F3W A;  3BDL A;  2XSC A;  4RCN A;  1EU3 A;  2B2W C;  4A3I B;  1SND A;  4IZ8 A;  5D3D A;  5LL6 X;  5CR3 A;  2C9O A;  5JPN C;  5M3F B;  5EBC A;  1LTR D;  2E75 C;  2Z4I A;  4X3S A;  1LT5 D;  1QIL A;  1EWC A;  3I72 A;  1U4L A;  1F2M A;  2M9V A;  1JCK B;  5JPM C;  1SEB D;  2F0I A;  1ILP A;  1STN A;  2F0L A;  3DEO A;  1JOO A;  3K58 A;  2B2T C;  2K28 A;  2EXZ A;  3RZO B;  4QB4 A;  4O1N A;  1ZYR C;  1S5C D;  2F0P A;  1GHJ A;  2EYF A;  2EYL A;  1TWC B;  1D2B A;  4A93 B;  3A8K E;  1WD1 A;  5EQ0 A;  3SDZ A;  3OOC A;  3OMC A;  2OEO A;  1EIG A;  1B3A A;  3BVZ A;  4DK0 A;  5BN3 A;  2IX1 A;  1IKM A;  2NB0 A;  4K5X A;  2H1E A;  3HOY B;  1BDO A;  1F2Y A;  1PFN A;  5M5X B;  1U4M A;  1HUN A;  2VUM B;  4H0L C;  1KDB A;  1JE4 A;  4CJ2 C;  2NYZ D;  2BE5 C;  5E4X A;  1EWH A;  1IHZ A;  1LAC A;  5ISR A;  2IJ0 A;  3P7J A;  3K5M A;  1DM0 B;  3D31 A;  3LWU A;  3F2U A;  4EQP A;  3FKI B;  1Y1W B;  2NN6 H;  2PPB C;  3NQI A;  5C4Z A;  5FLX L;  4OO1 I;  2KA7 A;  1I4H A;  2PO4 A;  4HCS A;  4DNR B;  3GTM B;  3P75 A;  3TP8 A;  4CJ1 B;  3EVQ A;  5DAU A;  5NUC A;  2B2U C;  2PCF B;  1NAP A;  1NCV A;  1GUG A;  2A69 C;  3MTS A;  1BCP C;  2M2L A;  1R4P B;  1A2T A;  2ICI A;  3V2T A;  5K36 G;  2E74 C;  2R92 B;  1RCV D;  2FMM A;  1X3Q A;  2KEC A;  3CRK C;  1I4G A;  1Z47 A;  1A3U A;  5IGC A;  1LTB D;  1AEX A;  4LAA A;  4K6D A;  1PFB A;  2QIL A;  2BA1 A;  3TSS A;  1RF2 D;  1ILQ A;  1QB5 D;  1MD2 D;  2F0Q A;  2E76 C;  3ND9 A;  2K04 A;  5JEA J;  2QKI C;  3HOZ B;  1GUS A;  5M3M B;  2HDL A;  4L63 B;  1TWA B;  4WFN 3;  4ID6 A;  2Q8I B;  4MN3 A;  3S1R B;  3K57 A;  1RKN A;  4ZKB B;  2AQ1 B;  4K14 A;  2SEB D;  4V19 0;  1EY5 A;  2XWJ B;  4X3T A;  2K5D A;  1CT1 D;  4KD3 A;  1VMC A;  4C3I B;  1S5D D;  4R8N A;  5C0X H;  1F2Z A;  1EZ8 A;  1EQV A;  3MXU A;  4L8J A;  2QDB A;  1EYD A;  1STE A;  3BS1 A;  4K2L A;  4Q5V A;  1PZJ D;  3G6J B;  3KUP A;  1D1I A;  1O7L A;  2D2C C;  1KAA A;  3TP6 A;  1TVX A;  1EY6 A;  1WD0 A;  3MFY A;  4HR7 B;  3JAM E;  2ICE C;  1BBX C;  2WAQ B;  5ELB A;  3QO2 A;  2MP1 A;  2NVY B;  1RJT A;  2WKD A;  1UUP A;  1VF5 C;  3FDT A;  1PFM A;  3HOU B;  2NVT B;  3I8Z A;  1S4Z A;  1WTQ A;  4XT3 B;  2DY7 A;  5JVH 3;  5HGT A;  2KJX A;  4ZUJ A;  1I4P A;  3H94 A;  1RD9 D;  1SSO A;  3Q24 A;  2A5H A;  1NR2 A;  1QWY A;  2J7Z A;  3I91 A;  3P20 A;  3J81 L;  3BYY B;  3PV0 A;  4R9W A;  5CV6 A;  3QOL A;  3A8I E;  3SK4 A;  4K8J A;  3GTQ B;  1A6X A;  1DCZ A;  2DNC A;  3W2D A;  5EGT A;  2N55 A;  4KHZ A;  1MGS A;  2M00 A;  4A3J B;  2PW5 A;  3HZX A;  5J1Z A;  4F7X A;  3MZ5 A;  1PZK D;  3OHX C;  1IW7 C;  1E0B A;  1S5F D;  1EY9 A;  1E2V A;  5DM7 3;  5IT9 L;  3HOV B;  2F0H A;  1Y8N B;  2L0C A;  4IFD H;  4ODG A;  2WP8 J;  1MSH A;  2K5W A;  2J4X A;  2JP1 A;  2XWB B;  3AU7 A;  3IAY A;  1KNE A;  1RDP D;  2RKS A;  1BR9 A;  2HUG A;  3OWF A;  1B2T A;  5EJW A;  3S17 B;  1HFG A;  3N52 A;  5G3L D;  2Y0S B;  5C5L A;  3CHB D;  3VR4 A;  3D8G A;  3S1N B;  3D4D A;  3MVV A;  2F0S A;  3NBI A;  3BG3 A;  5ELC A;  3MXG A;  3LWE A;  4CKB A;  4DA2 A;  1EQT A;  1EEF D;  3M85 A;  4A3F B;  1DOK A;  3O13 A;  1B9N A;  4ULL A;  4ZUI A;  1TWH B;  1IYU A;  4KI0 A;  5JAV A;  4BA2 I;  1RTO A;  1CK1 A;  4XT1 B;  4EQN A;  3E5S A;  1CHQ D;  1PDQ A;  3NBH A;  4XYO A;  3M4Y A;  2CW0 C;  1EY0 A;  2EYM A;  1I4X A;  3DWA A;  4HTH A;  1A15 A;  1ZEQ X;  1SNQ A;  1K8O A;  3KLS X;  1TWG B;  3A55 A;  2BDO A;  1WTR A;  4JK1 C;  5FO9 B;  2K32 A;  1PTO C;  1H9M A;  2EY6 A;  3MHB A;  3X3M A;  1XYI A;  5I2X A;  5I6W A;  3IL8 A;  3C2P A;  3TME A;  4RWS C;  1ROD A;  3QIA A;  1M8A A;  2B2Y A;  1W6K A;  1QCB D;  1PTO F;  2XRS D;  1SJE D;  4DN4 M;  4MHE A;  2NN6 G;  5FO8 B;  1T5E A;  3ND8 A;  2LY7 A;  4S3S A;  2IL8 A;  1GXD C;  2K6A A;  1JB3 A;  1TII D;  2TSS A;  4RA8 A;  3HKZ B;  4DU9 A;  4HAE A;  3T13 A;  4F8M A;  1K83 B;  3KF8 A;  2L1B A;  3MWY W;  1JOK A;  3M7G A;  3PUY A;  3A7A B;  3BZD B;  2EYO A;  2JEA I;  4WJW A;  3X3N A;  1D5Z C;  2A6H C;  1OXV A;  3VYU A;  3I73 A;  1OXU A;  4WOR A;  5CV7 A;  3VYS A;  4YIJ A;  2WIN B;  2EPB A;  4FO2 A;  2XVS A;  4KKS A;  4KY7 A;  2KCN A;  1DYQ A;  1NUC A;  1JQY D;  1FNW A;  2FIN B;  3I4M B;  4QUC A;  4IQZ A;  4DK1 A;  4C1N K;  3L9A X;  1IYV A;  1DXM A;  3G7L A;  4G7O C;  4PV1 C;  3KLR A;  5IOC A;  2OT2 A;  4XDX A;  3NXW A;  1OXX K;  1LLR D;  1CM9 A;  2B2V A;  1SNM A;  2AWN A;  2B2U A;  3GTJ B;  3R2T A;  1B53 A;  5KNC A;  3R8B A;  3TDQ A;  1LTS D;  2JA7 B;  3S16 B;  5C0X G;  1KTK A;  3OWE B;  1EEI D;  3TZU A;  3MFG A;  3M4O B;  5J39 A;  5T1I A;  3URY A;  1ZXT A;  1H9K A;  3H0G B;  1DZ1 A;  4BY7 B;  2TMP A;  4FXD A;  4IUR A;  5EKI A;  2A68 D;  1J9O A;  2B2Y C;  5A2Q E;  1LT4 D;  1C4Q A;  2B8F A;  2KHS A;  4G7H C;  4BY1 B;  1R9T B;  2FFK B;  2H4O A;  1F9P A;  3KK7 A;  3GV6 A;  3S2H B;  4KN7 C;  4JBW A;  3HRZ C;  1II3 A;  1H9S B;  4QIW B;  3C1E A;  4PNY A;  3DXJ C;  4QUF A;  4B9W A;  5IT9 E;  1EY4 A;  2L4N A;  2R7Z B;  4QF4 A;  1VDZ A;  1AZQ A;  5CV9 A;  5C5M A;  1Q1E A;  4M1U B;  4LJZ C;  1H9S A;  4BBS B;  2HQE A;  4ZLT F;  2HDM A;  5KGU A;  3DUZ A;  3GP7 A;  3NHH A;  1AN8 A;  2AWO A;  4ABN A;  3SVM A;  4KMU C;  1K8M A;  4M8A A;  4IUT A;  1HTL D;  2R93 B;  4HED A;  3VR5 A;  2RDH A;  2XN9 C;  1NSN S;  3SE0 A;  2G9D A;  3I90 A;  5E1F A;  3SEB A;  1ICW A;  1SDF A;  5JEA H;  3KBX A;  1HTP A;  4IFD G;  1DON A;  3NQT A;  3TN2 A;  2QEJ C;  3I3C A;  4HMI A;  3S15 B;  5IIF A;  1CZW A;  5D65 A;  3A54 A;  3NTI A;  2SNM A;  1QNK A;  1HPC A;  3CU7 A;  3C46 A;  4BS9 A;  1LV9 A;  1ENF A;  4RGT A;  1O7Z A;  4A3B B;  2B2V C;  5K5P A;  4OO1 H;  4AYB B;  4FNF A;  3H09 A;  1KNA A;  3R3O A;  1JIC A;  3GD7 A;  2RA4 A;  1IKL A;  2A6E D;  1QNU A;  1ENC A;  1SBB B;  3OW7 A;  2A74 C;  3HOX B;  1ET6 A;  5KYL A;  2L5T A;  4RAU C;  3WOE A;  3TBI B;  4IAL A;  4ILW A;  5G3L F;  4XTC S;  5IGG A;  4KHV A;  1TY0 A;  4KN4 C;  1F2L A;  4A3M B;  4DAV A;  1DD2 A;  3NWT A;  4KY6 A;  3DMU A;  2EY5 A;  1LTG D;  1F9S A;  3HEJ A;  3MAQ A;  2JA5 B;  3Q0A A;  4HMJ A;  3PIP 3;  2RVL A;  1FNU A;  1ESF A;  4DXF A;  1PLF A;  1SXT A;  4CGY B;  1G8Z D;  1PRT D;  2PNR C;  1SYC A;  1PTO H;  1ZKO A;  5AFW A;  2RQX A;  2NVX B;  1L0Y B;  2ZXP A;  2ZT9 C;  2A73 B;  1PMR A;  3RUZ A;  3HP3 A;  2RSN A;  4GZY C;  5E3F A;  2O5J C;  1I50 B;  3A56 A;  4K8I A;  3SK6 A;  4OIJ A;  3T53 B;  1D5X C;  4TKO B;  1YNN D;  4IUN A;  4ZYS A;  4DFA A;  2LFN A;  4FF3 A;  4FXG C;  2VXW A;  4J6H A;  4A3K B;  1SE2 A;  3NK9 A;  1WTV A;  1GOZ A;  1GJX A;  3D3R A;  4U67 3;  2K5Q A;  2I46 A;  4KJN A;  2NWG A;  1X3P A;  1PYW D;  1CI3 M;  5IGD A;  3BVG A;  2KQ3 A;  2Q8R E;  1CA5 A;  1YNJ D;  1TT2 A;  3QG1 A;  2F4I A;  1EFI D;  3J7A F;  4Y7N B;  4C56 C;  5C4J B;  1BO0 A;  1V8Q A;  3HG9 A;  4CKC A;  3I70 A;  5IGF A;  3Q6S A;  1PTO B;  3OIQ A;  4IUQ A;  1FGB D;  1GHK A;  1GUO A;  3BDC A;  4DAP A;  3FPP A;  3L7Z C;  2EZV A;  5CBE E;  2F0O A;  3K7A B;  1E2W A;  3NPP A;  3BYT B;  3K0Y A;  3BVM A;  2BDN A;  4KK7 A;  5I9P A;  3CRL C;  1TWF B;  1EIH A;  3J7Y W;  4OIK A;  2EY1 A;  1KDA A;  1ZYR D;  4WRD A;  1PXU A;  4NP5 A;  2E2D C;  4HSV A;  3AB9 A;  1I6V C;  1D1K A;  4HN7 A;  2PW7 A;  2WKC A;  1U4R A;  2B63 B;  1SE4 A;  1DOL A;  5HUR A;  3QWN A;  3VR2 A;  4XXE A;  1LAB A;  1F77 A;  3PO2 B;  1B4O A;  1TS5 A;  4EVO A;  2BE5 D;  2JXM B;  2K01 A;  5CV5 A;  2J0T D;  4CBV A;  1DJR D;  5KEE A;  4QMG A;  4O42 A;  3K59 A;  1XX8 A;  3NTH A;  1DOM A;  2NTT A;  3C1F A;  5BN5 A;  4FYD A;  5EPJ A;  5EPK A;  3HOW B;  2EOT A;  1BUV T;  1FNV A;  1G6Z A;  1A3T A;  4A3G B;  1WCM B;  2F0G A;  2R6G A;  5ELF A;  3ERO A;  2KOL A;  1HQM C;  1SMY D;  3D4R A;  2A69 D;  4N9T A;  3J80 L;  5LHY 1;  2MGS A;  4H7B A;  1TKW B;  1BCP D;  4UAI A;  2K7V A;  2K33 A;  1Q8I A;  4TSS A;  4F87 A;  3RZD B;  3FVQ A;  5C4H A;  1LTA D;  3TP5 A;  1H9J A;  2X69 A;  1STG A;  4FP5 D;  5FLX E;  2D9U A;  2OXP A;  2EE1 A;  5CBA E;  2YYZ A;  3PO3 B;  3NSW A;  1F9Q A;  1V1P A;  2KUM A;  2I07 B;  1JC7 A;  2FJ2 A;  3A8J E;  2L11 A;  2L55 A;  3FEW X;  2V4D A;  3LNN A;  4CKE A;  4IFD J;  2SOB A;  5KNB A;  2LKV A;  3H91 A;  1KDC A;  2ZXR A;  5C6A A;  2B8G A;  3EFX D;  3SXH A;  2FHT A;  3BDO A;  2AQ3 B;  1ENA A;  1SYE A;  1BF4 A;  5JEA G;  3S9W A;  5D14 A;  4J8Q A;  1F9R A;  1U9R A;  3ITP A;  2DY8 A;  2K05 A;  1RTN A;  2EJG C;  4RHR A;  1LTI D;  1SFO B;  2AUJ D;  2L9H A;  4FF4 A;  3PUW A;  1GUN A;  5KRU A;  1WTP A;  5EKL A;  3GQB A;  4OO1 G;  2NUC A;  2WV6 D;  5M9O A;  1ONL A;  3OPO A;  3IFT A;  3KBG A;  1QJO A;  4C3I G;  1B50 A;  2EJM A;  2BOS A;  2WAC A;  2K1B A;  4FXK C;  5FKA C;  4IUV A;  1BXT A;  5I6Y A;  1SNP A;  3M3Y B;  3NE5 B;  1UAP A;  2RDG A;  4TRD A;  4XQJ A;  1AZP A;  2EY2 A;  1A2U A;  2JEB I;  1B1Z A;  1EY8 A;  4TQU S;  4RHS A;  2BCO A;  1TS2 A;  3IFD A;  4I65 A;  2KEE A;  2LMC B;  1I4R A;  2HCI A;  4RFB A;  4U68 A;  4F88 A;  4IUU A;  1EZ6 A;  3HGB A;  3OMG A;  3GTL B;  2X6G A;  1PRT F;  2OF1 A;  4KKU A;  5IGE A;  3QB3 A;  2ZXO A;  4XYQ A;  1G2T A;  3U9O A;  3FMC A;  1KLU D;  3PUZ A;  1IL8 A;  2E2J B;  4QCL A;  1OXT A;  2F3V A;  3V96 A;  3WDN A;  4RH6 A;  2QCP X;  4E6I A;  4BWG B;  4UDU C;  3Q22 A;  2NTS A;  3ERQ A;  3E0J A;  3SK5 A;  4C2M B;  2BA0 A;  1Q12 A;  1EY7 A;  3J81 E;  4X3U A;  2JA6 B;  2N88 A;  5I4D A;  2KVM A;  4C3J B;  1FD7 D;  1LT6 D;  2R61 A;  1JWM D;  4ZAI A;  5ELE A;  3I4N B;  4EQO A;  1U4P A;  5KND A;  4ZK9 B;  2WB1 B;  1HUM A;  3RMH A;  2WII B;  1LT3 D;  5CC4 A;  1TS3 A;  1EU4 A;  3R2I A;  1A3V A;  1CA6 A;  1B44 D;  3DWP A;  4K5W A;  3GTK B;  1HXY D;  2K03 A;  3S1M B;  1QG7 A;  4X3K A;  3RD4 A;  1OO9 B;  3W3A A;  2MHV A;  5COR A;  1FR3 A;  1VMP A;  1JR0 D;  5EBD A;  4FF1 A;  3RLF A;  2CW0 D;  4XQQ A;  1SYB A;  1LO5 D;  1JOR A;  3T4A C;  4DXG A;  1SYF A;  2XIW A;  2AUK A;  3NUC A;  4Z9C B;  1CFM A;  2NBF A;  2DN8 A;  1SAP A;  2RDF A;  1XTC D;  2CHB D;  3DWQ A;  3J7A V;  4NMZ A;  1HQR D;  1UEA B;  4CJ0 B;  4RGO S;  1PTO D;  1Y8O B;  4IN3 A;  4H13 C;  3J80 E;  1G2S A;  5CYU A;  3GTP B;  4A3E B;  4LMQ D;  2YU9 B;  2NN6 I;  2NZ1 D;  1Y8P B;  1MI2 A;  1WVL A;  5JOB A;  3LX0 A;  3M7N A;  4V0B A;  2LS0 1;  3S1Q B;  3CQZ B;  2CVR A;  4ZRZ A;  4OL7 A;  3VA5 A;  4G4K A;  1V43 A;  1AFP A;  1H9R A;  3OSO A;  3FPU B;  3T51 B;  3H3V C;  2KED A;  2F0T A;  3VR6 A;  2IW3 A;  2Z8L A;  4G57 A;  1HCZ A;  4HSP A;  2IX0 A;  4BBR B;  3K6O A;  5C4X B;  1SMY C;  3Q23 A;  2Q8T A;  3OIP A;  1HA6 A;  1I3Q B;  5F2D A;  4PMB A;  5IOD A;  1Y69 U;  5COY A;  2IWH A;  1SNO A;  2E2I B;  2PZW A;  3TZD A;  3DEP A;  2A6H D;  3K5N A;  2B39 A;  2PZT A;  1D5M C;  5EPL A;  3VYR A;  2SDF A;  1WTW A;  1BCP F;  1STY A;  3D6C A;  2EDG A;  2IX3 A;  4HCE A;  5KYI A;  4K2K A;  2XNA C;  1QOH A;  2O5I C;  1T5X D;  3K5L A;  4B08 A;  3SK8 A;  1CHP D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...