4ZKBB

The chemokine binding protein of orf virus complexed with ccl3
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
57
structure length
49
Chain Sequence
b'TACCFSYTSRQIPDYFETSSQCSKPGVIFLTRQVCADPSEEWVQKYVSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemokine binding protein
publication title Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity.
pubmed doi rcsb
source organism Orf virus (strain nz2)
molecule tags Viral protein/cytokine
total genus 1
structure length 49
sequence length 57
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zkbB00
3LWEA 2JP1A 1SDFA 3I8ZA 4QUCA 2HUGA 4HAEA 1ILQA 4ZLTF 4CJ0B 1WTPA 1XYIA 1ZXTA 1EIHA 4LMQD 3DEOA 2B2UA 1WVLA 1O7ZA 1HFNA 4HEDA 1DOLA 2FHTA 5E4WC 4DN4M 4ZKBB 1X3PA 2EE1A 3GV3A 1HA6A 2HCCA 1U4PA 2Q8TA 4R9WA 2KOLA 1CM9A 4HSVA 4ZAIA 5T1IA 2HCIA 2R3ZA 3D6WA 1J8IA 4RWSC 1G2TA 2X69A 1B53A 3HP3A 2IL8A 1A15A 3ONAB 1KNEA 1RODA 1MSHA 5JJZA 3P7JA 1EIGA 2FINB 3TN2A 4CJ2C 2FMMA 2K28A 2N55A 1SAPA 2M2LA 1AZQA 1AP0A 2KEEA 1F9SA 5EQ0A 1ML0D 2H1EA 1QNKA 2B2UC 5E4XA 1RHPA 2KVMA 2N88A 2NYZD 1BBXC 5CBEE 1CA6A 2EPBA 4IUTA 1HRJA 2B2YA 3SVMA 2D9UA 5CBAE 2RVLA 2MGSA 4HCSA 1HFGA 1G6ZA 2MP1A 3FDTA 1QG7A 3F2UA 2B2TA 4X3TA 4XT1B 1O80A 2K05A 1WD1A 1JE4A 1EQTA 1AZPA 1VMPA 1IL8A 1PFMA 2DY8A 2FFKB 3IFDA 1F9RA 4RAUC 5EPLA 2B2WA 1BF4A 1VMCA 4MN3A 3FPUB 1BNZA 5COYA 1IKMA 1J9OA 2NZ1D 2VXWA 4CJ1B 1HUMA 2B2VA 2K04A 2RSNA 3DEPA 4IUQA 4OIKA 2KEDA 1NR4A 1B50A 1MI2A 2B2YC 2CVRA 2DY7A 3KUPA 1HHVA 3GV6A 4X3UA 1C8CA 1RTNA 1PDQA 2HDLA 2KUMA 2RSOA 2X6GA 3H91A 1JICA 2B2TC 1DZ1A 3DM1A 5EPJA 2MPMA 2FJ2A 1EOTA 1Q3LA 2EOTA 1WTXA 5AFWA 1DOKA 1F9PA 1WTVA 1U4RA 2KECA 2B2WC 1B2TA 1XX8A 3MTSA 3N52A 1B4OA 5DNFA 1WTQA 1NCVA 1U4LA 4IUPA 1SSOA 1S4ZA 1WTOA 1BO0A 4XT3B 2B2VC 1U4MA 1IKLA 1ICWA 2SDFA 1ILPA 1WTRA 1G91A 2JYOA 1X32A 4R8IA 5EKIA 2X6LA 2J7ZA 2L9HA 3Q6SA 3UI2A 1GUWA 1ESRA 4IUUA 2HDMA 2L4NA 1HUNA 1E0BA 1NR2A 4OIJA 4U68A 1PFNA 2RA4A 4O42A 3G7LA 3I90A 5D65A 5EPKA 4QUFA 1RJTA 3IL8A 5CMDA 1WD0A 2K01A 1O7YA 1F9QA 3MWYW 5T1GA 2NWGA 1M8AA 4X3KA 3KBXA 1PFBA 2XIWA 3I91A 1X3QA 1DOMA 1PLFA 1QE6A 2L11A 1F2LA 4MHEA 5EJWA 1TVXA 3QO2A 3TZDA 1DONA 2BDNA 1G2SA 2L1BA 3I3CA 1LV9A 4ZKCB 1MGSA 5CORA 4XDXA 4IURA 1KNAA 4X3SA 1NAPA 4NW2A 3R93A 1MSGA 5D14A 2K1BA 1RTOA 2L12A 2Q8RE 4RA8A 4ZK9B 1WTWA 2MJ8A 1EL0A 4UAIA 2K03A 1CA5A 4IUVA 1B3AA
chains in the Genus database with same CATH superfamily
2Z6KC 2RKSA 1SN8A 4FNFA 1V1PA 2WB1E 3EN2A 4BBRB 1KDAA 3ZYYX 2Z6KA 4HEDA 1DOLA 1MBYA 1S40A 2Q8TA 4BBRH 1N33Q 1HZCA 2G9HD 1I4RA 4AYBG 4IO9A 2IL8A 4G7OC 4EQNA 1F9SA 1PH5A 1UUPA 1SROA 1VQ5A 5JVH3 5E4XA 5KNCA 1B9MA 2KENA 4ID6A 4UDUC 3A0JA 1PVOA 1GJXA 1TKWB 3EIVA 3GTPB 3J81j 2VW9A 4OO1G 1L0YB 4OWTB 4A3FB 4KI0A 5CV4A 1FD7D 4IFDH 2QF7A 1XNRQ 1EWHA 3TEHB 1OXUA 3H6MA 4A3FH 1EZ8A 3DEPA 1C9OA 2HIVA 4OELB 1YHBA 4A3DB 2XWBB 2HDLA 3T4AC 5IGFA 4NXNL 1R9TB 5IYCG 4OHJA 1WTVA 1O7IA 4A3DH 1NMGA 5LMUL 1GXDC 1WFQA 4DNRB 4M1UB 4BWGB 4RCOA 3T1YQ 3E0JA 4YY3L 1G91A 2JYOA 2F0LA 4HIOA 3CC4A 3MXNA 2NVTH 2AHOB 2I5HA 2QKIC 2J7ZA 4LWCA 4LUZA 1ESRA 1OXVA 3H15A 1QVGA 5KYIA 3AB9A 1LTLA 2JA7G 1LLRD 1C0AA 2PI2E 1EFWA 1CQVA 1KDCA 1ONLA 1WD0A 4K8IA 4G7HC 2JA8B 3I73A 3MWYW 1ET9A 4X3KA 1BCPF 3A7LA 1PFBA 3BZDB 3RN5A 3VYRA 3FEWX 2L11A 1JC7A 5EJWA 2JA8H 3KLRA 1SR3A 4EGVA 2AUJD 5IGDA 3RLFA 1GUGA 1S72A 1IL2A 4XDXA 4BBSG 1I50B 4H02A 1SXTA 2B63B 5IP7H 4ABNA 4OXPA 4KKUA 2XWJB 3V05A 4A3EH 5J22A 3LWEA 1S5BD 1I50H 3C46A 2RDHA 2B63H 4A93B 3BVZA 4JI2L 1EQQA 4XXEA 1WVLA 2UXBQ 4QGUA 3DHQA 3M85A 4A3GG 4O0AA 2K52A 4R4CA 3CMAA 4DK0A 2D2CC 3HOUH 2KOLA 3MEHA 2F3WA 3VA7A 4JCVE 4LFCL 4CDDC 4K14A 1SAPA 2F03A 4LF9L 2F3IA 2YV5A 4HSPA 4XIGS 3K5OA 4KD3A 1PTOC 3ULJA 4DPGA 3IAYA 3HOXB 3DMUA 4HCSA 4XQNA 4A3MG 4KLKA 4P71A 2R7FA 3GTLB 3KF8A 2XN9C 1EQTA 4DV6Q 1AZPA 3RN2A 1IBKL 2FFKB 4OEMB 3C1EA 3HOXH 4L63B 5LMNW 1ZYRD 1SNQA 2IJ0A 4UP7A 3GTLH 4HIMA 1QNUA 4IUQA 4A75A 1Q1BA 2OXPA 1QB5D 3NEMA 5JPNC 2SNMA 4K2LA 3GV6A 5IGGA 3JAMc 1B1ZA 1WYDA 3J81c 2K5NA 2DNCA 5E3FA 3KLWA 1SYFA 3CPFA 3HOWB 1PZID 4DR2L 3IFTA 4DR1Q 5G3LF 3KBGA 3K58A 1U4LA 4XT3B 3PMFA 4PQXA 1RKNA 2NTTA 2SNSA 4DF7A 3HOWH 3LGJA 2X6LA 4DV6L 3QOJA 4FF2A 4AQYQ 4OIJA 1VQFA 1YHQA 3I90A 4A93G 1N32Q 1JB7A 2Y0SB 1VDZA 5FO8B 1JOQA 1ICFB 3CC7A 3QG1A 4BY7G 3TSSA 3MFYA 2GN5A 4APVA 3LNNA 5E7NA 1G2SA 3D3RA 3PO2H 3FKIG 5CORA 2CWPA 4K8JA 4IURA 4WJWA 4ZUIA 3T56B 1MSGA 4HTHA 1SYCA 1WOCA 1YEZA 2EJGC 4JI7Q 2V4DA 1CQFA 2JP1A 4K0KQ 2RHSB 1KABA 4A3KH 3BU2A 4LF4L 1BR9A 1HZAA 4QIWB 3SDZA 3J7AV 1XYIA 5IT9E 2E2JB 2B2UA 2IPKD 3A74A 3S15B 5CV8A 3PQIA 4R9WA 4ZAIA 1CM9A 3A8IE 1J6QA 1NY4A 2E2JH 4TQUS 2K5WA 1A63A 2Z4IA 2FMMA 5CR3A 5JAVA 2KEEA 4NXMQ 2MQHA 3KJPA 1JWUD 3I4MG 2KVMA 2KHSA 3SR1A 3CCVA 3CQZB 3S17B 2ID0A 1GOZA 3K59A 2B2WA 1E7ZA 1DYQA 3CQZH 2EXDA 3S17H 4R4TA 3HOYH 5JVG3 3SXHA 4A3IB 1SE3A 1G51A 3RZDB 1PRTD 1PDQA 4DAPA 4ZUJA 3HZXA 4QCLA 1C7YA 3L0OA 3ND8A 1YJNA 2EYPA 4EQOA 2MPMA 1EOTA 1I5FA 1WTXA 3RZDH 3G4SA 2JA5G 1IZ6A 3MHBA 1IBLQ 1EUJA 2VZAA 3F2DA 5C3XA 4UY8C 1WTRA 1LT5D 2R7DA 3QR8A 3GTQH 1P16A 5C44B 4EQ5A 2EYOA 3OYYA 2AKWB 5D65A 2A19A 3H3VC 5E1FA 1TWAB 1Y1VB 5JEAH 4U673 2O5IC 3CW2C 4C3HH 2NWGA 1IW7C 5C44H 4UP9A 4K5VA 3KDFB 1KHIA 4C2MH 4CHTB 1B70B 3K7UC 3K5MA 1SNPA 3ERSX 4QY7A 4OWWB 1TWAH 1Y1VH 1PTOD 1H9SB 4GOPB 4IOAA 4LUOA 5GAHC 1B44D 5M5YB 4JI8Q 4GKKQ 2Q2HA 3H09A 4G57A 1LT4D 4ZK9B 4WJ3M 4K2KA 2E2HH 1IBLL 3IKJA 1XMQL 5M5YH 1E2WA 2F0VA 3I8ZA 2HUGA 3WOFA 3A55A 5FLMG 4K6DA 3A8KE 4YWMA 3VYUA 3GP7A 4BY1B 5E4WC 4DK3C 4X64L 2A6HD 1HA6A 3QB3A 4HSVA 2HCIA 4A3IG 3S2HH 3NP8A 4J8QA 1KLUD 2FXQA 3KLSA 3D4RA 5IP9H 3A5UA 1KNEA 1JB3A 2UUAQ 1PFSA 5EQ0A 4CGYB 2RDGA 4JI5Q 4GKKL 2WB1B 3TP8A 1BBWA 3D31A 4JK1C 2JA6B 5C4XB 1EYCA 1SMYC 3PO3B 2QDBA 3FDTA 1PTOF 1K0RA 2MHVA 4L6TB 1HTLD 1BBUA 1YBYA 5C0XH 5C4XH 2JA6H 1IL8A 1KIXA 4OX9Q 1SNCA 4PNYA 4MNOA 1CKNB 1YNJD 3PO3H 3KYHC 4GNXA 1K0SA 1J9OA 1EFID 2IX0A 2WAQG 2K5QA 3K80C 4LF5Q 3PIO3 4X3UA 4HJ8A 2KUMA 1F77A 3GTJH 3H91A 1W3SA 5FLXL 1XNQL 4I65A 3TRZA 2HHHQ 1S5ED 5F2DA 4PMCA 1CKOA 1YNNC 2TMPA 3N52A 5D3IB 1PYBA 5C3EG 4JI5L 1D8LA 2JQOA 5FO9B 4NKLA 1PV4A 2SDFA 1WCMB 1SMXA 2C35B 3NTIA 1X32A 4KTAA 2VQFQ 3K0XA 4LUVA 1TIID 2E2IB 1A6XA 1SE8A 5EKKA 3HOVB 1X6OA 1WCMH 3P75A 2GA4B 4IUNA 2A73B 3UDXA 1L1OC 4BY1G 2Q8IB 1M8AA 1NE3A 1PH8A 2E2IH 2JJQA 1YITA 3IRBA 4MHEA 2QGQA 1GHJA 2CH4W 3F8TA 2NVXB 3QO2A 2ZTCA 4FVMA 1JJGA 3AFQA 3HKZB 1D5MC 2HHHL 3JC66 5LHY1 1NAPA 5IY0A 2F4VQ 2WB1G 3MVVA 5BN5A 5C0XI 2NVXH 1S5CD 2K03A 5ELEA 4ULLA 4J15A 1NMFA 1PH4A 4YWLA 1I4QA 2LY7A 1L0WA 2KCTA 3S24A 4CJ0B 5M3MB 2QEXA 1A2TA 2B8GA 3WDNA 2PI2A 2RQXA 3S1MB 5HGTA 4JI4Q 5M3MH 4FXKC 1BCPB 3HP3A 4QF4A 5LL6S 1VQ7A 2PCFB 5M3FH 1EIYB 2IY5B 1HZBA 4WORA 3S1MH 2F0WA 3S1RH 2LS01 2IHEA 2EVBA 1JE5A 1Y8NB 4DAVA 4Q0FA 2K33A 1BBXC 2Q2IA 5BR8Q 1K73C 1T9HA 4PZ6A 3IFDA 4CKCA 2AQ3B 3NK9A 3SK8A 2OQKA 3HOVG 2R6GA 5IYDG 4YHHL 1U5KA 4JI4L 4X62Q 2F0UA 1FGBD 5I2YA 5DAUA 2NN6G 3J81E 1JICA 3FVQA 1HXYD 4KY5A 1G6PA 3LX0A 3N6RA 1ASYA 1L2FA 5ELOA 1LO5D 2K7VA 5DNFA 1IBML 2EQSA 3GTMB 1STEA 4A4IA 2WKCA 1U4MA 5C4JB 3H0GG 2P5ZX 3ER0A 1HNXL 1SJHD 1XPRA 3NBHB 2AWNA 1Y1WG 4YWKA 3GTMH 4GZYC 3CP0A 4JI6Q 3A5ZB 1VQMA 2F0HA 2K01A 2JK8A 3SK4A 1V1OA 4A3BB 1QUQB 3KBXA 3MXPA 4I7AA 1DOMA 2KCMA 2EZVA 3KF6A 1Q8IA 2Z1CA 1EZ6A 4NDXA 1SMYD 4A3BH 4ZCKA 1R4QB 1S5FD 3R2TA 3VYSA 3PUWA 1D2BA 4XTCS 2VS1A 3NTHA 5D14A 3CCJA 3NPPA 4DV2Q 2VY3A 2R7ZG 4JI3Q 3MA2B 5I9OA 3CCMA 1STGA 2UUCQ 1N9WA 1Z47A 1BQQT 5IYBH 4FYDA 1ZEQX 5K36G 3L9AX 1YIJA 1ZYRC 4MTKA 1K8OA 3E0EA 2DGYA 1I3QB 1G8ZD 3Q24A 2F0OA 2F0GA 1DCZA 3GD7A 3GTKB 2IW3A 1VF7A 4UPAA 2R3ZA 2YTXA 1QOHA 1RODA 1MSHA 4OO1H 2EJMA 3GTKH 4L5TA 4RGNA 2H1EA 5I6YA 3OTOL 1STBA 4DV2L 2ZXRA 5M5XH 1VQLA 1PXUA 4ME5A 4HIDA 1KL9A 4JI3L 2HT1A 4DR3Q 4LJZC 2HQLA 2UUCL 4KHPQ 4Y52H 3KOJA 2CCZA 5GAEC 3I56A 1U9RA 2OQ0A 3P20A 5COYA 3U58A 2MO1A 2B2VA 4NXNQ 2WKDA 3U50C 4L8JA 2A69D 1E24A 5IGEA 5LMUQ 4F88A 4Z9CB 4IPGA 4YY3Q 1XX8A 2RHQB 2G5DA 1CSQA 4KJNA 1UE5A 1PA6A 5EBDA 2XVSA 2VQEQ 3E3XA 1LACA 2GVAA 3VA5A 4DR3L 1KC8C 4DAMA 3PUVA 2ICIA 1PH3A 5C4ZA 1JJCB 4LFBL 4KHPL 3J7YW 4C3IB 1PFNA 3LWUA 4FF4A 5JPMC 1PYSB 2R92B 3IL8A 4PG3A 5T1GA 4YCVA 2D0OA 3VR4A 4C3IH 1PLFA 3M4PA 1I6HB 2R92H 2NVTB 4DA2A 2ZM6Q 1AE2A 3I3CA 1LV9A 2F0SA 4PV1C 4ZKCB 2EXZA 4DXFA 4HN7A 1KNAA 1ENFA 2DN8A 3HKZE 1I6HH 4TRDA 3CRLC 2EYFA 1EL0A 1S3OA 4HJ5A 4JI2Q 1K9MC 3NTKA 1QVFA 2PMZB 4BBRG 1UNSA 2VQEL 1JORA 1OXTA 1Q90A 1YZ6A 1WTPA 5FLXE 4B3TQ 2YTYA 1O7ZA 4Y7NB 4LFCQ 2RBMA 1W6KA 1TWFB 4A3EB 3D6WA 4LF9Q 1Q12A 3J7ZC 1DJRD 4RMFA 4Y7NH 2QCPX 2BH8A 2CQOA 4O2DA 5CV6A 3ONAB 1PRTC 5BN3A 1Z7TA 1EIGA 1KD1C 4CJ2C 3P1HA 2ZM6L 2K28A 1AZQA 1GD7A 3BDLA 2M2LA 1TWFH 1SEBD 1TQOA 4IFDI 4IFDG 4RKBA 2N88A 3A8JE 1HRJA 1IBKQ 4IUTA 4A3FG 1KTKA 3M7GA 1XPUA 2LXKA 3HOUB 4GN4B 3GTOH 2SOBA 3J7A5 3VDYA 1SYDA 1EY8A 4P2CB 4B3TL 1VQAA 1HR0W 4LAAA 5CV5A 4A3DG 5K5PA 2PO4A 2B29A 3EROA 5M5WB 1VQ8A 1B50A 2CVRA 4QB4A 3NQTA 1C8CA 4DR2Q 2RSOA 3E9HA 5EBCA 2UXDQ 3S9WA 1RCVD 2ZTDA 4CKEA 4RH6A 1D6EC 5M5WH 3EJIA 2NBFA 3ULLA 3AYHB 2PPBC 3CAMA 4R4IA 1Q1EA 1B4OA 4MIUA 1HQRD 2E76C 1WTQA 4B9WA 1TR5A 3URYA 1S4ZA 3SGIA 3AU7A 4X65L 1DD2A 2EYLA 1D7QA 4POFA 2BA0A 3CPWA 2EY6A 4DR5L 1PTOB 1XTDA 2ICEC 3NQIA 1FR3A 3HOZH 3SK6A 4U68A 2JA8G 3G48A 3TP6A 5EPKA 2ZJPA 3DUZA 1FJGL 3RZOB 2QILA 5A2QL 1WI5A 3S2DB 1PTOH 4DR6L 2A6HC 1TWGH 3BVGA 1IYVA 4G7ZC 5IP7G 4A3EG 1VCIA 1CT1D 3RZOH 4V190 2Q2UA 3DXJC 3S14H 3S2DH 2UXDL 3VR5A 2B63G 3PV0A 2YYZA 1VQEA 5C5LA 4JBJA 2IX1A 4DNIA 4LF4Q 4RA8A 1O78A 2A74C 1A3UA 1B3AA 3HKSA 3HOUG 4JBMA 2ZJRA 3D0FA 4TKOB 4BA2I 3PO2B 4LMQD 1VQGA 1NJIC 2OEOA 1YNJC 3J80i 2HQEA 3M4QA 4LK1C 3G6JB 5I6WA 1G2TA 1B53A 1YVCA 3PIP3 4DR7L 2IT1A 4A3KB 5JJZA 3HRZC 4DAYB 2N55A 1NSNS 4DV7Q 1K3BC 2RDFA 3HOXG 3CF5A 4POGA 4DR4Q 4FF1A 1Q82C 2NVYH 2B2UC 4MTNA 4NB3A 2CWAA 4IPCA 2TSSA 3J80E 1X56A 2JEBI 4OGQC 2D62A 5HGQA 1H9KA 3W1GA 4DNTB 1HNZQ 2F0IA 1F9RA 4FO2A 1HJPA 1VMCA 5JJLA 4KHVA 2F3VA 2HIXA 3PUZA 1BNZA 1VQHA 1VQNA 1Y8PB 3G71A 2Z6BA 4A3JB 5AJ3Q 4DV0L 1LTBD 4B3RL 2I5MX 4KV6A 1LTGD 5KNBA 1HQMC 4A3JH 3DM1A 1CTMA 3HOWG 1B2TA 2B2WC 1HNWL 3MTSA 4DV7L 4DR4L 1VQCA 4KHZA 4P72A 3HOYB 1STYA 1NBWA 1SYEA 3W3AA 3DM3A 1BUVT 3U9OA 4R8IA 2LSSA 3TMEA 1TS3A 3BYYB 1SFOB 1PH7A 2Y0SG 1HNZL 1PZKD 4N8X1 3AQQA 2K50A 4JI0L 3PO2G 5JJIA 1O7YA 1LABA 2F0JA 1SFOH 2PW7A 5AJ3L 1KAWA 2WIIB 5FKAC 1QE6A 5CGKA 2MFIA 3K57A 1H95A 3GTQB 3RD4A 3R8BA 4A3KG 1XMQQ 5KGUA 1C4QA 3QJYA 3W1BA 2C5CA 4RGOS 3STBD 5BN4A 4GS3A 2R61A 4C3HB 1V9PA 4C2MB 1W6JA 4X64Q 4QUCA 3CD6A 3CCEA 4KN7C 2PMZE 2IHFA 3M4OB 2CH4A 4HJAA 3DEOA 3NUCA 1PZJD 1U0LA 2XNAC 4OWXB 4DV3L 1TT2A 2E2HB 3BDCA 3M4OH 2JEAI 2X69A 2N49A 3CKIB 3KDFA 2PQAB 3EBEA 1QZGA 1PH2A 5I4DA 5M9OA 1PRTF 4UP8A 3H94A 3H3VH 4GOPA 1H9SA 1CA6A 2L15A 4MZ9A 5IIFA 2L5TA 2EPBA 3OSOA 5EGTA 3SVMA 3MXUA 5FLXc 2YTVA 3S2HB 1QG7A 2B2TA 4XT1B 4LF8L 1VMPA 1EQRA 1VQPA 4KKSA 1H9JA 3I2ZA 4J1MA 2VXWA 2IWHA 3U4ZA 1K8AC 1XNQQ 1DM0B 2C9OA 3M4YA 1AE3A 1NR4A 1J5EQ 4P75A 3MC0B 2UXCQ 1EY6A 2F0EA 3T1HL 4JOIA 1N8RC 2E5LQ 3V2TA 3F2BA 3NWTA 1AEXA 2KCNA 4QMGA 3SHLA 2F52A 2EJFC 4GNXC 3O13A 4B3ML 3E5SA 5JEAG 4FF3A 2D0PA 5C44G 3ITPA 1AH9A 1A8VA 4LF7Q 3GTJB 2O2LD 1JR0D 2K5HA 1Y1VG 1EU3A 2E2DC 2RF4A 4TVAB 4QUFA 4DGZA 5J1ZA 3UE1A 1HA5A 1FL0A 3VR2A 1X3FA 4GKJQ 1CKNA 2A8VA 2XIWA 1VQBA 2XTIA 1J5EL 4RKLA 3PF4A 2UXCL 3H3VI 4HMIA 1FYCA 4O1NA 1FNVA 2E5LL 5KRUA 1E2VA 3K81C 5FJ8H 3Q8DA 3K7AB 4A3CH 2YU9B 2QEJC 4PZ8A 4FDBA 4UAIA 3U4VA 5A35A 2ES2A 3TBIB 1SRUA 2ENBA 3NE5B 1SDFA 2G9DA 1UEAB 2HD3A 3K7AH 4EQPA 4E6IA 4LF7L 3S1QH 3ND9A 5IP9G 2YU9H 1NTGA 5ELDA 1ZXTA 4A3LH 3TS2A 3OIQA 1CUKA 1TS5A 1X3PA 1CK1A 2HCCA 1E1TA 1HTPA 4GKJL 2VUMB 2LKVA 2PYKA 2A69C 1J8IA 1XPOA 1L1OB 2R93B 1A2UA 2OF1A 3UDGA 5C0XG 4CKBA 2JA6G 5C4XG 2LFNA 1EYDA 3NHHA 4LFAQ 3Q22A 2VUMH 1VS0A 1A62A 3PO3G 3X3MA 2R93H 3QIAA 2N3SA 4IPDA 3CU7A 4B3SL 4J6HA 1GUTA 3DWQA 3ULPA 4ME3A 1N36L 2NVQH 1XWEA 2F0PA 1O80A 2K05A 4WJ4A 5M3FB 4BXXH 1EY0A 4YHHQ 5JEAJ 3TZUA 3UDIA 1IYJB 5I2XA 3NXWA 3S1RB 2AMCB 2QA4A 1H9RA 2RCFA 2KJXA 3E9IA 4B9XA 2DNEA 2F4IA 2L55A 3KUPA 3PIPA 1Q8KA 1E1OA 5C4HA 1IBMQ 2WINB 3TDQA 5EPJA 3J80c 1Q3LA 1VQIA 1LM0A 1T5EA 1I4HA 3I4NB 4LFAL 3GO5A 1HNXQ 1WCMG 5DM63 1SNDA 1TWHB 1WTOA 4C3JB 2NZHA 2KHIA 2EYHA 2MUYA 2A68D 2E75C 1A3TA 4RHSA 3MEFA 3I4NH 1KLGD 3OOCA 5J39A 4IUUA 4YIJA 1TWHH 1TS4A 3GTGH 2L4NA 4C3JH 4KKTA 1M90C 3ICEA 1AN8A 3CCUA 2E74C 3UE0A 4CBVA 3FPPA 1VQKA 4L5RC 3PUXA 3I91A 1ZKOA 3HKZG 4JPBW 3CCQA 4ZQ3A 1DONA 3OW7A 1A0IA 2XRSD 3UDFA 4HJ9A 4IQZA 4KK7A 5HY6A 3OMGA 2L12A 3I72A 1WTWA 1F2ZA 5ELNA 1GUOA 1CI3M 1KRSA 5C0XJ 4LF6L 5M3MG 1X3GA 3K0YA 2K5VA 1E22A 5DLQE 4KJOA 1EIHA 1WJJA 1YJWA 2H4OA 3NBHA 2BE5D 2EE1A 3GV3A 2CFMA 2I07B 1QVCA 3OTOQ 3MFGA 2B8FA 1A15A 5FO7B 2MNAA 1QUQA 3P7JA 2Z8LA 2FINB 4AYBB 4OONA 4ILWA 4DV1Q 2F1MA 2Z4HA 5IT9L 1JCKB 1PMRA 1RHPA 3BYTB 4GLAC 3DWPA 4JV5Q 2B2YA 2WAQE 3BS1A 2EY1A 1HFGA 2EIFA 1CHQD 1WD1A 1EY7A 2CKZB 2Z0SA 1IKMA 2RCNA 1V1QA 4GN5A 2RSNA 5EAYA 3CCSA 5LMNL 1TY0A 2F0NA 1VF5C 5C3WA 2OCEA 5M5XB 3K6OA 1MI2A 2DJFC 1EY9A 4IOCA 3M3YH 2X6GA 2ZXPA 4H7BA 1IYUA 1UE1A 1U4RA 4IJLA 4M8AA 2F0FA 4DV1L 4LFBQ 1W2BA 1V1PB 1BO0A 2B2VC 1N34L 4FXDA 5I9PA 4JV5L 1ICWA 1I4XA 2ATWA 5IYCH 2F0KA 1SNMA 3TS0A 4Q5VA 4A3BG 1LTTD 3D6CA 1I6VC 2JA7B 1QCBD 2N8NA 1JOKA 1SLJA 3D4WA 1FNUA 1H9MA 2JA7H 5IYBG 2H5XA 4JYAL 1ASZA 2XSCA 4BBSB 3F2CA 3TP7A 1D1KA 1ET6A 5GROA 2Q2TA 4X66L 4BBSH 4OO1I 3PIOA 2ASBA 1BCPD 2WP8J 1DGSA 1TY2A 2FHTA 4R4OA 4GLXA 1U4PA 1XTCD 4A3GB 3GTPH 1XXGA 5JJKA 4I7ZC 3RUZA 3FMCA 1GUSA 1N33L 3T16A 4ZRZA 4A3GH 1C48A 1FNWA 2EYJA 4A76A 1QNKA 2NYZD 3MXNB 4N8FA 5FK9C 2NB0A 1JOOA 1Y14B 2JSOA 4N9TA 2JXMB 4KD4A 1R9TH 4A3MB 2DY8A 2V1CC 5EPLA 2CW0D 4PMWA 2F0QA 2IX3A 1M1KC 4KMUC 2K14A 2NZ1D 3ERQA 4OIKA 4A3MH 4B08A 3AEVA 4F7XA 2DY7A 3DWAA 1XNRL 2UU9Q 3WWVA 3PF5A 3T51B 3K8AA 3GTOB 2AUKA 4G4KA 4X65Q 2VNUD 3M9BA 2F0MA 5CYUA 1SE2A 1AW7A 1LUZA 4DFAA 5FOBB 4DR5Q 1PRTB 1LT3D 3STBC 3KK7A 1GM5A 3F1ZA 3FHWA 1BVSA 1FJGQ 4C3IG 3HS0C 1JT8A 1GVPA 4DR6Q 2K6AA 2R92G 1MJEA 2KHJA 1E3PA 2Z9HA 3T1YL 1Z9FA 4RGTA 3RLOA 1RJTA 2MO0A 2EYMA 3NENA 1L0XB 4JBKA 1GHKA 4S3SA 1QZHA 2F0DA 1PH9A 2UU9L 4BY7B 4A93H 3BDOA 4DU9A 5G3LD 2PQEA 4XYQA 3HOZB 1NUCA 1EWIA 3RLNA 1V8QA 1MGSA 1RTOA 3KF8B 4BY7H 1R4PB 3FKIB 3OIPA 4X6AH 1TWGB 1LTAD 1BKBA 1MJCA 4H13C 4IUVA 1LTSD 2KBNA 4PZ7A 1IXRA 1JWMD 4JVZA 3S14B 3FKIH 2I46A 2LMCB 4XYOA 2I0QA 4EVOA 3MZ5A 4DR7Q 4DN4M 2M00A 4ZKBB 2PNHA 3BG3A 3ZJYC 2NZOA 1YNXA 4AIMA 4RWSC 3PGZA 1GKHA 2CHBD 4GLVB 4RHRA 2UXBL 1D1IA 1VQ4A 1EYGA 2VB3X 1GO3E 3TN2A 3M7NA 2OTJA 5KEEA 3EFXD 3L7ZC 3K5NA 4AYBE 4L5QA 4IFDJ 5CBEE 1VQ6A 2D9UA 3I4MB 4DV0Q 3A7AB 4B3RQ 1BF4A 3FPUB 1B9NA 3I4MH 2AQ1B 1JWSD 2NVYB 1B8AA 1EY4A 1HUMA 2BDOA 3OHXC 1UAPA 1HHVA 3QWNA 4KN4C 1HNWQ 1RTNA 1O7LA 4CDFC 4QJFA 2NTSA 1RF2D 1P8LA 2KECA 3HOZG 1EQVA 3SEBA 1TU2B 5IGBA 3C3LA 3SK5A 3K5LA 4DAYA 2JA5B 5D3DA 1IKLA 4JI0Q 4NMZA 1MIUA 1X65A 4DR1L 1CHPD 2J0TD 1HH2P 4IJHA 3MXGA 1K28A 2EY5A 1Z6HA 5IGCA 1GUWA 2HDMA 2BOSA 2XGTA 5J3BA 2JA5H 1SNOA 3SE0A 3JAML 3J81L 4O42A 3G7LA 1F2YA 1F2MA 4BS9A 2O5JC 5IWAQ 5EKLA 5CMDA 3I55A 1XMOQ 4KY7A 5LL6X 2QDLA 2D5DA 4QQBX 4AQYL 1BOSA 1N32L 4LNQA 2B3GA 4YCWA 1F2LA 4JW0A 1ENCA 1TVXA 1TWCB 1EU4A 1EIFA 2SEBD 3R93A 2ZT9C 3OWEB 2Q8RE 1SYBA 3S15H 1TWCH 1II3A 2O4XA 1X54A 3L2PA 1STHA 4HAEA 4DV3Q 2AQ2B 4JI7L 3L3OC 4GN3B 1EYAA 1I4PA 3A56A 4XQJA 4K0KL 1RL2A 1SE4A 5IWAL 5KNDA 1XMOL 5IOCA 4DV4Q 5FLMH 3NELA 4RGMA 3OW2A 2DUDA 2M9VA 2WFWA 3CC2A 1QJOA 2CQAA 3KLSX 4C56C 4DUYQ 1VQ9A 1Q7YC 1AP0A 4DV5Q 1SYGA 4LF8Q 3KFUA 1CZWA 3A54A 1JMCA 4A3IH 2OTLA 4K6LA 2MGSA 4EX5A 1G6ZA 2MP1A 1STNA 4NXML 2A68C 1JE4A 1WTHA 3QOLA 1FGUA 1QWYA 1SJED 4IALA 1STAA 4RAUC 4A3JG 2EY2A 5GADC 4K5WA 4TSSA 1G291 3T1HQ 1YJ9A 3FRPB 4GOPC 2KEDA 1A3VA 4DV4L 4C1NK 5ELFA 1SBBB 2WAQB 5ELBA 3VR3A 2B2TC 1KAAA 1T5XD 4B3MQ 4PMBA 3HGBA 1EWCA 3T53B 3HOYG 2A6EC 2VB2X 4DUYL 5KIXA 4DV5L 1LT6D 2PQAA 1FVIA 3CRKC 2NUCA 2FMCA 5C3EB 3G6EA 3I4OA 3PSIA 2ZXOA 2L0CA 4JOIC 5ISRA 3CCRA 1HUNA 1E0BA 5C3EH 2UUBQ 2VL6A 4RCNA 1I4GA 1HZ9A 1X3EA 2BE5C 3FP9A 1B7YB 1TS2A 4DK6C 4DKAC 4HMJA 1X3QA 1NNXA 1E2ZA 2BDNA 4KY6A 3RR5A 3I7FA 4C3HG 4BY1H 2E8GA 3C2PA 4CDEC 3U9SA 3CXCA 3V96A 1ESFA 1Q86C 3PUYA 1RD9D 4RG1A 1VQOA 1I94Q 4JI8L 2LXJA 1LTID 4H44C 4NW2A 1BXTA 3D4DA 4DK1A 1KQSA 1ILQA 4GNXB 1HCZA 3Q23A 1PH1A 3BZCA 5NUCA 1KRTA 5IE8A 2UUBL 1GUNA 1TXYA 2KA7A 5CV7A 4ODGA 1CKMA 1VQJA 2J4XA 4HIKA 2PZUA 1EEID 3S1QB 3TQYA 4B3SQ 2K5DA 1N36Q 3I4LA 5DM73 1ML0D 1OXXK 3J7AF 2BH2A 2WACA 2K4KA 3OWFA 3S1NB 1VQDA 2UUAL 5CBAE 2ALYB 2RVLA 1I94L 4HCEA 4CDCC 3F2UA 2PNRC 1YHAA 3B6YA 4WFN3 1PFMA 3AFPA 3BJUA 4NPSA 1HPCA 3S1NH 1EY5A 1DXMA 1M4VA 3R2IA 5HURA 3HEJA 2A5HA 2JN4A 2K04A 3S16B 4OX9L 3RNUA 1X9NA 2WV6D 2DJGC 3RMHA 4L5SA 2NVQB 1DZ1A 1D5XC 1Q81C 2Y0SE 2FJ2A 3S16H 3PCOB 2EOTA 3HOVH 5AFWA 4LF5L 5A2QE 1F9PA 4JI1Q 1K8MA 1UEBA 1L1OA 4P74A 3NSWA 4HJ7A 4P73A 1PYWD 5IYDH 3W5OA 2B39A 1NCVA 4IZ8A 3D8GA 3OPOA 3R3OA 3CHBD 5IODA 2OT2A 4LW1A 2NN6H 4BA1I 4F8MA 3CCLA 5ELCA 2BCOA 5EKIA 3Q6SA 2L9HA 3H0GB 3UI2A 3VYTA 1KXLA 1CZGA 1MKHA 1NR2A 1D5ZC 2RA4A 4QL5A 1BCPC 1Y1WB 2VQFL 1IHZA 4DXGA 1F9QA 5FJ8G 3H0GH 4A3CG 2PW5A 4QIWE 1CFMA 4WRDA 2ZTEA 2JE6I 2KQ3A 4F87A 1Y1WH 4NP5A 3TZDA 3GTGB 2L1BA 4DUZQ 3Q0AA 2QW7A 4LF6Q 4X3SA 3NBIA 5C6AA 4JI1L 5KYLA 4A3LG 2K1BA 3BVMA 3I70A 4HR7B 3CMEA 3GQBA 3T13A 1UE6A 2R7ZB 1AFPA 4R4QA 3EQLC 2K75A 4ZLTF 2F4VL 1K3RA 5IT9c 5DEHA 3J81i 3JAMi 2I5LX 3DLLA 2R7ZH 2CW0C 5CC4A 1HFNA 3X3NA 3HFZB 2VUMG 4N9PA 1IW7D 3NWSA 1EOVA 1HR0Q 4YCUA 3VR6A 2R93G 5T1IA 3AMUA 2A6ED 4FP5D 1B3QA 2KCCA 3C1FA 1YI2A 1XJVA 1JJ2A 5K36H 1EEFD 5TSSA 4K5XA 1K8GA 4ALPA 4BXXG 1JQYD 4XQQA 4DUZL 2NN6I 3JAME 1UWVA 1QILA 1MD2D 3EA6A 5M3FG 3TP5A 4X3TA 1LTRD 4OL7A 4V0BA 2AWOA 5LMNQ 2OWOA 1KDBA 4MN3A 5BR8L 1PH6A 1Y69U 3TREA 4CJ1B 1RDPD 3KF6B 3GDEA 5C4JH 3BZKA 1HR0L 2BA1A 2B2YC 4C1NI 3J80L 1X55A 3EVQA 4R8NA 4RFBA 5CV9A 3I4NG 4UHVA 2PZWA 1N34Q 1DOKA 4X62L 1OTCA 4C3JG 1UE7A 2XRQD 4FXGC 4IUPA 1SSOA 4R1JA 1BDOA 4JBWA 5GAGC 4JG2A 1ILPA 2N78A 3E6ZX 1Y8OB 2PZTA 4IPHA 5H1SE 3M3YB 1ENAA 1K83B 2A1AA 1OXSC 1OO9B 2GVBA 4IN3A 1S5DD 3OMCA 1PHJA 4H0LC 5L37A 1V43A 2JA9A 4JC0A 4ZYSA 1K83H 3W2DA 4JYAQ 3WOEA 4JI6L 1LYLA 5JOBA 2ZJQA 3MAQA 3HG9A 5C5MA 5GQOA 2F0TA 2EDGA 1YNND 2K32A 1I3QH 1CSPA 3KJOA 4AH6A 2MJ8A 1Q46A 4X66Q 1MHWC 1CA5A 1RIPA
chains in the Genus database with same CATH topology
2RKSA 4FNFA 1V1PA 4BBRB 1KDAA 3ZYYX 4HEDA 1DOLA 1MBYA 2Q8TA 2G9HD 1I4RA 2IL8A 4G7OC 4EQNA 1F9SA 1UUPA 5JVH3 5E4XA 5KNCA 1B9MA 4ID6A 4UDUC 1GJXA 1TKWB 3GTPB 4OO1G 1L0YB 4A3FB 4KI0A 5CV4A 1FD7D 4IFDH 2QF7A 1EWHA 1OXUA 3H6MA 1EZ8A 3DEPA 4A3DB 2XWBB 2HDLA 3T4AC 5IGFA 1R9TB 4OHJA 1WTVA 1GXDC 4DNRB 4M1UB 4BWGB 4RCOA 3E0JA 1G91A 2JYOA 2F0LA 3MXNA 2J7ZA 2QKIC 1ESRA 1OXVA 5KYIA 3AB9A 1LLRD 1CQVA 1KDCA 1ONLA 1WD0A 4K8IA 4G7HC 2JA8B 3I73A 3MWYW 1ET9A 4X3KA 1BCPF 3A7LA 1PFBA 3BZDB 3VYRA 3FEWX 2L11A 1JC7A 5EJWA 3KLRA 4EGVA 2AUJD 5IGDA 3RLFA 1GUGA 4XDXA 1I50B 1SXTA 2B63B 4ABNA 4KKUA 2XWJB 3V05A 5J22A 3LWEA 1S5BD 3C46A 2RDHA 4A93B 3BVZA 4XXEA 1WVLA 3DHQA 3M85A 4DK0A 2D2CC 2KOLA 3MEHA 2F3WA 3VA7A 4K14A 1SAPA 2F03A 4HSPA 4XIGS 3K5OA 4KD3A 1PTOC 3IAYA 3HOXB 3DMUA 4HCSA 4XQNA 3GTLB 3KF8A 2XN9C 1EQTA 1AZPA 2FFKB 3C1EA 4L63B 1ZYRD 1SNQA 2IJ0A 1QNUA 4IUQA 1Q1BA 2OXPA 1QB5D 5JPNC 2SNMA 4K2LA 3GV6A 5IGGA 1B1ZA 2DNCA 5E3FA 1SYFA 3HOWB 1PZID 3IFTA 5G3LF 3KBGA 3K58A 1U4LA 4XT3B 3PMFA 4PQXA 1RKNA 2NTTA 2SNSA 4DF7A 2X6LA 3QOJA 4FF2A 4OIJA 3I90A 2Y0SB 1VDZA 5FO8B 1JOQA 3QG1A 3TSSA 3MFYA 3LNNA 1G2SA 3D3RA 5CORA 4K8JA 4IURA 4WJWA 4ZUIA 3T56B 1MSGA 4HTHA 1SYCA 2EJGC 2V4DA 1CQFA 2JP1A 1KABA 1BR9A 4QIWB 3SDZA 3J7AV 1XYIA 5IT9E 2E2JB 2B2UA 2IPKD 3S15B 5CV8A 4R9WA 4ZAIA 1CM9A 3A8IE 4TQUS 2K5WA 2Z4IA 2FMMA 5CR3A 5JAVA 2KEEA 1JWUD 2KVMA 2KHSA 3SR1A 3CQZB 3S17B 2ID0A 1GOZA 3K59A 2B2WA 1DYQA 5JVG3 3SXHA 4A3IB 1SE3A 3RZDB 1PRTD 1PDQA 4DAPA 4ZUJA 3HZXA 4QCLA 3ND8A 2EYPA 4EQOA 2MPMA 1EOTA 1WTXA 3MHBA 5C3XA 1WTRA 1LT5D 5C44B 2EYOA 5D65A 3H3VC 5E1FA 1TWAB 1Y1VB 5JEAH 4U673 2O5IC 2NWGA 1IW7C 4K5VA 4CHTB 3K5MA 1SNPA 1PTOD 1H9SB 1B44D 5M5YB 3H09A 4G57A 1LT4D 4ZK9B 4K2KA 3IKJA 1E2WA 2F0VA 3I8ZA 2HUGA 3WOFA 3A55A 4K6DA 3A8KE 3VYUA 3GP7A 4BY1B 5E4WC 2A6HD 1HA6A 3QB3A 4HSVA 2HCIA 3NP8A 4J8QA 1KLUD 3KLSA 3D4RA 1KNEA 1JB3A 5EQ0A 4CGYB 2RDGA 2WB1B 3TP8A 3D31A 4JK1C 2JA6B 5C4XB 1EYCA 1SMYC 3PO3B 2QDBA 3FDTA 1PTOF 2MHVA 4L6TB 1HTLD 5C0XH 1IL8A 1SNCA 4PNYA 1YNJD 1J9OA 1EFID 2IX0A 2K5QA 3PIO3 4X3UA 2KUMA 1F77A 3H91A 5FLXL 4I65A 1S5ED 5F2DA 4PMCA 3N52A 1YNNC 2TMPA 5D3IB 5FO9B 4NKLA 2SDFA 1WCMB 1X32A 3NTIA 4KTAA 1TIID 2E2IB 1A6XA 5EKKA 3HOVB 3P75A 2GA4B 4IUNA 2A73B 2Q8IB 1M8AA 4MHEA 2NVXB 1GHJA 3QO2A 4FVMA 3HKZB 1D5MC 5LHY1 1NAPA 5BN5A 3MVVA 5C0XI 1S5CD 2K03A 5ELEA 4ULLA 1I4QA 2LY7A 4CJ0B 5M3MB 1A2TA 2B8GA 3WDNA 2RQXA 3S1MB 5HGTA 4FXKC 1BCPB 3HP3A 4QF4A 5LL6S 2PCFB 4WORA 2F0WA 2LS01 2EVBA 1Y8NB 4DAVA 4Q0FA 2K33A 1BBXC 3IFDA 4CKCA 2AQ3B 3NK9A 3SK8A 2R6GA 2F0UA 1FGBD 5I2YA 5DAUA 2NN6G 3J81E 1JICA 3FVQA 1HXYD 4KY5A 3LX0A 3N6RA 1LO5D 2K7VA 5DNFA 3GTMB 1STEA 2WKCA 1U4MA 5C4JB 1SJHD 2AWNA 4GZYC 2F0HA 2K01A 3SK4A 1V1OA 4A3BB 3KBXA 3MXPA 1DOMA 2EZVA 1Q8IA 2Z1CA 1EZ6A 4NDXA 1SMYD 1R4QB 1S5FD 3R2TA 3VYSA 3PUWA 1D2BA 4XTCS 5D14A 3NTHA 3NPPA 3MA2B 5I9OA 1STGA 1Z47A 1BQQT 4FYDA 1ZEQX 5K36G 3L9AX 1ZYRC 1K8OA 1I3QB 1G8ZD 3Q24A 2F0OA 2F0GA 1DCZA 3GD7A 3GTKB 2IW3A 1VF7A 2R3ZA 1QOHA 1RODA 1MSHA 4OO1H 2EJMA 4RGNA 2H1EA 5I6YA 1STBA 2ZXRA 1PXUA 4ME5A 4LJZC 1U9RA 3P20A 5COYA 2B2VA 2WKDA 4L8JA 2A69D 5IGEA 4F88A 4Z9CB 1XX8A 4KJNA 5EBDA 2XVSA 1LACA 3VA5A 3PUVA 2ICIA 5C4ZA 3J7YW 4C3IB 1PFNA 3LWUA 4FF4A 5JPMC 2R92B 3IL8A 5T1GA 3VR4A 1PLFA 1I6HB 2NVTB 4DA2A 4ZKCB 3I3CA 1LV9A 2F0SA 4PV1C 2EXZA 4DXFA 4HN7A 1KNAA 1ENFA 2DN8A 4TRDA 3CRLC 2EYFA 1EL0A 3NTKA 2PMZB 1UNSA 1JORA 1OXTA 1Q90A 1WTPA 5FLXE 1O7ZA 4Y7NB 2RBMA 1W6KA 1TWFB 4A3EB 3D6WA 1Q12A 1DJRD 2QCPX 5BN3A 5CV6A 3ONAB 1PRTC 1Z7TA 1EIGA 4CJ2C 3P1HA 2K28A 1AZQA 3BDLA 2M2LA 1SEBD 1TQOA 4IFDI 4IFDG 4RKBA 2N88A 3A8JE 1HRJA 4IUTA 1KTKA 3M7GA 3HOUB 2SOBA 1SYDA 1EY8A 4P2CB 4LAAA 5CV5A 5K5PA 2PO4A 3EROA 5M5WB 1B50A 2CVRA 4QB4A 3NQTA 1C8CA 2RSOA 5EBCA 3S9WA 1RCVD 4CKEA 4RH6A 1D6EC 3EJIA 2NBFA 2PPBC 1Q1EA 1B4OA 4MIUA 1HQRD 2E76C 1WTQA 4B9WA 1TR5A 3URYA 1S4ZA 3AU7A 1DD2A 2EYLA 2BA0A 2EY6A 1PTOB 2ICEC 3NQIA 1FR3A 3SK6A 4U68A 3TP6A 5EPKA 3DUZA 3RZOB 2QILA 5A2QL 3S2DB 1PTOH 2A6HC 3BVGA 1IYVA 4G7ZC 1VCIA 1CT1D 4V190 3DXJC 3VR5A 3PV0A 2YYZA 2IX1A 5C5LA 4RA8A 1O78A 2A74C 1A3UA 1B3AA 4TKOB 4BA2I 3PO2B 4LMQD 2OEOA 1YNJC 2HQEA 4LK1C 3G6JB 5I6WA 1G2TA 1B53A 3PIP3 2IT1A 4A3KB 5JJZA 3HRZC 2N55A 1NSNS 2RDFA 4FF1A 2B2UC 2TSSA 3J80E 2JEBI 4OGQC 2D62A 1H9KA 4DNTB 2F0IA 1F9RA 4FO2A 1VMCA 4KHVA 2F3VA 3PUZA 1BNZA 1Y8PB 4A3JB 1LTBD 4KV6A 1LTGD 5KNBA 1HQMC 3DM1A 1CTMA 1B2TA 2B2WC 3MTSA 4KHZA 3HOYB 1STYA 1SYEA 3W3AA 1BUVT 3U9OA 4R8IA 3TMEA 1TS3A 3BYYB 1SFOB 1PZKD 1LABA 1O7YA 2F0JA 2PW7A 2WIIB 5FKAC 1QE6A 5CGKA 3K57A 3GTQB 3RD4A 3R8BA 5KGUA 1C4QA 3QJYA 2C5CA 4RGOS 5BN4A 2R61A 4C3HB 4C2MB 1W6JA 4QUCA 4KN7C 3M4OB 3DEOA 3NUCA 1PZJD 2XNAC 1TT2A 2E2HB 3BDCA 2JEAI 2X69A 3CKIB 5I4DA 5M9OA 1PRTF 3H94A 1H9SA 1CA6A 5IIFA 2L5TA 2EPBA 3OSOA 5EGTA 3SVMA 3MXUA 3S2HB 1QG7A 2B2TA 4XT1B 1VMPA 4KKSA 1H9JA 4J1MA 2VXWA 2IWHA 1DM0B 2C9OA 3M4YA 1NR4A 3MC0B 1EY6A 2F0EA 3V2TA 3NWTA 1AEXA 2KCNA 4QMGA 3SHLA 2EJFC 3O13A 3E5SA 5JEAG 4FF3A 3ITPA 3GTJB 2O2LD 1JR0D 1EU3A 2E2DC 4QUFA 4DGZA 5J1ZA 1HA5A 3VR2A 2XIWA 4RKLA 4HMIA 1FYCA 4O1NA 1FNVA 5KRUA 1E2VA 3K7AB 2YU9B 2QEJC 4UAIA 5A35A 3TBIB 2ENBA 1SDFA 3NE5B 2G9DA 1UEAB 4EQPA 4E6IA 3ND9A 5ELDA 1ZXTA 3OIQA 1TS5A 1X3PA 1CK1A 2HCCA 1HTPA 2VUMB 2LKVA 2PYKA 2A69C 1J8IA 2R93B 1A2UA 2OF1A 5C0XG 4CKBA 2LFNA 1EYDA 3NHHA 3Q22A 3X3MA 3QIAA 3CU7A 4J6HA 1GUTA 3DWQA 1XWEA 2F0PA 1O80A 2K05A 5M3FB 1EY0A 5JEAJ 3TZUA 5I2XA 3NXWA 3S1RB 1H9RA 2KJXA 4B9XA 2DNEA 2F4IA 2L55A 3KUPA 5C4HA 2WINB 3TDQA 5EPJA 1Q3LA 1T5EA 1I4HA 3I4NB 3GO5A 5DM63 1SNDA 1TWHB 1WTOA 4C3JB 2EYHA 2MUYA 2A68D 2E75C 1A3TA 4RHSA 1KLGD 3OOCA 5J39A 4IUUA 4YIJA 1TS4A 2L4NA 4KKTA 1AN8A 2E74C 4CBVA 3FPPA 3PUXA 3I91A 1ZKOA 4ZQ3A 1DONA 3OW7A 2XRSD 4IQZA 4KK7A 3OMGA 2L12A 3I72A 1WTWA 1F2ZA 1GUOA 1CI3M 5C0XJ 3K0YA 4KJOA 1EIHA 2H4OA 3NBHA 2BE5D 2EE1A 3GV3A 2I07B 3MFGA 2B8FA 1A15A 5FO7B 3P7JA 2Z8LA 2FINB 4AYBB 4ILWA 2F1MA 2Z4HA 5IT9L 1JCKB 1PMRA 1RHPA 3BYTB 3DWPA 2B2YA 3BS1A 2EY1A 1HFGA 1CHQD 1WD1A 1EY7A 1IKMA 2RSNA 1TY0A 2F0NA 1VF5C 5C3WA 5M5XB 3K6OA 1MI2A 1EY9A 2X6GA 2ZXPA 4H7BA 1IYUA 1U4RA 4M8AA 2F0FA 1V1PB 1BO0A 2B2VC 4FXDA 5I9PA 1ICWA 1I4XA 2F0KA 1SNMA 4Q5VA 1LTTD 3D6CA 1I6VC 2JA7B 1QCBD 1JOKA 3D4WA 1FNUA 1H9MA 2XSCA 4BBSB 3TP7A 1D1KA 1ET6A 4OO1I 1BCPD 2WP8J 1TY2A 2FHTA 1U4PA 1XTCD 4A3GB 1XXGA 4I7ZC 3RUZA 3FMCA 1GUSA 3T16A 4ZRZA 1C48A 1FNWA 2EYJA 1QNKA 2NYZD 5FK9C 2NB0A 1JOOA 2JSOA 4N9TA 2JXMB 4KD4A 4A3MB 2DY8A 5EPLA 2CW0D 4PMWA 2F0QA 2IX3A 4KMUC 2NZ1D 3ERQA 4OIKA 4B08A 4F7XA 2DY7A 3DWAA 3T51B 3GTOB 2AUKA 4G4KA 2VNUD 2F0MA 5CYUA 4DFAA 5FOBB 1SE2A 1AW7A 1PRTB 1LT3D 3KK7A 4C3IG 3HS0C 2K6AA 4RGTA 1RJTA 2EYMA 1L0XB 1GHKA 4S3SA 2F0DA 4BY7B 3BDOA 4DU9A 5G3LD 2PQEA 4XYQA 3HOZB 1NUCA 1V8QA 1MGSA 1RTOA 1R4PB 3FKIB 3OIPA 1TWGB 1LTAD 4IUVA 1LTSD 1JWMD 3S14B 2I46A 2LMCB 4XYOA 4EVOA 3MZ5A 4DN4M 2M00A 4ZKBB 3BG3A 4RWSC 2CHBD 4RHRA 1D1IA 2VB3X 3M7NA 3TN2A 5KEEA 3EFXD 3L7ZC 3K5NA 4IFDJ 5CBEE 2D9UA 3I4MB 3A7AB 1BF4A 3FPUB 1B9NA 2AQ1B 1JWSD 2NVYB 1EY4A 1HUMA 2BDOA 3OHXC 1UAPA 1HHVA 3QWNA 4KN4C 1RTNA 1O7LA 2NTSA 1RF2D 2KECA 1EQVA 3SEBA 1TU2B 5IGBA 3C3LA 3SK5A 3K5LA 4DAYA 2JA5B 5D3DA 1IKLA 4NMZA 1CHPD 2J0TD 1GUWA 3MXGA 2EY5A 1Z6HA 5IGCA 2HDMA 2BOSA 1SNOA 3SE0A 3JAML 3J81L 4O42A 3G7LA 1F2YA 1F2MA 4BS9A 2O5JC 5EKLA 5CMDA 4KY7A 5LL6X 2D5DA 1BOSA 1F2LA 1ENCA 1TVXA 1TWCB 1EU4A 2SEBD 3R93A 2ZT9C 3OWEB 2Q8RE 1SYBA 1II3A 2O4XA 1STHA 4HAEA 2AQ2B 3L3OC 1EYAA 1I4PA 3A56A 4XQJA 1SE4A 5KNDA 5IOCA 4RGMA 2M9VA 1QJOA 2CQAA 3KLSX 4C56C 1AP0A 1SYGA 1CZWA 3A54A 4K6LA 2MGSA 1G6ZA 2MP1A 1STNA 2A68C 1JE4A 3QOLA 4IALA 1QWYA 1SJED 1STAA 4RAUC 2EY2A 4K5WA 4TSSA 1G291 3FRPB 2KEDA 1A3VA 4C1NK 5ELFA 1SBBB 2WAQB 5ELBA 3VR3A 2B2TC 1KAAA 1T5XD 4PMBA 3HGBA 1EWCA 3T53B 2A6EC 2VB2X 5KIXA 1LT6D 3CRKC 2NUCA 2FMCA 5C3EB 2ZXOA 2L0CA 5ISRA 1HUNA 1E0BA 4RCNA 1I4GA 2BE5C 1TS2A 4HMJA 1X3QA 1E2ZA 2BDNA 4KY6A 4C3HG 3C2PA 3U9SA 3V96A 1ESFA 3PUYA 1RD9D 1LTID 4H44C 4NW2A 1BXTA 3D4DA 4DK1A 1ILQA 1HCZA 3Q23A 5NUCA 1GUNA 2KA7A 5CV7A 4ODGA 2J4XA 2PZUA 1EEID 3S1QB 2K5DA 3I4LA 5DM73 1ML0D 1OXXK 3J7AF 2WACA 3OWFA 3S1NB 5CBAE 2RVLA 4HCEA 3F2UA 2PNRC 4WFN3 1PFMA 1HPCA 1EY5A 1DXMA 1M4VA 3R2IA 5HURA 3HEJA 2A5HA 2K04A 3S16B 2WV6D 2NVQB 3RMHA 1DZ1A 1D5XC 2FJ2A 2EOTA 5AFWA 5A2QE 1F9PA 1K8MA 3NSWA 1PYWD 2B39A 1NCVA 4IZ8A 3D8GA 3OPOA 3R3OA 3CHBD 5IODA 2OT2A 2NN6H 4BA1I 4F8MA 5ELCA 2BCOA 5EKIA 3Q6SA 2L9HA 3H0GB 3UI2A 3VYTA 1CZGA 1NR2A 1D5ZC 2RA4A 1BCPC 1Y1WB 1IHZA 4DXGA 1F9QA 2PW5A 1CFMA 4WRDA 2JE6I 2KQ3A 4F87A 4NP5A 3TZDA 3GTGB 2L1BA 3Q0AA 4X3SA 3NBIA 5C6AA 5KYLA 2K1BA 3BVMA 3I70A 4HR7B 3GQBA 3T13A 2R7ZB 1AFPA 3EQLC 4ZLTF 5DEHA 2CW0C 5CC4A 1HFNA 3X3NA 4N9PA 1IW7D 3NWSA 3VR6A 5T1IA 3AMUA 2A6ED 4FP5D 2KCCA 3C1FA 5K36H 1EEFD 5TSSA 4K5XA 1JQYD 4XQQA 2NN6I 3JAME 1QILA 1MD2D 3EA6A 3TP5A 4X3TA 1LTRD 4OL7A 4V0BA 2AWOA 1KDBA 4MN3A 1Y69U 4CJ1B 1RDPD 2BA1A 2B2YC 4C1NI 3J80L 3EVQA 4R8NA 4RFBA 5CV9A 2PZWA 1DOKA 4C3JG 2XRQD 4FXGC 4IUPA 1SSOA 1BDOA 4JBWA 1ILPA 3E6ZX 1Y8OB 2PZTA 3M3YB 1ENAA 1K83B 4IN3A 1OXSC 1OO9B 1S5DD 3OMCA 4H0LC 1V43A 4ZYSA 3W2DA 3WOEA 5JOBA 3MAQA 3HG9A 5C5MA 2F0TA 2EDGA 1YNND 2K32A 2MJ8A 1CA5A 4H13C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWE A;  2JP1 A;  1SDF A;  3I8Z A;  4QUC A;  2HUG A;  4HAE A;  1ILQ A;  4ZLT F;  4CJ0 B;  1WTP A;  1XYI A;  1ZXT A;  1EIH A;  4LMQ D;  3DEO A;  2B2U A;  1WVL A;  1O7Z A;  1HFN A;  4HED A;  1DOL A;  2FHT A;  5E4W C;  4DN4 M;  4ZKB B;  1X3P A;  2EE1 A;  3GV3 A;  1HA6 A;  2HCC A;  1U4P A;  2Q8T A;  4R9W A;  2KOL A;  1CM9 A;  4HSV A;  4ZAI A;  5T1I A;  2HCI A;  2R3Z A;  3D6W A;  1J8I A;  4RWS C;  1G2T A;  2X69 A;  1B53 A;  3HP3 A;  2IL8 A;  1A15 A;  3ONA B;  1KNE A;  1ROD A;  1MSH A;  5JJZ A;  3P7J A;  1EIG A;  2FIN B;  3TN2 A;  4CJ2 C;  2FMM A;  2K28 A;  2N55 A;  1SAP A;  2M2L A;  1AZQ A;  1AP0 A;  2KEE A;  1F9S A;  5EQ0 A;  1ML0 D;  2H1E A;  1QNK A;  2B2U C;  5E4X A;  1RHP A;  2KVM A;  2N88 A;  2NYZ D;  1BBX C;  5CBE E;  1CA6 A;  2EPB A;  4IUT A;  1HRJ A;  2B2Y A;  3SVM A;  2D9U A;  5CBA E;  2RVL A;  2MGS A;  4HCS A;  1HFG A;  1G6Z A;  2MP1 A;  3FDT A;  1QG7 A;  3F2U A;  2B2T A;  4X3T A;  4XT1 B;  1O80 A;  2K05 A;  1WD1 A;  1JE4 A;  1EQT A;  1AZP A;  1VMP A;  1IL8 A;  1PFM A;  2DY8 A;  2FFK B;  3IFD A;  1F9R A;  4RAU C;  5EPL A;  2B2W A;  1BF4 A;  1VMC A;  4MN3 A;  3FPU B;  1BNZ A;  5COY A;  1IKM A;  1J9O A;  2NZ1 D;  2VXW A;  4CJ1 B;  1HUM A;  2B2V A;  2K04 A;  2RSN A;  3DEP A;  4IUQ A;  4OIK A;  2KED A;  1NR4 A;  1B50 A;  1MI2 A;  2B2Y C;  2CVR A;  2DY7 A;  3KUP A;  1HHV A;  3GV6 A;  4X3U A;  1C8C A;  1RTN A;  1PDQ A;  2HDL A;  2KUM A;  2RSO A;  2X6G A;  3H91 A;  1JIC A;  2B2T C;  1DZ1 A;  3DM1 A;  5EPJ A;  2MPM A;  2FJ2 A;  1EOT A;  1Q3L A;  2EOT A;  1WTX A;  5AFW A;  1DOK A;  1F9P A;  1WTV A;  1U4R A;  2KEC A;  2B2W C;  1B2T A;  1XX8 A;  3MTS A;  3N52 A;  1B4O A;  5DNF A;  1WTQ A;  1NCV A;  1U4L A;  4IUP A;  1SSO A;  1S4Z A;  1WTO A;  1BO0 A;  4XT3 B;  2B2V C;  1U4M A;  1IKL A;  1ICW A;  2SDF A;  1ILP A;  1WTR A;  1G91 A;  2JYO A;  1X32 A;  4R8I A;  5EKI A;  2X6L A;  2J7Z A;  2L9H A;  3Q6S A;  3UI2 A;  1GUW A;  1ESR A;  4IUU A;  2HDM A;  2L4N A;  1HUN A;  1E0B A;  1NR2 A;  4OIJ A;  4U68 A;  1PFN A;  2RA4 A;  4O42 A;  3G7L A;  3I90 A;  5D65 A;  5EPK A;  4QUF A;  1RJT A;  3IL8 A;  5CMD A;  1WD0 A;  2K01 A;  1O7Y A;  1F9Q A;  3MWY W;  5T1G A;  2NWG A;  1M8A A;  4X3K A;  3KBX A;  1PFB A;  2XIW A;  3I91 A;  1X3Q A;  1DOM A;  1PLF A;  1QE6 A;  2L11 A;  1F2L A;  4MHE A;  5EJW A;  1TVX A;  3QO2 A;  3TZD A;  1DON A;  2BDN A;  1G2S A;  2L1B A;  3I3C A;  1LV9 A;  4ZKC B;  1MGS A;  5COR A;  4XDX A;  4IUR A;  1KNA A;  4X3S A;  1NAP A;  4NW2 A;  3R93 A;  1MSG A;  5D14 A;  2K1B A;  1RTO A;  2L12 A;  2Q8R E;  4RA8 A;  4ZK9 B;  1WTW A;  2MJ8 A;  1EL0 A;  4UAI A;  2K03 A;  1CA5 A;  4IUV A;  1B3A A; 
#chains in the Genus database with same CATH topology
 2Z6K C;  2RKS A;  1SN8 A;  4FNF A;  1V1P A;  2WB1 E;  3EN2 A;  4BBR B;  1KDA A;  3ZYY X;  2Z6K A;  4HED A;  1DOL A;  1MBY A;  1S40 A;  2Q8T A;  4BBR H;  1N33 Q;  1HZC A;  2G9H D;  1I4R A;  4AYB G;  4IO9 A;  2IL8 A;  4G7O C;  4EQN A;  1F9S A;  1PH5 A;  1UUP A;  1SRO A;  1VQ5 A;  5JVH 3;  5E4X A;  5KNC A;  1B9M A;  2KEN A;  4ID6 A;  4UDU C;  3A0J A;  1PVO A;  1GJX A;  1TKW B;  3EIV A;  3GTP B;  3J81 j;  2VW9 A;  4OO1 G;  1L0Y B;  4OWT B;  4A3F B;  4KI0 A;  5CV4 A;  1FD7 D;  4IFD H;  2QF7 A;  1XNR Q;  1EWH A;  3TEH B;  1OXU A;  3H6M A;  4A3F H;  1EZ8 A;  3DEP A;  1C9O A;  2HIV A;  4OEL B;  1YHB A;  4A3D B;  2XWB B;  2HDL A;  3T4A C;  5IGF A;  4NXN L;  1R9T B;  5IYC G;  4OHJ A;  1WTV A;  1O7I A;  4A3D H;  1NMG A;  5LMU L;  1GXD C;  1WFQ A;  4DNR B;  4M1U B;  4BWG B;  4RCO A;  3T1Y Q;  3E0J A;  4YY3 L;  1G91 A;  2JYO A;  2F0L A;  4HIO A;  3CC4 A;  3MXN A;  2NVT H;  2AHO B;  2I5H A;  2QKI C;  2J7Z A;  4LWC A;  4LUZ A;  1ESR A;  1OXV A;  3H15 A;  1QVG A;  5KYI A;  3AB9 A;  1LTL A;  2JA7 G;  1LLR D;  1C0A A;  2PI2 E;  1EFW A;  1CQV A;  1KDC A;  1ONL A;  1WD0 A;  4K8I A;  4G7H C;  2JA8 B;  3I73 A;  3MWY W;  1ET9 A;  4X3K A;  1BCP F;  3A7L A;  1PFB A;  3BZD B;  3RN5 A;  3VYR A;  3FEW X;  2L11 A;  1JC7 A;  5EJW A;  2JA8 H;  3KLR A;  1SR3 A;  4EGV A;  2AUJ D;  5IGD A;  3RLF A;  1GUG A;  1S72 A;  1IL2 A;  4XDX A;  4BBS G;  1I50 B;  4H02 A;  1SXT A;  2B63 B;  5IP7 H;  4ABN A;  4OXP A;  4KKU A;  2XWJ B;  3V05 A;  4A3E H;  5J22 A;  3LWE A;  1S5B D;  1I50 H;  3C46 A;  2RDH A;  2B63 H;  4A93 B;  3BVZ A;  4JI2 L;  1EQQ A;  4XXE A;  1WVL A;  2UXB Q;  4QGU A;  3DHQ A;  3M85 A;  4A3G G;  4O0A A;  2K52 A;  4R4C A;  3CMA A;  4DK0 A;  2D2C C;  3HOU H;  2KOL A;  3MEH A;  2F3W A;  3VA7 A;  4JCV E;  4LFC L;  4CDD C;  4K14 A;  1SAP A;  2F03 A;  4LF9 L;  2F3I A;  2YV5 A;  4HSP A;  4XIG S;  3K5O A;  4KD3 A;  1PTO C;  3ULJ A;  4DPG A;  3IAY A;  3HOX B;  3DMU A;  4HCS A;  4XQN A;  4A3M G;  4KLK A;  4P71 A;  2R7F A;  3GTL B;  3KF8 A;  2XN9 C;  1EQT A;  4DV6 Q;  1AZP A;  3RN2 A;  1IBK L;  2FFK B;  4OEM B;  3C1E A;  3HOX H;  4L63 B;  5LMN W;  1ZYR D;  1SNQ A;  2IJ0 A;  4UP7 A;  3GTL H;  4HIM A;  1QNU A;  4IUQ A;  4A75 A;  1Q1B A;  2OXP A;  1QB5 D;  3NEM A;  5JPN C;  2SNM A;  4K2L A;  3GV6 A;  5IGG A;  3JAM c;  1B1Z A;  1WYD A;  3J81 c;  2K5N A;  2DNC A;  5E3F A;  3KLW A;  1SYF A;  3CPF A;  3HOW B;  1PZI D;  4DR2 L;  3IFT A;  4DR1 Q;  5G3L F;  3KBG A;  3K58 A;  1U4L A;  4XT3 B;  3PMF A;  4PQX A;  1RKN A;  2NTT A;  2SNS A;  4DF7 A;  3HOW H;  3LGJ A;  2X6L A;  4DV6 L;  3QOJ A;  4FF2 A;  4AQY Q;  4OIJ A;  1VQF A;  1YHQ A;  3I90 A;  4A93 G;  1N32 Q;  1JB7 A;  2Y0S B;  1VDZ A;  5FO8 B;  1JOQ A;  1ICF B;  3CC7 A;  3QG1 A;  4BY7 G;  3TSS A;  3MFY A;  2GN5 A;  4APV A;  3LNN A;  5E7N A;  1G2S A;  3D3R A;  3PO2 H;  3FKI G;  5COR A;  2CWP A;  4K8J A;  4IUR A;  4WJW A;  4ZUI A;  3T56 B;  1MSG A;  4HTH A;  1SYC A;  1WOC A;  1YEZ A;  2EJG C;  4JI7 Q;  2V4D A;  1CQF A;  2JP1 A;  4K0K Q;  2RHS B;  1KAB A;  4A3K H;  3BU2 A;  4LF4 L;  1BR9 A;  1HZA A;  4QIW B;  3SDZ A;  3J7A V;  1XYI A;  5IT9 E;  2E2J B;  2B2U A;  2IPK D;  3A74 A;  3S15 B;  5CV8 A;  3PQI A;  4R9W A;  4ZAI A;  1CM9 A;  3A8I E;  1J6Q A;  1NY4 A;  2E2J H;  4TQU S;  2K5W A;  1A63 A;  2Z4I A;  2FMM A;  5CR3 A;  5JAV A;  2KEE A;  4NXM Q;  2MQH A;  3KJP A;  1JWU D;  3I4M G;  2KVM A;  2KHS A;  3SR1 A;  3CCV A;  3CQZ B;  3S17 B;  2ID0 A;  1GOZ A;  3K59 A;  2B2W A;  1E7Z A;  1DYQ A;  3CQZ H;  2EXD A;  3S17 H;  4R4T A;  3HOY H;  5JVG 3;  3SXH A;  4A3I B;  1SE3 A;  1G51 A;  3RZD B;  1PRT D;  1PDQ A;  4DAP A;  4ZUJ A;  3HZX A;  4QCL A;  1C7Y A;  3L0O A;  3ND8 A;  1YJN A;  2EYP A;  4EQO A;  2MPM A;  1EOT A;  1I5F A;  1WTX A;  3RZD H;  3G4S A;  2JA5 G;  1IZ6 A;  3MHB A;  1IBL Q;  1EUJ A;  2VZA A;  3F2D A;  5C3X A;  4UY8 C;  1WTR A;  1LT5 D;  2R7D A;  3QR8 A;  3GTQ H;  1P16 A;  5C44 B;  4EQ5 A;  2EYO A;  3OYY A;  2AKW B;  5D65 A;  2A19 A;  3H3V C;  5E1F A;  1TWA B;  1Y1V B;  5JEA H;  4U67 3;  2O5I C;  3CW2 C;  4C3H H;  2NWG A;  1IW7 C;  5C44 H;  4UP9 A;  4K5V A;  3KDF B;  1KHI A;  4C2M H;  4CHT B;  1B70 B;  3K7U C;  3K5M A;  1SNP A;  3ERS X;  4QY7 A;  4OWW B;  1TWA H;  1Y1V H;  1PTO D;  1H9S B;  4GOP B;  4IOA A;  4LUO A;  5GAH C;  1B44 D;  5M5Y B;  4JI8 Q;  4GKK Q;  2Q2H A;  3H09 A;  4G57 A;  1LT4 D;  4ZK9 B;  4WJ3 M;  4K2K A;  2E2H H;  1IBL L;  3IKJ A;  1XMQ L;  5M5Y H;  1E2W A;  2F0V A;  3I8Z A;  2HUG A;  3WOF A;  3A55 A;  5FLM G;  4K6D A;  3A8K E;  4YWM A;  3VYU A;  3GP7 A;  4BY1 B;  5E4W C;  4DK3 C;  4X64 L;  2A6H D;  1HA6 A;  3QB3 A;  4HSV A;  2HCI A;  4A3I G;  3S2H H;  3NP8 A;  4J8Q A;  1KLU D;  2FXQ A;  3KLS A;  3D4R A;  5IP9 H;  3A5U A;  1KNE A;  1JB3 A;  2UUA Q;  1PFS A;  5EQ0 A;  4CGY B;  2RDG A;  4JI5 Q;  4GKK L;  2WB1 B;  3TP8 A;  1BBW A;  3D31 A;  4JK1 C;  2JA6 B;  5C4X B;  1EYC A;  1SMY C;  3PO3 B;  2QDB A;  3FDT A;  1PTO F;  1K0R A;  2MHV A;  4L6T B;  1HTL D;  1BBU A;  1YBY A;  5C0X H;  5C4X H;  2JA6 H;  1IL8 A;  1KIX A;  4OX9 Q;  1SNC A;  4PNY A;  4MNO A;  1CKN B;  1YNJ D;  3PO3 H;  3KYH C;  4GNX A;  1K0S A;  1J9O A;  1EFI D;  2IX0 A;  2WAQ G;  2K5Q A;  3K80 C;  4LF5 Q;  3PIO 3;  4X3U A;  4HJ8 A;  2KUM A;  1F77 A;  3GTJ H;  3H91 A;  1W3S A;  5FLX L;  1XNQ L;  4I65 A;  3TRZ A;  2HHH Q;  1S5E D;  5F2D A;  4PMC A;  1CKO A;  1YNN C;  2TMP A;  3N52 A;  5D3I B;  1PYB A;  5C3E G;  4JI5 L;  1D8L A;  2JQO A;  5FO9 B;  4NKL A;  1PV4 A;  2SDF A;  1WCM B;  1SMX A;  2C35 B;  3NTI A;  1X32 A;  4KTA A;  2VQF Q;  3K0X A;  4LUV A;  1TII D;  2E2I B;  1A6X A;  1SE8 A;  5EKK A;  3HOV B;  1X6O A;  1WCM H;  3P75 A;  2GA4 B;  4IUN A;  2A73 B;  3UDX A;  1L1O C;  4BY1 G;  2Q8I B;  1M8A A;  1NE3 A;  1PH8 A;  2E2I H;  2JJQ A;  1YIT A;  3IRB A;  4MHE A;  2QGQ A;  1GHJ A;  2CH4 W;  3F8T A;  2NVX B;  3QO2 A;  2ZTC A;  4FVM A;  1JJG A;  3AFQ A;  3HKZ B;  1D5M C;  2HHH L;  3JC6 6;  5LHY 1;  1NAP A;  5IY0 A;  2F4V Q;  2WB1 G;  3MVV A;  5BN5 A;  5C0X I;  2NVX H;  1S5C D;  2K03 A;  5ELE A;  4ULL A;  4J15 A;  1NMF A;  1PH4 A;  4YWL A;  1I4Q A;  2LY7 A;  1L0W A;  2KCT A;  3S24 A;  4CJ0 B;  5M3M B;  2QEX A;  1A2T A;  2B8G A;  3WDN A;  2PI2 A;  2RQX A;  3S1M B;  5HGT A;  4JI4 Q;  5M3M H;  4FXK C;  1BCP B;  3HP3 A;  4QF4 A;  5LL6 S;  1VQ7 A;  2PCF B;  5M3F H;  1EIY B;  2IY5 B;  1HZB A;  4WOR A;  3S1M H;  2F0W A;  3S1R H;  2LS0 1;  2IHE A;  2EVB A;  1JE5 A;  1Y8N B;  4DAV A;  4Q0F A;  2K33 A;  1BBX C;  2Q2I A;  5BR8 Q;  1K73 C;  1T9H A;  4PZ6 A;  3IFD A;  4CKC A;  2AQ3 B;  3NK9 A;  3SK8 A;  2OQK A;  3HOV G;  2R6G A;  5IYD G;  4YHH L;  1U5K A;  4JI4 L;  4X62 Q;  2F0U A;  1FGB D;  5I2Y A;  5DAU A;  2NN6 G;  3J81 E;  1JIC A;  3FVQ A;  1HXY D;  4KY5 A;  1G6P A;  3LX0 A;  3N6R A;  1ASY A;  1L2F A;  5ELO A;  1LO5 D;  2K7V A;  5DNF A;  1IBM L;  2EQS A;  3GTM B;  1STE A;  4A4I A;  2WKC A;  1U4M A;  5C4J B;  3H0G G;  2P5Z X;  3ER0 A;  1HNX L;  1SJH D;  1XPR A;  3NBH B;  2AWN A;  1Y1W G;  4YWK A;  3GTM H;  4GZY C;  3CP0 A;  4JI6 Q;  3A5Z B;  1VQM A;  2F0H A;  2K01 A;  2JK8 A;  3SK4 A;  1V1O A;  4A3B B;  1QUQ B;  3KBX A;  3MXP A;  4I7A A;  1DOM A;  2KCM A;  2EZV A;  3KF6 A;  1Q8I A;  2Z1C A;  1EZ6 A;  4NDX A;  1SMY D;  4A3B H;  4ZCK A;  1R4Q B;  1S5F D;  3R2T A;  3VYS A;  3PUW A;  1D2B A;  4XTC S;  2VS1 A;  3NTH A;  5D14 A;  3CCJ A;  3NPP A;  4DV2 Q;  2VY3 A;  2R7Z G;  4JI3 Q;  3MA2 B;  5I9O A;  3CCM A;  1STG A;  2UUC Q;  1N9W A;  1Z47 A;  1BQQ T;  5IYB H;  4FYD A;  1ZEQ X;  5K36 G;  3L9A X;  1YIJ A;  1ZYR C;  4MTK A;  1K8O A;  3E0E A;  2DGY A;  1I3Q B;  1G8Z D;  3Q24 A;  2F0O A;  2F0G A;  1DCZ A;  3GD7 A;  3GTK B;  2IW3 A;  1VF7 A;  4UPA A;  2R3Z A;  2YTX A;  1QOH A;  1ROD A;  1MSH A;  4OO1 H;  2EJM A;  3GTK H;  4L5T A;  4RGN A;  2H1E A;  5I6Y A;  3OTO L;  1STB A;  4DV2 L;  2ZXR A;  5M5X H;  1VQL A;  1PXU A;  4ME5 A;  4HID A;  1KL9 A;  4JI3 L;  2HT1 A;  4DR3 Q;  4LJZ C;  2HQL A;  2UUC L;  4KHP Q;  4Y52 H;  3KOJ A;  2CCZ A;  5GAE C;  3I56 A;  1U9R A;  2OQ0 A;  3P20 A;  5COY A;  3U58 A;  2MO1 A;  2B2V A;  4NXN Q;  2WKD A;  3U50 C;  4L8J A;  2A69 D;  1E24 A;  5IGE A;  5LMU Q;  4F88 A;  4Z9C B;  4IPG A;  4YY3 Q;  1XX8 A;  2RHQ B;  2G5D A;  1CSQ A;  4KJN A;  1UE5 A;  1PA6 A;  5EBD A;  2XVS A;  2VQE Q;  3E3X A;  1LAC A;  2GVA A;  3VA5 A;  4DR3 L;  1KC8 C;  4DAM A;  3PUV A;  2ICI A;  1PH3 A;  5C4Z A;  1JJC B;  4LFB L;  4KHP L;  3J7Y W;  4C3I B;  1PFN A;  3LWU A;  4FF4 A;  5JPM C;  1PYS B;  2R92 B;  3IL8 A;  4PG3 A;  5T1G A;  4YCV A;  2D0O A;  3VR4 A;  4C3I H;  1PLF A;  3M4P A;  1I6H B;  2R92 H;  2NVT B;  4DA2 A;  2ZM6 Q;  1AE2 A;  3I3C A;  1LV9 A;  2F0S A;  4PV1 C;  4ZKC B;  2EXZ A;  4DXF A;  4HN7 A;  1KNA A;  1ENF A;  2DN8 A;  3HKZ E;  1I6H H;  4TRD A;  3CRL C;  2EYF A;  1EL0 A;  1S3O A;  4HJ5 A;  4JI2 Q;  1K9M C;  3NTK A;  1QVF A;  2PMZ B;  4BBR G;  1UNS A;  2VQE L;  1JOR A;  1OXT A;  1Q90 A;  1YZ6 A;  1WTP A;  5FLX E;  4B3T Q;  2YTY A;  1O7Z A;  4Y7N B;  4LFC Q;  2RBM A;  1W6K A;  1TWF B;  4A3E B;  3D6W A;  4LF9 Q;  1Q12 A;  3J7Z C;  1DJR D;  4RMF A;  4Y7N H;  2QCP X;  2BH8 A;  2CQO A;  4O2D A;  5CV6 A;  3ONA B;  1PRT C;  5BN3 A;  1Z7T A;  1EIG A;  1KD1 C;  4CJ2 C;  3P1H A;  2ZM6 L;  2K28 A;  1AZQ A;  1GD7 A;  3BDL A;  2M2L A;  1TWF H;  1SEB D;  1TQO A;  4IFD I;  4IFD G;  4RKB A;  2N88 A;  3A8J E;  1HRJ A;  1IBK Q;  4IUT A;  4A3F G;  1KTK A;  3M7G A;  1XPU A;  2LXK A;  3HOU B;  4GN4 B;  3GTO H;  2SOB A;  3J7A 5;  3VDY A;  1SYD A;  1EY8 A;  4P2C B;  4B3T L;  1VQA A;  1HR0 W;  4LAA A;  5CV5 A;  4A3D G;  5K5P A;  2PO4 A;  2B29 A;  3ERO A;  5M5W B;  1VQ8 A;  1B50 A;  2CVR A;  4QB4 A;  3NQT A;  1C8C A;  4DR2 Q;  2RSO A;  3E9H A;  5EBC A;  2UXD Q;  3S9W A;  1RCV D;  2ZTD A;  4CKE A;  4RH6 A;  1D6E C;  5M5W H;  3EJI A;  2NBF A;  3ULL A;  3AYH B;  2PPB C;  3CAM A;  4R4I A;  1Q1E A;  1B4O A;  4MIU A;  1HQR D;  2E76 C;  1WTQ A;  4B9W A;  1TR5 A;  3URY A;  1S4Z A;  3SGI A;  3AU7 A;  4X65 L;  1DD2 A;  2EYL A;  1D7Q A;  4POF A;  2BA0 A;  3CPW A;  2EY6 A;  4DR5 L;  1PTO B;  1XTD A;  2ICE C;  3NQI A;  1FR3 A;  3HOZ H;  3SK6 A;  4U68 A;  2JA8 G;  3G48 A;  3TP6 A;  5EPK A;  2ZJP A;  3DUZ A;  1FJG L;  3RZO B;  2QIL A;  5A2Q L;  1WI5 A;  3S2D B;  1PTO H;  4DR6 L;  2A6H C;  1TWG H;  3BVG A;  1IYV A;  4G7Z C;  5IP7 G;  4A3E G;  1VCI A;  1CT1 D;  3RZO H;  4V19 0;  2Q2U A;  3DXJ C;  3S14 H;  3S2D H;  2UXD L;  3VR5 A;  2B63 G;  3PV0 A;  2YYZ A;  1VQE A;  5C5L A;  4JBJ A;  2IX1 A;  4DNI A;  4LF4 Q;  4RA8 A;  1O78 A;  2A74 C;  1A3U A;  1B3A A;  3HKS A;  3HOU G;  4JBM A;  2ZJR A;  3D0F A;  4TKO B;  4BA2 I;  3PO2 B;  4LMQ D;  1VQG A;  1NJI C;  2OEO A;  1YNJ C;  3J80 i;  2HQE A;  3M4Q A;  4LK1 C;  3G6J B;  5I6W A;  1G2T A;  1B53 A;  1YVC A;  3PIP 3;  4DR7 L;  2IT1 A;  4A3K B;  5JJZ A;  3HRZ C;  4DAY B;  2N55 A;  1NSN S;  4DV7 Q;  1K3B C;  2RDF A;  3HOX G;  3CF5 A;  4POG A;  4DR4 Q;  4FF1 A;  1Q82 C;  2NVY H;  2B2U C;  4MTN A;  4NB3 A;  2CWA A;  4IPC A;  2TSS A;  3J80 E;  1X56 A;  2JEB I;  4OGQ C;  2D62 A;  5HGQ A;  1H9K A;  3W1G A;  4DNT B;  1HNZ Q;  2F0I A;  1F9R A;  4FO2 A;  1HJP A;  1VMC A;  5JJL A;  4KHV A;  2F3V A;  2HIX A;  3PUZ A;  1BNZ A;  1VQH A;  1VQN A;  1Y8P B;  3G71 A;  2Z6B A;  4A3J B;  5AJ3 Q;  4DV0 L;  1LTB D;  4B3R L;  2I5M X;  4KV6 A;  1LTG D;  5KNB A;  1HQM C;  4A3J H;  3DM1 A;  1CTM A;  3HOW G;  1B2T A;  2B2W C;  1HNW L;  3MTS A;  4DV7 L;  4DR4 L;  1VQC A;  4KHZ A;  4P72 A;  3HOY B;  1STY A;  1NBW A;  1SYE A;  3W3A A;  3DM3 A;  1BUV T;  3U9O A;  4R8I A;  2LSS A;  3TME A;  1TS3 A;  3BYY B;  1SFO B;  1PH7 A;  2Y0S G;  1HNZ L;  1PZK D;  4N8X 1;  3AQQ A;  2K50 A;  4JI0 L;  3PO2 G;  5JJI A;  1O7Y A;  1LAB A;  2F0J A;  1SFO H;  2PW7 A;  5AJ3 L;  1KAW A;  2WII B;  5FKA C;  1QE6 A;  5CGK A;  2MFI A;  3K57 A;  1H95 A;  3GTQ B;  3RD4 A;  3R8B A;  4A3K G;  1XMQ Q;  5KGU A;  1C4Q A;  3QJY A;  3W1B A;  2C5C A;  4RGO S;  3STB D;  5BN4 A;  4GS3 A;  2R61 A;  4C3H B;  1V9P A;  4C2M B;  1W6J A;  4X64 Q;  4QUC A;  3CD6 A;  3CCE A;  4KN7 C;  2PMZ E;  2IHF A;  3M4O B;  2CH4 A;  4HJA A;  3DEO A;  3NUC A;  1PZJ D;  1U0L A;  2XNA C;  4OWX B;  4DV3 L;  1TT2 A;  2E2H B;  3BDC A;  3M4O H;  2JEA I;  2X69 A;  2N49 A;  3CKI B;  3KDF A;  2PQA B;  3EBE A;  1QZG A;  1PH2 A;  5I4D A;  5M9O A;  1PRT F;  4UP8 A;  3H94 A;  3H3V H;  4GOP A;  1H9S A;  1CA6 A;  2L15 A;  4MZ9 A;  5IIF A;  2L5T A;  2EPB A;  3OSO A;  5EGT A;  3SVM A;  3MXU A;  5FLX c;  2YTV A;  3S2H B;  1QG7 A;  2B2T A;  4XT1 B;  4LF8 L;  1VMP A;  1EQR A;  1VQP A;  4KKS A;  1H9J A;  3I2Z A;  4J1M A;  2VXW A;  2IWH A;  3U4Z A;  1K8A C;  1XNQ Q;  1DM0 B;  2C9O A;  3M4Y A;  1AE3 A;  1NR4 A;  1J5E Q;  4P75 A;  3MC0 B;  2UXC Q;  1EY6 A;  2F0E A;  3T1H L;  4JOI A;  1N8R C;  2E5L Q;  3V2T A;  3F2B A;  3NWT A;  1AEX A;  2KCN A;  4QMG A;  3SHL A;  2F52 A;  2EJF C;  4GNX C;  3O13 A;  4B3M L;  3E5S A;  5JEA G;  4FF3 A;  2D0P A;  5C44 G;  3ITP A;  1AH9 A;  1A8V A;  4LF7 Q;  3GTJ B;  2O2L D;  1JR0 D;  2K5H A;  1Y1V G;  1EU3 A;  2E2D C;  2RF4 A;  4TVA B;  4QUF A;  4DGZ A;  5J1Z A;  3UE1 A;  1HA5 A;  1FL0 A;  3VR2 A;  1X3F A;  4GKJ Q;  1CKN A;  2A8V A;  2XIW A;  1VQB A;  2XTI A;  1J5E L;  4RKL A;  3PF4 A;  2UXC L;  3H3V I;  4HMI A;  1FYC A;  4O1N A;  1FNV A;  2E5L L;  5KRU A;  1E2V A;  3K81 C;  5FJ8 H;  3Q8D A;  3K7A B;  4A3C H;  2YU9 B;  2QEJ C;  4PZ8 A;  4FDB A;  4UAI A;  3U4V A;  5A35 A;  2ES2 A;  3TBI B;  1SRU A;  2ENB A;  3NE5 B;  1SDF A;  2G9D A;  1UEA B;  2HD3 A;  3K7A H;  4EQP A;  4E6I A;  4LF7 L;  3S1Q H;  3ND9 A;  5IP9 G;  2YU9 H;  1NTG A;  5ELD A;  1ZXT A;  4A3L H;  3TS2 A;  3OIQ A;  1CUK A;  1TS5 A;  1X3P A;  1CK1 A;  2HCC A;  1E1T A;  1HTP A;  4GKJ L;  2VUM B;  2LKV A;  2PYK A;  2A69 C;  1J8I A;  1XPO A;  1L1O B;  2R93 B;  1A2U A;  2OF1 A;  3UDG A;  5C0X G;  4CKB A;  2JA6 G;  5C4X G;  2LFN A;  1EYD A;  3NHH A;  4LFA Q;  3Q22 A;  2VUM H;  1VS0 A;  1A62 A;  3PO3 G;  3X3M A;  2R93 H;  3QIA A;  2N3S A;  4IPD A;  3CU7 A;  4B3S L;  4J6H A;  1GUT A;  3DWQ A;  3ULP A;  4ME3 A;  1N36 L;  2NVQ H;  1XWE A;  2F0P A;  1O80 A;  2K05 A;  4WJ4 A;  5M3F B;  4BXX H;  1EY0 A;  4YHH Q;  5JEA J;  3TZU A;  3UDI A;  1IYJ B;  5I2X A;  3NXW A;  3S1R B;  2AMC B;  2QA4 A;  1H9R A;  2RCF A;  2KJX A;  3E9I A;  4B9X A;  2DNE A;  2F4I A;  2L55 A;  3KUP A;  3PIP A;  1Q8K A;  1E1O A;  5C4H A;  1IBM Q;  2WIN B;  3TDQ A;  5EPJ A;  3J80 c;  1Q3L A;  1VQI A;  1LM0 A;  1T5E A;  1I4H A;  3I4N B;  4LFA L;  3GO5 A;  1HNX Q;  1WCM G;  5DM6 3;  1SND A;  1TWH B;  1WTO A;  4C3J B;  2NZH A;  2KHI A;  2EYH A;  2MUY A;  2A68 D;  2E75 C;  1A3T A;  4RHS A;  3MEF A;  3I4N H;  1KLG D;  3OOC A;  5J39 A;  4IUU A;  4YIJ A;  1TWH H;  1TS4 A;  3GTG H;  2L4N A;  4C3J H;  4KKT A;  1M90 C;  3ICE A;  1AN8 A;  3CCU A;  2E74 C;  3UE0 A;  4CBV A;  3FPP A;  1VQK A;  4L5R C;  3PUX A;  3I91 A;  1ZKO A;  3HKZ G;  4JPB W;  3CCQ A;  4ZQ3 A;  1DON A;  3OW7 A;  1A0I A;  2XRS D;  3UDF A;  4HJ9 A;  4IQZ A;  4KK7 A;  5HY6 A;  3OMG A;  2L12 A;  3I72 A;  1WTW A;  1F2Z A;  5ELN A;  1GUO A;  1CI3 M;  1KRS A;  5C0X J;  4LF6 L;  5M3M G;  1X3G A;  3K0Y A;  2K5V A;  1E22 A;  5DLQ E;  4KJO A;  1EIH A;  1WJJ A;  1YJW A;  2H4O A;  3NBH A;  2BE5 D;  2EE1 A;  3GV3 A;  2CFM A;  2I07 B;  1QVC A;  3OTO Q;  3MFG A;  2B8F A;  1A15 A;  5FO7 B;  2MNA A;  1QUQ A;  3P7J A;  2Z8L A;  2FIN B;  4AYB B;  4OON A;  4ILW A;  4DV1 Q;  2F1M A;  2Z4H A;  5IT9 L;  1JCK B;  1PMR A;  1RHP A;  3BYT B;  4GLA C;  3DWP A;  4JV5 Q;  2B2Y A;  2WAQ E;  3BS1 A;  2EY1 A;  1HFG A;  2EIF A;  1CHQ D;  1WD1 A;  1EY7 A;  2CKZ B;  2Z0S A;  1IKM A;  2RCN A;  1V1Q A;  4GN5 A;  2RSN A;  5EAY A;  3CCS A;  5LMN L;  1TY0 A;  2F0N A;  1VF5 C;  5C3W A;  2OCE A;  5M5X B;  3K6O A;  1MI2 A;  2DJF C;  1EY9 A;  4IOC A;  3M3Y H;  2X6G A;  2ZXP A;  4H7B A;  1IYU A;  1UE1 A;  1U4R A;  4IJL A;  4M8A A;  2F0F A;  4DV1 L;  4LFB Q;  1W2B A;  1V1P B;  1BO0 A;  2B2V C;  1N34 L;  4FXD A;  5I9P A;  4JV5 L;  1ICW A;  1I4X A;  2ATW A;  5IYC H;  2F0K A;  1SNM A;  3TS0 A;  4Q5V A;  4A3B G;  1LTT D;  3D6C A;  1I6V C;  2JA7 B;  1QCB D;  2N8N A;  1JOK A;  1SLJ A;  3D4W A;  1FNU A;  1H9M A;  2JA7 H;  5IYB G;  2H5X A;  4JYA L;  1ASZ A;  2XSC A;  4BBS B;  3F2C A;  3TP7 A;  1D1K A;  1ET6 A;  5GRO A;  2Q2T A;  4X66 L;  4BBS H;  4OO1 I;  3PIO A;  2ASB A;  1BCP D;  2WP8 J;  1DGS A;  1TY2 A;  2FHT A;  4R4O A;  4GLX A;  1U4P A;  1XTC D;  4A3G B;  3GTP H;  1XXG A;  5JJK A;  4I7Z C;  3RUZ A;  3FMC A;  1GUS A;  1N33 L;  3T16 A;  4ZRZ A;  4A3G H;  1C48 A;  1FNW A;  2EYJ A;  4A76 A;  1QNK A;  2NYZ D;  3MXN B;  4N8F A;  5FK9 C;  2NB0 A;  1JOO A;  1Y14 B;  2JSO A;  4N9T A;  2JXM B;  4KD4 A;  1R9T H;  4A3M B;  2DY8 A;  2V1C C;  5EPL A;  2CW0 D;  4PMW A;  2F0Q A;  2IX3 A;  1M1K C;  4KMU C;  2K14 A;  2NZ1 D;  3ERQ A;  4OIK A;  4A3M H;  4B08 A;  3AEV A;  4F7X A;  2DY7 A;  3DWA A;  1XNR L;  2UU9 Q;  3WWV A;  3PF5 A;  3T51 B;  3K8A A;  3GTO B;  2AUK A;  4G4K A;  4X65 Q;  2VNU D;  3M9B A;  2F0M A;  5CYU A;  1SE2 A;  1AW7 A;  1LUZ A;  4DFA A;  5FOB B;  4DR5 Q;  1PRT B;  1LT3 D;  3STB C;  3KK7 A;  1GM5 A;  3F1Z A;  3FHW A;  1BVS A;  1FJG Q;  4C3I G;  3HS0 C;  1JT8 A;  1GVP A;  4DR6 Q;  2K6A A;  2R92 G;  1MJE A;  2KHJ A;  1E3P A;  2Z9H A;  3T1Y L;  1Z9F A;  4RGT A;  3RLO A;  1RJT A;  2MO0 A;  2EYM A;  3NEN A;  1L0X B;  4JBK A;  1GHK A;  4S3S A;  1QZH A;  2F0D A;  1PH9 A;  2UU9 L;  4BY7 B;  4A93 H;  3BDO A;  4DU9 A;  5G3L D;  2PQE A;  4XYQ A;  3HOZ B;  1NUC A;  1EWI A;  3RLN A;  1V8Q A;  1MGS A;  1RTO A;  3KF8 B;  4BY7 H;  1R4P B;  3FKI B;  3OIP A;  4X6A H;  1TWG B;  1LTA D;  1BKB A;  1MJC A;  4H13 C;  4IUV A;  1LTS D;  2KBN A;  4PZ7 A;  1IXR A;  1JWM D;  4JVZ A;  3S14 B;  3FKI H;  2I46 A;  2LMC B;  4XYO A;  2I0Q A;  4EVO A;  3MZ5 A;  4DR7 Q;  4DN4 M;  2M00 A;  4ZKB B;  2PNH A;  3BG3 A;  3ZJY C;  2NZO A;  1YNX A;  4AIM A;  4RWS C;  3PGZ A;  1GKH A;  2CHB D;  4GLV B;  4RHR A;  2UXB L;  1D1I A;  1VQ4 A;  1EYG A;  2VB3 X;  1GO3 E;  3TN2 A;  3M7N A;  2OTJ A;  5KEE A;  3EFX D;  3L7Z C;  3K5N A;  4AYB E;  4L5Q A;  4IFD J;  5CBE E;  1VQ6 A;  2D9U A;  3I4M B;  4DV0 Q;  3A7A B;  4B3R Q;  1BF4 A;  3FPU B;  1B9N A;  3I4M H;  2AQ1 B;  1JWS D;  2NVY B;  1B8A A;  1EY4 A;  1HUM A;  2BDO A;  3OHX C;  1UAP A;  1HHV A;  3QWN A;  4KN4 C;  1HNW Q;  1RTN A;  1O7L A;  4CDF C;  4QJF A;  2NTS A;  1RF2 D;  1P8L A;  2KEC A;  3HOZ G;  1EQV A;  3SEB A;  1TU2 B;  5IGB A;  3C3L A;  3SK5 A;  3K5L A;  4DAY A;  2JA5 B;  5D3D A;  1IKL A;  4JI0 Q;  4NMZ A;  1MIU A;  1X65 A;  4DR1 L;  1CHP D;  2J0T D;  1HH2 P;  4IJH A;  3MXG A;  1K28 A;  2EY5 A;  1Z6H A;  5IGC A;  1GUW A;  2HDM A;  2BOS A;  2XGT A;  5J3B A;  2JA5 H;  1SNO A;  3SE0 A;  3JAM L;  3J81 L;  4O42 A;  3G7L A;  1F2Y A;  1F2M A;  4BS9 A;  2O5J C;  5IWA Q;  5EKL A;  5CMD A;  3I55 A;  1XMO Q;  4KY7 A;  5LL6 X;  2QDL A;  2D5D A;  4QQB X;  4AQY L;  1BOS A;  1N32 L;  4LNQ A;  2B3G A;  4YCW A;  1F2L A;  4JW0 A;  1ENC A;  1TVX A;  1TWC B;  1EU4 A;  1EIF A;  2SEB D;  3R93 A;  2ZT9 C;  3OWE B;  2Q8R E;  1SYB A;  3S15 H;  1TWC H;  1II3 A;  2O4X A;  1X54 A;  3L2P A;  1STH A;  4HAE A;  4DV3 Q;  2AQ2 B;  4JI7 L;  3L3O C;  4GN3 B;  1EYA A;  1I4P A;  3A56 A;  4XQJ A;  4K0K L;  1RL2 A;  1SE4 A;  5IWA L;  5KND A;  1XMO L;  5IOC A;  4DV4 Q;  5FLM H;  3NEL A;  4RGM A;  3OW2 A;  2DUD A;  2M9V A;  2WFW A;  3CC2 A;  1QJO A;  2CQA A;  3KLS X;  4C56 C;  4DUY Q;  1VQ9 A;  1Q7Y C;  1AP0 A;  4DV5 Q;  1SYG A;  4LF8 Q;  3KFU A;  1CZW A;  3A54 A;  1JMC A;  4A3I H;  2OTL A;  4K6L A;  2MGS A;  4EX5 A;  1G6Z A;  2MP1 A;  1STN A;  4NXM L;  2A68 C;  1JE4 A;  1WTH A;  3QOL A;  1FGU A;  1QWY A;  1SJE D;  4IAL A;  1STA A;  4RAU C;  4A3J G;  2EY2 A;  5GAD C;  4K5W A;  4TSS A;  1G29 1;  3T1H Q;  1YJ9 A;  3FRP B;  4GOP C;  2KED A;  1A3V A;  4DV4 L;  4C1N K;  5ELF A;  1SBB B;  2WAQ B;  5ELB A;  3VR3 A;  2B2T C;  1KAA A;  1T5X D;  4B3M Q;  4PMB A;  3HGB A;  1EWC A;  3T53 B;  3HOY G;  2A6E C;  2VB2 X;  4DUY L;  5KIX A;  4DV5 L;  1LT6 D;  2PQA A;  1FVI A;  3CRK C;  2NUC A;  2FMC A;  5C3E B;  3G6E A;  3I4O A;  3PSI A;  2ZXO A;  2L0C A;  4JOI C;  5ISR A;  3CCR A;  1HUN A;  1E0B A;  5C3E H;  2UUB Q;  2VL6 A;  4RCN A;  1I4G A;  1HZ9 A;  1X3E A;  2BE5 C;  3FP9 A;  1B7Y B;  1TS2 A;  4DK6 C;  4DKA C;  4HMJ A;  1X3Q A;  1NNX A;  1E2Z A;  2BDN A;  4KY6 A;  3RR5 A;  3I7F A;  4C3H G;  4BY1 H;  2E8G A;  3C2P A;  4CDE C;  3U9S A;  3CXC A;  3V96 A;  1ESF A;  1Q86 C;  3PUY A;  1RD9 D;  4RG1 A;  1VQO A;  1I94 Q;  4JI8 L;  2LXJ A;  1LTI D;  4H44 C;  4NW2 A;  1BXT A;  3D4D A;  4DK1 A;  1KQS A;  1ILQ A;  4GNX B;  1HCZ A;  3Q23 A;  1PH1 A;  3BZC A;  5NUC A;  1KRT A;  5IE8 A;  2UUB L;  1GUN A;  1TXY A;  2KA7 A;  5CV7 A;  4ODG A;  1CKM A;  1VQJ A;  2J4X A;  4HIK A;  2PZU A;  1EEI D;  3S1Q B;  3TQY A;  4B3S Q;  2K5D A;  1N36 Q;  3I4L A;  5DM7 3;  1ML0 D;  1OXX K;  3J7A F;  2BH2 A;  2WAC A;  2K4K A;  3OWF A;  3S1N B;  1VQD A;  2UUA L;  5CBA E;  2ALY B;  2RVL A;  1I94 L;  4HCE A;  4CDC C;  3F2U A;  2PNR C;  1YHA A;  3B6Y A;  4WFN 3;  1PFM A;  3AFP A;  3BJU A;  4NPS A;  1HPC A;  3S1N H;  1EY5 A;  1DXM A;  1M4V A;  3R2I A;  5HUR A;  3HEJ A;  2A5H A;  2JN4 A;  2K04 A;  3S16 B;  4OX9 L;  3RNU A;  1X9N A;  2WV6 D;  2DJG C;  3RMH A;  4L5S A;  2NVQ B;  1DZ1 A;  1D5X C;  1Q81 C;  2Y0S E;  2FJ2 A;  3S16 H;  3PCO B;  2EOT A;  3HOV H;  5AFW A;  4LF5 L;  5A2Q E;  1F9P A;  4JI1 Q;  1K8M A;  1UEB A;  1L1O A;  4P74 A;  3NSW A;  4HJ7 A;  4P73 A;  1PYW D;  5IYD H;  3W5O A;  2B39 A;  1NCV A;  4IZ8 A;  3D8G A;  3OPO A;  3R3O A;  3CHB D;  5IOD A;  2OT2 A;  4LW1 A;  2NN6 H;  4BA1 I;  4F8M A;  3CCL A;  5ELC A;  2BCO A;  5EKI A;  3Q6S A;  2L9H A;  3H0G B;  3UI2 A;  3VYT A;  1KXL A;  1CZG A;  1MKH A;  1NR2 A;  1D5Z C;  2RA4 A;  4QL5 A;  1BCP C;  1Y1W B;  2VQF L;  1IHZ A;  4DXG A;  1F9Q A;  5FJ8 G;  3H0G H;  4A3C G;  2PW5 A;  4QIW E;  1CFM A;  4WRD A;  2ZTE A;  2JE6 I;  2KQ3 A;  4F87 A;  1Y1W H;  4NP5 A;  3TZD A;  3GTG B;  2L1B A;  4DUZ Q;  3Q0A A;  2QW7 A;  4LF6 Q;  4X3S A;  3NBI A;  5C6A A;  4JI1 L;  5KYL A;  4A3L G;  2K1B A;  3BVM A;  3I70 A;  4HR7 B;  3CME A;  3GQB A;  3T13 A;  1UE6 A;  2R7Z B;  1AFP A;  4R4Q A;  3EQL C;  2K75 A;  4ZLT F;  2F4V L;  1K3R A;  5IT9 c;  5DEH A;  3J81 i;  3JAM i;  2I5L X;  3DLL A;  2R7Z H;  2CW0 C;  5CC4 A;  1HFN A;  3X3N A;  3HFZ B;  2VUM G;  4N9P A;  1IW7 D;  3NWS A;  1EOV A;  1HR0 Q;  4YCU A;  3VR6 A;  2R93 G;  5T1I A;  3AMU A;  2A6E D;  4FP5 D;  1B3Q A;  2KCC A;  3C1F A;  1YI2 A;  1XJV A;  1JJ2 A;  5K36 H;  1EEF D;  5TSS A;  4K5X A;  1K8G A;  4ALP A;  4BXX G;  1JQY D;  4XQQ A;  4DUZ L;  2NN6 I;  3JAM E;  1UWV A;  1QIL A;  1MD2 D;  3EA6 A;  5M3F G;  3TP5 A;  4X3T A;  1LTR D;  4OL7 A;  4V0B A;  2AWO A;  5LMN Q;  2OWO A;  1KDB A;  4MN3 A;  5BR8 L;  1PH6 A;  1Y69 U;  3TRE A;  4CJ1 B;  1RDP D;  3KF6 B;  3GDE A;  5C4J H;  3BZK A;  1HR0 L;  2BA1 A;  2B2Y C;  4C1N I;  3J80 L;  1X55 A;  3EVQ A;  4R8N A;  4RFB A;  5CV9 A;  3I4N G;  4UHV A;  2PZW A;  1N34 Q;  1DOK A;  4X62 L;  1OTC A;  4C3J G;  1UE7 A;  2XRQ D;  4FXG C;  4IUP A;  1SSO A;  4R1J A;  1BDO A;  4JBW A;  5GAG C;  4JG2 A;  1ILP A;  2N78 A;  3E6Z X;  1Y8O B;  2PZT A;  4IPH A;  5H1S E;  3M3Y B;  1ENA A;  1K83 B;  2A1A A;  1OXS C;  1OO9 B;  2GVB A;  4IN3 A;  1S5D D;  3OMC A;  1PHJ A;  4H0L C;  5L37 A;  1V43 A;  2JA9 A;  4JC0 A;  4ZYS A;  1K83 H;  3W2D A;  4JYA Q;  3WOE A;  4JI6 L;  1LYL A;  5JOB A;  2ZJQ A;  3MAQ A;  3HG9 A;  5C5M A;  5GQO A;  2F0T A;  2EDG A;  1YNN D;  2K32 A;  1I3Q H;  1CSP A;  3KJO A;  4AH6 A;  2MJ8 A;  1Q46 A;  4X66 Q;  1MHW C;  1CA5 A;  1RIP A; 
#chains in the Genus database with same CATH homology
 2RKS A;  4FNF A;  1V1P A;  4BBR B;  1KDA A;  3ZYY X;  4HED A;  1DOL A;  1MBY A;  2Q8T A;  2G9H D;  1I4R A;  2IL8 A;  4G7O C;  4EQN A;  1F9S A;  1UUP A;  5JVH 3;  5E4X A;  5KNC A;  1B9M A;  4ID6 A;  4UDU C;  1GJX A;  1TKW B;  3GTP B;  4OO1 G;  1L0Y B;  4A3F B;  4KI0 A;  5CV4 A;  1FD7 D;  4IFD H;  2QF7 A;  1EWH A;  1OXU A;  3H6M A;  1EZ8 A;  3DEP A;  4A3D B;  2XWB B;  2HDL A;  3T4A C;  5IGF A;  1R9T B;  4OHJ A;  1WTV A;  1GXD C;  4DNR B;  4M1U B;  4BWG B;  4RCO A;  3E0J A;  1G91 A;  2JYO A;  2F0L A;  3MXN A;  2J7Z A;  2QKI C;  1ESR A;  1OXV A;  5KYI A;  3AB9 A;  1LLR D;  1CQV A;  1KDC A;  1ONL A;  1WD0 A;  4K8I A;  4G7H C;  2JA8 B;  3I73 A;  3MWY W;  1ET9 A;  4X3K A;  1BCP F;  3A7L A;  1PFB A;  3BZD B;  3VYR A;  3FEW X;  2L11 A;  1JC7 A;  5EJW A;  3KLR A;  4EGV A;  2AUJ D;  5IGD A;  3RLF A;  1GUG A;  4XDX A;  1I50 B;  1SXT A;  2B63 B;  4ABN A;  4KKU A;  2XWJ B;  3V05 A;  5J22 A;  3LWE A;  1S5B D;  3C46 A;  2RDH A;  4A93 B;  3BVZ A;  4XXE A;  1WVL A;  3DHQ A;  3M85 A;  4DK0 A;  2D2C C;  2KOL A;  3MEH A;  2F3W A;  3VA7 A;  4K14 A;  1SAP A;  2F03 A;  4HSP A;  4XIG S;  3K5O A;  4KD3 A;  1PTO C;  3IAY A;  3HOX B;  3DMU A;  4HCS A;  4XQN A;  3GTL B;  3KF8 A;  2XN9 C;  1EQT A;  1AZP A;  2FFK B;  3C1E A;  4L63 B;  1ZYR D;  1SNQ A;  2IJ0 A;  1QNU A;  4IUQ A;  1Q1B A;  2OXP A;  1QB5 D;  5JPN C;  2SNM A;  4K2L A;  3GV6 A;  5IGG A;  1B1Z A;  2DNC A;  5E3F A;  1SYF A;  3HOW B;  1PZI D;  3IFT A;  5G3L F;  3KBG A;  3K58 A;  1U4L A;  4XT3 B;  3PMF A;  4PQX A;  1RKN A;  2NTT A;  2SNS A;  4DF7 A;  2X6L A;  3QOJ A;  4FF2 A;  4OIJ A;  3I90 A;  2Y0S B;  1VDZ A;  5FO8 B;  1JOQ A;  3QG1 A;  3TSS A;  3MFY A;  3LNN A;  1G2S A;  3D3R A;  5COR A;  4K8J A;  4IUR A;  4WJW A;  4ZUI A;  3T56 B;  1MSG A;  4HTH A;  1SYC A;  2EJG C;  2V4D A;  1CQF A;  2JP1 A;  1KAB A;  1BR9 A;  4QIW B;  3SDZ A;  3J7A V;  1XYI A;  5IT9 E;  2E2J B;  2B2U A;  2IPK D;  3S15 B;  5CV8 A;  4R9W A;  4ZAI A;  1CM9 A;  3A8I E;  4TQU S;  2K5W A;  2Z4I A;  2FMM A;  5CR3 A;  5JAV A;  2KEE A;  1JWU D;  2KVM A;  2KHS A;  3SR1 A;  3CQZ B;  3S17 B;  2ID0 A;  1GOZ A;  3K59 A;  2B2W A;  1DYQ A;  5JVG 3;  3SXH A;  4A3I B;  1SE3 A;  3RZD B;  1PRT D;  1PDQ A;  4DAP A;  4ZUJ A;  3HZX A;  4QCL A;  3ND8 A;  2EYP A;  4EQO A;  2MPM A;  1EOT A;  1WTX A;  3MHB A;  5C3X A;  1WTR A;  1LT5 D;  5C44 B;  2EYO A;  5D65 A;  3H3V C;  5E1F A;  1TWA B;  1Y1V B;  5JEA H;  4U67 3;  2O5I C;  2NWG A;  1IW7 C;  4K5V A;  4CHT B;  3K5M A;  1SNP A;  1PTO D;  1H9S B;  1B44 D;  5M5Y B;  3H09 A;  4G57 A;  1LT4 D;  4ZK9 B;  4K2K A;  3IKJ A;  1E2W A;  2F0V A;  3I8Z A;  2HUG A;  3WOF A;  3A55 A;  4K6D A;  3A8K E;  3VYU A;  3GP7 A;  4BY1 B;  5E4W C;  2A6H D;  1HA6 A;  3QB3 A;  4HSV A;  2HCI A;  3NP8 A;  4J8Q A;  1KLU D;  3KLS A;  3D4R A;  1KNE A;  1JB3 A;  5EQ0 A;  4CGY B;  2RDG A;  2WB1 B;  3TP8 A;  3D31 A;  4JK1 C;  2JA6 B;  5C4X B;  1EYC A;  1SMY C;  3PO3 B;  2QDB A;  3FDT A;  1PTO F;  2MHV A;  4L6T B;  1HTL D;  5C0X H;  1IL8 A;  1SNC A;  4PNY A;  1YNJ D;  1J9O A;  1EFI D;  2IX0 A;  2K5Q A;  3PIO 3;  4X3U A;  2KUM A;  1F77 A;  3H91 A;  5FLX L;  4I65 A;  1S5E D;  5F2D A;  4PMC A;  3N52 A;  1YNN C;  2TMP A;  5D3I B;  5FO9 B;  4NKL A;  2SDF A;  1WCM B;  1X32 A;  3NTI A;  4KTA A;  1TII D;  2E2I B;  1A6X A;  5EKK A;  3HOV B;  3P75 A;  2GA4 B;  4IUN A;  2A73 B;  2Q8I B;  1M8A A;  4MHE A;  2NVX B;  1GHJ A;  3QO2 A;  4FVM A;  3HKZ B;  1D5M C;  5LHY 1;  1NAP A;  5BN5 A;  3MVV A;  5C0X I;  1S5C D;  2K03 A;  5ELE A;  4ULL A;  1I4Q A;  2LY7 A;  4CJ0 B;  5M3M B;  1A2T A;  2B8G A;  3WDN A;  2RQX A;  3S1M B;  5HGT A;  4FXK C;  1BCP B;  3HP3 A;  4QF4 A;  5LL6 S;  2PCF B;  4WOR A;  2F0W A;  2LS0 1;  2EVB A;  1Y8N B;  4DAV A;  4Q0F A;  2K33 A;  1BBX C;  3IFD A;  4CKC A;  2AQ3 B;  3NK9 A;  3SK8 A;  2R6G A;  2F0U A;  1FGB D;  5I2Y A;  5DAU A;  2NN6 G;  3J81 E;  1JIC A;  3FVQ A;  1HXY D;  4KY5 A;  3LX0 A;  3N6R A;  1LO5 D;  2K7V A;  5DNF A;  3GTM B;  1STE A;  2WKC A;  1U4M A;  5C4J B;  1SJH D;  2AWN A;  4GZY C;  2F0H A;  2K01 A;  3SK4 A;  1V1O A;  4A3B B;  3KBX A;  3MXP A;  1DOM A;  2EZV A;  1Q8I A;  2Z1C A;  1EZ6 A;  4NDX A;  1SMY D;  1R4Q B;  1S5F D;  3R2T A;  3VYS A;  3PUW A;  1D2B A;  4XTC S;  5D14 A;  3NTH A;  3NPP A;  3MA2 B;  5I9O A;  1STG A;  1Z47 A;  1BQQ T;  4FYD A;  1ZEQ X;  5K36 G;  3L9A X;  1ZYR C;  1K8O A;  1I3Q B;  1G8Z D;  3Q24 A;  2F0O A;  2F0G A;  1DCZ A;  3GD7 A;  3GTK B;  2IW3 A;  1VF7 A;  2R3Z A;  1QOH A;  1ROD A;  1MSH A;  4OO1 H;  2EJM A;  4RGN A;  2H1E A;  5I6Y A;  1STB A;  2ZXR A;  1PXU A;  4ME5 A;  4LJZ C;  1U9R A;  3P20 A;  5COY A;  2B2V A;  2WKD A;  4L8J A;  2A69 D;  5IGE A;  4F88 A;  4Z9C B;  1XX8 A;  4KJN A;  5EBD A;  2XVS A;  1LAC A;  3VA5 A;  3PUV A;  2ICI A;  5C4Z A;  3J7Y W;  4C3I B;  1PFN A;  3LWU A;  4FF4 A;  5JPM C;  2R92 B;  3IL8 A;  5T1G A;  3VR4 A;  1PLF A;  1I6H B;  2NVT B;  4DA2 A;  4ZKC B;  3I3C A;  1LV9 A;  2F0S A;  4PV1 C;  2EXZ A;  4DXF A;  4HN7 A;  1KNA A;  1ENF A;  2DN8 A;  4TRD A;  3CRL C;  2EYF A;  1EL0 A;  3NTK A;  2PMZ B;  1UNS A;  1JOR A;  1OXT A;  1Q90 A;  1WTP A;  5FLX E;  1O7Z A;  4Y7N B;  2RBM A;  1W6K A;  1TWF B;  4A3E B;  3D6W A;  1Q12 A;  1DJR D;  2QCP X;  5BN3 A;  5CV6 A;  3ONA B;  1PRT C;  1Z7T A;  1EIG A;  4CJ2 C;  3P1H A;  2K28 A;  1AZQ A;  3BDL A;  2M2L A;  1SEB D;  1TQO A;  4IFD I;  4IFD G;  4RKB A;  2N88 A;  3A8J E;  1HRJ A;  4IUT A;  1KTK A;  3M7G A;  3HOU B;  2SOB A;  1SYD A;  1EY8 A;  4P2C B;  4LAA A;  5CV5 A;  5K5P A;  2PO4 A;  3ERO A;  5M5W B;  1B50 A;  2CVR A;  4QB4 A;  3NQT A;  1C8C A;  2RSO A;  5EBC A;  3S9W A;  1RCV D;  4CKE A;  4RH6 A;  1D6E C;  3EJI A;  2NBF A;  2PPB C;  1Q1E A;  1B4O A;  4MIU A;  1HQR D;  2E76 C;  1WTQ A;  4B9W A;  1TR5 A;  3URY A;  1S4Z A;  3AU7 A;  1DD2 A;  2EYL A;  2BA0 A;  2EY6 A;  1PTO B;  2ICE C;  3NQI A;  1FR3 A;  3SK6 A;  4U68 A;  3TP6 A;  5EPK A;  3DUZ A;  3RZO B;  2QIL A;  5A2Q L;  3S2D B;  1PTO H;  2A6H C;  3BVG A;  1IYV A;  4G7Z C;  1VCI A;  1CT1 D;  4V19 0;  3DXJ C;  3VR5 A;  3PV0 A;  2YYZ A;  2IX1 A;  5C5L A;  4RA8 A;  1O78 A;  2A74 C;  1A3U A;  1B3A A;  4TKO B;  4BA2 I;  3PO2 B;  4LMQ D;  2OEO A;  1YNJ C;  2HQE A;  4LK1 C;  3G6J B;  5I6W A;  1G2T A;  1B53 A;  3PIP 3;  2IT1 A;  4A3K B;  5JJZ A;  3HRZ C;  2N55 A;  1NSN S;  2RDF A;  4FF1 A;  2B2U C;  2TSS A;  3J80 E;  2JEB I;  4OGQ C;  2D62 A;  1H9K A;  4DNT B;  2F0I A;  1F9R A;  4FO2 A;  1VMC A;  4KHV A;  2F3V A;  3PUZ A;  1BNZ A;  1Y8P B;  4A3J B;  1LTB D;  4KV6 A;  1LTG D;  5KNB A;  1HQM C;  3DM1 A;  1CTM A;  1B2T A;  2B2W C;  3MTS A;  4KHZ A;  3HOY B;  1STY A;  1SYE A;  3W3A A;  1BUV T;  3U9O A;  4R8I A;  3TME A;  1TS3 A;  3BYY B;  1SFO B;  1PZK D;  1LAB A;  1O7Y A;  2F0J A;  2PW7 A;  2WII B;  5FKA C;  1QE6 A;  5CGK A;  3K57 A;  3GTQ B;  3RD4 A;  3R8B A;  5KGU A;  1C4Q A;  3QJY A;  2C5C A;  4RGO S;  5BN4 A;  2R61 A;  4C3H B;  4C2M B;  1W6J A;  4QUC A;  4KN7 C;  3M4O B;  3DEO A;  3NUC A;  1PZJ D;  2XNA C;  1TT2 A;  2E2H B;  3BDC A;  2JEA I;  2X69 A;  3CKI B;  5I4D A;  5M9O A;  1PRT F;  3H94 A;  1H9S A;  1CA6 A;  5IIF A;  2L5T A;  2EPB A;  3OSO A;  5EGT A;  3SVM A;  3MXU A;  3S2H B;  1QG7 A;  2B2T A;  4XT1 B;  1VMP A;  4KKS A;  1H9J A;  4J1M A;  2VXW A;  2IWH A;  1DM0 B;  2C9O A;  3M4Y A;  1NR4 A;  3MC0 B;  1EY6 A;  2F0E A;  3V2T A;  3NWT A;  1AEX A;  2KCN A;  4QMG A;  3SHL A;  2EJF C;  3O13 A;  3E5S A;  5JEA G;  4FF3 A;  3ITP A;  3GTJ B;  2O2L D;  1JR0 D;  1EU3 A;  2E2D C;  4QUF A;  4DGZ A;  5J1Z A;  1HA5 A;  3VR2 A;  2XIW A;  4RKL A;  4HMI A;  1FYC A;  4O1N A;  1FNV A;  5KRU A;  1E2V A;  3K7A B;  2YU9 B;  2QEJ C;  4UAI A;  5A35 A;  3TBI B;  2ENB A;  1SDF A;  3NE5 B;  2G9D A;  1UEA B;  4EQP A;  4E6I A;  3ND9 A;  5ELD A;  1ZXT A;  3OIQ A;  1TS5 A;  1X3P A;  1CK1 A;  2HCC A;  1HTP A;  2VUM B;  2LKV A;  2PYK A;  2A69 C;  1J8I A;  2R93 B;  1A2U A;  2OF1 A;  5C0X G;  4CKB A;  2LFN A;  1EYD A;  3NHH A;  3Q22 A;  3X3M A;  3QIA A;  3CU7 A;  4J6H A;  1GUT A;  3DWQ A;  1XWE A;  2F0P A;  1O80 A;  2K05 A;  5M3F B;  1EY0 A;  5JEA J;  3TZU A;  5I2X A;  3NXW A;  3S1R B;  1H9R A;  2KJX A;  4B9X A;  2DNE A;  2F4I A;  2L55 A;  3KUP A;  5C4H A;  2WIN B;  3TDQ A;  5EPJ A;  1Q3L A;  1T5E A;  1I4H A;  3I4N B;  3GO5 A;  5DM6 3;  1SND A;  1TWH B;  1WTO A;  4C3J B;  2EYH A;  2MUY A;  2A68 D;  2E75 C;  1A3T A;  4RHS A;  1KLG D;  3OOC A;  5J39 A;  4IUU A;  4YIJ A;  1TS4 A;  2L4N A;  4KKT A;  1AN8 A;  2E74 C;  4CBV A;  3FPP A;  3PUX A;  3I91 A;  1ZKO A;  4ZQ3 A;  1DON A;  3OW7 A;  2XRS D;  4IQZ A;  4KK7 A;  3OMG A;  2L12 A;  3I72 A;  1WTW A;  1F2Z A;  1GUO A;  1CI3 M;  5C0X J;  3K0Y A;  4KJO A;  1EIH A;  2H4O A;  3NBH A;  2BE5 D;  2EE1 A;  3GV3 A;  2I07 B;  3MFG A;  2B8F A;  1A15 A;  5FO7 B;  3P7J A;  2Z8L A;  2FIN B;  4AYB B;  4ILW A;  2F1M A;  2Z4H A;  5IT9 L;  1JCK B;  1PMR A;  1RHP A;  3BYT B;  3DWP A;  2B2Y A;  3BS1 A;  2EY1 A;  1HFG A;  1CHQ D;  1WD1 A;  1EY7 A;  1IKM A;  2RSN A;  1TY0 A;  2F0N A;  1VF5 C;  5C3W A;  5M5X B;  3K6O A;  1MI2 A;  1EY9 A;  2X6G A;  2ZXP A;  4H7B A;  1IYU A;  1U4R A;  4M8A A;  2F0F A;  1V1P B;  1BO0 A;  2B2V C;  4FXD A;  5I9P A;  1ICW A;  1I4X A;  2F0K A;  1SNM A;  4Q5V A;  1LTT D;  3D6C A;  1I6V C;  2JA7 B;  1QCB D;  1JOK A;  3D4W A;  1FNU A;  1H9M A;  2XSC A;  4BBS B;  3TP7 A;  1D1K A;  1ET6 A;  4OO1 I;  1BCP D;  2WP8 J;  1TY2 A;  2FHT A;  1U4P A;  1XTC D;  4A3G B;  1XXG A;  4I7Z C;  3RUZ A;  3FMC A;  1GUS A;  3T16 A;  4ZRZ A;  1C48 A;  1FNW A;  2EYJ A;  1QNK A;  2NYZ D;  5FK9 C;  2NB0 A;  1JOO A;  2JSO A;  4N9T A;  2JXM B;  4KD4 A;  4A3M B;  2DY8 A;  5EPL A;  2CW0 D;  4PMW A;  2F0Q A;  2IX3 A;  4KMU C;  2NZ1 D;  3ERQ A;  4OIK A;  4B08 A;  4F7X A;  2DY7 A;  3DWA A;  3T51 B;  3GTO B;  2AUK A;  4G4K A;  2VNU D;  2F0M A;  5CYU A;  4DFA A;  5FOB B;  1SE2 A;  1AW7 A;  1PRT B;  1LT3 D;  3KK7 A;  4C3I G;  3HS0 C;  2K6A A;  4RGT A;  1RJT A;  2EYM A;  1L0X B;  1GHK A;  4S3S A;  2F0D A;  4BY7 B;  3BDO A;  4DU9 A;  5G3L D;  2PQE A;  4XYQ A;  3HOZ B;  1NUC A;  1V8Q A;  1MGS A;  1RTO A;  1R4P B;  3FKI B;  3OIP A;  1TWG B;  1LTA D;  4IUV A;  1LTS D;  1JWM D;  3S14 B;  2I46 A;  2LMC B;  4XYO A;  4EVO A;  3MZ5 A;  4DN4 M;  2M00 A;  4ZKB B;  3BG3 A;  4RWS C;  2CHB D;  4RHR A;  1D1I A;  2VB3 X;  3M7N A;  3TN2 A;  5KEE A;  3EFX D;  3L7Z C;  3K5N A;  4IFD J;  5CBE E;  2D9U A;  3I4M B;  3A7A B;  1BF4 A;  3FPU B;  1B9N A;  2AQ1 B;  1JWS D;  2NVY B;  1EY4 A;  1HUM A;  2BDO A;  3OHX C;  1UAP A;  1HHV A;  3QWN A;  4KN4 C;  1RTN A;  1O7L A;  2NTS A;  1RF2 D;  2KEC A;  1EQV A;  3SEB A;  1TU2 B;  5IGB A;  3C3L A;  3SK5 A;  3K5L A;  4DAY A;  2JA5 B;  5D3D A;  1IKL A;  4NMZ A;  1CHP D;  2J0T D;  1GUW A;  3MXG A;  2EY5 A;  1Z6H A;  5IGC A;  2HDM A;  2BOS A;  1SNO A;  3SE0 A;  3JAM L;  3J81 L;  4O42 A;  3G7L A;  1F2Y A;  1F2M A;  4BS9 A;  2O5J C;  5EKL A;  5CMD A;  4KY7 A;  5LL6 X;  2D5D A;  1BOS A;  1F2L A;  1ENC A;  1TVX A;  1TWC B;  1EU4 A;  2SEB D;  3R93 A;  2ZT9 C;  3OWE B;  2Q8R E;  1SYB A;  1II3 A;  2O4X A;  1STH A;  4HAE A;  2AQ2 B;  3L3O C;  1EYA A;  1I4P A;  3A56 A;  4XQJ A;  1SE4 A;  5KND A;  5IOC A;  4RGM A;  2M9V A;  1QJO A;  2CQA A;  3KLS X;  4C56 C;  1AP0 A;  1SYG A;  1CZW A;  3A54 A;  4K6L A;  2MGS A;  1G6Z A;  2MP1 A;  1STN A;  2A68 C;  1JE4 A;  3QOL A;  4IAL A;  1QWY A;  1SJE D;  1STA A;  4RAU C;  2EY2 A;  4K5W A;  4TSS A;  1G29 1;  3FRP B;  2KED A;  1A3V A;  4C1N K;  5ELF A;  1SBB B;  2WAQ B;  5ELB A;  3VR3 A;  2B2T C;  1KAA A;  1T5X D;  4PMB A;  3HGB A;  1EWC A;  3T53 B;  2A6E C;  2VB2 X;  5KIX A;  1LT6 D;  3CRK C;  2NUC A;  2FMC A;  5C3E B;  2ZXO A;  2L0C A;  5ISR A;  1HUN A;  1E0B A;  4RCN A;  1I4G A;  2BE5 C;  1TS2 A;  4HMJ A;  1X3Q A;  1E2Z A;  2BDN A;  4KY6 A;  4C3H G;  3C2P A;  3U9S A;  3V96 A;  1ESF A;  3PUY A;  1RD9 D;  1LTI D;  4H44 C;  4NW2 A;  1BXT A;  3D4D A;  4DK1 A;  1ILQ A;  1HCZ A;  3Q23 A;  5NUC A;  1GUN A;  2KA7 A;  5CV7 A;  4ODG A;  2J4X A;  2PZU A;  1EEI D;  3S1Q B;  2K5D A;  3I4L A;  5DM7 3;  1ML0 D;  1OXX K;  3J7A F;  2WAC A;  3OWF A;  3S1N B;  5CBA E;  2RVL A;  4HCE A;  3F2U A;  2PNR C;  4WFN 3;  1PFM A;  1HPC A;  1EY5 A;  1DXM A;  1M4V A;  3R2I A;  5HUR A;  3HEJ A;  2A5H A;  2K04 A;  3S16 B;  2WV6 D;  2NVQ B;  3RMH A;  1DZ1 A;  1D5X C;  2FJ2 A;  2EOT A;  5AFW A;  5A2Q E;  1F9P A;  1K8M A;  3NSW A;  1PYW D;  2B39 A;  1NCV A;  4IZ8 A;  3D8G A;  3OPO A;  3R3O A;  3CHB D;  5IOD A;  2OT2 A;  2NN6 H;  4BA1 I;  4F8M A;  5ELC A;  2BCO A;  5EKI A;  3Q6S A;  2L9H A;  3H0G B;  3UI2 A;  3VYT A;  1CZG A;  1NR2 A;  1D5Z C;  2RA4 A;  1BCP C;  1Y1W B;  1IHZ A;  4DXG A;  1F9Q A;  2PW5 A;  1CFM A;  4WRD A;  2JE6 I;  2KQ3 A;  4F87 A;  4NP5 A;  3TZD A;  3GTG B;  2L1B A;  3Q0A A;  4X3S A;  3NBI A;  5C6A A;  5KYL A;  2K1B A;  3BVM A;  3I70 A;  4HR7 B;  3GQB A;  3T13 A;  2R7Z B;  1AFP A;  3EQL C;  4ZLT F;  5DEH A;  2CW0 C;  5CC4 A;  1HFN A;  3X3N A;  4N9P A;  1IW7 D;  3NWS A;  3VR6 A;  5T1I A;  3AMU A;  2A6E D;  4FP5 D;  2KCC A;  3C1F A;  5K36 H;  1EEF D;  5TSS A;  4K5X A;  1JQY D;  4XQQ A;  2NN6 I;  3JAM E;  1QIL A;  1MD2 D;  3EA6 A;  3TP5 A;  4X3T A;  1LTR D;  4OL7 A;  4V0B A;  2AWO A;  1KDB A;  4MN3 A;  1Y69 U;  4CJ1 B;  1RDP D;  2BA1 A;  2B2Y C;  4C1N I;  3J80 L;  3EVQ A;  4R8N A;  4RFB A;  5CV9 A;  2PZW A;  1DOK A;  4C3J G;  2XRQ D;  4FXG C;  4IUP A;  1SSO A;  1BDO A;  4JBW A;  1ILP A;  3E6Z X;  1Y8O B;  2PZT A;  3M3Y B;  1ENA A;  1K83 B;  4IN3 A;  1OXS C;  1OO9 B;  1S5D D;  3OMC A;  4H0L C;  1V43 A;  4ZYS A;  3W2D A;  3WOE A;  5JOB A;  3MAQ A;  3HG9 A;  5C5M A;  2F0T A;  2EDG A;  1YNN D;  2K32 A;  2MJ8 A;  1CA5 A;  4H13 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...