4ZKBB

The chemokine binding protein of orf virus complexed with ccl3
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
57
structure length
49
Chain Sequence
TACCFSYTSRQIPDYFETSSQCSKPGVIFLTRQVCADPSEEWVQKYVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity.
pubmed doi rcsb
source organism Orf virus (strain nz2)
molecule tags Viral protein/cytokine
molecule keywords Chemokine binding protein
total genus 1
structure length 49
sequence length 57
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zkbB00
2JP1A 1HA6A 1Q3LA 1SDFA 4ZK9B 5JJZA 1BO0A 1M8AA 1B53A 2B2WC 1NR4A 2HCCA 1U4MA 1X32A 3I90A 2K28A 1EIGA 3P7JA 3SVMA 4HSVA 1X3PA 1HUMA 3R93A 2FINB 2BDNA 1B4OA 2B2VC 1IKMA 1B50A 2KVMA 1MGSA 2JYOA 4IUQA 1GUWA 3IL8A 4OIJA 1C8CA 2M2LA 2B2UC 5CORA 5EPJA 3G7LA 5EPLA 1WTVA 3TZDA 3MWYW 1RHPA 3LWEA 2B2WA 1ICWA 1J8IA 4X3SA 3IFDA 1E0BA 1J9OA 1RTNA 4MN3A 2B2YA 5D65A 2H1EA 1HFNA 1AZPA 1IL8A 1QE6A 1G2TA 3KBXA 1HUNA 4X3UA 1DOLA 4LMQD 2KUMA 2EPBA 2B2TC 2N88A 2L12A 4IUUA 4ZAIA 5CBAE 4QUCA 5CBEE 1WTXA 5EPKA 1PDQA 2RVLA 3I3CA 3MTSA 2KECA 1F9PA 1KNEA 1WTQA 1WD0A 1DOKA 1MI2A 2HCIA 2X6GA 2J7ZA 3H91A 1TVXA 3I8ZA 5E4XA 4DN4M 1NAPA 1NR2A 4XT1B 1WTWA 4HAEA 5T1IA 1IKLA 2R3ZA 1PFNA 1O80A 2NYZD 1PFMA 1VMPA 1F9QA 1SAPA 2NWGA 1U4RA 2XIWA 2B2TA 1MSHA 1RODA 2KEDA 4IUPA 1DZ1A 2D9UA 2RSNA 2K05A 5CMDA 3HP3A 2MGSA 4X3KA 5EQ0A 1DONA 1WTRA 4ZKCB 2HUGA 1WVLA 2EE1A 3Q6SA 2IL8A 4RWSC 1A15A 5EJWA 2B2YC 1CM9A 2DY7A 2KOLA 4X3TA 3D6WA 2K03A 1G2SA 3ONAB 1EOTA 4XT3B 3I91A 2N55A 1KNAA 4OIKA 3F2UA 2B2UA 1QNKA 2HDLA 1G6ZA 2MP1A 5AFWA 2L9HA 1EL0A 4RA8A 1AZQA 3KUPA 5D14A 1ILQA 2KEEA 4MHEA 4CJ2C 1CA5A 2B2VA 1RTOA 4UAIA 3FPUB 1XYIA 2L4NA 1F9SA 2NZ1D 1EIHA 1BNZA 2MPMA 1JE4A 2K04A 4XDXA 3DM1A 2K01A 4RAUC 4HEDA 1PFBA 1SSOA 2X6LA 3FDTA 5T1GA 4R8IA 4QUFA 4R9WA 1BF4A 2EOTA 2K1BA 2DY8A 5DNFA 2SDFA 3DEPA 1U4LA 4IUTA 2RSOA 1S4ZA 2FMMA 4CJ0B 4IUVA 1AP0A 1F9RA 1WD1A 1HRJA 1PLFA 2FJ2A 1CA6A 4U68A 3DEOA 4ZKBB 1MSGA 1WTPA 1BBXC 3TN2A 2VXWA 5COYA 1B3AA 4ZLTF 2L1BA 2X69A 2HDMA 1JICA 2RA4A 4CJ1B 2CVRA 2MJ8A 1B2TA 1XX8A 1G91A 4O42A 1VMCA 1F2LA 2L11A 3GV6A 1X3QA 1U4PA 5E4WC 1ILPA 1NCVA 3QO2A 1ESRA 2Q8TA 3UI2A 2Q8RE 2FHTA 4HCSA 1WTOA 2FFKB 1O7ZA 1RJTA 1LV9A 1QG7A 4NW2A 3GV3A 1DOMA 1EQTA 1HHVA 1ZXTA 1HFGA 1ML0D 5EKIA 4IURA 3N52A 1O7YA
chains in the Genus database with same CATH superfamily
1HA6A 2Q2HA 5JJZA 4HJ9A 1EL0A 4A3MH 2V1CC 1HTPA 2EXZA 3H6MA 3J81j 4NDXA 2Q2IA 3TREA 4ABNA 1GUWA 5KRUA 4A3EH 1AN8A 2B2UC 1FGBD 3K81C 1E1TA 4CKEA 1QILA 3T51B 1RL2A 3CQZB 3K0YA 4K6DA 1X54A 1RTNA 3AFPA 4GS3A 1FYCA 3T4AC 3S1MH 2E8GA 5C4JB 5KIXA 1EZ6A 1V1QA 2LFNA 5CBAE 3NBHB 2RVLA 5G3LF 4LF6L 4A93B 4K5WA 3PF5A 3BVMA 3EFXD 3W2DA 3KOJA 1IBLL 4OX9Q 3L0OA 3I4MB 1IKLA 1O80A 1ZEQX 2KHSA 5DAUA 2R93B 3HOWG 3DMUA 2NWGA 3FKIB 2WIIB 5JJIA 5IYDH 2K7VA 3M3YB 2D5DA 3UE1A 1Y1WG 1LTGD 4A3JB 4K6LA 2IW3A 1VS0A 2GVAA 2SNMA 1L1OC 3EIVA 5IGDA 1VQ4A 3NEMA 3K57A 2RF4A 5LMUQ 5C3EG 3OIQA 1ZYRD 4OIKA 4DV0Q 1LUZA 2PMZB 1AW7A 2L9HA 4CDCC 3K7AB 2IPKD 5C4XH 5EBCA 1W2BA 5IP9G 1VQOA 2JA8H 4BBRB 4AQYQ 1STYA 1ASZA 1D7QA 4R9WA 2A69C 5IE8A 3DEPA 1STGA 2EZVA 2VUMG 1PRTB 2Z1CA 5JEAJ 4CGYB 1STEA 1K83H 4JI3L 3DUZA 1PRTF 1A62A 2N8NA 3CPFA 3DXJC 4JI8L 2IX0A 2CVRA 3JC66 4J8QA 3LNNA 1E2WA 3NWTA 4DR2Q 2XRQD 4HCSA 1SEBD 4OONA 2FFKB 2QEXA 1SN8A 4XXEA 1PZKD 4BXXH 1N32Q 1LO5D 2TMPA 3EVQA 1WFQA 3GTPB 4A3IG 4DR5L 2E76C 4DAYA 3OMGA 4NXMQ 4LUZA 1BO0A 1JOOA 1PZID 2CH4A 4C56C 5I2XA 2TSSA 1JOKA 4X65Q 2IWHA 1YNNC 5CR3A 4NPSA 5I4DA 1I4QA 4EVOA 1N34Q 1H95A 1V1PA 1HXYD 2B2YA 1QVFA 5ISRA 1D5MC 5IYBG 2PI2A 4AYBE 1TWGH 1B7YB 4C1NI 5AJ3L 3HOUH 4X3UA 3GTPH 4ZAIA 1XMOQ 4QB4A 3K58A 3SE0A 5C3EH 3MEHA 2F52A 1BOSA 2YTYA 5CC4A 3GTOB 2N49A 5M9OA 1XPOA 1Q8IA 1VMPA 5IWAL 1CKOA 2FXQA 1MSHA 2XVSA 1PH2A 3CXCA 1WTRA 1UEAB 2IHFA 3O13A 3TS0A 1S5CD 1JR0D 3U50C 4WFN3 2UXCL 4HR7B 5D3DA 3U9SA 1QNKA 3FRPB 4KLKA 3F8TA 1Q8KA 2SOBA 3NELA 2KEEA 3PSIA 3BZCA 4BA2I 2RKSA 1N33L 1F9SA 1IL2A 4XQQA 5J39A 4XYOA 4JBMA 4P74A 3CHBD 4C2MH 4R8IA 4QUFA 4DV2Q 5DNFA 1LTSD 4IUTA 1QOHA 4LFBL 4G7ZC 1TKWB 1STHA 1SE8A 5AJ3Q 2G9DA 2AMCB 3M4YA 2I46A 2UXDQ 1WTPA 3QB3A 4ZLTF 1SYFA 3PIOA 5M3FH 1A63A 2PNHA 4ILWA 3J7YW 1YNXA 2KCTA 3CC7A 1HNXL 1Y1VG 3S17B 1NCVA 1TS2A 4WJ4A 1AE2A 1HNWQ 2SEBD 2ZXPA 2PNRC 2ZJRA 2YU9H 1DOMA 1WOCA 3K5NA 2L0CA 1ZXTA 4YCVA 1E2ZA 1W6JA 1NR4A 2GN5A 1K0RA 3BYTB 3PQIA 4KHPL 1HUMA 1GHJA 4TVAB 1A6XA 4LF9L 1YEZA 2QF7A 4C3IB 2JA5G 4K0KQ 1ESFA 3CCQA 3VYUA 2F3IA 1J8IA 4JBKA 1E0BA 4JBWA 3CAMA 3M4OB 1L1OA 3M3YH 3GP7A 1QE6A 1HUNA 5GAEC 1KAWA 1SROA 4DV2L 1K73C 2AHOB 2OT2A 3F2DA 3U9OA 3OTOQ 3MTSA 1WD0A 5ELDA 2VQFL 1XXGA 1SXTA 1UNSA 2JA7B 4K2LA 4FF3A 4BXXG 2G5DA 2VNUD 3AU7A 2A5HA 1SAPA 3QJYA 4C3JH 4DV5L 4HJ8A 2EQSA 3CC2A 1PFSA 3RNUA 5KYLA 2CH4W 2WB1E 3VR3A 5HGQA 2R93G 1NMFA 1BVSA 1CZWA 4IFDG 5C0XH 2XNAC 4QIWE 2QDLA 5DM73 2PMZE 3I91A 4LFCL 3S2DB 5CV4A 3NTHA 1KNAA 3I56A 2MP1A 2ZTEA 1KXLA 2KENA 5C3EB 4GN3B 2E5LQ 4DR7L 5IOCA 5KNBA 4DUZL 1XNRQ 3HOVG 3RZOB 1B70B 5FO8B 5M5WH 1H9MA 5GQOA 2JA8G 3BVZA 4DR6Q 4FP5D 1KHIA 1HZCA 2KHJA 1QZGA 1VQLA 5ELFA 2B3GA 3NWSA 4M1UB 4ZUIA 4CJ0B 1F9RA 3E0EA 4NXNL 3OMCA 2FJ2A 2DJFC 3ICEA 1MSGA 1JWSD 2SNSA 4L5TA 3EBEA 4B3SL 1JICA 3MEFA 2Q2UA 3G4SA 3URYA 1B2TA 1D8LA 4XTCS 3OPOA 2JE6I 2EIFA 3R8BA 1X3EA 4B08A 1TIID 1CHPD 3A56A 4HJ7A 1O7YA 5IGEA 3HOUB 3SEBA 1RIPA 4ZK9B 4JI2L 2RDGA 4QMGA 1S5FD 5EGTA 1KLUD 3TDQA 4YWLA 1LTAD 2RHQB 3B6YA 3MXPA 1BUVT 2A6EC 2Z6BA 2MNAA 1WI5A 4BY7B 2A6HC 4JI5L 4GN5A 1R9TH 1BKBA 4DA2A 2R7ZG 3J7A5 2WKDA 4KD3A 5M3MH 4HJ5A 2AQ3B 1FNVA 4V0BA 5C0XG 1WTQA 5IGCA 1M4VA 5I2YA 1JWMD 4POFA 1PTOB 2DN8A 2DUDA 2R3ZA 2ZXOA 1A8VA 3AQQA 4A3KH 1KDBA 5IIFA 3P75A 1U4RA 3VA7A 4IUPA 1BCPF 2EYFA 3J80L 2D9UA 2NZOA 1Y8NB 2K5NA 1YVCA 4JV5Q 4OO1I 1CFMA 2K5HA 1MJCA 3CPWA 1PMRA 1WYDA 1QWYA 1SNDA 5EJWA 2BE5C 4QL5A 5IP7H 1E2VA 3K5LA 3HKSA 5A2QE 4LF8L 5KGUA 4B3TL 1FJGL 5JJKA 4UHVA 5AFWA 1DXMA 5ELCA 2E74C 1CA5A 3KFUA 1BCPD 3GD7A 3MXNB 3OYYA 3GTQB 2RQXA 3JAME 5T1GA 1WCMH 3AYHB 4JYAL 5JVG3 1N34L 4E6IA 3K80C 1H9SB 1YNND 2MUYA 1A3UA 1HRJA 4JI7L 2F0GA 3L3OC 4LF4L 3DEOA 3CW2C 4ZKBB 3S2DH 3TEHB 4OXPA 1EYDA 1I5FA 5D3IB 2R93H 1JJCB 1JQYD 4H7BA 3Q22A 2ZTCA 3R3OA 2NN6H 2Q8TA 2K5DA 3HOWH 3NQIA 5K5PA 3WDNA 1LACA 4A3IH 3AEVA 2K5VA 1JB7A 3UDXA 3C3LA 4C3HB 4BBSB 3Q8DA 2ZXRA 4MTKA 1VQDA 1T9HA 4DV0L 1Y69U 5G3LD 4L5RC 4A3BG 2HHHL 2PZTA 2BDNA 3ULJA 3PO3G 1SNMA 3UE0A 2BDOA 4OIJA 2NVTB 1LT4D 3BYYB 3MWYW 4QGUA 4ME3A 3NQTA 1EUJA 1X3GA 3IFDA 5BN3A 4JVZA 4HIDA 4DK1A 1EQRA 1SJHD 2K50A 3DWAA 3RZDH 3RLOA 3KBXA 4X6AH 4DXFA 4DR1Q 2B8FA 3BZDB 3H0GB 4JOIA 3I73A 4JW0A 1TY0A 1GUSA 4HIKA 4LFBQ 1EZ8A 3IRBA 5EPKA 2K75A 1IW7D 2IX1A 2J4XA 4EGVA 4A3MB 2VUMB 2HCIA 1L1OB 1TXYA 2QILA 4Q5VA 5C3XA 4XT1B 2WKCA 4A93H 3RMHA 1AFPA 4BY7H 2LY7A 3T16A 2NVTH 3DWQA 4GOPB 3SK6A 2WAQB 1B9NA 2PW7A 2MGSA 4A3KG 3KJOA 1EY6A 3Q6SA 3VR5A 1PYWD 1HZAA 1SYDA 1YHAA 2MFIA 2F0SA 2B2YC 3K5OA 5GAHC 3Q23A 3J80E 1VF5C 4X65L 1D2BA 4GOPC 4HIOA 1M1KC 3GQBA 2C35B 1X55A 3S17H 2HIVA 3TBIB 5CYUA 1STAA 4LUVA 1Q12A 5IYCH 2X6LA 3HOVB 2LMCB 4J15A 4N9TA 3KLWA 3PIPA 1XMOL 5LL6X 1JE5A 5M3FG 1TS3A 1AP0A 1UE1A 2VL6A 3FP9A 2D2CC 1ONLA 4RGTA 3GTKH 4N8X1 4FXDA 1K83B 2ZM6Q 2EY5A 4A93G 1J5EQ 1LTBD 3GTMH 3RD4A 2MJ8A 4ZCKA 3J80c 2UUCQ 5C4XB 3RR5A 3UI2A 1ASYA 1AE3A 1BCPB 1PXUA 4F88A 4BBRH 1JC7A 2PPBC 4GN4B 2CQAA 1BDOA 2VB3X 3A54A 4UY8C 3N52A 4OWWB 1PTOF 3ER0A 1Q1BA 1VQGA 2KA7A 1XWEA 3EROA 2JA5H 1K3RA 3GTGH 4A3EB 1IKMA 3HOUG 3GTKB 3TP5A 3S15H 5CORA 4ZUJA 5GADC 1K0SA 4MTNA 1C7YA 2LXJA 3TZDA 4KY7A 2R6GA 2H4OA 1CKMA 4CBVA 3M4PA 5BR8L 1QNUA 1WTHA 1F77A 4UPAA 2NVYB 4IFDI 4I7AA 4R4TA 2WV6D 2JJQA 3PIO3 4DV7L 2KECA 1F9PA 2F4VQ 2R7ZB 1MI2A 2X6GA 1V9PA 3H91A 4N8FA 2UXBQ 4PV1C 4HAEA 3ULLA 1O7LA 1I3QH 2XIWA 5M5WB 4OWXB 2D0PA 1CQFA 1DZ1A 2RSNA 5EAYA 4A3FH 3HP3A 4ZKCB 1WCMB 5H1SE 2AUJD 2LXKA 4RWSC 4A3LH 1IYJB 2HD3A 1KRSA 3FKIG 2HHHQ 2Z4IA 1LM0A 2F0QA 2EY2A 3H15A 2NUCA 5IGGA 4DR5Q 1JJ2A 2B2UA 2Q8IB 3S16B 4NXML 1V43A 2I5LX 4JCVE 4LJZC 1UAPA 5D14A 1T5XD 1L0YB 2GA4B 5FLMG 3FMCA 4A3DG 4IPDA 2BH8A 1HNZL 4AYBG 1SBBB 2OTJA 1KRTA 3HOYB 2SDFA 1Z9FA 4DNTB 5C3WA 1OXUA 1F2YA 2B63G 4IUVA 4BBRG 4MZ9A 1S40A 1PLFA 2Z6KA 1KIXA 4IOAA 2R92H 1VQCA 3CD6A 3BS1A 1QVGA 3HOZB 1S5DD 2F4VL 4R4OA 1VMCA 1F2LA 1X3QA 1LTLA 4JBJA 1ESRA 1L0XB 2PCFB 1HA5A 4GNXB 1KAAA 4RCOA 1WTOA 1TY2A 3ITPA 4LUOA 3PUZA 1RJTA 1XTDA 3CF5A 2BCOA 3G71A 1M90C 1TWFH 5DLQE 2Q2TA 3A7AB 4OL7A 4IURA 5M3MB 4LFCQ 1HR0Q 2KQ3A 2CQOA 3D4RA 3J80i 1KDCA 4DUZQ 3ZJYC 3SR1A 5C0XI 1EFID 2CW0D 1P8LA 3P20A 3J7AF 3RZOH 4A3GG 2JYOA 4IUQA 1SFOB 4LF8Q 3GTLB 1S3OA 2L5TA 5CGKA 3D4DA 3T53B 1XPUA 3OW2A 2WP8J 3S1RB 2A8VA 4DAPA 3D3RA 2E2HB 4O1NA 1HNZQ 1KABA 2CKZB 5CV8A 2OXPA 1G291 1RKNA 4IFDJ 2EPBA 2L12A 2LS01 1VQJA 4JI8Q 4P73A 5C44G 1C9OA 4JI7Q 1VQEA 3I70A 4KJOA 3SXHA 3RN5A 2OQKA 3SK4A 2UU9Q 5IY0A 4B9XA 4FNFA 4DKAC 4B3ML 1K8MA 3ERQA 4A3DH 2VQEL 4JOIC 2F0MA 3L7ZC 3N6RA 2UUAL 4JI2Q 3D6WA 4JPBW 1G2SA 5C6AA 4ME5A 3ONAB 1E7ZA 4XT3B 2NVXB 1U9RA 1MKHA 2BA0A 2HDLA 3FHWA 1CHQD 4JI4Q 4QF4A 3KUPA 4PMWA 4CKBA 4JC0A 3KJPA 4CJ2C 3CQZH 2F0KA 1LT6D 5C5LA 1VCIA 4DV3L 5IP9H 4UAIA 2F0OA 2XN9C 1H9KA 2NZ1D 3NUCA 3VR4A 2DJGC 3DWPA 3BDLA 1EU4A 4HEDA 4RAUC 5FLMH 3S2HH 4KMUC 4EQNA 2VZAA 2ALYB 4QQBX 3OWEB 2VW9A 3E0JA 1C4QA 3QOJA 5COYA 4DU9A 1SMYC 2X69A 3OTOL 3GTGB 4RCNA 3E9HA 5A2QL 1SNQA 4O42A 2WB1G 4PQXA 2NTSA 3V2TA 3MXUA 3I4MG 1YZ6A 5IGFA 4IOCA 1G6PA 4K8IA 1KLGD 3H3VC 1BBWA 3GDEA 1NSNS 4KY5A 1B53A 3P7JA 1X3PA 2EYOA 2JN4A 1B9MA 1MGSA 4P75A 3HOXB 2V4DA 3T13A 2KBNA 3M7GA 5EPJA 2R7DA 3NTKA 1EEID 3G7LA 4YIJA 3LWEA 3CMEA 2DNEA 1A0IA 4C3IG 4BA1I 2CFMA 3T1HQ 1HFNA 2RDHA 4GKKQ 1EYGA 5ELBA 3RUZA 5E1FA 1Y8OB 1A3VA 1KC8C 1UE6A 3WOFA 1I94Q 1D1IA 3QG1A 1WTXA 1F2MA 5IT9E 3I3CA 4HSPA 2Z9HA 4RKLA 1DD2A 3A7LA 1DOKA 1HNXQ 3I4NG 4JG2A 3I4OA 5I6WA 4A3CH 4FDBA 2A6ED 4B3SQ 1J5EL 3D4WA 4UP9A 2PQAA 3BU2A 1FD7D 3LWUA 3KLSA 1VQPA 3HOVH 5NUCA 2KCCA 3W5OA 4DV4Q 4FXGC 3FKIH 2N3SA 1QJOA 1R9TB 3VR2A 5EKKA 2OWOA 3NE5B 1U0LA 4L8JA 2C5CA 4J1MA 4X3TA 3PUWA 1Q46A 4DAVA 1SLJA 1S5BD 2EYHA 5JJLA 1V1PB 5JVH3 4PG3A 1AEXA 1SE2A 3A5ZB 2VB2X 2A74C 4MHEA 4KHVA 2HQEA 4IQZA 3PO3B 3ND9A 1EIHA 1OXSC 3KF8A 5HY6A 3QWNA 1SJED 4DV6Q 1PFBA 2Z4HA 3CCEA 1HH2P 3QIAA 4CDDC 3EA6A 1IBML 3KDFB 4FXKC 4UP8A 1PH3A 4KKUA 2HT1A 5ELNA 1XTCD 4C3JG 3H3VH 1BBXC 4G4KA 2JQOA 1X56A 1XMQL 2LSSA 1EY5A 3MVVA 4CDFC 3HS0C 1GD7A 4DNRB 5K36H 3CCUA 1TT2A 1QUQB 2EJFC 4X62L 2UUBL 4M8AA 4FF2A 1Y1WB 1HFGA 3E9IA 2NBFA 2OTLA 2F0IA 1HQRD 1EY7A 1JJGA 1SR3A 2ZJPA 1YNJD 1CUKA 1M8AA 4QIWB 2E5LL 4DR7Q 1X32A 4L6TB 3L2PA 5M3MG 3HEJA 2FINB 1B50A 3KF8B 2UXCQ 2QA4A 4YWKA 4B3TQ 1FJGQ 1I3QB 3CU7A 4H0LC 1TWAB 4HMJA 1TWHB 3A5UA 3NSWA 1DJRD 1I4RA 5TSSA 4MN3A 2H1EA 2R7FA 3JAMc 4QY7A 1PTOD 2JK8A 4JI3Q 5CV6A 1PV4A 3L9AX 5KNDA 1DOLA 4JI1Q 2JA6H 2JSOA 1KD1C 5FLXE 1EIYB 2Z6KC 2RDFA 5E4XA 3SDZA 4LF4Q 1DGSA 1S72A 1B44D 1NR2A 2UXDL 4LW1A 3STBD 1CZGA 4A3FG 2FMCA 3TZUA 3TQYA 1DM0B 1SYCA 3TRZA 2K05A 3OW7A 2BA1A 3Q0AA 2MO0A 1PYSB 3F2UA 5KYIA 2VUMH 1PRTC 1X6OA 4S3SA 3K8AA 4KHPQ 2F0FA 1EQVA 2RBMA 2BE5D 1EYCA 2KHIA 4CDEC 4L5SA 1HZBA 3S1NB 4GKKL 3MHBA 2R61A 4EQPA 4ID6A 2CWAA 2AUKA 1YHQA 4A3LG 5M5YB 2FMMA 2R92G 2OQ0A 3S1MB 4JI6Q 1WD1A 3HG9A 2I5MX 4GLXA 3AMUA 2JA7H 1CKNA 5FLXL 2CWPA 2P5ZX 3KLSX 2I5HA 1JCKB 2LKVA 1I6VC 1Y1VB 2EY6A 5EKLA 3VA5A 3CCJA 1VQ7A 3C2PA 3PO3H 2E2IH 3I4MH 2JA9A 2FHTA 1TU2B 4RKBA 5C4ZA 4KV6A 4B3MQ 2I07B 5EKIA 2XSCA 5ELEA 4HIMA 2JP1A 3M7NA 3CCSA 3S16H 1PYBA 1Z47A 5LMUL 3X3NA 5C4HA 1OXTA 1ZKOA 3AFQA 3PUYA 4OEMB 4DV6L 4A4IA 4C3IH 1ICWA 4JYAQ 1YHBA 4B9WA 3TS2A 3HOXG 3A8JE 4DV3Q 2XWBB 3RZDB 1JT8A 5D65A 2I0QA 4IPGA 4J6HA 2JA8B 1JORA 3M4OH 3NBHA 3PIP3 1X65A 4K14A 1NE3A 4KN7C 5C44H 4B3RQ 1TWGB 1LABA 1N36L 3W1BA 2HIXA 2NTTA 4AIMA 1KNEA 2G9HD 4DF7A 1CSPA 4H02A 1NAPA 1HQMC 5T1IA 5M5XH 1QVCA 1E1OA 5IT9c 2ZM6L 3K59A 2OF1A 1LT5D 3GO5A 2DGYA 5LMNW 4DV1Q 3PF4A 1NBWA 1GUGA 1HPCA 5EQ0A 1DONA 2HUGA 1LYLA 2IL8A 2A73B 4A3IB 2WAQG 4BWGB 1H9SA 2K03A 4DR4L 1UUPA 2D62A 4LF9Q 4IPHA 3PO2H 1IBKQ 1YITA 3PUVA 1GUOA 4GOPA 2L4NA 3KF6A 2K04A 4XDXA 1MIUA 3FDTA 4DR1L 4K8JA 5FK9C 4LF5Q 4C2MB 2O2LD 3T1HL 1UE7A 2EY1A 4YY3L 2ZJQA 4X64Q 3PMFA 2A69D 4Y7NB 5IT9L 2VXWA 1A2TA 1B3AA 4B3RL 4X66Q 5C0XJ 3F2CA 2WACA 1LTRD 2M9VA 4R8NA 1R4PB 2RA4A 3PO2B 3VYTA 4DV5Q 3KF6B 2K5QA 2CCZA 2VQEQ 4DAMA 2NN6I 1Q90A 3RLNA 3S9WA 4KKTA 4DV1L 2A68D 3G48A 4F7XA 1EQTA 5I9OA 1VQAA 3Q24A 3NP8A 1EY4A 1Q3LA 4DR3Q 1PH6A 1JB3A 1RF2D 3M4QA 1B4OA 2KVMA 1X9NA 3BG3A 2WFWA 3MXGA 1EY8A 1EWIA 3DLLA 4DR6L 2ASBA 2E2JH 1EY0A 4HMIA 3D0FA 3KYHC 1RHPA 1KTKA 5IYDG 1MJEA 1C0AA 4KN4C 4DFAA 4IO9A 1I6HH 1IHZA 1A2UA 1VQ6A 3BDOA 4U673 1QCBD 2HQLA 2ATWA 3HZXA 5LL6S 3E6ZX 5KEEA 4LF7Q 4IFDH 3U4VA 1H9JA 4DN4M 2BH2A 1IZ6A 1PFNA 5FLXc 5LMNQ 1PFMA 1K9MC 4ZRZA 2YV5A 2NB0A 1VQNA 1I4XA 1N32L 2K33A 4IPCA 1E22A 3E3XA 3OHXC 4EQOA 1A15A 1CM9A 2KOLA 4LNQA 5DEHA 2YTXA 2NVQB 2EVBA 3T1YL 1K8AC 2KCNA 3PCOB 4K2KA 3TSSA 4GNXA 1GUNA 3E5SA 4DAYB 4A3BB 4O0AA 5IYCG 1XYIA 3S15B 1S5ED 3LGJA 1B3QA 3I4LA 3PUXA 3FPPA 3DM1A 1NUCA 2EYPA 1SSOA 4GLVB 1NMGA 2JEAI 3VYRA 4KTAA 2EOTA 4A3DB 2DY8A 3KK7A 2AQ2B 4DK3C 1Y1WH 3MFYA 3HKZE 3R2IA 5M3FB 4QCLA 4NB3A 4U68A 1LT3D 2NVYH 2WINB 1K8GA 2NVQH 2YYZA 1SRUA 2AKWB 1UEBA 1FR3A 4GZYC 2XGTA 4LF6Q 2RCFA 5IWAQ 2VQFQ 1G91A 4PZ8A 3OSOA 3NBIA 5E4WC 3VYSA 1IBLQ 1BQQT 4DUYQ 3SGIA 1D5XC 1G8ZD 1D6EC 3JAML 4DR4Q 5I9PA 2PZUA 2JA6B 1SNPA 3G6EA 5CV7A 5ELOA 2K52A 3I90A 4C3HH 4DK6C 4BBSH 1RD9D 4ODGA 4XIGS 5I6YA 4L5QA 2IHEA 1TS4A 3OOCA 1N33Q 2K4KA 3IL8A 1FVIA 4KK7A 1EY9A 3KDFA 3HOXH 3A55A 2B2WA 1EYAA 5FOBB 1XNRL 4LF5L 1PZJD 1IL8A 2F0PA 3IKJA 1KQSA 1E24A 3H0GG 1SE4A 4DPGA 1P16A 3ERSX 2KUMA 5C4JH 3S14H 1D5ZC 4YHHL 1PDQA 3MC0B 3X3MA 4C3JB 4KY6A 3H3VI 3OWFA 2MO1A 5J22A 1GKHA 2E2JB 3H94A 4KKSA 4A3KB 4Y52H 2CW0C 2UUCL 1OTCA 4X3KA 3G6JB 4DUYL 1WVLA 2EE1A 1STBA 1ENFA 2IX3A 4IJHA 4RFBA 4C3HG 3CKIB 2F0JA 4BBSG 1EOTA 1W3SA 3S14B 4LK1C 4RHSA 2RHSB 4BY1G 4DXGA 2F1MA 1GJXA 1Y1VH 3BZKA 1D1KA 3NHHA 2QCPX 1XJVA 1GHKA 2B2VA 3F1ZA 1RTOA 1DYQA 2MPMA 5E7NA 2F0TA 4APVA 4JK1C 1PA6A 4OHJA 5GAGC 2BOSA 1Z7TA 3R2TA 3H0GH 5BN5A 1BR9A 1SE3A 1SYGA 3EN2A 1NY4A 1EIFA 4GKJL 4OX9L 2EYMA 3WOEA 1F2ZA 3GTOH 2L1BA 1VF7A 1VQ9A 3I72A 1YNJC 3IAYA 3QOLA 5J3BA 3HOWB 4A3BH 1PH7A 2UXBL 1SYBA 1JMCA 5JOBA 2UUAQ 3CCMA 1ET6A 2DNCA 1IYUA 2WB1B 1BXTA 1HCZA 4EQ5A 5FJ8G 1ML0D 1HR0W 4DV4L 1MHWC 4HJAA 4PZ7A 3CCLA 3KBGA 4FO2A 2B8GA 3D31A 1U4MA 4YCWA 4JI4L 4A75A 2F0VA 5JEAH 4A76A 4DNIA 3MXNA 3C46A 4LFAQ 1I4PA 1Y8PB 4XYQA 1DCZA 1VQMA 2VY3A 4RGMA 4AQYL 1L0WA 3RLFA 1LTTD 1LLRD 1W6KA 2H5XA 2K32A 1R4QB 3D6CA 1J9OA 1OXVA 3DM3A 1IYVA 2PYKA 4ZYSA 1CKNB 4WORA 1JWUD 2M00A 3D8GA 1G2TA 3FEWX 1QZHA 2A1AA 1CT1D 2XWJB 3HGBA 3K7UC 1PH4A 2EJMA 2B63B 2A68C 1HJPA 4O2DA 1TVXA 2F0NA 2O4XA 1VQKA 1I4GA 4X66L 2NYZD 1ET9A 2F0EA 3AB9A 2ZT9C 1RODA 1L2FA 4A3JH 1EEFD 1SMYD 3VDYA 4I7ZC 1PH8A 1EOVA 1STNA 4PNYA 3MAQA 4IALA 5FO7B 3STBC 4X62Q 2UUBQ 2EDGA 4KJNA 4R1JA 4L63B 4Y7NH 1CSQA 4HCEA 4A3EG 3NENA 4RA8A 4NMZA 1ILQA 1KL9A 3ND8A 5FKAC 5A35A 3DHQA 4UP7A 1EWCA 3A8KE 1WJJA 5BR8Q 3C1FA 3FPUB 1I4HA 3TP7A 3CCRA 1BNZA 1JE4A 1UE5A 1II3A 3J7AV 1BF4A 1GM5A 4CKCA 1BBUA 1YBYA 1T5EA 1N36Q 4PMBA 1PVOA 4MNOA 4DV7Q 4DGZA 3I55A 1SNOA 3CP0A 4BS9A 5M5YH 4A3MG 3UDIA 3TN2A 3W1GA 2HDMA 1B1ZA 2AWNA 4CJ1B 2F3VA 5CV9A 4ULLA 2O5JC 1XX8A 3V05A 5JEAG 4JV5L 3UDGA 4UDUC 3U58A 4POGA 5J1ZA 4NKLA 2ES2A 1ENAA 4QJFA 1QG7A 1ZYRC 2PO4A 3TP8A 3WWVA 4FF4A 1XPRA 1EFWA 3NK9A 1VDZA 1I50H 3MZ5A 1SDFA 1TS5A 3ZYYX 4HSVA 1XNQQ 2QGQA 2JA6G 2B2VC 4JI0L 3HFZB 1Q86C 3T1YQ 4XQNA 1Q7YC 2Y0SE 1C8CA 1Z6HA 3J7ZC 3SK8A 2QKIC 2F0DA 1SFOH 2YTVA 4IUNA 3K6OA 2Z8LA 4X3SA 3HOYH 1N9WA 4AYBB 2KCMA 4IJLA 2PQEA 5L37A 2ICIA 4LMQD 3JAMi 1PH5A 2ICEC 4IUUA 5CBEE 3A0JA 1CQVA 2F4IA 3HOZH 1EWHA 3J81i 1Q81C 1SMXA 2K14A 3I8ZA 4A3CG 3I4NB 2K5WA 4IN3A 1HNWL 5JAVA 5C5MA 5JPMC 4WRDA 3V96A 2XTIA 2K6AA 1HTLD 5CMDA 5F2DA 4G57A 1ENCA 1E3PA 5DM63 3J81E 1GXDC 1FNWA 5IP7G 4RGNA 1GO3E 2AWOA 1JOQA 1A3TA 1G6ZA 2B63H 2JXMB 2JA5B 2Y0SB 1AZQA 3S1NH 3I4NH 4JI0Q 1CTMA 3HKZB 1C48A 4K5VA 1Y14B 3HRZC 1I6HB 4LAAA 4P2CB 1O78A 2MHVA 4FF1A 1IXRA 3P1HA 3S2HB 1S4ZA 4H44C 4GLAC 4WJ3M 1YJWA 4P72A 4LF7L 1VQHA 2IJ0A 1YJ9A 2VS1A 1K8OA 2F0LA 4FVMA 4PMCA 5LMNL 2A19A 1PH1A 1H9RA 2R7ZH 3K5MA 3LX0A 1Q82C 3CCVA 1RDPD 2Q8RE 1QUQA 4MIUA 4NW2A 4K5XA 5IYBH 3S1QH 4R4IA 1RCVD 2L15A 3BVGA 4G7OC 1NNXA 3C1EA 3J81L 2B2WC 2HCCA 2K28A 3GTJH 1PHJA 4ZQ3A 4DK0A 2M2LA 3GTQH 3BJUA 1WTVA 3IFTA 1SYEA 3CC4A 2NN6G 4TQUS 1QB5D 1U5KA 4OELB 2QDBA 4R4CA 2QW7A 1VQ8A 4NXNQ 3H09A 1UWVA 2E2HH 5KNCA 1I50B 3S1QB 1IBMQ 4I65A 1KDAA 1PTOC 4QUCA 2CHBD 1NJIC 1K28A 4HN7A 1VQ5A 4YY3Q 2ENBA 2J7ZA 2AQ1B 3CMAA 4GKJQ 1WTWA 1CK1A 1OXXK 1VQIA 3U4ZA 4OO1H 1F9QA 4A3JG 3GTMB 2B39A 2B2TA 2KEDA 5IODA 3I7FA 1V1OA 3SK5A 3TP6A 1XNQL 4AH6A 2Z0SA 4LWCA 1OO9B 2OEOA 3OIPA 4RH6A 4OGQC 1K3BC 1NTGA 2IT1A 4H13C 4RMFA 4A3GB 4DR3L 2NVXH 1GOZA 2RCNA 1CI3M 3BDCA 3TMEA 4IZ8A 4EX5A 1MD2D 3M85A 1VQBA 4XQJA 4K0KL 1X3FA 2A6HD 1G51A 1PH9A 1U4LA 2E2DC 1I94L 4F87A 1LTID 2PI2E 3PGZA 2ID0A 2JA7G 2R92B 5C44B 3MFGA 1SNCA 4JI1L 5CV5A 4A3GH 2KJXA 3ULPA 2QEJC 1V8QA 1U4PA 1WCMG 1ILPA 5M5XB 1TWFB 3EJIA 1O7ZA 5E3FA 1YIJA 4GNXC 2PW5A 4KHZA 4HTHA 4YCUA 1IBKL 4RHRA 4CHTB 3SVMA 1EIGA 3J81c 3R93A 1FL0A 3GTLH 4C1NK 3S24A 1PTOH 4KD4A 3NTIA 3CRKC 4BY1B 1EQQA 3F2BA 5EPLA 3HOYG 1O7IA 2E75C 1VQFA 3M9BA 5HGTA 5K36G 1MBYA 4NP5A 2B29A 4OO1G 1TWAH 1Q1EA 4TRDA 1IW7C 2YU9B 1AZPA 4YWMA 5BN4A 5FJ8H 4V190 3PV0A 4X64L 1ICFB 3RN2A 1TWCH 2N88A 2B2TC 2F3WA 3HOZG 2O5IC 3UDFA 2C9OA 4TKOB 3W3AA 2J0TD 2MQHA 1XMQQ 3EQLC 4JI6L 3FVQA 4RGOS 3GTJB 2F0UA 2F0WA 3K7AH 2IY5B 2D0OA 4G7HC 4BY1H 1AH9A 5FO9B 2EYJA 3MA2B 3A74A 2GVBA 5IGBA 4DR2L 1J6QA 1HR0L 1EU3A 2OCEA 2DY7A 3K0XA 3VR6A 1B8AA 4FYDA 1FGUA 2EXDA 1TWCB 5HURA 1PRTD 2N55A 3NXWA 4KI0A 5LHY1 2F03A 4LFAL 4BY7G 5GROA 4ALPA 2L55A 2NZHA 1GVPA 1TWHH 2EJGC 1FNUA 3QR8A 3KLRA 4WJWA 2Y0SG 2K01A 4TSSA 1N8RC 4R4QA 3HKZG 3S1RH 2K1BA 3SHLA 1HZ9A 2PQAB 5JPNC 2RSOA 4JI5Q 3NPPA 4Q0FA 3T56B 2ZTDA 1CA6A 2PZWA 2EYLA 4PZ6A 2UU9L 5C4XG 4F8MA 1GUTA 4YHHQ 1TQOA 3PO2G 4OWTB 1BCPC 2F0HA 2JEBI 2L11A 1TR5A 3GV6A 1YJNA 4N9PA 3A8IE 4A3FB 3QO2A 2XRSD 2WAQE 2E2IB 1YI2A 4P71A 4Z9CB 1LV9A 3CRLC 3GV3A 4RG1A 1HHVA 2N78A 5EBDA 3I2ZA
chains in the Genus database with same CATH topology
1HA6A 5JJZA 1EL0A 1HTPA 2EXZA 3H6MA 4NDXA 4ABNA 1GUWA 5KRUA 1AN8A 2B2UC 1FGBD 4CKEA 1QILA 3T51B 3CQZB 3K0YA 4K6DA 1RTNA 1FYCA 3T4AC 5C4JB 5KIXA 1EZ6A 2LFNA 5CBAE 2RVLA 5G3LF 4A93B 4K5WA 3BVMA 3EFXD 3W2DA 3I4MB 1IKLA 1O80A 1ZEQX 2KHSA 5DAUA 2R93B 3DMUA 2NWGA 3FKIB 2WIIB 2K7VA 3M3YB 2D5DA 1LTGD 4A3JB 4K6LA 2IW3A 2SNMA 5IGDA 3K57A 3OIQA 1ZYRD 4OIKA 2PMZB 1AW7A 2L9HA 3K7AB 2IPKD 5EBCA 4BBRB 1STYA 4R9WA 2A69C 3DEPA 1STGA 2EZVA 1PRTB 2Z1CA 5JEAJ 4CGYB 1STEA 3DUZA 1PRTF 3DXJC 2IX0A 2CVRA 4J8QA 3LNNA 1E2WA 3NWTA 2XRQD 4HCSA 1SEBD 2FFKB 4XXEA 1PZKD 1LO5D 2TMPA 3EVQA 3GTPB 2E76C 4DAYA 3OMGA 1BO0A 1JOOA 1PZID 4C56C 5I2XA 2TSSA 1JOKA 2IWHA 1YNNC 5CR3A 5I4DA 1I4QA 4EVOA 1V1PA 1HXYD 2B2YA 5ISRA 1D5MC 4C1NI 4X3UA 4ZAIA 4QB4A 3K58A 3SE0A 3MEHA 1BOSA 5CC4A 3GTOB 5M9OA 1Q8IA 1VMPA 1MSHA 2XVSA 1WTRA 1UEAB 3O13A 1S5CD 1JR0D 4WFN3 4HR7B 5D3DA 3U9SA 1QNKA 3FRPB 2SOBA 2KEEA 4BA2I 2RKSA 1F9SA 4XQQA 5J39A 4XYOA 3CHBD 4R8IA 4QUFA 5DNFA 1LTSD 4IUTA 1QOHA 4G7ZC 1TKWB 1STHA 2G9DA 3M4YA 2I46A 1WTPA 3QB3A 4ZLTF 1SYFA 4ILWA 3J7YW 3S17B 1NCVA 1TS2A 2SEBD 2ZXPA 2PNRC 1DOMA 3K5NA 2L0CA 1ZXTA 1E2ZA 1W6JA 1NR4A 3BYTB 1HUMA 1GHJA 1A6XA 2QF7A 4C3IB 1ESFA 3VYUA 1J8IA 1E0BA 4JBWA 3M4OB 3GP7A 1QE6A 1HUNA 2OT2A 3U9OA 3MTSA 1WD0A 5ELDA 1XXGA 1SXTA 1UNSA 2JA7B 4K2LA 4FF3A 3AU7A 2A5HA 1SAPA 3QJYA 5KYLA 3VR3A 1CZWA 4IFDG 5C0XH 2XNAC 5DM73 3I91A 3S2DB 5CV4A 3NTHA 1KNAA 2MP1A 5C3EB 5IOCA 5KNBA 3RZOB 5FO8B 1H9MA 3BVZA 4FP5D 5ELFA 3NWSA 4M1UB 4ZUIA 4CJ0B 1F9RA 3OMCA 2FJ2A 1MSGA 1JWSD 2SNSA 1JICA 3URYA 1B2TA 4XTCS 3OPOA 2JE6I 3R8BA 4B08A 1TIID 1CHPD 3A56A 1O7YA 5IGEA 3HOUB 3SEBA 4ZK9B 2RDGA 4QMGA 1S5FD 5EGTA 1KLUD 3TDQA 1LTAD 3MXPA 1BUVT 2A6EC 4BY7B 2A6HC 4DA2A 2WKDA 4KD3A 2AQ3B 1FNVA 4V0BA 5C0XG 1WTQA 5IGCA 1M4VA 5I2YA 1JWMD 1PTOB 2DN8A 2R3ZA 2ZXOA 1KDBA 5IIFA 3P75A 1U4RA 3VA7A 1BCPF 2EYFA 4IUPA 3J80L 2D9UA 1Y8NB 4OO1I 1CFMA 1PMRA 1QWYA 1SNDA 5EJWA 2BE5C 3K5LA 1E2VA 5A2QE 5KGUA 5AFWA 1DXMA 5ELCA 2E74C 1CA5A 1BCPD 3GD7A 3GTQB 2RQXA 3JAME 5T1GA 5JVG3 4E6IA 1H9SB 1YNND 2MUYA 1A3UA 1HRJA 2F0GA 3L3OC 3DEOA 4ZKBB 1EYDA 5D3IB 4H7BA 1JQYD 3Q22A 3R3OA 2NN6H 2Q8TA 2K5DA 3NQIA 5K5PA 3WDNA 1LACA 3C3LA 4C3HB 4BBSB 2ZXRA 1Y69U 5G3LD 2PZTA 2BDNA 1SNMA 2BDOA 4OIJA 2NVTB 1LT4D 3BYYB 3MWYW 3IFDA 3NQTA 5BN3A 4DK1A 1SJHD 3DWAA 3KBXA 4DXFA 2VNUD 2B8FA 3BZDB 3H0GB 3I73A 1TY0A 1GUSA 1EZ8A 5EPKA 2IX1A 1IW7D 2VUMB 2J4XA 4EGVA 4A3MB 2HCIA 2QILA 4Q5VA 5C3XA 4XT1B 2WKCA 3RMHA 1AFPA 2LY7A 3T16A 3DWQA 3SK6A 2WAQB 1B9NA 2PW7A 2MGSA 1EY6A 3Q6SA 3VR5A 1PYWD 1SYDA 2F0SA 2B2YC 3K5OA 3Q23A 3J80E 1VF5C 1D2BA 3GQBA 3TBIB 5CYUA 1STAA 1Q12A 2X6LA 3HOVB 2LMCB 4N9TA 5LL6X 1TS3A 1AP0A 2D2CC 1ONLA 4RGTA 4FXDA 1K83B 2EY5A 1LTBD 3RD4A 2MJ8A 5C4XB 3UI2A 1BCPB 1PXUA 4F88A 1JC7A 2PPBC 2CQAA 1BDOA 2VB3X 3A54A 3N52A 1PTOF 1Q1BA 2KA7A 3EROA 1XWEA 1IKMA 4A3EB 3GTKB 3TP5A 5CORA 4ZUJA 3TZDA 4KY7A 2R6GA 2H4OA 4CBVA 1QNUA 1F77A 2NVYB 4IFDI 2WV6D 2R7ZB 3PIO3 2KECA 1F9PA 1MI2A 2X6GA 3H91A 4PV1C 4HAEA 1O7LA 2XIWA 5M5WB 1DZ1A 1CQFA 2RSNA 3HP3A 4ZKCB 1WCMB 2AUJD 4RWSC 2Z4IA 2F0QA 2EY2A 2NUCA 5IGGA 2B2UA 2Q8IB 3S16B 1V43A 4LJZC 1UAPA 5D14A 1T5XD 1L0YB 2GA4B 3FMCA 1SBBB 3HOYB 2SDFA 4DNTB 5C3WA 1OXUA 1F2YA 4IUVA 1PLFA 3BS1A 3HOZB 1S5DD 1VMCA 1F2LA 1X3QA 1ESRA 1L0XB 2PCFB 1HA5A 1KAAA 4RCOA 1WTOA 1TY2A 3ITPA 3PUZA 1RJTA 2BCOA 3A7AB 4OL7A 4IURA 5M3MB 2KQ3A 3D4RA 1KDCA 3SR1A 5C0XI 1EFID 2CW0D 3P20A 3J7AF 2JYOA 4IUQA 1SFOB 3GTLB 2L5TA 5CGKA 3D4DA 3T53B 2WP8J 3S1RB 4DAPA 3D3RA 2E2HB 4O1NA 1KABA 5CV8A 2OXPA 1G291 1RKNA 4IFDJ 2EPBA 2L12A 2LS01 3I70A 4KJOA 3SXHA 3SK4A 4B9XA 4FNFA 1K8MA 3ERQA 2F0MA 3L7ZC 3N6RA 3D6WA 1G2SA 5C6AA 4ME5A 3ONAB 4XT3B 2NVXB 1U9RA 2BA0A 2HDLA 1CHQD 4QF4A 3KUPA 4PMWA 4CKBA 4CJ2C 2F0KA 1LT6D 5C5LA 1VCIA 4UAIA 2F0OA 2XN9C 1H9KA 2NZ1D 3NUCA 3VR4A 3DWPA 3BDLA 1EU4A 4HEDA 4RAUC 4KMUC 4EQNA 3OWEB 3E0JA 1C4QA 3QOJA 5COYA 4DU9A 1SMYC 2X69A 3GTGB 4RCNA 5A2QL 1SNQA 4O42A 4PQXA 2NTSA 3V2TA 3MXUA 5IGFA 4K8IA 1KLGD 3H3VC 1NSNS 4KY5A 1B53A 3P7JA 1X3PA 2EYOA 1B9MA 1MGSA 3HOXB 2V4DA 3T13A 3M7GA 5EPJA 3NTKA 1EEID 3G7LA 4YIJA 3LWEA 2DNEA 4C3IG 4BA1I 1HFNA 2RDHA 5ELBA 3RUZA 5E1FA 1Y8OB 1A3VA 3WOFA 1D1IA 3QG1A 1WTXA 5IT9E 1F2MA 3I3CA 4HSPA 4RKLA 1DD2A 3A7LA 1DOKA 5I6WA 2A6ED 3D4WA 1FD7D 3LWUA 3KLSA 5NUCA 2KCCA 4FXGC 1QJOA 1R9TB 3VR2A 5EKKA 3NE5B 4L8JA 2C5CA 4J1MA 4X3TA 3PUWA 4DAVA 1S5BD 2EYHA 1V1PB 5JVH3 1AEXA 1SE2A 2VB2X 2A74C 4MHEA 4KHVA 2HQEA 4IQZA 3PO3B 3ND9A 1EIHA 1OXSC 3KF8A 3QWNA 1SJED 1PFBA 2Z4HA 3QIAA 3EA6A 4FXKC 4KKUA 1XTCD 4C3JG 1BBXC 4G4KA 1EY5A 3MVVA 3HS0C 4DNRB 5K36H 1TT2A 2EJFC 4M8AA 4FF2A 1Y1WB 1HFGA 2NBFA 2F0IA 1HQRD 1EY7A 1YNJD 1M8AA 4QIWB 1X32A 4L6TB 3HEJA 2FINB 1B50A 1I3QB 3CU7A 4H0LC 1TWAB 4HMJA 1TWHB 3NSWA 1DJRD 1I4RA 5TSSA 4MN3A 2H1EA 1PTOD 5CV6A 3L9AX 5KNDA 1DOLA 2JSOA 5FLXE 2RDFA 5E4XA 3SDZA 1B44D 1NR2A 1CZGA 2FMCA 3TZUA 1DM0B 1SYCA 2K05A 3OW7A 2BA1A 3Q0AA 5KYIA 3F2UA 1PRTC 4S3SA 2F0FA 1EQVA 2RBMA 2BE5D 1EYCA 3S1NB 3MHBA 2R61A 4EQPA 4ID6A 2AUKA 5M5YB 2FMMA 3S1MB 1WD1A 3HG9A 3AMUA 5FLXL 3KLSX 1JCKB 2LKVA 1I6VC 1Y1VB 2EY6A 3VA5A 5EKLA 3C2PA 2FHTA 1TU2B 4RKBA 5C4ZA 4KV6A 2I07B 5EKIA 2XSCA 5ELEA 2JP1A 3M7NA 1Z47A 3X3NA 5C4HA 1OXTA 1ZKOA 3PUYA 1ICWA 4B9WA 3A8JE 2XWBB 3RZDB 5D65A 4J6HA 2JA8B 1JORA 3NBHA 3PIP3 4K14A 4KN7C 1TWGB 1LABA 2NTTA 1KNEA 2G9HD 4DF7A 1NAPA 1HQMC 5T1IA 3K59A 2OF1A 1LT5D 3GO5A 1GUGA 1HPCA 5EQ0A 1DONA 2HUGA 2IL8A 2A73B 4A3IB 4BWGB 1H9SA 2K03A 1UUPA 2D62A 3PUVA 1GUOA 2L4NA 2K04A 4XDXA 3FDTA 4K8JA 5FK9C 4C2MB 2O2LD 2EY1A 3PMFA 2A69D 4Y7NB 5IT9L 2VXWA 1A2TA 1B3AA 5C0XJ 2WACA 1LTRD 2M9VA 4R8NA 1R4PB 2RA4A 3PO2B 3VYTA 2K5QA 2NN6I 1Q90A 3S9WA 4KKTA 2A68D 4F7XA 1EQTA 5I9OA 3Q24A 3NP8A 1EY4A 1Q3LA 1JB3A 1RF2D 1B4OA 2KVMA 3BG3A 3MXGA 1EY8A 1EY0A 4HMIA 1RHPA 1KTKA 4KN4C 4DFAA 1IHZA 1A2UA 3BDOA 4U673 1QCBD 3HZXA 5LL6S 3E6ZX 5KEEA 4IFDH 1H9JA 4DN4M 1PFNA 1PFMA 4ZRZA 2NB0A 1I4XA 2K33A 3OHXC 4EQOA 1A15A 1CM9A 2KOLA 5DEHA 2NVQB 2EVBA 2KCNA 4K2KA 3TSSA 1GUNA 3E5SA 4A3BB 1XYIA 3S15B 1S5ED 3I4LA 3PUXA 3FPPA 3DM1A 1NUCA 2EYPA 1SSOA 2JEAI 3VYRA 4KTAA 2EOTA 4A3DB 2DY8A 3KK7A 2AQ2B 3MFYA 3R2IA 5M3FB 4QCLA 4U68A 1LT3D 2WINB 2YYZA 1FR3A 4GZYC 1G91A 3OSOA 3NBIA 5E4WC 3VYSA 1BQQT 1D5XC 1G8ZD 1D6EC 3JAML 5I9PA 2PZUA 2JA6B 1SNPA 5CV7A 3I90A 1RD9D 4ODGA 4XIGS 5I6YA 1TS4A 3OOCA 3IL8A 4KK7A 1EY9A 3A55A 2B2WA 1EYAA 5FOBB 1PZJD 1IL8A 2F0PA 3IKJA 1SE4A 2KUMA 1D5ZC 1PDQA 3MC0B 3X3MA 4C3JB 4KY6A 3OWFA 5J22A 2E2JB 3H94A 4KKSA 4A3KB 2CW0C 4X3KA 3G6JB 1WVLA 2EE1A 1STBA 1ENFA 2IX3A 4RFBA 4C3HG 3CKIB 2F0JA 1EOTA 3S14B 4LK1C 4RHSA 4DXGA 2F1MA 1GJXA 1D1KA 3NHHA 2QCPX 1GHKA 2B2VA 1RTOA 1DYQA 2MPMA 2F0TA 4JK1C 4OHJA 2BOSA 1Z7TA 3R2TA 5BN5A 1BR9A 1SE3A 1SYGA 2EYMA 3WOEA 1F2ZA 2L1BA 1VF7A 3I72A 1YNJC 3IAYA 3QOLA 3HOWB 1SYBA 5JOBA 1ET6A 2DNCA 1IYUA 2WB1B 1BXTA 1HCZA 1ML0D 3KBGA 4FO2A 2B8GA 3D31A 1U4MA 2F0VA 5JEAH 3MXNA 3C46A 1I4PA 1Y8PB 4XYQA 1DCZA 4RGMA 3RLFA 1LTTD 1LLRD 1W6KA 2K32A 1R4QB 3D6CA 1J9OA 1OXVA 1IYVA 2PYKA 4ZYSA 4WORA 1JWUD 2M00A 3D8GA 1G2TA 3FEWX 1CT1D 2XWJB 3HGBA 2EJMA 2B63B 2A68C 1TVXA 2F0NA 2O4XA 1I4GA 2NYZD 1ET9A 2F0EA 3AB9A 2ZT9C 1RODA 1EEFD 1SMYD 4I7ZC 1STNA 4PNYA 3MAQA 4IALA 5FO7B 2EDGA 4KJNA 4L63B 4HCEA 4RA8A 4NMZA 1ILQA 3ND8A 5FKAC 5A35A 3DHQA 1EWCA 3A8KE 3C1FA 3FPUB 1I4HA 3TP7A 1BNZA 1JE4A 1II3A 3J7AV 1BF4A 4CKCA 1T5EA 4PMBA 4DGZA 1SNOA 4BS9A 3TN2A 2HDMA 1B1ZA 2AWNA 4CJ1B 2F3VA 5CV9A 4ULLA 2O5JC 1XX8A 3V05A 5JEAG 4UDUC 5J1ZA 4NKLA 1ENAA 1QG7A 1ZYRC 2PO4A 3TP8A 4FF4A 3NK9A 1VDZA 3MZ5A 1SDFA 1TS5A 3ZYYX 4HSVA 2B2VC 4XQNA 1C8CA 1Z6HA 3SK8A 2QKIC 2F0DA 4IUNA 3K6OA 2Z8LA 4X3SA 4AYBB 2PQEA 2ICIA 4LMQD 2ICEC 4IUUA 5CBEE 1CQVA 2F4IA 1EWHA 3I8ZA 3I4NB 2K5WA 4IN3A 5JAVA 5C5MA 5JPMC 4WRDA 3V96A 2K6AA 1HTLD 5CMDA 5F2DA 4G57A 1ENCA 5DM63 3J81E 1GXDC 1FNWA 4RGNA 1JOQA 2AWOA 1A3TA 1G6ZA 2JXMB 2JA5B 2Y0SB 1AZQA 1CTMA 3HKZB 1C48A 4K5VA 3HRZC 1I6HB 4LAAA 4P2CB 1O78A 2MHVA 4FF1A 3P1HA 3S2HB 1S4ZA 4H44C 2IJ0A 1K8OA 2F0LA 4FVMA 4PMCA 1H9RA 3K5MA 3LX0A 1RDPD 2Q8RE 4MIUA 4NW2A 4K5XA 1RCVD 3BVGA 4G7OC 3C1EA 3J81L 2B2WC 2HCCA 2K28A 4ZQ3A 4DK0A 2M2LA 1WTVA 3IFTA 1SYEA 2NN6G 4TQUS 1QB5D 2QDBA 3H09A 5KNCA 1I50B 3S1QB 4I65A 1KDAA 1PTOC 4QUCA 2CHBD 4HN7A 2ENBA 2J7ZA 2AQ1B 1WTWA 1CK1A 1OXXK 4OO1H 1F9QA 3GTMB 2B39A 2B2TA 2KEDA 5IODA 1V1OA 3SK5A 3TP6A 4RH6A 1OO9B 2OEOA 3OIPA 2IT1A 4H13C 4OGQC 4A3GB 1GOZA 1CI3M 3BDCA 3TMEA 4IZ8A 3M85A 1MD2D 4XQJA 2A6HD 1U4LA 2E2DC 4F87A 1LTID 2ID0A 2R92B 5C44B 3MFGA 1SNCA 5CV5A 2KJXA 2QEJC 1V8QA 1U4PA 1ILPA 5M5XB 1TWFB 3EJIA 1O7ZA 5E3FA 2PW5A 4KHZA 4HTHA 4RHRA 4CHTB 3SVMA 1EIGA 3R93A 4C1NK 1PTOH 4KD4A 3NTIA 3CRKC 4BY1B 5EPLA 2E75C 5HGTA 5K36G 1MBYA 4NP5A 4OO1G 1Q1EA 4TRDA 1IW7C 2YU9B 1AZPA 5BN4A 4V190 3PV0A 2N88A 2B2TC 2F3WA 2O5IC 2C9OA 4TKOB 3W3AA 2J0TD 3EQLC 3FVQA 4RGOS 3GTJB 2F0UA 2F0WA 4G7HC 5FO9B 2EYJA 3MA2B 5IGBA 1EU3A 2DY7A 3VR6A 4FYDA 1TWCB 5HURA 1PRTD 2N55A 3NXWA 4KI0A 5LHY1 2F03A 2L55A 2EJGC 1FNUA 3KLRA 4WJWA 4TSSA 2K01A 2K1BA 3SHLA 5JPNC 2RSOA 3NPPA 4Q0FA 3T56B 1CA6A 2PZWA 2EYLA 4F8MA 1GUTA 1TQOA 1BCPC 2F0HA 2JEBI 2L11A 1TR5A 3GV6A 4N9PA 3A8IE 4A3FB 3QO2A 2XRSD 2E2IB 4Z9CB 1LV9A 3CRLC 3GV3A 1HHVA 5EBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP1 A;  1HA6 A;  1Q3L A;  1SDF A;  4ZK9 B;  5JJZ A;  1BO0 A;  1M8A A;  1B53 A;  2B2W C;  1NR4 A;  2HCC A;  1U4M A;  1X32 A;  3I90 A;  2K28 A;  1EIG A;  3P7J A;  3SVM A;  4HSV A;  1X3P A;  1HUM A;  3R93 A;  2FIN B;  2BDN A;  1B4O A;  2B2V C;  1IKM A;  1B50 A;  2KVM A;  1MGS A;  2JYO A;  4IUQ A;  1GUW A;  3IL8 A;  4OIJ A;  1C8C A;  2M2L A;  2B2U C;  5COR A;  5EPJ A;  3G7L A;  5EPL A;  1WTV A;  3TZD A;  3MWY W;  1RHP A;  3LWE A;  2B2W A;  1ICW A;  1J8I A;  4X3S A;  3IFD A;  1E0B A;  1J9O A;  1RTN A;  4MN3 A;  2B2Y A;  5D65 A;  2H1E A;  1HFN A;  1AZP A;  1IL8 A;  1QE6 A;  1G2T A;  3KBX A;  1HUN A;  4X3U A;  1DOL A;  4LMQ D;  2KUM A;  2EPB A;  2B2T C;  2N88 A;  2L12 A;  4IUU A;  4ZAI A;  5CBA E;  4QUC A;  5CBE E;  1WTX A;  5EPK A;  1PDQ A;  2RVL A;  3I3C A;  3MTS A;  2KEC A;  1F9P A;  1KNE A;  1WTQ A;  1WD0 A;  1DOK A;  1MI2 A;  2HCI A;  2X6G A;  2J7Z A;  3H91 A;  1TVX A;  3I8Z A;  5E4X A;  4DN4 M;  1NAP A;  1NR2 A;  4XT1 B;  1WTW A;  4HAE A;  5T1I A;  1IKL A;  2R3Z A;  1PFN A;  1O80 A;  2NYZ D;  1PFM A;  1VMP A;  1F9Q A;  1SAP A;  2NWG A;  1U4R A;  2XIW A;  2B2T A;  1MSH A;  1ROD A;  2KED A;  4IUP A;  1DZ1 A;  2D9U A;  2RSN A;  2K05 A;  5CMD A;  3HP3 A;  2MGS A;  4X3K A;  5EQ0 A;  1DON A;  1WTR A;  4ZKC B;  2HUG A;  1WVL A;  2EE1 A;  3Q6S A;  2IL8 A;  4RWS C;  1A15 A;  5EJW A;  2B2Y C;  1CM9 A;  2DY7 A;  2KOL A;  4X3T A;  3D6W A;  2K03 A;  1G2S A;  3ONA B;  1EOT A;  4XT3 B;  3I91 A;  2N55 A;  1KNA A;  4OIK A;  3F2U A;  2B2U A;  1QNK A;  2HDL A;  1G6Z A;  2MP1 A;  5AFW A;  2L9H A;  1EL0 A;  4RA8 A;  1AZQ A;  3KUP A;  5D14 A;  1ILQ A;  2KEE A;  4MHE A;  4CJ2 C;  1CA5 A;  2B2V A;  1RTO A;  4UAI A;  3FPU B;  1XYI A;  2L4N A;  1F9S A;  2NZ1 D;  1EIH A;  1BNZ A;  2MPM A;  1JE4 A;  2K04 A;  4XDX A;  3DM1 A;  2K01 A;  4RAU C;  4HED A;  1PFB A;  1SSO A;  2X6L A;  3FDT A;  5T1G A;  4R8I A;  4QUF A;  4R9W A;  1BF4 A;  2EOT A;  2K1B A;  2DY8 A;  5DNF A;  2SDF A;  3DEP A;  1U4L A;  4IUT A;  2RSO A;  1S4Z A;  2FMM A;  4CJ0 B;  4IUV A;  1AP0 A;  1F9R A;  1WD1 A;  1HRJ A;  1PLF A;  2FJ2 A;  1CA6 A;  4U68 A;  3DEO A;  4ZKB B;  1MSG A;  1WTP A;  1BBX C;  3TN2 A;  2VXW A;  5COY A;  1B3A A;  4ZLT F;  2L1B A;  2X69 A;  2HDM A;  1JIC A;  2RA4 A;  4CJ1 B;  2CVR A;  2MJ8 A;  1B2T A;  1XX8 A;  1G91 A;  4O42 A;  1VMC A;  1F2L A;  2L11 A;  3GV6 A;  1X3Q A;  1U4P A;  5E4W C;  1ILP A;  1NCV A;  3QO2 A;  1ESR A;  2Q8T A;  3UI2 A;  2Q8R E;  2FHT A;  4HCS A;  1WTO A;  2FFK B;  1O7Z A;  1RJT A;  1LV9 A;  1QG7 A;  4NW2 A;  3GV3 A;  1DOM A;  1EQT A;  1HHV A;  1ZXT A;  1HFG A;  1ML0 D;  5EKI A;  4IUR A;  3N52 A;  1O7Y A; 
#chains in the Genus database with same CATH topology
 1HA6 A;  2Q2H A;  5JJZ A;  4HJ9 A;  1EL0 A;  4A3M H;  2V1C C;  1HTP A;  2EXZ A;  3H6M A;  3J81 j;  4NDX A;  2Q2I A;  3TRE A;  4ABN A;  1GUW A;  5KRU A;  4A3E H;  1AN8 A;  2B2U C;  1FGB D;  3K81 C;  1E1T A;  4CKE A;  1QIL A;  3T51 B;  1RL2 A;  3CQZ B;  3K0Y A;  4K6D A;  1X54 A;  1RTN A;  3AFP A;  4GS3 A;  1FYC A;  3T4A C;  3S1M H;  2E8G A;  5C4J B;  5KIX A;  1EZ6 A;  1V1Q A;  2LFN A;  5CBA E;  3NBH B;  2RVL A;  5G3L F;  4LF6 L;  4A93 B;  4K5W A;  3PF5 A;  3BVM A;  3EFX D;  3W2D A;  3KOJ A;  1IBL L;  4OX9 Q;  3L0O A;  3I4M B;  1IKL A;  1O80 A;  1ZEQ X;  2KHS A;  5DAU A;  2R93 B;  3HOW G;  3DMU A;  2NWG A;  3FKI B;  2WII B;  5JJI A;  5IYD H;  2K7V A;  3M3Y B;  2D5D A;  3UE1 A;  1Y1W G;  1LTG D;  4A3J B;  4K6L A;  2IW3 A;  1VS0 A;  2GVA A;  2SNM A;  1L1O C;  3EIV A;  5IGD A;  1VQ4 A;  3NEM A;  3K57 A;  2RF4 A;  5LMU Q;  5C3E G;  3OIQ A;  1ZYR D;  4OIK A;  4DV0 Q;  1LUZ A;  2PMZ B;  1AW7 A;  2L9H A;  4CDC C;  3K7A B;  2IPK D;  5C4X H;  5EBC A;  1W2B A;  5IP9 G;  1VQO A;  2JA8 H;  4BBR B;  4AQY Q;  1STY A;  1ASZ A;  1D7Q A;  4R9W A;  2A69 C;  5IE8 A;  3DEP A;  1STG A;  2EZV A;  2VUM G;  1PRT B;  2Z1C A;  5JEA J;  4CGY B;  1STE A;  1K83 H;  4JI3 L;  3DUZ A;  1PRT F;  1A62 A;  2N8N A;  3CPF A;  3DXJ C;  4JI8 L;  2IX0 A;  2CVR A;  3JC6 6;  4J8Q A;  3LNN A;  1E2W A;  3NWT A;  4DR2 Q;  2XRQ D;  4HCS A;  1SEB D;  4OON A;  2FFK B;  2QEX A;  1SN8 A;  4XXE A;  1PZK D;  4BXX H;  1N32 Q;  1LO5 D;  2TMP A;  3EVQ A;  1WFQ A;  3GTP B;  4A3I G;  4DR5 L;  2E76 C;  4DAY A;  3OMG A;  4NXM Q;  4LUZ A;  1BO0 A;  1JOO A;  1PZI D;  2CH4 A;  4C56 C;  5I2X A;  2TSS A;  1JOK A;  4X65 Q;  2IWH A;  1YNN C;  5CR3 A;  4NPS A;  5I4D A;  1I4Q A;  4EVO A;  1N34 Q;  1H95 A;  1V1P A;  1HXY D;  2B2Y A;  1QVF A;  5ISR A;  1D5M C;  5IYB G;  2PI2 A;  4AYB E;  1TWG H;  1B7Y B;  4C1N I;  5AJ3 L;  3HOU H;  4X3U A;  3GTP H;  4ZAI A;  1XMO Q;  4QB4 A;  3K58 A;  3SE0 A;  5C3E H;  3MEH A;  2F52 A;  1BOS A;  2YTY A;  5CC4 A;  3GTO B;  2N49 A;  5M9O A;  1XPO A;  1Q8I A;  1VMP A;  5IWA L;  1CKO A;  2FXQ A;  1MSH A;  2XVS A;  1PH2 A;  3CXC A;  1WTR A;  1UEA B;  2IHF A;  3O13 A;  3TS0 A;  1S5C D;  1JR0 D;  3U50 C;  4WFN 3;  2UXC L;  4HR7 B;  5D3D A;  3U9S A;  1QNK A;  3FRP B;  4KLK A;  3F8T A;  1Q8K A;  2SOB A;  3NEL A;  2KEE A;  3PSI A;  3BZC A;  4BA2 I;  2RKS A;  1N33 L;  1F9S A;  1IL2 A;  4XQQ A;  5J39 A;  4XYO A;  4JBM A;  4P74 A;  3CHB D;  4C2M H;  4R8I A;  4QUF A;  4DV2 Q;  5DNF A;  1LTS D;  4IUT A;  1QOH A;  4LFB L;  4G7Z C;  1TKW B;  1STH A;  1SE8 A;  5AJ3 Q;  2G9D A;  2AMC B;  3M4Y A;  2I46 A;  2UXD Q;  1WTP A;  3QB3 A;  4ZLT F;  1SYF A;  3PIO A;  5M3F H;  1A63 A;  2PNH A;  4ILW A;  3J7Y W;  1YNX A;  2KCT A;  3CC7 A;  1HNX L;  1Y1V G;  3S17 B;  1NCV A;  1TS2 A;  4WJ4 A;  1AE2 A;  1HNW Q;  2SEB D;  2ZXP A;  2PNR C;  2ZJR A;  2YU9 H;  1DOM A;  1WOC A;  3K5N A;  2L0C A;  1ZXT A;  4YCV A;  1E2Z A;  1W6J A;  1NR4 A;  2GN5 A;  1K0R A;  3BYT B;  3PQI A;  4KHP L;  1HUM A;  1GHJ A;  4TVA B;  1A6X A;  4LF9 L;  1YEZ A;  2QF7 A;  4C3I B;  2JA5 G;  4K0K Q;  1ESF A;  3CCQ A;  3VYU A;  2F3I A;  1J8I A;  4JBK A;  1E0B A;  4JBW A;  3CAM A;  3M4O B;  1L1O A;  3M3Y H;  3GP7 A;  1QE6 A;  1HUN A;  5GAE C;  1KAW A;  1SRO A;  4DV2 L;  1K73 C;  2AHO B;  2OT2 A;  3F2D A;  3U9O A;  3OTO Q;  3MTS A;  1WD0 A;  5ELD A;  2VQF L;  1XXG A;  1SXT A;  1UNS A;  2JA7 B;  4K2L A;  4FF3 A;  4BXX G;  2G5D A;  2VNU D;  3AU7 A;  2A5H A;  1SAP A;  3QJY A;  4C3J H;  4DV5 L;  4HJ8 A;  2EQS A;  3CC2 A;  1PFS A;  3RNU A;  5KYL A;  2CH4 W;  2WB1 E;  3VR3 A;  5HGQ A;  2R93 G;  1NMF A;  1BVS A;  1CZW A;  4IFD G;  5C0X H;  2XNA C;  4QIW E;  2QDL A;  5DM7 3;  2PMZ E;  3I91 A;  4LFC L;  3S2D B;  5CV4 A;  3NTH A;  1KNA A;  3I56 A;  2MP1 A;  2ZTE A;  1KXL A;  2KEN A;  5C3E B;  4GN3 B;  2E5L Q;  4DR7 L;  5IOC A;  5KNB A;  4DUZ L;  1XNR Q;  3HOV G;  3RZO B;  1B70 B;  5FO8 B;  5M5W H;  1H9M A;  5GQO A;  2JA8 G;  3BVZ A;  4DR6 Q;  4FP5 D;  1KHI A;  1HZC A;  2KHJ A;  1QZG A;  1VQL A;  5ELF A;  2B3G A;  3NWS A;  4M1U B;  4ZUI A;  4CJ0 B;  1F9R A;  3E0E A;  4NXN L;  3OMC A;  2FJ2 A;  2DJF C;  3ICE A;  1MSG A;  1JWS D;  2SNS A;  4L5T A;  3EBE A;  4B3S L;  1JIC A;  3MEF A;  2Q2U A;  3G4S A;  3URY A;  1B2T A;  1D8L A;  4XTC S;  3OPO A;  2JE6 I;  2EIF A;  3R8B A;  1X3E A;  4B08 A;  1TII D;  1CHP D;  3A56 A;  4HJ7 A;  1O7Y A;  5IGE A;  3HOU B;  3SEB A;  1RIP A;  4ZK9 B;  4JI2 L;  2RDG A;  4QMG A;  1S5F D;  5EGT A;  1KLU D;  3TDQ A;  4YWL A;  1LTA D;  2RHQ B;  3B6Y A;  3MXP A;  1BUV T;  2A6E C;  2Z6B A;  2MNA A;  1WI5 A;  4BY7 B;  2A6H C;  4JI5 L;  4GN5 A;  1R9T H;  1BKB A;  4DA2 A;  2R7Z G;  3J7A 5;  2WKD A;  4KD3 A;  5M3M H;  4HJ5 A;  2AQ3 B;  1FNV A;  4V0B A;  5C0X G;  1WTQ A;  5IGC A;  1M4V A;  5I2Y A;  1JWM D;  4POF A;  1PTO B;  2DN8 A;  2DUD A;  2R3Z A;  2ZXO A;  1A8V A;  3AQQ A;  4A3K H;  1KDB A;  5IIF A;  3P75 A;  1U4R A;  3VA7 A;  4IUP A;  1BCP F;  2EYF A;  3J80 L;  2D9U A;  2NZO A;  1Y8N B;  2K5N A;  1YVC A;  4JV5 Q;  4OO1 I;  1CFM A;  2K5H A;  1MJC A;  3CPW A;  1PMR A;  1WYD A;  1QWY A;  1SND A;  5EJW A;  2BE5 C;  4QL5 A;  5IP7 H;  1E2V A;  3K5L A;  3HKS A;  5A2Q E;  4LF8 L;  5KGU A;  4B3T L;  1FJG L;  5JJK A;  4UHV A;  5AFW A;  1DXM A;  5ELC A;  2E74 C;  1CA5 A;  3KFU A;  1BCP D;  3GD7 A;  3MXN B;  3OYY A;  3GTQ B;  2RQX A;  3JAM E;  5T1G A;  1WCM H;  3AYH B;  4JYA L;  5JVG 3;  1N34 L;  4E6I A;  3K80 C;  1H9S B;  1YNN D;  2MUY A;  1A3U A;  1HRJ A;  4JI7 L;  2F0G A;  3L3O C;  4LF4 L;  3DEO A;  3CW2 C;  4ZKB B;  3S2D H;  3TEH B;  4OXP A;  1EYD A;  1I5F A;  5D3I B;  2R93 H;  1JJC B;  1JQY D;  4H7B A;  3Q22 A;  2ZTC A;  3R3O A;  2NN6 H;  2Q8T A;  2K5D A;  3HOW H;  3NQI A;  5K5P A;  3WDN A;  1LAC A;  4A3I H;  3AEV A;  2K5V A;  1JB7 A;  3UDX A;  3C3L A;  4C3H B;  4BBS B;  3Q8D A;  2ZXR A;  4MTK A;  1VQD A;  1T9H A;  4DV0 L;  1Y69 U;  5G3L D;  4L5R C;  4A3B G;  2HHH L;  2PZT A;  2BDN A;  3ULJ A;  3PO3 G;  1SNM A;  3UE0 A;  2BDO A;  4OIJ A;  2NVT B;  1LT4 D;  3BYY B;  3MWY W;  4QGU A;  4ME3 A;  3NQT A;  1EUJ A;  1X3G A;  3IFD A;  5BN3 A;  4JVZ A;  4HID A;  4DK1 A;  1EQR A;  1SJH D;  2K50 A;  3DWA A;  3RZD H;  3RLO A;  3KBX A;  4X6A H;  4DXF A;  4DR1 Q;  2B8F A;  3BZD B;  3H0G B;  4JOI A;  3I73 A;  4JW0 A;  1TY0 A;  1GUS A;  4HIK A;  4LFB Q;  1EZ8 A;  3IRB A;  5EPK A;  2K75 A;  1IW7 D;  2IX1 A;  2J4X A;  4EGV A;  4A3M B;  2VUM B;  2HCI A;  1L1O B;  1TXY A;  2QIL A;  4Q5V A;  5C3X A;  4XT1 B;  2WKC A;  4A93 H;  3RMH A;  1AFP A;  4BY7 H;  2LY7 A;  3T16 A;  2NVT H;  3DWQ A;  4GOP B;  3SK6 A;  2WAQ B;  1B9N A;  2PW7 A;  2MGS A;  4A3K G;  3KJO A;  1EY6 A;  3Q6S A;  3VR5 A;  1PYW D;  1HZA A;  1SYD A;  1YHA A;  2MFI A;  2F0S A;  2B2Y C;  3K5O A;  5GAH C;  3Q23 A;  3J80 E;  1VF5 C;  4X65 L;  1D2B A;  4GOP C;  4HIO A;  1M1K C;  3GQB A;  2C35 B;  1X55 A;  3S17 H;  2HIV A;  3TBI B;  5CYU A;  1STA A;  4LUV A;  1Q12 A;  5IYC H;  2X6L A;  3HOV B;  2LMC B;  4J15 A;  4N9T A;  3KLW A;  3PIP A;  1XMO L;  5LL6 X;  1JE5 A;  5M3F G;  1TS3 A;  1AP0 A;  1UE1 A;  2VL6 A;  3FP9 A;  2D2C C;  1ONL A;  4RGT A;  3GTK H;  4N8X 1;  4FXD A;  1K83 B;  2ZM6 Q;  2EY5 A;  4A93 G;  1J5E Q;  1LTB D;  3GTM H;  3RD4 A;  2MJ8 A;  4ZCK A;  3J80 c;  2UUC Q;  5C4X B;  3RR5 A;  3UI2 A;  1ASY A;  1AE3 A;  1BCP B;  1PXU A;  4F88 A;  4BBR H;  1JC7 A;  2PPB C;  4GN4 B;  2CQA A;  1BDO A;  2VB3 X;  3A54 A;  4UY8 C;  3N52 A;  4OWW B;  1PTO F;  3ER0 A;  1Q1B A;  1VQG A;  2KA7 A;  1XWE A;  3ERO A;  2JA5 H;  1K3R A;  3GTG H;  4A3E B;  1IKM A;  3HOU G;  3GTK B;  3TP5 A;  3S15 H;  5COR A;  4ZUJ A;  5GAD C;  1K0S A;  4MTN A;  1C7Y A;  2LXJ A;  3TZD A;  4KY7 A;  2R6G A;  2H4O A;  1CKM A;  4CBV A;  3M4P A;  5BR8 L;  1QNU A;  1WTH A;  1F77 A;  4UPA A;  2NVY B;  4IFD I;  4I7A A;  4R4T A;  2WV6 D;  2JJQ A;  3PIO 3;  4DV7 L;  2KEC A;  1F9P A;  2F4V Q;  2R7Z B;  1MI2 A;  2X6G A;  1V9P A;  3H91 A;  4N8F A;  2UXB Q;  4PV1 C;  4HAE A;  3ULL A;  1O7L A;  1I3Q H;  2XIW A;  5M5W B;  4OWX B;  2D0P A;  1CQF A;  1DZ1 A;  2RSN A;  5EAY A;  4A3F H;  3HP3 A;  4ZKC B;  1WCM B;  5H1S E;  2AUJ D;  2LXK A;  4RWS C;  4A3L H;  1IYJ B;  2HD3 A;  1KRS A;  3FKI G;  2HHH Q;  2Z4I A;  1LM0 A;  2F0Q A;  2EY2 A;  3H15 A;  2NUC A;  5IGG A;  4DR5 Q;  1JJ2 A;  2B2U A;  2Q8I B;  3S16 B;  4NXM L;  1V43 A;  2I5L X;  4JCV E;  4LJZ C;  1UAP A;  5D14 A;  1T5X D;  1L0Y B;  2GA4 B;  5FLM G;  3FMC A;  4A3D G;  4IPD A;  2BH8 A;  1HNZ L;  4AYB G;  1SBB B;  2OTJ A;  1KRT A;  3HOY B;  2SDF A;  1Z9F A;  4DNT B;  5C3W A;  1OXU A;  1F2Y A;  2B63 G;  4IUV A;  4BBR G;  4MZ9 A;  1S40 A;  1PLF A;  2Z6K A;  1KIX A;  4IOA A;  2R92 H;  1VQC A;  3CD6 A;  3BS1 A;  1QVG A;  3HOZ B;  1S5D D;  2F4V L;  4R4O A;  1VMC A;  1F2L A;  1X3Q A;  1LTL A;  4JBJ A;  1ESR A;  1L0X B;  2PCF B;  1HA5 A;  4GNX B;  1KAA A;  4RCO A;  1WTO A;  1TY2 A;  3ITP A;  4LUO A;  3PUZ A;  1RJT A;  1XTD A;  3CF5 A;  2BCO A;  3G71 A;  1M90 C;  1TWF H;  5DLQ E;  2Q2T A;  3A7A B;  4OL7 A;  4IUR A;  5M3M B;  4LFC Q;  1HR0 Q;  2KQ3 A;  2CQO A;  3D4R A;  3J80 i;  1KDC A;  4DUZ Q;  3ZJY C;  3SR1 A;  5C0X I;  1EFI D;  2CW0 D;  1P8L A;  3P20 A;  3J7A F;  3RZO H;  4A3G G;  2JYO A;  4IUQ A;  1SFO B;  4LF8 Q;  3GTL B;  1S3O A;  2L5T A;  5CGK A;  3D4D A;  3T53 B;  1XPU A;  3OW2 A;  2WP8 J;  3S1R B;  2A8V A;  4DAP A;  3D3R A;  2E2H B;  4O1N A;  1HNZ Q;  1KAB A;  2CKZ B;  5CV8 A;  2OXP A;  1G29 1;  1RKN A;  4IFD J;  2EPB A;  2L12 A;  2LS0 1;  1VQJ A;  4JI8 Q;  4P73 A;  5C44 G;  1C9O A;  4JI7 Q;  1VQE A;  3I70 A;  4KJO A;  3SXH A;  3RN5 A;  2OQK A;  3SK4 A;  2UU9 Q;  5IY0 A;  4B9X A;  4FNF A;  4DKA C;  4B3M L;  1K8M A;  3ERQ A;  4A3D H;  2VQE L;  4JOI C;  2F0M A;  3L7Z C;  3N6R A;  2UUA L;  4JI2 Q;  3D6W A;  4JPB W;  1G2S A;  5C6A A;  4ME5 A;  3ONA B;  1E7Z A;  4XT3 B;  2NVX B;  1U9R A;  1MKH A;  2BA0 A;  2HDL A;  3FHW A;  1CHQ D;  4JI4 Q;  4QF4 A;  3KUP A;  4PMW A;  4CKB A;  4JC0 A;  3KJP A;  4CJ2 C;  3CQZ H;  2F0K A;  1LT6 D;  5C5L A;  1VCI A;  4DV3 L;  5IP9 H;  4UAI A;  2F0O A;  2XN9 C;  1H9K A;  2NZ1 D;  3NUC A;  3VR4 A;  2DJG C;  3DWP A;  3BDL A;  1EU4 A;  4HED A;  4RAU C;  5FLM H;  3S2H H;  4KMU C;  4EQN A;  2VZA A;  2ALY B;  4QQB X;  3OWE B;  2VW9 A;  3E0J A;  1C4Q A;  3QOJ A;  5COY A;  4DU9 A;  1SMY C;  2X69 A;  3OTO L;  3GTG B;  4RCN A;  3E9H A;  5A2Q L;  1SNQ A;  4O42 A;  2WB1 G;  4PQX A;  2NTS A;  3V2T A;  3MXU A;  3I4M G;  1YZ6 A;  5IGF A;  4IOC A;  1G6P A;  4K8I A;  1KLG D;  3H3V C;  1BBW A;  3GDE A;  1NSN S;  4KY5 A;  1B53 A;  3P7J A;  1X3P A;  2EYO A;  2JN4 A;  1B9M A;  1MGS A;  4P75 A;  3HOX B;  2V4D A;  3T13 A;  2KBN A;  3M7G A;  5EPJ A;  2R7D A;  3NTK A;  1EEI D;  3G7L A;  4YIJ A;  3LWE A;  3CME A;  2DNE A;  1A0I A;  4C3I G;  4BA1 I;  2CFM A;  3T1H Q;  1HFN A;  2RDH A;  4GKK Q;  1EYG A;  5ELB A;  3RUZ A;  5E1F A;  1Y8O B;  1A3V A;  1KC8 C;  1UE6 A;  3WOF A;  1I94 Q;  1D1I A;  3QG1 A;  1WTX A;  1F2M A;  5IT9 E;  3I3C A;  4HSP A;  2Z9H A;  4RKL A;  1DD2 A;  3A7L A;  1DOK A;  1HNX Q;  3I4N G;  4JG2 A;  3I4O A;  5I6W A;  4A3C H;  4FDB A;  2A6E D;  4B3S Q;  1J5E L;  3D4W A;  4UP9 A;  2PQA A;  3BU2 A;  1FD7 D;  3LWU A;  3KLS A;  1VQP A;  3HOV H;  5NUC A;  2KCC A;  3W5O A;  4DV4 Q;  4FXG C;  3FKI H;  2N3S A;  1QJO A;  1R9T B;  3VR2 A;  5EKK A;  2OWO A;  3NE5 B;  1U0L A;  4L8J A;  2C5C A;  4J1M A;  4X3T A;  3PUW A;  1Q46 A;  4DAV A;  1SLJ A;  1S5B D;  2EYH A;  5JJL A;  1V1P B;  5JVH 3;  4PG3 A;  1AEX A;  1SE2 A;  3A5Z B;  2VB2 X;  2A74 C;  4MHE A;  4KHV A;  2HQE A;  4IQZ A;  3PO3 B;  3ND9 A;  1EIH A;  1OXS C;  3KF8 A;  5HY6 A;  3QWN A;  1SJE D;  4DV6 Q;  1PFB A;  2Z4H A;  3CCE A;  1HH2 P;  3QIA A;  4CDD C;  3EA6 A;  1IBM L;  3KDF B;  4FXK C;  4UP8 A;  1PH3 A;  4KKU A;  2HT1 A;  5ELN A;  1XTC D;  4C3J G;  3H3V H;  1BBX C;  4G4K A;  2JQO A;  1X56 A;  1XMQ L;  2LSS A;  1EY5 A;  3MVV A;  4CDF C;  3HS0 C;  1GD7 A;  4DNR B;  5K36 H;  3CCU A;  1TT2 A;  1QUQ B;  2EJF C;  4X62 L;  2UUB L;  4M8A A;  4FF2 A;  1Y1W B;  1HFG A;  3E9I A;  2NBF A;  2OTL A;  2F0I A;  1HQR D;  1EY7 A;  1JJG A;  1SR3 A;  2ZJP A;  1YNJ D;  1CUK A;  1M8A A;  4QIW B;  2E5L L;  4DR7 Q;  1X32 A;  4L6T B;  3L2P A;  5M3M G;  3HEJ A;  2FIN B;  1B50 A;  3KF8 B;  2UXC Q;  2QA4 A;  4YWK A;  4B3T Q;  1FJG Q;  1I3Q B;  3CU7 A;  4H0L C;  1TWA B;  4HMJ A;  1TWH B;  3A5U A;  3NSW A;  1DJR D;  1I4R A;  5TSS A;  4MN3 A;  2H1E A;  2R7F A;  3JAM c;  4QY7 A;  1PTO D;  2JK8 A;  4JI3 Q;  5CV6 A;  1PV4 A;  3L9A X;  5KND A;  1DOL A;  4JI1 Q;  2JA6 H;  2JSO A;  1KD1 C;  5FLX E;  1EIY B;  2Z6K C;  2RDF A;  5E4X A;  3SDZ A;  4LF4 Q;  1DGS A;  1S72 A;  1B44 D;  1NR2 A;  2UXD L;  4LW1 A;  3STB D;  1CZG A;  4A3F G;  2FMC A;  3TZU A;  3TQY A;  1DM0 B;  1SYC A;  3TRZ A;  2K05 A;  3OW7 A;  2BA1 A;  3Q0A A;  2MO0 A;  1PYS B;  3F2U A;  5KYI A;  2VUM H;  1PRT C;  1X6O A;  4S3S A;  3K8A A;  4KHP Q;  2F0F A;  1EQV A;  2RBM A;  2BE5 D;  1EYC A;  2KHI A;  4CDE C;  4L5S A;  1HZB A;  3S1N B;  4GKK L;  3MHB A;  2R61 A;  4EQP A;  4ID6 A;  2CWA A;  2AUK A;  1YHQ A;  4A3L G;  5M5Y B;  2FMM A;  2R92 G;  2OQ0 A;  3S1M B;  4JI6 Q;  1WD1 A;  3HG9 A;  2I5M X;  4GLX A;  3AMU A;  2JA7 H;  1CKN A;  5FLX L;  2CWP A;  2P5Z X;  3KLS X;  2I5H A;  1JCK B;  2LKV A;  1I6V C;  1Y1V B;  2EY6 A;  5EKL A;  3VA5 A;  3CCJ A;  1VQ7 A;  3C2P A;  3PO3 H;  2E2I H;  3I4M H;  2JA9 A;  2FHT A;  1TU2 B;  4RKB A;  5C4Z A;  4KV6 A;  4B3M Q;  2I07 B;  5EKI A;  2XSC A;  5ELE A;  4HIM A;  2JP1 A;  3M7N A;  3CCS A;  3S16 H;  1PYB A;  1Z47 A;  5LMU L;  3X3N A;  5C4H A;  1OXT A;  1ZKO A;  3AFQ A;  3PUY A;  4OEM B;  4DV6 L;  4A4I A;  4C3I H;  1ICW A;  4JYA Q;  1YHB A;  4B9W A;  3TS2 A;  3HOX G;  3A8J E;  4DV3 Q;  2XWB B;  3RZD B;  1JT8 A;  5D65 A;  2I0Q A;  4IPG A;  4J6H A;  2JA8 B;  1JOR A;  3M4O H;  3NBH A;  3PIP 3;  1X65 A;  4K14 A;  1NE3 A;  4KN7 C;  5C44 H;  4B3R Q;  1TWG B;  1LAB A;  1N36 L;  3W1B A;  2HIX A;  2NTT A;  4AIM A;  1KNE A;  2G9H D;  4DF7 A;  1CSP A;  4H02 A;  1NAP A;  1HQM C;  5T1I A;  5M5X H;  1QVC A;  1E1O A;  5IT9 c;  2ZM6 L;  3K59 A;  2OF1 A;  1LT5 D;  3GO5 A;  2DGY A;  5LMN W;  4DV1 Q;  3PF4 A;  1NBW A;  1GUG A;  1HPC A;  5EQ0 A;  1DON A;  2HUG A;  1LYL A;  2IL8 A;  2A73 B;  4A3I B;  2WAQ G;  4BWG B;  1H9S A;  2K03 A;  4DR4 L;  1UUP A;  2D62 A;  4LF9 Q;  4IPH A;  3PO2 H;  1IBK Q;  1YIT A;  3PUV A;  1GUO A;  4GOP A;  2L4N A;  3KF6 A;  2K04 A;  4XDX A;  1MIU A;  3FDT A;  4DR1 L;  4K8J A;  5FK9 C;  4LF5 Q;  4C2M B;  2O2L D;  3T1H L;  1UE7 A;  2EY1 A;  4YY3 L;  2ZJQ A;  4X64 Q;  3PMF A;  2A69 D;  4Y7N B;  5IT9 L;  2VXW A;  1A2T A;  1B3A A;  4B3R L;  4X66 Q;  5C0X J;  3F2C A;  2WAC A;  1LTR D;  2M9V A;  4R8N A;  1R4P B;  2RA4 A;  3PO2 B;  3VYT A;  4DV5 Q;  3KF6 B;  2K5Q A;  2CCZ A;  2VQE Q;  4DAM A;  2NN6 I;  1Q90 A;  3RLN A;  3S9W A;  4KKT A;  4DV1 L;  2A68 D;  3G48 A;  4F7X A;  1EQT A;  5I9O A;  1VQA A;  3Q24 A;  3NP8 A;  1EY4 A;  1Q3L A;  4DR3 Q;  1PH6 A;  1JB3 A;  1RF2 D;  3M4Q A;  1B4O A;  2KVM A;  1X9N A;  3BG3 A;  2WFW A;  3MXG A;  1EY8 A;  1EWI A;  3DLL A;  4DR6 L;  2ASB A;  2E2J H;  1EY0 A;  4HMI A;  3D0F A;  3KYH C;  1RHP A;  1KTK A;  5IYD G;  1MJE A;  1C0A A;  4KN4 C;  4DFA A;  4IO9 A;  1I6H H;  1IHZ A;  1A2U A;  1VQ6 A;  3BDO A;  4U67 3;  1QCB D;  2HQL A;  2ATW A;  3HZX A;  5LL6 S;  3E6Z X;  5KEE A;  4LF7 Q;  4IFD H;  3U4V A;  1H9J A;  4DN4 M;  2BH2 A;  1IZ6 A;  1PFN A;  5FLX c;  5LMN Q;  1PFM A;  1K9M C;  4ZRZ A;  2YV5 A;  2NB0 A;  1VQN A;  1I4X A;  1N32 L;  2K33 A;  4IPC A;  1E22 A;  3E3X A;  3OHX C;  4EQO A;  1A15 A;  1CM9 A;  2KOL A;  4LNQ A;  5DEH A;  2YTX A;  2NVQ B;  2EVB A;  3T1Y L;  1K8A C;  2KCN A;  3PCO B;  4K2K A;  3TSS A;  4GNX A;  1GUN A;  3E5S A;  4DAY B;  4A3B B;  4O0A A;  5IYC G;  1XYI A;  3S15 B;  1S5E D;  3LGJ A;  1B3Q A;  3I4L A;  3PUX A;  3FPP A;  3DM1 A;  1NUC A;  2EYP A;  1SSO A;  4GLV B;  1NMG A;  2JEA I;  3VYR A;  4KTA A;  2EOT A;  4A3D B;  2DY8 A;  3KK7 A;  2AQ2 B;  4DK3 C;  1Y1W H;  3MFY A;  3HKZ E;  3R2I A;  5M3F B;  4QCL A;  4NB3 A;  4U68 A;  1LT3 D;  2NVY H;  2WIN B;  1K8G A;  2NVQ H;  2YYZ A;  1SRU A;  2AKW B;  1UEB A;  1FR3 A;  4GZY C;  2XGT A;  4LF6 Q;  2RCF A;  5IWA Q;  2VQF Q;  1G91 A;  4PZ8 A;  3OSO A;  3NBI A;  5E4W C;  3VYS A;  1IBL Q;  1BQQ T;  4DUY Q;  3SGI A;  1D5X C;  1G8Z D;  1D6E C;  3JAM L;  4DR4 Q;  5I9P A;  2PZU A;  2JA6 B;  1SNP A;  3G6E A;  5CV7 A;  5ELO A;  2K52 A;  3I90 A;  4C3H H;  4DK6 C;  4BBS H;  1RD9 D;  4ODG A;  4XIG S;  5I6Y A;  4L5Q A;  2IHE A;  1TS4 A;  3OOC A;  1N33 Q;  2K4K A;  3IL8 A;  1FVI A;  4KK7 A;  1EY9 A;  3KDF A;  3HOX H;  3A55 A;  2B2W A;  1EYA A;  5FOB B;  1XNR L;  4LF5 L;  1PZJ D;  1IL8 A;  2F0P A;  3IKJ A;  1KQS A;  1E24 A;  3H0G G;  1SE4 A;  4DPG A;  1P16 A;  3ERS X;  2KUM A;  5C4J H;  3S14 H;  1D5Z C;  4YHH L;  1PDQ A;  3MC0 B;  3X3M A;  4C3J B;  4KY6 A;  3H3V I;  3OWF A;  2MO1 A;  5J22 A;  1GKH A;  2E2J B;  3H94 A;  4KKS A;  4A3K B;  4Y52 H;  2CW0 C;  2UUC L;  1OTC A;  4X3K A;  3G6J B;  4DUY L;  1WVL A;  2EE1 A;  1STB A;  1ENF A;  2IX3 A;  4IJH A;  4RFB A;  4C3H G;  3CKI B;  2F0J A;  4BBS G;  1EOT A;  1W3S A;  3S14 B;  4LK1 C;  4RHS A;  2RHS B;  4BY1 G;  4DXG A;  2F1M A;  1GJX A;  1Y1V H;  3BZK A;  1D1K A;  3NHH A;  2QCP X;  1XJV A;  1GHK A;  2B2V A;  3F1Z A;  1RTO A;  1DYQ A;  2MPM A;  5E7N A;  2F0T A;  4APV A;  4JK1 C;  1PA6 A;  4OHJ A;  5GAG C;  2BOS A;  1Z7T A;  3R2T A;  3H0G H;  5BN5 A;  1BR9 A;  1SE3 A;  1SYG A;  3EN2 A;  1NY4 A;  1EIF A;  4GKJ L;  4OX9 L;  2EYM A;  3WOE A;  1F2Z A;  3GTO H;  2L1B A;  1VF7 A;  1VQ9 A;  3I72 A;  1YNJ C;  3IAY A;  3QOL A;  5J3B A;  3HOW B;  4A3B H;  1PH7 A;  2UXB L;  1SYB A;  1JMC A;  5JOB A;  2UUA Q;  3CCM A;  1ET6 A;  2DNC A;  1IYU A;  2WB1 B;  1BXT A;  1HCZ A;  4EQ5 A;  5FJ8 G;  1ML0 D;  1HR0 W;  4DV4 L;  1MHW C;  4HJA A;  4PZ7 A;  3CCL A;  3KBG A;  4FO2 A;  2B8G A;  3D31 A;  1U4M A;  4YCW A;  4JI4 L;  4A75 A;  2F0V A;  5JEA H;  4A76 A;  4DNI A;  3MXN A;  3C46 A;  4LFA Q;  1I4P A;  1Y8P B;  4XYQ A;  1DCZ A;  1VQM A;  2VY3 A;  4RGM A;  4AQY L;  1L0W A;  3RLF A;  1LTT D;  1LLR D;  1W6K A;  2H5X A;  2K32 A;  1R4Q B;  3D6C A;  1J9O A;  1OXV A;  3DM3 A;  1IYV A;  2PYK A;  4ZYS A;  1CKN B;  4WOR A;  1JWU D;  2M00 A;  3D8G A;  1G2T A;  3FEW X;  1QZH A;  2A1A A;  1CT1 D;  2XWJ B;  3HGB A;  3K7U C;  1PH4 A;  2EJM A;  2B63 B;  2A68 C;  1HJP A;  4O2D A;  1TVX A;  2F0N A;  2O4X A;  1VQK A;  1I4G A;  4X66 L;  2NYZ D;  1ET9 A;  2F0E A;  3AB9 A;  2ZT9 C;  1ROD A;  1L2F A;  4A3J H;  1EEF D;  1SMY D;  3VDY A;  4I7Z C;  1PH8 A;  1EOV A;  1STN A;  4PNY A;  3MAQ A;  4IAL A;  5FO7 B;  3STB C;  4X62 Q;  2UUB Q;  2EDG A;  4KJN A;  4R1J A;  4L63 B;  4Y7N H;  1CSQ A;  4HCE A;  4A3E G;  3NEN A;  4RA8 A;  4NMZ A;  1ILQ A;  1KL9 A;  3ND8 A;  5FKA C;  5A35 A;  3DHQ A;  4UP7 A;  1EWC A;  3A8K E;  1WJJ A;  5BR8 Q;  3C1F A;  3FPU B;  1I4H A;  3TP7 A;  3CCR A;  1BNZ A;  1JE4 A;  1UE5 A;  1II3 A;  3J7A V;  1BF4 A;  1GM5 A;  4CKC A;  1BBU A;  1YBY A;  1T5E A;  1N36 Q;  4PMB A;  1PVO A;  4MNO A;  4DV7 Q;  4DGZ A;  3I55 A;  1SNO A;  3CP0 A;  4BS9 A;  5M5Y H;  4A3M G;  3UDI A;  3TN2 A;  3W1G A;  2HDM A;  1B1Z A;  2AWN A;  4CJ1 B;  2F3V A;  5CV9 A;  4ULL A;  2O5J C;  1XX8 A;  3V05 A;  5JEA G;  4JV5 L;  3UDG A;  4UDU C;  3U58 A;  4POG A;  5J1Z A;  4NKL A;  2ES2 A;  1ENA A;  4QJF A;  1QG7 A;  1ZYR C;  2PO4 A;  3TP8 A;  3WWV A;  4FF4 A;  1XPR A;  1EFW A;  3NK9 A;  1VDZ A;  1I50 H;  3MZ5 A;  1SDF A;  1TS5 A;  3ZYY X;  4HSV A;  1XNQ Q;  2QGQ A;  2JA6 G;  2B2V C;  4JI0 L;  3HFZ B;  1Q86 C;  3T1Y Q;  4XQN A;  1Q7Y C;  2Y0S E;  1C8C A;  1Z6H A;  3J7Z C;  3SK8 A;  2QKI C;  2F0D A;  1SFO H;  2YTV A;  4IUN A;  3K6O A;  2Z8L A;  4X3S A;  3HOY H;  1N9W A;  4AYB B;  2KCM A;  4IJL A;  2PQE A;  5L37 A;  2ICI A;  4LMQ D;  3JAM i;  1PH5 A;  2ICE C;  4IUU A;  5CBE E;  3A0J A;  1CQV A;  2F4I A;  3HOZ H;  1EWH A;  3J81 i;  1Q81 C;  1SMX A;  2K14 A;  3I8Z A;  4A3C G;  3I4N B;  2K5W A;  4IN3 A;  1HNW L;  5JAV A;  5C5M A;  5JPM C;  4WRD A;  3V96 A;  2XTI A;  2K6A A;  1HTL D;  5CMD A;  5F2D A;  4G57 A;  1ENC A;  1E3P A;  5DM6 3;  3J81 E;  1GXD C;  1FNW A;  5IP7 G;  4RGN A;  1GO3 E;  2AWO A;  1JOQ A;  1A3T A;  1G6Z A;  2B63 H;  2JXM B;  2JA5 B;  2Y0S B;  1AZQ A;  3S1N H;  3I4N H;  4JI0 Q;  1CTM A;  3HKZ B;  1C48 A;  4K5V A;  1Y14 B;  3HRZ C;  1I6H B;  4LAA A;  4P2C B;  1O78 A;  2MHV A;  4FF1 A;  1IXR A;  3P1H A;  3S2H B;  1S4Z A;  4H44 C;  4GLA C;  4WJ3 M;  1YJW A;  4P72 A;  4LF7 L;  1VQH A;  2IJ0 A;  1YJ9 A;  2VS1 A;  1K8O A;  2F0L A;  4FVM A;  4PMC A;  5LMN L;  2A19 A;  1PH1 A;  1H9R A;  2R7Z H;  3K5M A;  3LX0 A;  1Q82 C;  3CCV A;  1RDP D;  2Q8R E;  1QUQ A;  4MIU A;  4NW2 A;  4K5X A;  5IYB H;  3S1Q H;  4R4I A;  1RCV D;  2L15 A;  3BVG A;  4G7O C;  1NNX A;  3C1E A;  3J81 L;  2B2W C;  2HCC A;  2K28 A;  3GTJ H;  1PHJ A;  4ZQ3 A;  4DK0 A;  2M2L A;  3GTQ H;  3BJU A;  1WTV A;  3IFT A;  1SYE A;  3CC4 A;  2NN6 G;  4TQU S;  1QB5 D;  1U5K A;  4OEL B;  2QDB A;  4R4C A;  2QW7 A;  1VQ8 A;  4NXN Q;  3H09 A;  1UWV A;  2E2H H;  5KNC A;  1I50 B;  3S1Q B;  1IBM Q;  4I65 A;  1KDA A;  1PTO C;  4QUC A;  2CHB D;  1NJI C;  1K28 A;  4HN7 A;  1VQ5 A;  4YY3 Q;  2ENB A;  2J7Z A;  2AQ1 B;  3CMA A;  4GKJ Q;  1WTW A;  1CK1 A;  1OXX K;  1VQI A;  3U4Z A;  4OO1 H;  1F9Q A;  4A3J G;  3GTM B;  2B39 A;  2B2T A;  2KED A;  5IOD A;  3I7F A;  1V1O A;  3SK5 A;  3TP6 A;  1XNQ L;  4AH6 A;  2Z0S A;  4LWC A;  1OO9 B;  2OEO A;  3OIP A;  4RH6 A;  4OGQ C;  1K3B C;  1NTG A;  2IT1 A;  4H13 C;  4RMF A;  4A3G B;  4DR3 L;  2NVX H;  1GOZ A;  2RCN A;  1CI3 M;  3BDC A;  3TME A;  4IZ8 A;  4EX5 A;  1MD2 D;  3M85 A;  1VQB A;  4XQJ A;  4K0K L;  1X3F A;  2A6H D;  1G51 A;  1PH9 A;  1U4L A;  2E2D C;  1I94 L;  4F87 A;  1LTI D;  2PI2 E;  3PGZ A;  2ID0 A;  2JA7 G;  2R92 B;  5C44 B;  3MFG A;  1SNC A;  4JI1 L;  5CV5 A;  4A3G H;  2KJX A;  3ULP A;  2QEJ C;  1V8Q A;  1U4P A;  1WCM G;  1ILP A;  5M5X B;  1TWF B;  3EJI A;  1O7Z A;  5E3F A;  1YIJ A;  4GNX C;  2PW5 A;  4KHZ A;  4HTH A;  4YCU A;  1IBK L;  4RHR A;  4CHT B;  3SVM A;  1EIG A;  3J81 c;  3R93 A;  1FL0 A;  3GTL H;  4C1N K;  3S24 A;  1PTO H;  4KD4 A;  3NTI A;  3CRK C;  4BY1 B;  1EQQ A;  3F2B A;  5EPL A;  3HOY G;  1O7I A;  2E75 C;  1VQF A;  3M9B A;  5HGT A;  5K36 G;  1MBY A;  4NP5 A;  2B29 A;  4OO1 G;  1TWA H;  1Q1E A;  4TRD A;  1IW7 C;  2YU9 B;  1AZP A;  4YWM A;  5BN4 A;  5FJ8 H;  4V19 0;  3PV0 A;  4X64 L;  1ICF B;  3RN2 A;  1TWC H;  2N88 A;  2B2T C;  2F3W A;  3HOZ G;  2O5I C;  3UDF A;  2C9O A;  4TKO B;  3W3A A;  2J0T D;  2MQH A;  1XMQ Q;  3EQL C;  4JI6 L;  3FVQ A;  4RGO S;  3GTJ B;  2F0U A;  2F0W A;  3K7A H;  2IY5 B;  2D0O A;  4G7H C;  4BY1 H;  1AH9 A;  5FO9 B;  2EYJ A;  3MA2 B;  3A74 A;  2GVB A;  5IGB A;  4DR2 L;  1J6Q A;  1HR0 L;  1EU3 A;  2OCE A;  2DY7 A;  3K0X A;  3VR6 A;  1B8A A;  4FYD A;  1FGU A;  2EXD A;  1TWC B;  5HUR A;  1PRT D;  2N55 A;  3NXW A;  4KI0 A;  5LHY 1;  2F03 A;  4LFA L;  4BY7 G;  5GRO A;  4ALP A;  2L55 A;  2NZH A;  1GVP A;  1TWH H;  2EJG C;  1FNU A;  3QR8 A;  3KLR A;  4WJW A;  2Y0S G;  2K01 A;  4TSS A;  1N8R C;  4R4Q A;  3HKZ G;  3S1R H;  2K1B A;  3SHL A;  1HZ9 A;  2PQA B;  5JPN C;  2RSO A;  4JI5 Q;  3NPP A;  4Q0F A;  3T56 B;  2ZTD A;  1CA6 A;  2PZW A;  2EYL A;  4PZ6 A;  2UU9 L;  5C4X G;  4F8M A;  1GUT A;  4YHH Q;  1TQO A;  3PO2 G;  4OWT B;  1BCP C;  2F0H A;  2JEB I;  2L11 A;  1TR5 A;  3GV6 A;  1YJN A;  4N9P A;  3A8I E;  4A3F B;  3QO2 A;  2XRS D;  2WAQ E;  2E2I B;  1YI2 A;  4P71 A;  4Z9C B;  1LV9 A;  3CRL C;  3GV3 A;  4RG1 A;  1HHV A;  2N78 A;  5EBD A;  3I2Z A; 
#chains in the Genus database with same CATH homology
 1HA6 A;  5JJZ A;  1EL0 A;  1HTP A;  2EXZ A;  3H6M A;  4NDX A;  4ABN A;  1GUW A;  5KRU A;  1AN8 A;  2B2U C;  1FGB D;  4CKE A;  1QIL A;  3T51 B;  3CQZ B;  3K0Y A;  4K6D A;  1RTN A;  1FYC A;  3T4A C;  5C4J B;  5KIX A;  1EZ6 A;  2LFN A;  5CBA E;  2RVL A;  5G3L F;  4A93 B;  4K5W A;  3BVM A;  3EFX D;  3W2D A;  3I4M B;  1IKL A;  1O80 A;  1ZEQ X;  2KHS A;  5DAU A;  2R93 B;  3DMU A;  2NWG A;  3FKI B;  2WII B;  2K7V A;  3M3Y B;  2D5D A;  1LTG D;  4A3J B;  4K6L A;  2IW3 A;  2SNM A;  5IGD A;  3K57 A;  3OIQ A;  1ZYR D;  4OIK A;  2PMZ B;  1AW7 A;  2L9H A;  3K7A B;  2IPK D;  5EBC A;  4BBR B;  1STY A;  4R9W A;  2A69 C;  3DEP A;  1STG A;  2EZV A;  1PRT B;  2Z1C A;  5JEA J;  4CGY B;  1STE A;  3DUZ A;  1PRT F;  3DXJ C;  2IX0 A;  2CVR A;  4J8Q A;  3LNN A;  1E2W A;  3NWT A;  2XRQ D;  4HCS A;  1SEB D;  2FFK B;  4XXE A;  1PZK D;  1LO5 D;  2TMP A;  3EVQ A;  3GTP B;  2E76 C;  4DAY A;  3OMG A;  1BO0 A;  1JOO A;  1PZI D;  4C56 C;  5I2X A;  2TSS A;  1JOK A;  2IWH A;  1YNN C;  5CR3 A;  5I4D A;  1I4Q A;  4EVO A;  1V1P A;  1HXY D;  2B2Y A;  5ISR A;  1D5M C;  4C1N I;  4X3U A;  4ZAI A;  4QB4 A;  3K58 A;  3SE0 A;  3MEH A;  1BOS A;  5CC4 A;  3GTO B;  5M9O A;  1Q8I A;  1VMP A;  1MSH A;  2XVS A;  1WTR A;  1UEA B;  3O13 A;  1S5C D;  1JR0 D;  4WFN 3;  4HR7 B;  5D3D A;  3U9S A;  1QNK A;  3FRP B;  2SOB A;  2KEE A;  4BA2 I;  2RKS A;  1F9S A;  4XQQ A;  5J39 A;  4XYO A;  3CHB D;  4R8I A;  4QUF A;  5DNF A;  1LTS D;  4IUT A;  1QOH A;  4G7Z C;  1TKW B;  1STH A;  2G9D A;  3M4Y A;  2I46 A;  1WTP A;  3QB3 A;  4ZLT F;  1SYF A;  4ILW A;  3J7Y W;  3S17 B;  1NCV A;  1TS2 A;  2SEB D;  2ZXP A;  2PNR C;  1DOM A;  3K5N A;  2L0C A;  1ZXT A;  1E2Z A;  1W6J A;  1NR4 A;  3BYT B;  1HUM A;  1GHJ A;  1A6X A;  2QF7 A;  4C3I B;  1ESF A;  3VYU A;  1J8I A;  1E0B A;  4JBW A;  3M4O B;  3GP7 A;  1QE6 A;  1HUN A;  2OT2 A;  3U9O A;  3MTS A;  1WD0 A;  5ELD A;  1XXG A;  1SXT A;  1UNS A;  2JA7 B;  4K2L A;  4FF3 A;  3AU7 A;  2A5H A;  1SAP A;  3QJY A;  5KYL A;  3VR3 A;  1CZW A;  4IFD G;  5C0X H;  2XNA C;  5DM7 3;  3I91 A;  3S2D B;  5CV4 A;  3NTH A;  1KNA A;  2MP1 A;  5C3E B;  5IOC A;  5KNB A;  3RZO B;  5FO8 B;  1H9M A;  3BVZ A;  4FP5 D;  5ELF A;  3NWS A;  4M1U B;  4ZUI A;  4CJ0 B;  1F9R A;  3OMC A;  2FJ2 A;  1MSG A;  1JWS D;  2SNS A;  1JIC A;  3URY A;  1B2T A;  4XTC S;  3OPO A;  2JE6 I;  3R8B A;  4B08 A;  1TII D;  1CHP D;  3A56 A;  1O7Y A;  5IGE A;  3HOU B;  3SEB A;  4ZK9 B;  2RDG A;  4QMG A;  1S5F D;  5EGT A;  1KLU D;  3TDQ A;  1LTA D;  3MXP A;  1BUV T;  2A6E C;  4BY7 B;  2A6H C;  4DA2 A;  2WKD A;  4KD3 A;  2AQ3 B;  1FNV A;  4V0B A;  5C0X G;  1WTQ A;  5IGC A;  1M4V A;  5I2Y A;  1JWM D;  1PTO B;  2DN8 A;  2R3Z A;  2ZXO A;  1KDB A;  5IIF A;  3P75 A;  1U4R A;  3VA7 A;  1BCP F;  2EYF A;  4IUP A;  3J80 L;  2D9U A;  1Y8N B;  4OO1 I;  1CFM A;  1PMR A;  1QWY A;  1SND A;  5EJW A;  2BE5 C;  3K5L A;  1E2V A;  5A2Q E;  5KGU A;  5AFW A;  1DXM A;  5ELC A;  2E74 C;  1CA5 A;  1BCP D;  3GD7 A;  3GTQ B;  2RQX A;  3JAM E;  5T1G A;  5JVG 3;  4E6I A;  1H9S B;  1YNN D;  2MUY A;  1A3U A;  1HRJ A;  2F0G A;  3L3O C;  3DEO A;  4ZKB B;  1EYD A;  5D3I B;  4H7B A;  1JQY D;  3Q22 A;  3R3O A;  2NN6 H;  2Q8T A;  2K5D A;  3NQI A;  5K5P A;  3WDN A;  1LAC A;  3C3L A;  4C3H B;  4BBS B;  2ZXR A;  1Y69 U;  5G3L D;  2PZT A;  2BDN A;  1SNM A;  2BDO A;  4OIJ A;  2NVT B;  1LT4 D;  3BYY B;  3MWY W;  3IFD A;  3NQT A;  5BN3 A;  4DK1 A;  1SJH D;  3DWA A;  3KBX A;  4DXF A;  2VNU D;  2B8F A;  3BZD B;  3H0G B;  3I73 A;  1TY0 A;  1GUS A;  1EZ8 A;  5EPK A;  2IX1 A;  1IW7 D;  2VUM B;  2J4X A;  4EGV A;  4A3M B;  2HCI A;  2QIL A;  4Q5V A;  5C3X A;  4XT1 B;  2WKC A;  3RMH A;  1AFP A;  2LY7 A;  3T16 A;  3DWQ A;  3SK6 A;  2WAQ B;  1B9N A;  2PW7 A;  2MGS A;  1EY6 A;  3Q6S A;  3VR5 A;  1PYW D;  1SYD A;  2F0S A;  2B2Y C;  3K5O A;  3Q23 A;  3J80 E;  1VF5 C;  1D2B A;  3GQB A;  3TBI B;  5CYU A;  1STA A;  1Q12 A;  2X6L A;  3HOV B;  2LMC B;  4N9T A;  5LL6 X;  1TS3 A;  1AP0 A;  2D2C C;  1ONL A;  4RGT A;  4FXD A;  1K83 B;  2EY5 A;  1LTB D;  3RD4 A;  2MJ8 A;  5C4X B;  3UI2 A;  1BCP B;  1PXU A;  4F88 A;  1JC7 A;  2PPB C;  2CQA A;  1BDO A;  2VB3 X;  3A54 A;  3N52 A;  1PTO F;  1Q1B A;  2KA7 A;  3ERO A;  1XWE A;  1IKM A;  4A3E B;  3GTK B;  3TP5 A;  5COR A;  4ZUJ A;  3TZD A;  4KY7 A;  2R6G A;  2H4O A;  4CBV A;  1QNU A;  1F77 A;  2NVY B;  4IFD I;  2WV6 D;  2R7Z B;  3PIO 3;  2KEC A;  1F9P A;  1MI2 A;  2X6G A;  3H91 A;  4PV1 C;  4HAE A;  1O7L A;  2XIW A;  5M5W B;  1DZ1 A;  1CQF A;  2RSN A;  3HP3 A;  4ZKC B;  1WCM B;  2AUJ D;  4RWS C;  2Z4I A;  2F0Q A;  2EY2 A;  2NUC A;  5IGG A;  2B2U A;  2Q8I B;  3S16 B;  1V43 A;  4LJZ C;  1UAP A;  5D14 A;  1T5X D;  1L0Y B;  2GA4 B;  3FMC A;  1SBB B;  3HOY B;  2SDF A;  4DNT B;  5C3W A;  1OXU A;  1F2Y A;  4IUV A;  1PLF A;  3BS1 A;  3HOZ B;  1S5D D;  1VMC A;  1F2L A;  1X3Q A;  1ESR A;  1L0X B;  2PCF B;  1HA5 A;  1KAA A;  4RCO A;  1WTO A;  1TY2 A;  3ITP A;  3PUZ A;  1RJT A;  2BCO A;  3A7A B;  4OL7 A;  4IUR A;  5M3M B;  2KQ3 A;  3D4R A;  1KDC A;  3SR1 A;  5C0X I;  1EFI D;  2CW0 D;  3P20 A;  3J7A F;  2JYO A;  4IUQ A;  1SFO B;  3GTL B;  2L5T A;  5CGK A;  3D4D A;  3T53 B;  2WP8 J;  3S1R B;  4DAP A;  3D3R A;  2E2H B;  4O1N A;  1KAB A;  5CV8 A;  2OXP A;  1G29 1;  1RKN A;  4IFD J;  2EPB A;  2L12 A;  2LS0 1;  3I70 A;  4KJO A;  3SXH A;  3SK4 A;  4B9X A;  4FNF A;  1K8M A;  3ERQ A;  2F0M A;  3L7Z C;  3N6R A;  3D6W A;  1G2S A;  5C6A A;  4ME5 A;  3ONA B;  4XT3 B;  2NVX B;  1U9R A;  2BA0 A;  2HDL A;  1CHQ D;  4QF4 A;  3KUP A;  4PMW A;  4CKB A;  4CJ2 C;  2F0K A;  1LT6 D;  5C5L A;  1VCI A;  4UAI A;  2F0O A;  2XN9 C;  1H9K A;  2NZ1 D;  3NUC A;  3VR4 A;  3DWP A;  3BDL A;  1EU4 A;  4HED A;  4RAU C;  4KMU C;  4EQN A;  3OWE B;  3E0J A;  1C4Q A;  3QOJ A;  5COY A;  4DU9 A;  1SMY C;  2X69 A;  3GTG B;  4RCN A;  5A2Q L;  1SNQ A;  4O42 A;  4PQX A;  2NTS A;  3V2T A;  3MXU A;  5IGF A;  4K8I A;  1KLG D;  3H3V C;  1NSN S;  4KY5 A;  1B53 A;  3P7J A;  1X3P A;  2EYO A;  1B9M A;  1MGS A;  3HOX B;  2V4D A;  3T13 A;  3M7G A;  5EPJ A;  3NTK A;  1EEI D;  3G7L A;  4YIJ A;  3LWE A;  2DNE A;  4C3I G;  4BA1 I;  1HFN A;  2RDH A;  5ELB A;  3RUZ A;  5E1F A;  1Y8O B;  1A3V A;  3WOF A;  1D1I A;  3QG1 A;  1WTX A;  5IT9 E;  1F2M A;  3I3C A;  4HSP A;  4RKL A;  1DD2 A;  3A7L A;  1DOK A;  5I6W A;  2A6E D;  3D4W A;  1FD7 D;  3LWU A;  3KLS A;  5NUC A;  2KCC A;  4FXG C;  1QJO A;  1R9T B;  3VR2 A;  5EKK A;  3NE5 B;  4L8J A;  2C5C A;  4J1M A;  4X3T A;  3PUW A;  4DAV A;  1S5B D;  2EYH A;  1V1P B;  5JVH 3;  1AEX A;  1SE2 A;  2VB2 X;  2A74 C;  4MHE A;  4KHV A;  2HQE A;  4IQZ A;  3PO3 B;  3ND9 A;  1EIH A;  1OXS C;  3KF8 A;  3QWN A;  1SJE D;  1PFB A;  2Z4H A;  3QIA A;  3EA6 A;  4FXK C;  4KKU A;  1XTC D;  4C3J G;  1BBX C;  4G4K A;  1EY5 A;  3MVV A;  3HS0 C;  4DNR B;  5K36 H;  1TT2 A;  2EJF C;  4M8A A;  4FF2 A;  1Y1W B;  1HFG A;  2NBF A;  2F0I A;  1HQR D;  1EY7 A;  1YNJ D;  1M8A A;  4QIW B;  1X32 A;  4L6T B;  3HEJ A;  2FIN B;  1B50 A;  1I3Q B;  3CU7 A;  4H0L C;  1TWA B;  4HMJ A;  1TWH B;  3NSW A;  1DJR D;  1I4R A;  5TSS A;  4MN3 A;  2H1E A;  1PTO D;  5CV6 A;  3L9A X;  5KND A;  1DOL A;  2JSO A;  5FLX E;  2RDF A;  5E4X A;  3SDZ A;  1B44 D;  1NR2 A;  1CZG A;  2FMC A;  3TZU A;  1DM0 B;  1SYC A;  2K05 A;  3OW7 A;  2BA1 A;  3Q0A A;  5KYI A;  3F2U A;  1PRT C;  4S3S A;  2F0F A;  1EQV A;  2RBM A;  2BE5 D;  1EYC A;  3S1N B;  3MHB A;  2R61 A;  4EQP A;  4ID6 A;  2AUK A;  5M5Y B;  2FMM A;  3S1M B;  1WD1 A;  3HG9 A;  3AMU A;  5FLX L;  3KLS X;  1JCK B;  2LKV A;  1I6V C;  1Y1V B;  2EY6 A;  3VA5 A;  5EKL A;  3C2P A;  2FHT A;  1TU2 B;  4RKB A;  5C4Z A;  4KV6 A;  2I07 B;  5EKI A;  2XSC A;  5ELE A;  2JP1 A;  3M7N A;  1Z47 A;  3X3N A;  5C4H A;  1OXT A;  1ZKO A;  3PUY A;  1ICW A;  4B9W A;  3A8J E;  2XWB B;  3RZD B;  5D65 A;  4J6H A;  2JA8 B;  1JOR A;  3NBH A;  3PIP 3;  4K14 A;  4KN7 C;  1TWG B;  1LAB A;  2NTT A;  1KNE A;  2G9H D;  4DF7 A;  1NAP A;  1HQM C;  5T1I A;  3K59 A;  2OF1 A;  1LT5 D;  3GO5 A;  1GUG A;  1HPC A;  5EQ0 A;  1DON A;  2HUG A;  2IL8 A;  2A73 B;  4A3I B;  4BWG B;  1H9S A;  2K03 A;  1UUP A;  2D62 A;  3PUV A;  1GUO A;  2L4N A;  2K04 A;  4XDX A;  3FDT A;  4K8J A;  5FK9 C;  4C2M B;  2O2L D;  2EY1 A;  3PMF A;  2A69 D;  4Y7N B;  5IT9 L;  2VXW A;  1A2T A;  1B3A A;  5C0X J;  2WAC A;  1LTR D;  2M9V A;  4R8N A;  1R4P B;  2RA4 A;  3PO2 B;  3VYT A;  2K5Q A;  2NN6 I;  1Q90 A;  3S9W A;  4KKT A;  2A68 D;  4F7X A;  1EQT A;  5I9O A;  3Q24 A;  3NP8 A;  1EY4 A;  1Q3L A;  1JB3 A;  1RF2 D;  1B4O A;  2KVM A;  3BG3 A;  3MXG A;  1EY8 A;  1EY0 A;  4HMI A;  1RHP A;  1KTK A;  4KN4 C;  4DFA A;  1IHZ A;  1A2U A;  3BDO A;  4U67 3;  1QCB D;  3HZX A;  5LL6 S;  3E6Z X;  5KEE A;  4IFD H;  1H9J A;  4DN4 M;  1PFN A;  1PFM A;  4ZRZ A;  2NB0 A;  1I4X A;  2K33 A;  3OHX C;  4EQO A;  1A15 A;  1CM9 A;  2KOL A;  5DEH A;  2NVQ B;  2EVB A;  2KCN A;  4K2K A;  3TSS A;  1GUN A;  3E5S A;  4A3B B;  1XYI A;  3S15 B;  1S5E D;  3I4L A;  3PUX A;  3FPP A;  3DM1 A;  1NUC A;  2EYP A;  1SSO A;  2JEA I;  3VYR A;  4KTA A;  2EOT A;  4A3D B;  2DY8 A;  3KK7 A;  2AQ2 B;  3MFY A;  3R2I A;  5M3F B;  4QCL A;  4U68 A;  1LT3 D;  2WIN B;  2YYZ A;  1FR3 A;  4GZY C;  1G91 A;  3OSO A;  3NBI A;  5E4W C;  3VYS A;  1BQQ T;  1D5X C;  1G8Z D;  1D6E C;  3JAM L;  5I9P A;  2PZU A;  2JA6 B;  1SNP A;  5CV7 A;  3I90 A;  1RD9 D;  4ODG A;  4XIG S;  5I6Y A;  1TS4 A;  3OOC A;  3IL8 A;  4KK7 A;  1EY9 A;  3A55 A;  2B2W A;  1EYA A;  5FOB B;  1PZJ D;  1IL8 A;  2F0P A;  3IKJ A;  1SE4 A;  2KUM A;  1D5Z C;  1PDQ A;  3MC0 B;  3X3M A;  4C3J B;  4KY6 A;  3OWF A;  5J22 A;  2E2J B;  3H94 A;  4KKS A;  4A3K B;  2CW0 C;  4X3K A;  3G6J B;  1WVL A;  2EE1 A;  1STB A;  1ENF A;  2IX3 A;  4RFB A;  4C3H G;  3CKI B;  2F0J A;  1EOT A;  3S14 B;  4LK1 C;  4RHS A;  4DXG A;  2F1M A;  1GJX A;  1D1K A;  3NHH A;  2QCP X;  1GHK A;  2B2V A;  1RTO A;  1DYQ A;  2MPM A;  2F0T A;  4JK1 C;  4OHJ A;  2BOS A;  1Z7T A;  3R2T A;  5BN5 A;  1BR9 A;  1SE3 A;  1SYG A;  2EYM A;  3WOE A;  1F2Z A;  2L1B A;  1VF7 A;  3I72 A;  1YNJ C;  3IAY A;  3QOL A;  3HOW B;  1SYB A;  5JOB A;  1ET6 A;  2DNC A;  1IYU A;  2WB1 B;  1BXT A;  1HCZ A;  1ML0 D;  3KBG A;  4FO2 A;  2B8G A;  3D31 A;  1U4M A;  2F0V A;  5JEA H;  3MXN A;  3C46 A;  1I4P A;  1Y8P B;  4XYQ A;  1DCZ A;  4RGM A;  3RLF A;  1LTT D;  1LLR D;  1W6K A;  2K32 A;  1R4Q B;  3D6C A;  1J9O A;  1OXV A;  1IYV A;  2PYK A;  4ZYS A;  4WOR A;  1JWU D;  2M00 A;  3D8G A;  1G2T A;  3FEW X;  1CT1 D;  2XWJ B;  3HGB A;  2EJM A;  2B63 B;  2A68 C;  1TVX A;  2F0N A;  2O4X A;  1I4G A;  2NYZ D;  1ET9 A;  2F0E A;  3AB9 A;  2ZT9 C;  1ROD A;  1EEF D;  1SMY D;  4I7Z C;  1STN A;  4PNY A;  3MAQ A;  4IAL A;  5FO7 B;  2EDG A;  4KJN A;  4L63 B;  4HCE A;  4RA8 A;  4NMZ A;  1ILQ A;  3ND8 A;  5FKA C;  5A35 A;  3DHQ A;  1EWC A;  3A8K E;  3C1F A;  3FPU B;  1I4H A;  3TP7 A;  1BNZ A;  1JE4 A;  1II3 A;  3J7A V;  1BF4 A;  4CKC A;  1T5E A;  4PMB A;  4DGZ A;  1SNO A;  4BS9 A;  3TN2 A;  2HDM A;  1B1Z A;  2AWN A;  4CJ1 B;  2F3V A;  5CV9 A;  4ULL A;  2O5J C;  1XX8 A;  3V05 A;  5JEA G;  4UDU C;  5J1Z A;  4NKL A;  1ENA A;  1QG7 A;  1ZYR C;  2PO4 A;  3TP8 A;  4FF4 A;  3NK9 A;  1VDZ A;  3MZ5 A;  1SDF A;  1TS5 A;  3ZYY X;  4HSV A;  2B2V C;  4XQN A;  1C8C A;  1Z6H A;  3SK8 A;  2QKI C;  2F0D A;  4IUN A;  3K6O A;  2Z8L A;  4X3S A;  4AYB B;  2PQE A;  2ICI A;  4LMQ D;  2ICE C;  4IUU A;  5CBE E;  1CQV A;  2F4I A;  1EWH A;  3I8Z A;  3I4N B;  2K5W A;  4IN3 A;  5JAV A;  5C5M A;  5JPM C;  4WRD A;  3V96 A;  2K6A A;  1HTL D;  5CMD A;  5F2D A;  4G57 A;  1ENC A;  5DM6 3;  3J81 E;  1GXD C;  1FNW A;  4RGN A;  1JOQ A;  2AWO A;  1A3T A;  1G6Z A;  2JXM B;  2JA5 B;  2Y0S B;  1AZQ A;  1CTM A;  3HKZ B;  1C48 A;  4K5V A;  3HRZ C;  1I6H B;  4LAA A;  4P2C B;  1O78 A;  2MHV A;  4FF1 A;  3P1H A;  3S2H B;  1S4Z A;  4H44 C;  2IJ0 A;  1K8O A;  2F0L A;  4FVM A;  4PMC A;  1H9R A;  3K5M A;  3LX0 A;  1RDP D;  2Q8R E;  4MIU A;  4NW2 A;  4K5X A;  1RCV D;  3BVG A;  4G7O C;  3C1E A;  3J81 L;  2B2W C;  2HCC A;  2K28 A;  4ZQ3 A;  4DK0 A;  2M2L A;  1WTV A;  3IFT A;  1SYE A;  2NN6 G;  4TQU S;  1QB5 D;  2QDB A;  3H09 A;  5KNC A;  1I50 B;  3S1Q B;  4I65 A;  1KDA A;  1PTO C;  4QUC A;  2CHB D;  4HN7 A;  2ENB A;  2J7Z A;  2AQ1 B;  1WTW A;  1CK1 A;  1OXX K;  4OO1 H;  1F9Q A;  3GTM B;  2B39 A;  2B2T A;  2KED A;  5IOD A;  1V1O A;  3SK5 A;  3TP6 A;  4RH6 A;  1OO9 B;  2OEO A;  3OIP A;  2IT1 A;  4H13 C;  4OGQ C;  4A3G B;  1GOZ A;  1CI3 M;  3BDC A;  3TME A;  4IZ8 A;  3M85 A;  1MD2 D;  4XQJ A;  2A6H D;  1U4L A;  2E2D C;  4F87 A;  1LTI D;  2ID0 A;  2R92 B;  5C44 B;  3MFG A;  1SNC A;  5CV5 A;  2KJX A;  2QEJ C;  1V8Q A;  1U4P A;  1ILP A;  5M5X B;  1TWF B;  3EJI A;  1O7Z A;  5E3F A;  2PW5 A;  4KHZ A;  4HTH A;  4RHR A;  4CHT B;  3SVM A;  1EIG A;  3R93 A;  4C1N K;  1PTO H;  4KD4 A;  3NTI A;  3CRK C;  4BY1 B;  5EPL A;  2E75 C;  5HGT A;  5K36 G;  1MBY A;  4NP5 A;  4OO1 G;  1Q1E A;  4TRD A;  1IW7 C;  2YU9 B;  1AZP A;  5BN4 A;  4V19 0;  3PV0 A;  2N88 A;  2B2T C;  2F3W A;  2O5I C;  2C9O A;  4TKO B;  3W3A A;  2J0T D;  3EQL C;  3FVQ A;  4RGO S;  3GTJ B;  2F0U A;  2F0W A;  4G7H C;  5FO9 B;  2EYJ A;  3MA2 B;  5IGB A;  1EU3 A;  2DY7 A;  3VR6 A;  4FYD A;  1TWC B;  5HUR A;  1PRT D;  2N55 A;  3NXW A;  4KI0 A;  5LHY 1;  2F03 A;  2L55 A;  2EJG C;  1FNU A;  3KLR A;  4WJW A;  4TSS A;  2K01 A;  2K1B A;  3SHL A;  5JPN C;  2RSO A;  3NPP A;  4Q0F A;  3T56 B;  1CA6 A;  2PZW A;  2EYL A;  4F8M A;  1GUT A;  1TQO A;  1BCP C;  2F0H A;  2JEB I;  2L11 A;  1TR5 A;  3GV6 A;  4N9P A;  3A8I E;  4A3F B;  3QO2 A;  2XRS D;  2E2I B;  4Z9C B;  1LV9 A;  3CRL C;  3GV3 A;  1HHV A;  5EBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...