4ZL1A

Crystal structure of human dihydroorotate dehydrogenase (dhodh) with 18x at 1.86 a resolution
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
365
structure length
365
Chain Sequence
TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human dihydroorotate dehydrogenase (DHODH) with 18XYW at 1.86 A resolution
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 139
structure length 365
sequence length 365
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zl1A00
3LRMA 2HSAA 1I2PA 2Z6IA 3EWWA 3ZFHA 3KX6A 1JUEA 2O7QA 1OJXA 1L2UA 5CKSA 3B03A 4JX5A 5DY2A 3PR2A 1OYCA 2V2HA 4DF0A 2PRLA 1DQXA 4FNPA 4NUWA 2C0AA 3LERA 4POCA 5I3HA 3PBWA 2CLEA 2E6FA 4RX0A 3NYZA 1F05A 1FDYA 1FDJA 3ATZA 4JTJA 3HJZA 3DFTA 3NA8A 4NJHA 1TQJA 3QMTA 2E6AA 3G24A 2IQTA 1OABA 4O0KA 3EWUA 4N02A 4K8EA 3FKKA 2CZDA 4EWND 3NPWA 2VEPA 2I9EA 1W37A 2CWNA 1W5PA 3GDTA 3CPRA 3P81A 3P5ZA 2J27A 1P4CA 2YDAA 4M6QA 1JCJA 1JJKA 3W1PA 2G97A 3KVKA 4AMAA 5FF2A 3Q37A 5HUOA 2QUVA 2YGYA 3R13A 4RCXA 4MPQA 3RLVA 4HHPA 2DORA 4GXMA 4K38A 3JS3A 5EA9A 3GIYA 3W7KA 1PL9A 4IQLA 4AB4A 2JBMA 3BLIA 2ZFAA 3DFOA 1KFCA 1OHLA 2C6QA 3W1UA 5HR6A 5FEPA 4UFLA 2J88A 2YYUA 4NJJA 1I4NA 3R2GA 4JDYA 4OBTA 2E09A 2RFGA 3BLEA 3NPXA 5HWNA 1W3IA 5AHMA 1EEPA 3CEPA 1OFAA 1EP3A 1TSIA 3HPZA 3QC3A 1G7UA 2ABBA 5AB3A 1VYSX 3QRHA 4AHQA 2QDHA 4MKNA 1K8YA 1G4EA 2GVJA 3E02A 3TDFA 1OX6A 4CQ8A 4HSOA 2CZ5A 1DHPA 3SSJA 2NV1A 3TMLA 3GYEA 3L0KA 3IVTA 1OFPA 3FYPA 3LI0A 5FI8A 5AOUA 4R7JA 1SFJA 1FCUA 4O0ZA 1A53A 2VEKA 5D38A 1XBYA 2VEMA 4LNYA 4FEZA 3TSDA 3KRZA 5EPDA 5I3FA 1X7FA 4MYXA 1TCDA 3B0PA 4R34A 1SZGA 4O1BA 4JS3A 3FJLA 1PVNA 3MO7A 1TV7A 5I3GA 4OHQA 3LHVA 1RQHA 3N19B 3ANYA 2GUUA 3VKJA 2R8WA 1EIXA 3L5AA 4K36A 4MZ1A 1ZAJA 5G1TA 1DQWA 3BG9A 2V8ZA 3OIXA 1YLVA 4RV8A 1GVRA 4N6FA 3T4CA 1K7EA 4MYAA 2ATMA 2ZRXA 4KFNA 3VCRA 4TU1A 3G1SA 4LT9A 4UTKA 4UTWC 1KV8A 3W7RA 1OYBA 1VCGA 1WV2A 1TTIA 2QF7A 4XBSA 3EXSA 3S5ZA 1YDOA 1TJRA 3GZ3A 4Q33A 5D2TA 2E5BA 2FB3A 1OX5A 1YXYA 2V30A 3M5ZA 2R14A 2FPVA 1ZY9A 2QJGA 5FEZA 1E51A 3W1MA 1TRDA 1IIHA 1TQXA 5HINA 3KOFA 5BMWA 1DL3A 4AHOA 1LBFA 1G4SA 2FTPA 2OJPA 3S6DA 2HS6A 4M7TA 4RZ6A 4M7SA 2Y7GA 3KRUA 1LLWA 4J9JA 4Y8FA 1HFBA 5LSMA 3HQ1A 2TRSA 3M5VA 3W7MA 5KSWA 5DELA 3CU2A 4E38A 1P5BA 3LGEA 4IWWA 3RF9A 2OZ0A 1LOQA 4Z08A 3LCXA 1DVJA 1TTQA 5C2XA 4N9BA 1QMLA 4HKPA 4I7WA 1TMHA 3DXIA 4CCCA 4C1LA 3TA6A 4LW7A 1YPFA 3NL2A 1DJNA 1W0MA 3U8GA 2RDWA 5IM51 1AL8A 1GWJA 1PV8A 2RDUA 2YW4A 4WY0B 3NL3A 5G2IA 2X1SA 4JY9A 3W7LA 4TMBA 1QOQA 4LS2A 3UYCA 4ORMA 5I3IA 4NX0A 3G3MA 4O14A 3NO5A 3MBFA 4PODA 3DU0A 3G1HA 3STGA 3C6CA 1EP1A 2QCLA 4WY0F 4I7VA 3CWOX 4IX0A 1W5MA 3IIPA 1ZHAA 3GB6A 3LI1A 4M6PA 3SGUA 2V82A 2BZNA 2B7NA 4FHAA 3G1FA 4TMCA 4B5NA 1D3GA 3MWAA 1GTEA 1MSSA 2FPTA 1KM5A 1DORA 5DCEA 3RLUA 4GUFA 4EIVA 1LYXA 2V9DA 3T40A 3L65A 3B05A 3UWVA 3UQNA 1KTCA 1P0NA 2Y7FA 4GFSA 5E0KA 4EF9A 4IMGA 3SJ3A 1VPXA 1A5BA 2B7QA 4X9SA 3I65A 4K37A 4ZQOA 4JYDA 2CW6A 4DELA 2NWRA 4XWUA 5D09A 1G4PA 3MJYA 3PWAA 2C14A 1W5OA 3SFKA 1Z48A 3NDOA 1UUOA 1VCVA 3UWUA 3ZWTA 2G95A 1PHQA 3GDRA 1LORA 1A5SA 4X2RA 3DI1A 5A5WA 4BI7A 4DF2A 2NUYA 2Y62A 3EWXA 5F4WA 1GVSA 3STEA 4JTTA 1FBAA 4O28A 1VHCA 3QQ1A 1K8ZA 1P1XA 1OVDA 3T44A 3FOKA 3R5EA 1XDMA 3TSBA 3BPWA 4D2JA 1XC4A 5CZJA 1G6CA 5D37A 4AH7A 1I2OA 3EWZA 2HMCA 1XBXA 3IGXA 3LHUA 1L6SA 3W1LA 4LV4A 5J5DA 1VH7A 3JRKA 3UZ5A 4O1AA 3W6YA 1SZEA 1J5TA 1H62A 3KVMA 3GAYA 4I7UA 1RPXA 3IRDA 2WO5A 4OE7A 3KFTA 2VELA 2P1FA 3LLFA 2NXIA 3EWBX 4UTUA 2VFEA 4MY9A 4O57A 2WKJA 3PG8A 1EB3A 1EX5A 2H3BA 1SO5A 4UFKA 1LM1A 1JVNA 4PTNA 5HUPA 3TAOA 2YSWA 2PCQA 1A5AA 4CLMA 2OX1A 4JXCA 2C16A 4LRTA 1YXDA 3STFA 5AYYA 3WJZA 2NUXA 2DZVA 4JEQA 2CLOA 3LTPA 3W84A 4KKXA 4MFEA 2BLEA 1RV8A 2VEIA 2F7FA 3CTLA 1G7VA 5DBTA 3L9CA 1VR6A 3EX4A 4EVZA 4M6VA 2QCFA 4OV9A 1LBLA 1VYRA 1DOSA 3BW3A 2E5CA 4RK8A 3CB8A 4JY8A 4ORIA 3GLCA 2A1YA 3NZ1A 2C19A 4LS1A 3W23A 1BTMA 2ALDA 4Y9AA 2AQWA 2H3DA 4HT3A 4WOZA 3MUXA 5TQLA 1M7PA 3TFXA 2NZLA 4S2BA 5DXXA 3G3DA 5LNSA 1SW0A 1T0OA 3PSWA 1SUXA 4NJKA 4Q4KA 2KZHA 3FIGA 3PUEA 4NNBA 2QDGA 4JX6A 3W83A 2NX3A 3YPIA 1EWEA 4UTHA 3L5LA 3L0NA 4U28A 1GYLA 1PIIA 2E1DA 5L9FA 1S5TA 3CLMA 3TV8A 4TX9A 4IOTA 2EHHA 3L66A 1FWWA 2YXGA 2B4GA 2NXGA 5E93A 1ZAHA 3TUUA 3H53A 4X22A 2Y70A 5FESA 4BI6A 5MHBA 2FPYA 2C1HA 1C29A 4CNOA 2EPHA 1LLZA 1OFRA 3T55A 5LGXA 4E2BA 1NAL1 3G8RA 2ZA1A 5DLCA 5IBXA 1QFEA 2QKFA 5BMXA 1YTEA 3SZ8A 4E2DA 4W9TA 1WXJA 3SY5A 1GVFA 2VFHA 1SZNA 1UCWA 4MIMA 2W79A 3S5YA 3P5YA 3WJSA 1IGSA 1LP6A 4LY8A 4JTHA 3NQ8A 3NZRA 1R30A 1Z44A 2V5LA 1X8FA 2VKZG 4H6KA 2WSRA 1H1YA 1NSJA 2CLHA 3G22A 4JIQA 4O4WA 3FLUA 3INPA 1RQEA 4Z0JA 4M19A 3HB9A 6ALDA 3MBDA 4K7VA 4L4MA 3C0JA 4IMFA 1IF2A 1VJIA 2P0OA 1CX9A 1W3NA 1WAUA 3W2LA 3BARA 5D02A 1UB3A 2C3ZA 2A6LA 3TMQA 1F74A 3VE7A 4JYEA 3NQ7A 5A8GA 4TO8A 2V2DA 3P8JA 4OWGA 3C4UA 1T99A 1UUMA 4ALDA 5LNVA 5EKYA 4ZQPA 1O4UA 3CWNA 3EXRA 1HUVA 1DJQA 4ZVJA 4RZ5A 3G1AA 5F2MA 3NGJA 3L21A 2QAFA 3B04A 1XDLA 1H7XA 1X6UA 3UY7A 4O19A 4IX2A 5AHIA 5K7JA 4JTEA 4UTIA 5K2ZA 5FF4A 2B0MA 3IIOA 1B57A 2ZRUA 5FF7A 5AC7A 5F4SA 1VQTA 2Y63A 1GJPA 4JYFA 5LGZA 1F5ZA 4UTWA 1LZOA 3M6YA 3L67A 3LB0A 3W7DA 1F6KA 2GQAA 1FQ0A 1XFBA 5E1QA 1PCWA 3I7QA 3NOEA 3I6RA 3QM3A 4N9EA 5H2ZA 3MP5A 1DBTA 3PG9A 2R91A 4YLWA 1KW1A 1SO3A 1J4EA 2DZPA 3F1QA 3O15A 3M44A 2RDTA 3KVLA 3PC0A 4DPQA 1KLZA 2CLFA 3UWYA 4N2YA 2ZDRA 1GTHA 3QMSA 1IIGA 3LRKA 3VNDA 3WJWA 4UUIA 1H7OA 1VRDA 3AJXA 1KV5A 1JCXA 1HO1A 5CGQA 4A21A 1FCVA 4JTIA 1QCWA 3ABRA 3P62A 3W7JA 4UMAA 3UY8A 3LXAA 2QR6A 5CSSA 1XXXA 1W5NA 2AAMA 2QJIA 3NXFA 2WNQA 1TPH1 4LUJA 3LXBA 5G4WA 1WBJA 3PVFA 1WDWA 2RH9A 3W1QA 4R53A 1FWSA 3W85A 1Q6LA 2PRHA 5D04C 3WK1A 1SQ7A 4RXGA 3C2OA 3HGRA 3NG3A 1ZNNA 3C2RA 3MHFA 3DH7A 5FEWA 3CM4A 4NZJA 1GYNA 3W2MA 3P74A 4NT0A 5K9CA 4WX2A 4KFOA 3ATYA 3LBMA 4GBUA 1JQVA 3PUDA 2ZQ0A 3BG5A 3W76A 1BKSA 3O8AA 2EKCA 3C8FA 3THAA 4GUJA 4UNKA 4XKYB 3QMRA 4UTJA 3TU9A 1JR1A 5F4XA 3S42A 1BWKA 2YZRA 2A6NA 1HTIA 4HPXA 4AEOA 1TTPA 2GOUA 1OK6A 2H8ZA 1LDCA 1ADOA 5LHEA 3OVPA 3M7WA 1QDSA 1G67A 1J2WA 2R94A 3FEMA 2DJXA 5LKYA 1TV8A 5KINA 4BI5A 2V0TA 4UMBA 5EL1A 5HR7A 2RKXA 4UTMA 2CLLA 3WJYA 4LVBA 2J9YA 4RXFA 5CPLA 3I7SA 5AFDA 3LCIA 4UFMA 1M7OA 4DF1A 3EX6A 1H7NA 1ML1A 3DFQA 4LU0A 5CPOA 2Y7EA 5D32A 1VYPX 4FIQA 3EB2A 4FNUA 3HPXA 3M43A 5D2XA 1G69A 4PL2A 5BOOA 4JTGA 4XTDA 2ZBTA 5K9XA 4AXKA 3TJXA 3LHWA 3W1NA 2X2GA 3W1TA 2Y85A 1ZAIA 3TAKA 1R47A 3W7PA 1HG3A 1QNVA 1L6YA 4QM1A 2X1UA 4PEKA 5D2VA 4MJZA 5F2IA 2XN0A 5KZMA 4UFJA 1L6WA 2RHGA 4XUGA 2ISVA 2CLKA 3K30A 6TIMA 3RK8A 4LVDA 3TJLA 4HNTA 4ZQNA 3QF0A 2A85A 3E0IA 3LV5A 4KWWA 3G8EA 5BW6A 3NR0A 2ZCGA 3HIJA 3EWYA 5C5YA 1SW7A 3TQKA 1R2SA 3TW7A 3ZWSA 3IEBA 3OBKA 1JUKA 3W2KA 1F7BA 3FS2A 4WOQA 4NXSA 4YWIA 1KM0A 3HF3A 1KTBA 5EY5A 5K4XA 1UASA 3BGJA 1X1OA 4UXDA 3W7OA 4A22A 3JR2A 1CI1A 4NJGA 2DJLA 5HQEA 3GDKA 2X1TA 4TR9A 3Q94A 4LS0A 1SR9A 1GVOA 2ATSA 1H7RA 2JGQA 4PFMA 1LROA 2E77A 2ZYFA 4Y6GA 2GQ9A 4BK9A 4JGDA 3NAVA 3O16A 2V5BA 3W71A 4CNNA 2P10A 3M5XA 4AVFA 3H54A 1AW5A 1GT8A 4P61A 3TK7A 3IVSA 1W31A 4BWLA 1W56A 2QCHA 5U4NA 3HG2A 4IMDA 1NVMA 3A21A 1WBHA 3U6WA 1TPUA 2C13A 2VFIA 3NQEA 1TPWA 1MZHA 3LTYA 3FJ6A 3MI3A 3A5VA 4UR8A 3ABOA 1QPQA 4UFIA 3EKLA 1QPRA 2WJZA 4FIRA 3A24A 4O16A 2Z6JA 1AW2A 1NF7A 2QJHA 4XKYA 1OK4A 3EEGA 1VZWA 3P61A 3ABQA 1VGAA 4H3DA 3LCFA 3OG3A 3PBVA 1Q6OA 1H50A 4BF9A 4UIOA 4O12A 1KM1A 3NL5A 1BWLA 1FWNA 4UTTA 4HNUA 5IBXC 1KLYA 1QO2A 2FQIA 3Q58A 4YCPA 1GEQA 1TRIA 5AN7A 4DBEA 3B8DA 5G1YA 1LRTA 1H60A 3CHVA 3LX9A 3KHJA 3P7YA 4NJIA 3LLDA 3MMTA 3TXVA 4JD4A 2WNZA 3GAKA 3A5FA 4NVTA 3S8HA 4S1FA 3OVQA 1TPB1 4A3UA 1TYGA 3W7EA 3B06A 4O50A 3HG3A 4PL1A 4IMEA 3S1VA 3W2NA 2BSLA 1R46A 4OU1A 2Q3OA 1PE1A 4DXVA 2WQPA 4GUHA 3QPYA 5K3VA 3NQ2A 5G2WA 5EMUA 3G0XA 4MLJA 1KFEA 4LC6A 1MXSA 4O10A 4Z1AA 1ZCOA 1I45A 4QNEA 2XN1A 2Y61A 2J24A 3BW4A 3T7VA 4MOZA 4FNQA 4ZL1A 3O06A 3TE9A 3EX3A 3UXAA 3I7RA 2TSYA 1ALDA 1EUAA 3UD6A 1W5QA 1LTDA 4FNRA 1OFEA 1GPWA 1ZJIA 3QZEA 2WSYA 4HIBA 1THFD 1MEHA 1PS9A 3DFNA 4LOCA 3RU6A 5C54A 3V75A 4MUZA 3MHUA 2Y88A 3DHFA 3WK2A 4K6AA 4JTLA 1K7XA 3A9IA 5AHFA 1Y0EA 4UC5A 1W54A 4GE8A 4LC8A 4BWLC 1H1ZA 4O18A 1ME9A 2DZTA 2NLIA 3OHIA 4UCGA 3DFSA 2X1RA 2A7PA 1KTNA 5FF0A 4PA8A 4FX6M 4UFHA 3W1RA 5BRBA 1KM4A 4JTSA 3WK3A 2YR1A 1ZFJA 2NUWA 3DZ1A 3EX2A 3B4UA 3S0CA 4MZYA 3FFSA 4RZ4A 2A2IA 4FO4A 4R33A 4O11A 4QAIA 1QOPA 4CNPA 3G18A 1LRQA 3AO0A 1IXOA 1JCMP 2LLEA 2QUTA 5D03A 3O1NA 3NL6A 3KRSA 3G1VA 1M6JA 4QSHA 3G1DA 3PULA 4ADTA 1OFQA 2YFOA 4ICNA 2TMDA 5DCBA 1FWRA 2DP3A 1SZFA 1Z42A 2FIQA 3UWZA 2A7NA 1B9BA 1YTKA 2ZRWA 3QSRA 4UTTC 3LBCA 2FB2A 3PUOA 2FFCA 1ZALA 2CFFA 2QUUA 5CPMA 3N2MA 2CZEA 2W6RA 5I3JA 4JX4A 3HGJA 4WQ6A 2EGZA 4DEFA 2GJNA 1JCYA 2ZA2A 3QEZA 3WK0A 4LTSA 1ICQA 1JUBA 5F1UA 4LVAA 3IGSA 3NQDA 5LHFA 1AL7A 4ONVA 4PC8A 1IXNA 1I2RA 4GUGA 3QW4B 4N4QA 3M47A 2J9XA 4GWEA 1FCBA 3UNDA 3QJAA 2NV2A 3E96A 4JTKA 4FNSA 3M16A 1ME8A 2CLIA 3S1XA 5LZLA 3DENA 4YCOA 1SSDA 4UNLA 4XTIA 1YYAA 3BW2A 4MFDA 2X16A 2HTMA 3MHGA 1SU5A 1IXQA 2Z2UA 1V5XA 5L6UA 1SPQA 3VFLA 1B4KA 3LCGA 4P2VA 1WQ5A 1TPFA 3HGSA 3W87A 4LWWA 1YDNA 1MEIA 5DCDA 1D3HA 3W07A 2ISWA 3STCA 3LCLA 3L2IA 4DO5A 4FF7A 3UXDA 3GK0A 4ZZ9A 2ZZ4A 1KBIA 1TPDA 3R12A 3SIZA 2JKEA 1RR2A 2ZZ6A 1TB3A 4OV4A 1RQBA 5DY3A 4K7YA 4PCFA 3C61A 4AHPA 2QCDB 1S5VA 3NM1A 2A5HA 3FA5A 3IIXA 4AF0A 1Z41A 3HMJG 4E0CA 1WYIA 5DBUA 4KFPA 3IGUA 1GG1A 1NFBA 4ZQCA 2DZWA 3O6CA 4EF8A 1ICSA 3LHZA 2Y6ZA 4QISA 2FLIA 1I2QA 3TCEA 5CG7A 2E6YA 2Z0IA 4EOUA 5KITA 4A2RA 4Z1BA 4Z1CA 1GVQA 1V7YA 1G4TA 1L9WA 3P67A 2CZFA 3NQAA 4WXYA 1VLIA 2EAWA 3IIZA 5D2WA 3N73A 3S9YA 4IMCA 1S3HA 3BK0A 4RR4A 2DZSA 2GPTA 3T78A 1EPXA 2Y7DA 3TH6A 2QCNA 4GJ1A 4DQWA 3HG5A 3W2JA 1JQXA 4IXHA 4WY0A 3NM3A 1SW3A 3UPWA 3UWQA 3W7HA 4GNJA 5CPNA 5FF3A 4RLIA 3PF3A 4N9CA 3W3OA 4UTLA 5AYXA 4BFAA 3LCHA 3O6DA 3TNOA 1EP2A 4O15A 1XKYA 2QCCA 3OEXA 3QSTA 2H90A 4CCDA 1LRNA 2GJLA 4Y96A 4YL2A 1QPOA 3W70A 2DU2A 5TIMA 4L4LA 1KA9F 4QITA 1PHWA 3S5NA 3HBLA 2QAPA 3PY2A 3S1WA 2G5WA 3W73A 3W74A 4NNCA 5D05A 3M5YA 4AWSA 4ML9A 4IPIA 8TIMA 2GVGA 2NXHA 3M9YA 4IJBA 1XM3A 3M1ZA 3NPVA 1S5WA 3SW6A 4HNVA 2A21A 4QJ1A 1Q45A 3MP4A 3GXTA 1D9EA 3N3MA 4ZQRA 3TQVA 3F03K 3M0ZA 4ZMGA 3HO8A 2CLMA 4OT7A 5HULA 5J5RA 3BG3A 1BEUA 1A5CA 2ZZ5A 3WFAA 2PURA 4MY8A 3PS7A 4O8RA 1R2TA 4NU7A 1JCNA 1EUNA 1H7PA 3LHYA 1VLWA 3HGOA 3TC7A 1FCQA 4AWTA 2DZXA 1WA3A 4DPPA 1FUYA 2I14A 3E12A 1MO0A 1AG1O 3UWWA 3TC6A 3GDLA 3W7NA 5G4EA 3IV3A 1H51A 2TYSA 1Q6RA 5HWJA 1YPIA 2ZRVA 3P8IA 1CW2A 5F2LA 2BWGA 2ZTJA 1K03A 3TIMA 1QPNA 3C2EA 3W7IA 4IUOA 2D73A 5AC6A 1XUZA 3NNTA 4WZHA 4QQ3A 2A0NA 2ZRZA 2WPBA 2G96A 2OMAA 1O94A 1DV7A 3I68A 3DFPA 5GVJA 3L0GA 1TREA 4FX7A 4O54A 2X30A 3L5MA 4WJEA 3C56A 4O53A 5T26A 1P0KA 4MJMA 3G0SA 1FX6A 4Z0SA 3N9RA 3O05A 3E49A 1OFDA 1FY6A 5KMYA 1O95A 2BXVA 3L68A 1VHNA 4CCEA 3NQFA 3PBYA 3S1UA 2ZZ2A 2A4AA 2E68A 5CZ0A 1KBJA 4Q32A 3W9ZA 1LBMA 1XBVA 3GXNA 1WX0A 3CT7A 2JK2A 1YADA 1SO6A 3W88A 1RVGA 3WJXA 1F76A 1W1ZA 2ZZ1A 1QWGA 1TV5A 1WOBA 1EA0A 5HNRA 1B3OA 1H7WA 3GX9A 4LVFA 1H5YA 3DAQA 4FX8A 2QEZA 1N55A 1KM2A 1KFBA 3MI2A 5ABTA 5SWUA 3A22A 3BGGA 3ELFA 3NQGA 3TX9A 3NQVA 1ME7A 4H4IA 4WXZA 2YX0A 1A50A 1JULA 5H91A 4O17A 4WUIA 3SI9A 3V1PA 1AMKA 4MZ8A 4AWUA 4A29A 4O52A 2Y89A 4PH6A 4X3ZA 5AHLA 3FKRA 3NPUA 3NQ6A 1W8SA 4IPJA 3LOTA 3CQ0A 1XI3A 3GDMA 1OX4B 3C2FA 3QH2A 3TKFA 1B4EA 5K9DA 1OX4A 1I2NA 1VCFA 4AAJA 1GOXA 3TQ0A 2ZA3A 3KAOA 3W2UA 4LV9A 1OFBA 1TPVA 5D33A 3CIXA 2UV8G 3N14A 1TIMA 4NX5A 4CQAA 2WV8A 4Y90A 1OF8A 3GVGA 3P82A 3CIWA 1XL9A 2TPSA 1N7KA 5G5IA 4RKAA 1QR7A 3P84A 3SR7A 2Q8ZA 3QQ0A 5F2GA 3DKLA 2EF9A 4NQ1A 3RNDA 3HOJA 3CEUA 2YW3A 3RFAA 4UMCA 3THQA 1OG0A 4IXXA 1F6PA 4DO6A 2HS8A 1XUUA 4JTUA 2ISSA 2VOMA 1M5WA 1IXPA 1OFOA 2PE4A 3C52A 3GR7A 3TROA 3W7GA 4GUIA 5LNRA 5KZEA 1H61A 4ADUA 4MVAA 1HO4A 5C6MA 2FJKA 2VFFA 1SSGA 3PB2A 3TSMA 4CQ9A 1W3TA 2FDSA 3DGRA 3LDVA 3USBA 2PRMA 4C1KA 4O13A 3W1AA 1XCFA 2NWSA 4JICA 1FDZA 1K7FA 2J9ZA 2F84A 3GKFA 3S5OA 3LV6A 5LNWA 2J6XA 1NF0A 3W7QA 4U4MA 5TBOA 4I9AA 4O1CA 1YTDA 3HG4A 4GRSA 5CZSA 1H63A 4N9DA 1EWDA 3G1XA 1RD5A 3W7CA 4DO4A 3N2XA 5I3KA 5HMSA 1AK5A 1TJPA 1MEWA 1I8JA 1UBSA 3ZS4A 1K02A 3C2VA 4NZFA 2ABAA 1JCLA 4FXRA 1YDVA 2OT1A 5D2YA 2QCEA 3UZJA 4LVGA 3QPZA 2XN2A 3EX1A 4M5PA 5EBUA 3B0UX 2B7PA 1U5JA 3B0VC 3LRLA 4DBDA 3PAJA 1TPEA 3W75A 2QCMA 3G1YA 3BLFA 3C3NA 1N8FA 5HJLA 3PB0A 5DN1A 1KFLA 4HPJA 3TR2A 4LRSA 5F1VA 1KFKA 1SFLA 2BTMA 1O5XA 3DI0A 3DKJA 4QNWA 5FEXA 4KWVA 2ZTKA 4NXKA 1JRBA 1ICPA 3O07A 3NQCA 3W86A 4JNMA 1OF6A 3NEVA 3F4WA 3H55A 5U7SA 3DBPA 5AYZA 4JN6A 4A2SA 2V2CA 3ABSA 4ADSA 3G0UA 2H8XA 3SECA 2JGYA 3RMJA 3BVJA 3KXQA 2BX7A 3LM7A 3O63A 2VENA 2ZRYA 1Q3NA 3GKAA 4WD0A 4JDBA 1ONRA 3BO9A 3QYQA 3N9SA 3W22A 1FXPA 3DHDA 3EXTA 4YXGA 1LOSA 1ZENA 1GZGA 5K4ZA 1VC4A 1T96A 1LOLA 4O1DA 4JIPA 4AF0B 2ZZ3A 3W1XA 2W0UA 3LXCA 2YFNA 5CZTA 2H6RA 5AHNA 1UJPA 3EKZA 4NNAA 3GXPA 2Z1BA 3A23A 3QW3A 1KFJA 2CU0A 3LCWA 2WNNA 4YMZA 3TXZA 1GG0A 1PCKA 5G2HA 2NX1A 4MLRA 3F4NA 1TTJA 4BR1A 2VXNA 3NQMA 5KTLA 1QO5A 5BNKA 4OQVA 4XBKA 3VE9A 3R89A 3PM6A 3IIVA 4IGHA 5EYWA 4N4PA 4UR7A 2A7RA 4XQ6A 1F73A 3P80A 1VS1A 5KZDA 5LNUA 3O6YX 2AGKA 2O7SA 3KVJA 4HSNA 7TIMA 1X1ZA 1GQNA 3NVTA 3M41A 4K8HA 4MY1A 4HN4A 1OYAA 3GR8A 1U83A 2Q3RA 3QFEA 2C18A 2YPIA 3P60A 3MW7A 1R2RA 3ZR4A 2OCZA 5DXYA 3MYOA 5AHEA 4ZQMA 2QCDA 3E9AA 3IVUA 4Z1DA 3TFCA 3UPBA 1LCOA 4LUIA 1QAPA 4HNNA 1SO4A 3D0CA 3W72A 1F2JA 3BV4A 1XBZA 2PC4A 1RZMA 2YCEA 3MI6A 1WOAA 1JRCA 1TO3A 1FWTA 4K39A 4FB7A 4JR5A 4RJEA 2YYTA 1NEYA 3GNNA 2QCGA 3HPSA 2NX9A 1O60A 3R8RA 4GC4A 4QIUA 1KM6A 2JKAA 3GNDA 3Q2DA 2C15A 5CSRA 1FXQA 3MP3A 3LTSA 4S2CA 4FNTA 1K8XA 2Q8LA 4TIMA 2E6DA 2DZUA 5HWMA 4N6EA 4FXSA 1HL2A 2E5DA 4OGZA 3VI2A 1C8VA 1Q6QA 3CC1A 3FYOA 5C55A 3SGZA 1T8XA 3MYPA 5AC8A 2WSQA 3U2OA 2XFWA 2GVLA 1TPC1 2JKPA 2V81A 4JTFA 3PSVA 4G1KA 1DKWA 2VFGA 1KM3A 1K3UA 2OT0A 3LHTA 1C9DA 2VC6A 2GQ8A 3OA3A 2B7OA 3PBUA 1YXCA 2WOQA 2ZZ7A 4O4VA 3N34A 1O5KA 5D30A 4XZ9A 2I1OA 3TW6A 2VFDA 3OVRA 1AW1A
chains in the Genus database with same CATH superfamily
3BCJA 3GU1A 5I24A 4RNIA 2J8TA 4M3PA 5GJMA 2O7QA 1OJXA 1L2UA 4HZ7A 5CKSA 3UBPC 1OWQA 4JX5A 4GPNA 2V2HA 2PRLA 1KNWA 5AYBA 1VP5A 2VCBA 4NUWA 3XINA 2C0AA 3LERA 4BCEA 2ZE0A 3DIPA 3PBWA 2E6FA 3UZWA 4KIRA 1QNSA 1FDJA 1DJWA 2VUYA 1OGBA 1DWIM 3FKKA 2VEPA 4Q4SA 2OTDA 3CPRA 1XLDA 2J27A 3P5ZA 1JCJA 3FSTA 2G97A 3KVKA 3M0KA 5FF2A 4O0QA 4DUXA 1GVIA 5HUOA 3R13A 4GVHA 4RCXA 4AC1X 3MDWA 4K38A 3F7JA 1UR1A 4IIDA 1G01A 4AB4A 2D69A 3J7HA 3W53A 4XD4A 1FFQA 3BLIA 2ZFAA 1OHLA 3B8SA 3UA4A 5C2GA 3P93A 3HPFA 2YYUA 4NJJA 3R2GA 1S2VA 1ZL1A 3IAQA 3T0CA 5IXEA 2RFGA 4OOZA 3NPXA 1EEPA 1TSIA 4ZB2A 4XG1A 2GOKA 4PCPA 3KM8A 2IPFA 1VBGA 5LIWX 1VYSX 5CEWA 2CESA 2TAAA 4MKNA 2Z1XA 2OSWA 1PYMA 1G4EA 3TDFA 1M7XA 2E4TA 3VPLA 2NV1A 3GYEA 2VNCA 3IVTA 5FI8A 4R7JA 3ZLHA 2GFTA 4DXKA 1SFJA 1A53A 2VEKA 4W7UA 5D38A 2VEMA 1WKFA 4JHZA 1H4PA 3H2MA 1CXHA 3Q67A 3S3GA 3CS2A 3GTXA 4FR1A 3NWRA 1UR2A 3B0PA 1SZGA 3GU2A 3FJLA 3UNTA 5I3GA 2CEQA 5A2BA 2IW0A 1QK0A 3VKJA 2XH4A 3NSNA 3T0BA 1M9HA 2YXOA 3E38A 1VENA 4MZ1A 1RY0A 2V8ZA 2QULA 3M0MA 3WLLA 4UR9A 3UVIA 5JUVA 1K7EA 1WP6A 4MYAA 1XLHA 1ITUA 2ZRXA 3VCRA 3G1SA 4LT9A 4UTKA 3UJRA 1EEXA 3GVRA 3W7RA 1EJRC 3MB9A 4MJ4A 1VCGA 3IS4A 1EC9A 1VFMA 4JL1A 4Q33A 2OODA 2NVCA 2MNRA 1OX5A 4NL1A 4H8VA 4FP1A 3CAKA 2FPVA 2DT2A 2QJGA 3BOXA 1TRDA 1TQXA 3DCPA 4PMVA 4BQ2A 3KOFA 4EWJA 1Q6CA 2PD5A 3MZ2A 2I7GA 1EO7A 4RZ6A 4GO8A 1ONWA 3OZOA 4M7SA 3KRUA 3I4EA 4I9TA 3WBAA 3UW6A 1OM0A 4Y8FA 4DN1A 5LSMA 2TRSA 4YHGA 3W7MA 3KBSA 4DI9A 1AQFA 3CU2A 3T42A 1P5BA 4E38A 3S6OA 2J66A 4S39A 2PD9A 1UQYA 2QMKA 3SY8A 5C2CA 3H2OA 4RNFA 1E6RA 2BOFX 4HKPA 4LXFA 4I7WA 5DEZA 4C1LA 3CLWA 1YPFA 1E3XA 5T9CE 1OBAA 1CLXA 2YDQA 5IM51 4B16A 1AL8A 1PV8A 2XIOA 2RDUA 1FHLA 2JIWA 1L8NA 3FHAA 2OWCA 4JY9A 3W7LA 4F79A 1JXKA 3K13A 3WMLA 2PDGA 1TWZA 5DX7A 2WHLA 3KTSA 3S46A 1M3UA 4H6EA 3F2BA 2VZUA 3N6HA 4PODA 4C6OA 2BVYA 3DU0A 3CZLA 1EP1A 2BXYA 3E0VA 2ZWYA 4WY0F 1W5MA 4H01A 3IIPA 1ZHAA 3GB6A 2QLYA 3LI1A 4TTUA 4LUYA 3A13A 3G1FA 4TMCA 1HKKA 1D3GA 4KS0A 3PZVA 2PBGA 2FPTA 3LGGA 2PGEA 1NQKA 3RLUA 1LYXA 1QI4A 4NI8A 1SJDA 3L65A 2NSXA 1YIXA 3K8MA 3M0LA 1KTCA 4LAKA 2Y7FA 4W5UA 4EF9A 4H9MA 4XZWA 2POZA 4X9SA 1MUWA 1PSCA 4ZQOA 3MCMA 4NZ4A 1MFVA 3GVVA 3MA8A 1GGOA 1BSLA 3CT2A 3TZNA 3ZWTA 3UWUA 1EGVA 1LORA 3PFMA 3EWXA 2WMIA 5F4WA 1GVSA 2XM2A 1FBAA 1VHCA 4W5ZA 1K8ZA 3BLPX 2P3ZA 1TWDA 4ZO8A 3FOKA 1CYGA 3R5EA 3VKAA 3MC5A 4D2JA 2EJ1A 1ZJAA 1G6CA 5D37A 3AI0A 3UZ5A 3AIVA 3DYMA 4IUGA 1Q2RA 3KVMA 1XYZA 3RPTA 3GAYA 3IRDA 1D7FA 4OE7A 2YB4A 4CU6A 2VELA 2P1FA 1EX1A 3LQGA 5BZAA 3UCQA 2NXIA 1AUSL 5FJRA 2VFEA 1A4MA 1LM1A 4KH2A 3TAOA 1YE4A 2PCQA 2OX1A 4LY4A 3WBXA 1OD8A 5A2AA 4D71A 4GMEA 1DYSA 2FGLA 1EOKA 1O12A 1QI2A 2P0IA 6CGTA 5HK4A 8A3HA 2F6XA 1N82A 3ARYA 3UF9A 3CH9A 1G7VA 3CTLA 4EPDC 3TOPA 1X6NA 1XLJA 4H83A 7REQA 2QDEA 1J96A 2Y8KA 1GOQA 1DOSA 2J25A 2E5CA 3TTSA 4NAFA 2A1YA 3PN8A 5EBAA 3H22A 1UOKA 3OOQA 1C8QA 2WAGA 4KPLA 2ALDA 4Y9AA 2AQWA 4ZB5A 5CZKA 3MUXA 5TQLA 1UOZA 5H6HA 3TYDA 4XSLA 3M7SA 4AZCA 2QDGA 1HJQA 2CCRA 3EMCA 5CPQA 4GYJA 4HA0A 3CXOA 1PIIA 4H9UA 2XIQA 5L9FA 1S5TA 3CLMA 2EHHA 1Q85A 3TUUA 4X22A 5FESA 2VVSA 4BI6A 1NM9A 4MNKA 2FPYA 1KKRA 2C1HA 2IKHA 4IFOA 1LLZA 1CECA 3BOFA 4E2BA 4QJ3B 4QJ5B 2FMNA 2ZA1A 3RITA 1HP4A 3PTKA 4RDWA 3II1A 3AYVA 1GVFA 1UCWA 1E9ZB 3V1HA 3S5YA 3WJSA 1IGSA 3KCLA 4FOJA 3M4HA 4JTHA 4XV0A 2Z2BA 1X8FA 2VKZG 4H6KA 2WSRA 4U3CA 3FHQA 1GJUA 4CNUA 1EC7A 3HB9A 2G0WA 3ES8A 2WSKA 1CX9A 3BARA 1OZMA 2C3ZA 2A6LA 4Z2LA 1UR9A 2PSNA 3NQ7A 1I0DA 1GOMA 4TO8A 3BJSA 4M82A 4OWGA 4M81A 2Z7KA 1TVPA 1HP5A 4JTRA 4BEUA 1HUVA 4UOQA 5CGMA 4PUUA 3GIQA 3G1AA 1XLBA 5F2MA 2QAFA 1H7XA 4ZE4A 3VNZA 4A4AA 3MDUA 3H6OA 1AJZA 1UD3A 2YBTA 5AHIA 4UTIA 5FF4A 1B57A 2ZRUA 3SUUA 3ZR6A 5A6MA 2Y63A 4DWDA 4JFTA 3MUIA 5LGZA 1F5ZA 3QYSA 1S2WA 3W7DA 4J35A 3EA2A 1FQ0A 1XFBA 4PFHA 3I6RA 3QM3A 3GW0A 3KDNA 2RJHA 3S2CA 3PZMA 2R91A 1SO3A 3O15A 1J11A 4DLFA 3ZM8A 1KLZA 3VNYA 4N2YA 4DZIA 1D2KA 4EPEC 1IIGA 2EG8A 1LL4A 5E0FA 4C6DA 4BZYA 3WJWA 4UUIA 1H7OA 1GOWA 2J13A 3H8AA 4ZOEA 3VILA 3UY8A 1L8PA 5CSSA 1W1A1 1C8XA 3EZ4A 2P88A 2WMIB 4LUJA 6A3HA 1XCWA 2RH9A 4S3JA 2PRHA 5D04C 2QS8A 4ASTA 2QIWA 3U5UA 5FEWA 4U5KA 4HHMA 3W2MA 3H2NA 4C5YA 3APYA 1WZKA 2C0HA 5GNXA 3LBMA 2YOCA 4GBUA 2CYGA 2ZQ0A 2Z1WA 3PBMA 5GNYA 3W76A 3KTCA 3O8AA 3AXKA 4TXEA 4XKYB 3QMRA 3LYEA 3HQOA 2PEVA 1NDYA 4AZ5A 3RLHA 1HTIA 4TOQA 4HPXA 4AEOA 2QW5A 2GOUA 5A8MA 3WLMA 4S3DA 3R4IA 1PPIA 4O8AA 2R94A 4EXAA 1HKVA 5BXTA 5KINA 1RD6A 5EL1A 5BYWA 2J74A 1E6PA 2RKXA 4LVBA 5CPLA 2R1PA 3H26A 4AIUA 1M7OA 3DFQA 1IV8A 2Y7EA 4JQAA 1Q7ZA 5BOFA 2Z1VA 5A2CA 4FIQA 1JCTA 2I5QA 3CZEA 3HPXA 4O1FA 1PEZA 2HK0A 1WXZA 3T05A 4JTGA 2EQDA 4AXKA 3TJXA 4DJFA 3EKGA 3N4AA 5A8NA 3MY9A 4IHCA 3SBFA 2J75A 3GQYA 3VD3A 4OTKA 4Q8MA 3VOGA 1TZ7A 1XIDA 1B90A 3MZNA 4QG8A 1YBQB 2RAGA 2XHYA 3BTNA 5FA5A 4DWSB 2CLKA 1CGTA 2VVNA 3RK8A 3TJLA 1V3MA 2A85A 1LWIA 3D47A 3LV5A 3TR9A 1SW7A 2OZ8A 3MKKA 4NY2A 3BURA 2ZIDA 1TMQA 1KRBC 1R2SA 3TW7A 1JUKA 5HMDA 1F7BA 2CHRA 1K9TA 1PXGA 4OZOA 2I17A 1UASA 3BGJA 3U57A 3W7OA 4GH1A 4Q7NA 3WQEA 1O7AA 5JBDA 2X1TA 4XAGA 2WPGA 1GVOA 3QV9A 1NU5A 1H7RA 2JGQA 2DZAA 5MF5A 4Y6GA 4GVFA 1G94A 3KOZA 3ES7A 3NAVA 3AMLA 1QNOA 3C2YA 1TV3A 5CCZA 1KXTA 4P61A 3IVSA 1W31A 1XW8A 2PDFA 3AXHA 3HN3A 4C1NB 4MJ2A 1ELSA 1M7JA 3A21A 2QUMA 1TPUA 4HD5A 1TPWA 1SM9A 2P53A 4UR8A 1H0IA 1UR0A 1IR2A 1QPRA 4WR3A 3A24A 4O16A 1OGGA 1AW2A 4GI4A 2QJHA 4XKYA 2GZXA 3EBVA 5HNNA 1CNVA 3OG2A 4C7FA 3BLDA 3ABQA 4BQ4A 1WDPA 4CN1A 4H9XA 3OG3A 1Q6OA 4IJRA 5DFAA 4CNTA 3C0SA 1KGWA 3OU8A 1KM1A 1SMDA 3NL5A 1BAGA 1FWNA 3GXFA 5IBXC 1KLYA 5GJNA 4PCSA 1TRIA 1EXBA 4DBEA 5CPSA 4C6IA 2GWGA 3LX9A 4E4FA 3LLDA 1XIFA 2D22A 4NVTA 2EG6A 2WMKA 5C9UA 4A3UA 4QEHA 4L7ZA 2Q6ZA 4P5UA 3TCSA 2PDUA 4YHEA 5ECVA 2RUSA 2BSLA 3MTWA 3WY1A 4TQTA 1FFRA 3AAMA 2EKGA 4JN8A 3AZSA 2VEGA 4D6JA 3N11A 3KEHA 2GVEA 4GXPA 2VHLA 2XN1A 4ZL1A 4C6KA 1Z3NA 3TE9A 3UXAA 3I7RA 1EUAA 4AVNA 4D6CA 3B0XA 3BV7A 1BFNA 4FNRA 2DPEA 2WBKA 1H2JA 1YW1A 3CZJA 1MEHA 4G5DA 1QI5A 4LOCA 1SJAA 2GSHA 5EU9A 1ZS2A 1XGDA 5HNUA 3WK2A 4JTLA 4PMQA 1NDVA 1XSKA 1K7XA 4UC5A 1EQCA 4REQB 3WH6A 2X1RA 5JIWA 2A7PA 1G9HA 4XZBA 8XIMA 4C6EA 4MMWA 1F3XA 5FF0A 1VIZA 3UZZA 2F6UA 1K70A 1UWAA 4KEVA 1XC6A 2PWUA 3WK3A 1W9UA 4LCQA 3B4UA 3VKDA 4J3TA 4LEQA 4PULA 3VZXA 2A2IA 3CV1A 4FO4A 4QAIA 1QOPA 1TMLA 4GQQA 2PWHA 4WSHA 1G0CA 2LLEA 5D03A 4DRSA 1M6JA 2OO6A 1DEDA 1OFQA 2YFOA 1JIBA 3GUWA 2PI6A 1FH9A 1OC7A 1SZFA 2A7NA 1R9XA 2ZRWA 4UTTC 5I2UA 2WZIA 1IR1A 2CFFA 2WC7A 3DHUA 5I3JA 1FWHC 2O4MA 4IQDA 3MKCA 1C92A 2RGLA 3OYXA 1UWUA 3VIKA 3QEZA 5F1UA 3SN4A 4L6HA 3BUVA 4J5NA 3UNDA 3S47A 4AWEA 3QJAA 4OVXA 2CLIA 5LZLA 3DENA 4XTIA 3MHGA 1SPQA 3APTA 1WQ5A 4P8WA 4MDPA 3GW3A 1P48A 4LWWA 1YDNA 3M0HA 5DCDA 3K46A 1HJWA 3O0KA 3N25A 2Y24A 3L2IA 4DO5A 4QJ4B 2WC4A 4BF7A 1TUFA 4ZZ9A 2FGBA 3OP2A 4L4OA 1BSIA 2G4FA 2OZTA 2ZZ6A 2ZVRA 4B90A 1VFLA 1F9CA 1YHTA 1JDCA 5DF0A 4K7YA 4AHPA 2QCDB 2UZ9A 2J47A 3FA5A 1AH0A 4E0CA 5DBUA 5CG0A 3RN6A 2QMJA 3ITYA 4XZHA 1Q7MA 2ISDA 1ICSA 2WJDA 1U1JA 4YJ5A 4QISA 1UKSA 5CG7A 3IJDA 2FZ9A 5MKGA 1C7TA 3TYBA 4C6QA 5LIYX 2J7HA 2W91A 4AZBA 4PUJA 1GCYA 1UMYA 1KBBA 2O55A 4RR4A 3BK0A 3MT1A 2DZSA 1E0XA 2E9LA 4JFVA 4GJ1A 4DQWA 4WY0A 2WVUA 4IXHA 1SW3A 1E56A 3CZGA 5EGRA 5FF3A 3KCJA 4RLIA 3PF3A 4N9CA 2NLYA 3LCHA 2PDXA 5CPTA 3TNOA 3T08A 1A4LA 1EP2A 1VEOA 4LF1A 3H21A 3QSTA 1E15A 1R7AA 3TTYA 1LRNA 4Y96A 5I6SA 4Z1YA 3OLDA 3VIGA 4L4LA 2BB0A 2PF0A 1JEZA 3S5NA 1XYCA 3NO1A 1WUFA 2PWFA 2PDYA 3W74A 1VD6A 3SCVA 2GVGA 2NXHA 3M9YA 4IJBA 1GEHA 1V3JA 2PLKA 3M1ZA 1S5WA 1Q45A 3WEMA 3WBWA 3MP4A 1EPVA 3F03K 1W32A 1S38A 2Z00A 3GG8A 3URBA 1XGEA 2ZZ5A 2PURA 2FGZA 2PODA 1R2TA 5AC5A 1E0TA 4NU7A 1H7PA 2XH7A 1XH2A 3C3UA 1TUXA 2DZXA 1WA3A 5XIMA 4DPPA 2I14A 1CGWA 4NZCA 2DSUA 1OGSA 1M68A 2WSPA 1Q6RA 4PUKA 3ME3A 1YPIA 3LNMA 5A8OA 2ZRVA 4AMCA 1XICA 1K03A 4PMZA 4GI9A 1QPNA 4K2SA 3N12A 3C2EA 3W7IA 1XD0A 4WZHA 4CN4A 4QQ3A 3EOOA 2E28A 1DXIA 3DFPA 5GVJA 4G2DA 2J7FA 4FX7A 1LQAA 2X30A 3L5MA 5T26A 3C56A 1W9DM 1ADDA 1FX6A 4M29A 1UWSA 1FOBA 2BY2A 4B5XA 1SGJA 2OXNA 1O95A 1Q13A 3NUKA 2BXVA 1VHNA 1P7TA 3PBYA 5IFPA 1P0EA 1YKWA 4F66A 2IKGA 2VQUA 2QHAA 4GX8A 3GXNA 5D9MA 3AQUA 2JK2A 3H23A 1SO6A 3VKKA 2D23A 1LLOA 4Y8EA 2GJPA 3GD6A 3U7BA 1EA0A 1H7WA 3GX9A 1H5YA 3CUFA 3CO8A 1KM2A 5ABTA 2XFYA 2D24A 5D9OA 5E9XA 1LJYA 4H7CA 2C1GA 1XRSA 3A22A 3BGGA 4Y7EA 3OB8A 3AC0A 4LPCA 5CC6A 2ZUSA 1ME7A 3NQVA 4ECLA 3RRAA 1XYMA 5EMYA 1DWAM 2ZE3A 4MPKA 1S3TC 1EKOA 4WUIA 3SI9A 1AMKA 4AWUA 3GXDA 2Y89A 3RX2A 1M1BA 3ABXA 1PBGA 4IIFA 4M56A 3D46A 3VK5A 1DTNA 1OSEA 4QCEA 1XI3A 3WD1A 3HU7A 1XQLA 3GDMA 3QH2A 4JFSA 1DXEA 4GFIA 3TKFA 4PRTA 1CENA 2YA2A 2FZBA 1KWGA 4OBSA 4LV9A 2Z29A 1OFBA 4H9ZA 1C8YA 2UV8G 3H24A 1QUMA 4L64A 4E3TA 3BCDA 3GVGA 4C6NA 3CV6A 5G5IA 3UVAA 2OYLA 5F2GA 4NZ3A 3CEUA 1JXJA 4RDZA 5H1WA 2ACUA 4IXXA 1F6PA 4DO6A 4JTUA 2FZMA 3ZSSA 1M5WA 1IXPA 3GR7A 2ONEA 5LNRA 4F0SA 4L9ZA 4MVAA 3WFZA 1RCQA 4CQ9A 1W3TA 3LDVA 4O13A 1ISWA 4I9MA 1Z8AA 4NZ5A 1AQMA 3SIMA 2FZ8A 3NJ3A 3VD7A 6XIMA 3H12A 2J6XA 4U4MA 4PUMA 2BFGA 3LZ3A 3MCNA 1LG1A 4I9AA 2XIIA 2PWDA 5CZSA 1Y5XA 3AFBA 3GZAA 4FLOA 2HRWA 1I8JA 1UBSA 2ADAA 1V0MA 3ZS4A 1JCLA 1NIUA 4QP0A 2OT1A 4JZ5A 5D2YA 2QCEA 1UJQA 4IIHA 4FZIA 5EBUA 5AVNA 1UWTA 3B0VC 3LRLA 4E8GA 1X98A 3BLFA 4HJWA 1V6YA 5HJLA 3UG5A 3S9ZA 3AMCA 1O5XA 3GNRA 4L65A 4QNWA 2NVDA 4KWVA 3B8UA 4J3WA 4DYEA 3B0YA 1A5MC 2PWVA 3D6NA 1A5KC 3GFZA 3NEVA 3PJWA 5U7SA 1PKMA 1KRCC 2PZ0A 2O4QA 3MMUA 2IXUA 1PDZA 4DZHA 4JN6A 1Y5WA 4ZOCA 3SCSA 3CQHA 3HFTA 4WVXA 4ADSA 3FSUA 2QYGA 1V51A 3BAYA 3B9AA 3I3DA 3RMJA 5D9NA 3LM7A 2ZRYA 2DQXA 3WUEA 4R27A 1BF6A 3QYQA 5I06A 3R0UA 4ZR8A 3UZYA 1EZWA 3DHDA 4NIRA 3SURA 1GQIA 1ZENA 4RE4A 5H8MA 4JIPA 2W0UA 3ARQA 1O1HA 2GGGA 5AHNA 1ZGDA 1KFWA 1UJPA 3EKZA 1K4HA 3GXPA 2CU0A 1NY1A 2D2HA 2GVYA 1UPPA 1HGYA 2VXNA 1Z9AA 4PN2A 5KTLA 3WH5A 3ID7A 1IT8A 3EWCA 3WKZA 4IP4A 2ZX6A 1HL9A 4JHOA 1VS1A 4WLCA 1C90A 2AGKA 2OO0A 1T8QA 2OYMA 2Q8XA 4LCRA 2Z1SA 4WHBA 2Y5JA 3A47A 2FZNA 3KVJA 1X1ZA 3CQJA 3NVTA 3RO6A 4A3HA 1JPHA 4HA1A 2Q3RA 3WNMA 4QSFA 2C18A 1R2RA 3PWGA 2HVMA 2X0HA 4TVUA 3MYOA 2CWXA 1JF6A 3TYEA 1XLKA 3FXYA 3UPBA 2ZX9A 1LCOA 3U0HA 4YN5A 1HKIA 2F9RA 2JIEA 1XLAA 4HNNA 5G1MA 3D0CA 4BKNA 1XBZA 1NARA 4AY1A 2PC4A 3QHMA 1DJGA 1IYXA 1PDYA 4PR4A 1UKQA 1TO3A 4K39A 4FB7A 3VOFA 5JQ9A 1O60A 3RR4A 4YVVA 3R8RA 2CNCA 4QIUA 1KM6A 2WCSA 1RP9A 4RDVA 4S2CA 1QJWA 1FKWA 1YMYA 2AL2A 1FH8A 5C70A 4N6EA 2PP3A 5IHSA 1EYEA 1R3RA 3MVTA 2X7VA 3CC1A 2XG9A 2GVLA 2V81A 1WAWA 4W4QA 1M65A 3H4GA 1NWUA 2BG5A 3OA3A 2GQ8A 3PTQA 2XU2A 2B7OA 4O4VA 4REQA 3SO7A 4PUNA 4XZ9A 2YDRA 1FWBC 1P6BA 2I1OA 3OVRA 1BHGA 1DE5A 3TEVA 1H09A 1XG4A 3QKZA 1W9BM 3LRMA 4MAZA 2Z6IA 2HDJA 4AIOA 2O9OA 3EWWA 1OT1A 3EPMA 4LYKA 1E6QM 4BQ5A 3THCA 3CH0A 4GY0A 2PU0A 1JAEA 3EMZA 1SYTA 3T9PA 3PR2A 1X96A 4DY1A 4KCWA 1R7OA 4GQGA 1GZJA 1U5VA 4FNPA 4JBRA 4POCA 5I3HA 3CHFA 2CLEA 4RX0A 4XX6A 1F05A 4JTJA 3NA8A 4YTQA 3QMTA 4LH8A 1RY8A 1OABA 3WDPP 4O0KA 3B8WA 2CZDA 4QFUA 2I9EA 1W37A 2Y1HA 3GDBA 2A3AA 1H1NA 3P81A 4K1WA 2YDAA 2ODOA 2VRQA 3F4VA 2QUVA 4B9YA 4FA3A 3RLVA 1JYNA 5EA9A 1TWSA 3W7KA 3W29A 3VO0A 2WLZA 3WD0A 3BMXA 3IAPA 5J04A 1WZAA 3WLTA 2FVLA 2J88A 1I4NA 1WUEA 4JDYA 5I02A 3FYYA 1AMYA 4B3LA 2E09A 2QPUA 3BLEA 1W3IA 5AHMA 3CEPA 1EP3A 2WKGA 1JDAA 1QTWA 3EPNA 5AB3A 4U2ZA 2UBPC 2V3EA 1PZ2A 2QDHA 2X0SA 1K8YA 4FK9A 4CQ8A 1S5MA 4DX3A 4HSOA 2E8ZA 3NDZA 4WDUA 1M01A 4H41A 3L0KA 3LI0A 4WCJA 2W62A 4GCXA 3H2EA 3CHEA 2XFRA 4O0ZA 3R0KA 5TD4A 1XBYA 4MHBA 4BF5A 3IUIA 3KRZA 4H7VA 3WBEA 3F4DA 1VBRA 1EOMA 4MYXA 3FK4A 3MV11 1ZTVA 1E40A 2XIMA 2Y8UA 3KL3A 1B0IA 1JGMA 1X7IA 4CD4A 3LHVA 1RQHA 1TA3B 1EIXA 1VFHA 3L5AA 4IM4A 1WCGA 1ISZA 3BG9A 1JAKA 3KOXA 4QRNA 3OIXA 3B9NA 4JHMA 4LEFA 2ATMA 4WK9A 2FHFA 3PNUA 3P2VA 4X9YA 3BQ6A 5M03A 2DUAA 2V63A 4GIYA 3IANA 4HU3A 1TTIA 9XIMA 5T9BG 3EXSA 3U7VA 2E5BA 4JKLA 2V30A 1UZHA 3UGRA 3GWQA 2EPLX 1E51A 2FVMA 5CBJA 5HINA 4ZO6A 3WN6A 1DL3A 4AHOA 1MZRA 1LBFA 1XG3A 3S6DA 2G3JA 3WQDA 3WQ4A 4PUEA 4M7TA 1WPCA 1NWSA 1WKDA 2Y7GA 4ZCWA 5BXRA 8CGTA 4J9JA 3B8IA 1HFBA 3M5VA 3DERA 4R88A 5DELA 4IWWA 2PGWA 4PTXA 3BE7A 3MSGA 2BP1A 3DXIA 3U2CA 5DMYA 1JZ2A 1H5VA 3R8GA 3U8GA 2JE8A 3IACA 2XDFA 3PAOA 1LL6A 1V03A 1VFFA 3NO3A 3TN3A 3WNLA 4HZ6A 5ENLA 2OEKA 2VI0A 4ORMA 5I3IA 3G3MA 4KERA 3MBFA 2WJFA 3QGKC 3WLKX 3K4DA 3C6CA 1Q7QA 4IX0A 1HXJA 3NZPA 4M6PA 1M53A 3SQLA 2XWDA 1UP0A 2B7NA 4B5NA 1PX3A 4QDPA 3N9KA 3AS3A 1XCXA 4RE2A 4AD2A 1MSSA 4B2DA 4Q8VA 1OCNA 3RO8A 1ADSA 4EIVA 3PZTA 2V9DA 2AL1A 2HPMA 3T40A 4UOJA 2O9RA 3B05A 1P0NA 2WB5A 5E0KA 4IMGA 4L6OA 1RJPA 3SJ3A 4C91A 3NEHA 4L5ZA 3K4WA 1A5BA 2B7QA 4RW3A 3SFWA 4Z2HA 3PZOA 4K37A 4JYDA 4DELA 2NWRA 4XWUA 3GM8A 3EAUA 1ZCCA 3SFKA 3BANA 2WM1A 5C7VA 1Z48A 1XH0A 3DEQA 1VBJA 1VCVA 1X97A 3VGFA 2J77A 4GYPA 3TJ4A 4RDYA 1A5SA 4X2RA 2VGGA 5A5WA 2GJXB 4DF2A 4CVWA 2Y62A 1JFXA 4V2XA 4HMDA 2O56A 4GGHA 1Q6DA 3W26A 4O28A 3GY1A 3QZ6A 1B30A 2IMRA 2AAAA 1S1PA 1ONXA 3TONA 2QZRA 3BPWA 3OQEA 1U33A 1XC4A 1XYFA 4AH7A 1F6YA 3W1LA 1L6SA 1FHDA 4LV4A 4LAMA 4MWAD 2WM0A 1EF3A 2DH2A 3EDFA 4AY8A 1JFHA 1J5TA 4IP5A 2WO5A 2CKRA 3DN5A 3PZGA 4QLJA 5EMMA 3U48A 1UIOA 1J2BA 3LLFA 2OVLA 3B8TA 4PMXA 4XZIA 2D1ZA 1WDDA 3PG8A 3RM8A 5EMKA 1JVNA 4DJFD 5TAOA 3WFLA 4B3KA 1ZJBA 2NQHA 3AU6A 1JYWA 4LRTA 1YXDA 2X1IA 5AYYA 4OUEA 2NUXA 4A3QA 2BOGX 4KF1A 4YTRA 3JW7A 3SQMA 4JEQA 4DAIA 3W84A 4H6RA 4JNYA 2PDLA 1RV8A 2VEIA 1EJUC 1V3KA 1S2AA 3N4FA 3RRXA 5BXPA 1P43A 3CB8A 1SR0A 3KZPA 5I7GA 4ORIA 3ITOA 3KLKA 3V35A 2C19A 1V3LA 5A8QA 3W23A 3AZTA 3SAZA 1VEPA 1C3FA 1BYAA 2H3DA 4MAVA 2WW5A 3E0LA 3B9EA 5H8PA 3G3DA 4IFRA 2GYIA 1QI0A 4LQ1A 1SUXA 3ANUA 2CKSA 2P8CA 4Q4RA 2KZHA 4X63A 4DAFA 1Q4WA 2VRKA 3EYPA 3O7UA 1BQGA 3V5FA 1OCQA 2FFIA 1EWEA 4UTHA 5A8PA 3CZKA 4L1XA 2VUNA 3A4JA 4DIAA 7ODCA 4X61A 4HTBA 2NXGA 1DIKA 2Q01A 6PTDA 1YEYA 2G4JA 3BZGA 4CNOA 4LUTB 2EPHA 2HNEA 5LGXA 2E67A 1W9XA 1HKMA 3AJ7A 5IBXA 5BMXA 3FXGA 4TX8A 3IJ7A 5JXQA 4W9TA 1OT2A 1LG2A 2WVVB 3U5YA 1F07A 3RPMA 1HF6A 2VFHA 4MIMA 3P5YA 3H2AA 4LY8A 1YE6A 1E6NA 4J1OA 1NSJA 5CSYA 4JIQA 4O4WA 2BV9A 1R38A 2VRJA 6ALDA 3CBWA 3TYZA 4C5ZA 4K7VA 4L4MA 4UCFA 4D6GA 3C0JA 4FPSA 4ILSA 1WAUA 1BD0A 5M1TA 1QBAA 3WBYA 4D72A 4AYGA 3GH4A 1MQQA 3WF2A 1UB3A 4JYEA 5FACA 1L6GA 3QR3A 1Q65A 3C4UA 1UUMA 1UC4A 3HM7A 1EBHA 1W1YA 2PLJA 1JD7A 1DWFM 1UROA 3L21A 4CU7A 1AJ2A 3UY7A 5HBFA 1TCMA 2B0MA 4PMOA 4C6JA 1OIFA 2C91A 2XH0A 1VQTA 1TA3A 3RU8X 5HJXA 1LZOA 1CXEA 2WCAA 3VDCA 3L67A 3LB0A 1F6KA 1RCOB 4GHRA 2QQ6A 3N6JA 4MTVA 3SDOA 1PCWA 3I7QA 2YL8A 5H2ZA 3MP5A 4MUPA 2IQ0A 1KW1A 4P8VA 5I03A 1J4EA 4QXIA 3SCWA 4EAYA 3KVLA 1VJZA 4DPQA 1A0CA 4HU4A 1GTHA 3LRKA 3VNDA 1TJ0A 2UY4A 4RL3A 2NQLA 2UY3A 1HO1A 1UG6A 1A0EA 4A21A 1BRLA 2YIHA 1BXBA 4UMAA 3LXAA 2QR6A 3E1F1 2AAMA 2QJIA 6ENLA 1HJSA 2WNQA 4LUTA 1P0DA 1TPH1 5G4WA 3PVFA 1WDWA 4I8DA 4R53A 1Q6LA 3WK1A 1CEOA 3HGRA 1EXPA 1ZNNA 4IGNA 1XSIA 4JKMA 4NT0A 3HMCA 5K9CA 3UEQA 1CBGA 4J3XA 3I3BA 3BG5A 3N13A 5EB8A 1Z6KA 4PRRA 4GINA 5C71A 3PK7A 4WRHA 3BAJA 1JR1A 1OY0A 3RPDA 2OLSA 1MW0A 2PCEA 1FTXA 3BH4A 6REQB 1R5YA 4ZTXA 3AROA 3FDGA 3P0XA 4H2HA 5A3HA 3OVGA 2ESCA 3G5EA 2J7BA 1B3YA 3M7WA 3PTMA 3VGHA 1E6ZA 1J2WA 2GQ3A 1R86A 2V0TA 1NDZA 4U5IA 4UTMA 2J9YA 3I7SA 4Q4OA 4Q6XA 4DF1A 4IT1A 3ZJ8A 4LYRA 2C79A 4MKVA 4AVOA 1RSCA 1AJ0A 5D2XA 1G69A 4EANA 3EB3A 5K9XA 2JFEX 4TV6A 3OO2A 2PF8A 2ZDSA 3TAKA 3W7PA 1HG3A 1QHOA 3IJ9A 4QM1A 1S2CA 1BYBA 4Q22A 5D2VA 5KZMA 1JZ5A 1EDQA 1L6WA 2D2JA 1V08A 4NAEA 1US2A 2ISVA 4KWSA 3XISA 4ZA0A 1B3ZA 1W3HA 2GLKA 4ZSTA 4LVDA 4TVCA 4HSHA 1QOXA 2ZUUA 5BW6A 3NR0A 3NZGA 1FWEC 1TIWA 3EWYA 3VX0A 1RHCA 2A3HA 3TQKA 2PS2A 4OBRA 4UNIA 1OC5A 3ZWSA 3W2KA 3FS2A 2V69A 1EJXC 3N1AA 2XSAA 4E5TA 1KTBA 5EY5A 5K4XA 5REQB 4UXDA 3JR2A 2CBIA 1A3XA 1IE7C 2DJLA 3D3AA 3SN0A 5HQEA 3BAKA 4R3UA 1SR9A 3N2BA 5G4HC 4PYSA 1LROA 2ZYFA 3ABZA 2XISA 4B5SA 4BK9A 4JGDA 2BGSA 1PTDA 2PTZA 2V5BA 4I5RA 4CNNA 2P10A 3B8VA 5M2FX 3MCOA 1B3VA 1AW5A 1QK2A 4JIEA 2QCHA 5U4NA 1GHRA 2WMJA 4C6PA 1NVMA 1WBHA 3U6WA 2C13A 5B80A 3HZ3A 3FJ6A 3AS2A 1QPQA 3EKLA 2VDGA 2WJZA 5CC3A 1F61A 3IARA 1XLCA 1VZWA 5DMMA 3DOPA 1VGAA 4H3DA 1TWIA 3LCFA 3BGAA 1FP9A 4AIEA 2HNHA 4K3ZA 5DT5A 4P8XA 4HU0A 3CUZA 4BF9A 3GXIA 3RR1A 2WHMA 4UTTA 1DJHA 2XFFA 2BVTA 3WG6A 3Q58A 4YCPA 1Y8BA 1GEQA 5AN7A 4O1EA 1RBAA 2IPGA 3VMNA 2D20A 3AHVA 3GAKA 2R1KA 1V0KA 2OOFA 1Q5MA 4K1GA 2WJEA 1JZ8A 1FA2A 1TYGA 1E4LA 3W7EA 1B31A 3RJYA 5AC4A 2DVUA 4W85A 4E8CA 4KW2A 4HNLA 3R94A 3W02A 4OU1A 1PE1A 4A8IA 4DUVA 2WQPA 4GUHA 3QPYA 3GIPA 4MLJA 1ENUA 5ABFA 1ZCOA 4KRZA 4QNEA 1J10A 3BW4A 3W81A 4L9YA 4MOZA 4ERGA 3SSZA 3KBMA 3O06A 1E9LA 2BNJA 2TSYA 1J0JA 3VNMA 1ALDA 3UD6A 1LTDA 3VOIA 1GPWA 4HIBA 1THFD 1PS9A 3PHAA 3RU6A 3V75A 2V68A 3UA3A 5HXMA 3MHUA 2Y88A 3DHFA 4C90A 2ZVIA 3A9IA 2EO7A 4OIFA 1UA3A 5AKQA 4D6IA 1WB0A 3WF1A 3G1RA 1ZU8A 2DZTA 3VNJA 3PZQA 3OHIA 3CJPA 4QTGA 1UD5A 3WLOA 4HPGA 2WZEA 4FX6M 3W1RA 3W24A 2WZTA 1TJ2A 4NYYA 4PBGA 3DZ1A 3CIVA 4MZYA 1VFUA 3WF3A 1DHKA 1DJYA 3W01A 4LSBA 4CNPA 2VX7A 3AO0A 2HBVA 1WDSA 4A3YA 4CUCA 3TLQA 3NL6A 3BAWA 9CGTA 4B5TA 1ZB5A 3G1VA 2CERA 3IGHX 2EPNA 1H49A 3G1DA 4Q8NA 1Q8AA 3MUZ1 2ZXDA 2P50A 2DP3A 4JEJA 3UWZA 2XZ7A 3N2CA 1WDRA 1QHZA 1XR2A 3LBCA 2FB2A 4HMEA 1BPLB 1ZALA 2FTWA 1OIMA 3SUSA 4ZSUA 4IG2B 1ZUAX 4JX4A 2E0PA 2EGZA 4I5XA 2ZA2A 5JBFA 4LTSA 1JUBA 1R0MA 5LHFA 4PC8A 4DO7A 1IXNA 2QJMA 4GUGA 1REQB 4N4QA 1TWWA 2J9XA 2Z2AA 2YL9A 4GKLA 2NV2A 4JTKA 3UZXA 3M16A 1G5AA 4GBDA 2XVNA 2X16A 2HTMA 3BZJA 1IXQA 1B4KA 3E0FA 5C0QA 4Q4MA 3LCGA 3PZ9A 1DJXA 5CBIA 1TPFA 3AICA 1MEIA 2IQDA 1D3HA 3QHNA 2ISWA 3LCLA 4FF7A 3UXDA 4PEEA 3WH7A 1X1NA 3O3RA 3R12A 5LYRA 2Z24A 1EJTC 1RR2A 4HPHA 5CJNA 2GGHA 2YCJA 5C9XA 3C86A 3SM0A 3GNPA 2NW0A 3AIUA 4OV4A 5T8GA 1RQBA 5DY3A 2OZ3A 2YKKA 3O6AA 5GPRA 2NT0A 1S5VA 3NM1A 1T40A 1YNYA 4A6GA 2L5HA 2MUCA 4GC3A 1MQRA 4AF0A 3NSMA 3IV8A 2R6OA 3CB3A 3IGUA 1UYQA 2XVLA 4GZJA 4HHLA 4ZQCA 4DI8A 4EF8A 3LHZA 1OEPA 2XZ9A 2OWXA 2FLIA 1I2QA 3TCEA 2PDIA 2E6YA 2Z0IA 4EOUA 4JCMA 4A2RA 4Z1BA 3EGJA 2ZUWA 1GVQA 3PNZA 3OGSA 2CZFA 4XIMA 4WXYA 2EAWA 3IIZA 2Y8VA 3KP0A 1ZBVA 5D2WA 3EDJA 3S9YA 4MM1A 4IMCA 4IZGA 3TVAA 4JFWA 2GPTA 3T78A 1EPXA 4XZLX 3TH6A 4EAMA 3GNOA 1FVPA 3UPWA 1XLIA 3UWQA 5CPNA 4HZ8A 3DUGA 5LA0A 3N15A 4AD5A 4O15A 2QCCA 3QFWA 1Q2SA 2EJAA 5KETA 3O2LA 4JCLA 3HV8A 3GXMA 1PIFA 1KA9F 1PHWA 3EWDA 4C6CA 3ARSA 3HBLA 4C6LA 3G6MA 3U2EA 1GJWA 5IRPA 2G5WA 3M5YA 4I9JA 3WQWA 1XM3A 3NPVA 2A21A 4CQDA 3FGCB 1GOOA 2ZUNA 1UIPA 2REQB 3M0ZA 4ZMGA 5E5CA 3OLGA 5HULA 3BG3A 1BEUA 4HOWA 3E3HA 3PS7A 4O8RA 3ZIZA 1V3HA 3V3WA 3K8LA 1EUNA 2ICSA 3HGOA 3TC7A 2D2OA 1JZ3A 3NGFA 4AWTA 3K4AA 3E12A 1MO0A 1AG1O 2D3LA 3TYCA 4HJFA 2IPWA 3WEZA 4DXXA 1RAKA 4FLSA 3UWWA 5A6LA 1H51A 5JMUA 2TYSA 2CHNA 4PMJA 1CW2A 1L2QA 4WJXA 2ZTJA 2QVHA 3I3EA 4HMCA 5FJPA 4F2TA 3DC0A 3C5QA 1HJVA 4HZMA 5AC6A 1XUZA 3HJEA 3NNTA 3N2OA 2A0NA 2ZRZA 2WPBA 4PUDA 2OMAA 1O94A 3KW3A 2O9PA 3FAXA 3CV2A 4IMAA 1HJXA 1NH6A 3T1GA 3SRFA 4WJEA 4Y9MA 3G0SA 4Z0SA 4ZENA 3N9RA 2AMXA 3O05A 4HK6A 1IZJA 3E2VA 3VD5A 4Z2GA 4E3VA 3S1UA 3I6TA 2A4AA 3VKCA 4CU8A 1E5NA 1KBJA 1EZ2A 3GYCA 1XBVA 2PP0A 1WX0A 3I6EA 1QW9A 3BSHA 3S4TA 1RVGA 4MKSA 1VPQA 1W1ZA 2YA0A 1QWGA 2ZZ1A 1AZ2A 3R11A 1TV5A 1WOBA 5HNRA 1B3OA 3WF4A 4AG0A 4LVFA 2WQDA 4FX8A 2QEZA 1KCZA 2XYLA 5AY7A 1GVYA 1UD6A 3C0LA 3T0TA 1EA9C 3NQGA 1WKEA 4H4IA 5A6JA 2XGZA 3QKEA 4WXZA 1DIEA 2CLPA 5ABFB 1QWKA 1A50A 4Q8TA 4O17A 1UBPC 4DNHA 3B3DA 3L4UA 3URQA 4QR6A 3P14A 1W1B1 2AKZA 3GVWA 4W88A 4A29A 6XIAA 1QPKA 4ZBCA 2PDQA 4YNGA 5M17A 3FKRA 5AVHA 4XKMA 4PTWA 3V4BA 2FKPA 3F5JA 3VGDA 2JEPA 4OFCA 3LOTA 4NASA 3RDKA 3CQ0A 4DHGA 4A8NA 1IEVA 3A12A 3C2FA 2Y5EA 2OU4A 3B4YA 4PCTA 2J8FA 1I2NA 1VCFA 4AAJA 1GOXA 4LBUA 1NP2A 2ZA3A 1R3SA 2GWNA 4GIEA 2C1IA 4RPPA 1TIMA 3WD2A 5FJOA 1OF8A 2EBNA 4HP5A 4H9YA 2X0YA 1TKKA 2Q8ZA 2CC0A 3CAVA 1E43A 1S5NA 4NQ1A 4AYSA 1TE1A 3IUHA 2YW3A 1RALA 1NOFA 4S38A 4GYKA 5PTDA 1F8IA 4XISA 2PE4A 5FCZA 5KZEA 4W7WA 4KQNA 1H61A 3NFUA 2FJKA 4C60A 3TSMA 3GUGA 3DGRA 3USBA 1A47A 2PRMA 1XCFA 2OYKA 3TN6A 1SVDA 4JICA 4NAEB 2AMGA 2J9ZA 3S5OA 4IPNB 1NF0A 1UKTA 1KBKA 3KOYA 5TBOA 3UFYA 3HG4A 1LT7A 1H63A 4N9DA 3G1XA 5CC7A 3N2XA 1JYVA 1AK5A 3NQBA 1PYFA 5B7ZA 4H9VA 2UY2A 5KEZA 1CIUA 1JI1A 4LVGA 4WEVX 2XN2A 1YNQA 4S3FA 2QPXA 4IFKA 3UR8A 4DBDA 2VGFA 1VFOA 3PAJA 1GQLA 1TELA 2W92A 4YVXA 4HPJA 4IQJA 3L4TA 3DI0A 1GW9A 1UPMB 2ZTKA 2HK1A 1JRBA 1XPYA 1E6XM 1ICPA 1MI3A 2VD8A 3O07A 1O6IA 4V33A 2OGJA 1BG9A 3IK4A 2H9AB 2NQZA 3O0FA 3DBPA 2B31A 1IHIA 1UWRA 4B3ZA 4LYQA 1QATA 5HA7A 4F8XA 4G1NA 2V2CA 1GKRA 3SECA 1EJVC 3QR1A 3VMPA 2BX7A 3GKAA 4WD0A 4I5UA 2YJQA 1ONRA 1JZ4A 2ZX5A 4ROPA 3EXTA 3DDMA 3UXLA 4YXGA 1LOSA 3BQ5A 5FJJA 3EA1A 4FALA 4AF0B 1HKJA 1OG6A 2BODX 3R25A 4Z2JA 1BWVA 3W1XA 1CT5A 3POHA 5CZTA 4UQAA 1IEIA 4RW5A 2WZHA 1V0LA 2Z1BA 3TTOA 3QW3A 4KCTA 1KFJA 2WNNA 3ITXA 2VZTA 4YMZA 1GG0A 1ZP3A 5G2HA 3TN4A 3HPAA 5I77A 2DFAA 5AYIA 4NHVA 4OQVA 1PX8A 3C0QA 4BJHA 5EYWA 4N4PA 4UR7A 2A7RA 4XQ6A 5ABEA 2F6KA 2PB1A 3P80A 5KZDA 5LNUA 4ZO9A 1ZRQA 1UC5A 3O6YX 4E4PA 1TJ1A 1RBOB 2WKLA 3M41A 4DBWA 4HN4A 3GR8A 2DIEA 3QFEA 4D1JA 3MW7A 2VOTA 1T7LA 3ZR4A 2OCZA 3FV9A 4Q6JA 4FI4A 1X38A 1VFTA 4W84A 4Z1DA 1QW8A 1QT1A 1RK6A 1EF2A 1U30A 1FWIC 4HCDA 5CH9A 3W72A 3BV4A 5LXXA 2EPMX 1WOAA 1FWTA 4GZIA 1NP0A 4GI8A 2NX9A 4KEZA 2FTYA 3KBVA 1TZZA 1JGIA 5DRCA 3LTSA 1RCXB 5DT7A 2DZUA 4Q8OA 4AISA 1XWYA 3BOLA 2BY1A 4FXSA 3LPOA 2E5DA 4OGZA 5LIUX 4S3CA 3WH9A 2YA1A 1AA1B 2WSQA 2VR4A 1CGUA 1LWJA 3U9IA 1KM3A 1P1MA 1NFGA 3LHTA 1C9DA 5A95A 3Q65A 3PBUA 1YXCA 2R82A 1O5KA 3VIFA 1DWHM 2VT0A 5HDRA 2X05A 1KRAC 5I00A 2VGIA 2HSAA 1I2PA 2GSEA 2VL4A 2DSWA 3GTFA 1R85A 3SUWA 3KX6A 4CEXC 3B03A 5DY2A 1OYCA 1RA0A 3R43A 4DF0A 2G50A 4J28A 4PTDA 1GYMA 3KOWA 1U2YA 2WBGA 1A5NC 1FDYA 2V5DA 3ATZA 4W89A 3HJZA 3DFTA 3EOUA 3G24A 2IQTA 3OBAA 1YBQA 3EWUA 4N02A 1JNEA 4K8EA 4EWND 4F0LA 3CAWA 2CWNA 1L6FA 2ANUA 3GDTA 2DIJA 4PBEA 1P4CA 4M6QA 3OODA 5GQBA 1IEQA 3EOEA 5I79A 3SCRA 3GTNA 3Q37A 3CV7A 3A9BA 1XKJA 1KXQA 4MPQA 2BY0A 1V02A 4GXMA 1TG7A 1MNSA 4M51A 3JS3A 3GIYA 4IQLA 3PZIA 3VD4A 2W61A 2JBMA 2ZWZA 4Q7BA 3IK2A 4QROA 3ZVIA 2OSYA 3DFOA 3SQSA 2C6QA 2AGTA 1XSJA 5FEPA 4HBKA 1XHGA 4UFLA 5T91A 4OBTA 2GK1B 2RGMA 1N8WA 3HPZA 3DC8A 3QC3A 4X2PA 3GU9A 3RILA 1W3KA 3QTPA 4AC7C 3MUAA 4JN7A 4GY7A 5IDZA 2PDHA 5BXSA 3QRHA 3WMCA 1JZ7A 3V7PA 3GH5A 1V79A 3E02A 2XPKA 3VYLA 4WKHA 4DLMA 3FVDA 2CZ5A 3ARVA 3RYSA 3JZEA 1DHPA 1K1DA 1RP8A 3SSJA 3QZAA 2KX9A 1CZ1A 3FYPA 3FW6A 5AOUA 1W1PA 1FCUA 5A6BD 2ALRA 3PTDA 5E9AA 4LNYA 4FEZA 4U31A 3TSDA 1C9WA 2JQXA 3EOLA 1TCDA 4GXWA 3GRIA 4R34A 4RE3A 3VIHA 4O1BA 2FZDA 2X09A 4XK2A 2WMHA 4L61A 2XINA 2HVOA 4OHQA 4CKQA 2WVTA 3N19B 3WQPA 2IUZA 3GBEA 4G7EA 1ZAJA 3KUMA 5G1TA 3B9OA 3DG6A 1YLVA 1GVRA 4N6FA 3T4CA 5I07A 4JL2A 5FSEC 4KFNA 1EJ7L 5CXPA 4TVDA 2BOEX 1KV8A 4HHHA 1MW3A 3WIJA 3MMWA 2ZC1A 3GE7A 1WV2A 4IH3A 3AWOA 3HURA 2QF7A 5ECUA 4V28A 4EXBA 1TJRA 3FA3A 1I9CB 2ISFA 5D2TA 2BY3A 2FB3A 1W3LA 3VIMA 3TTEA 3WMBA 2OPJA 2ZX8A 4FOKA 1DP0A 1ZY9A 3SUVA 3W1MA 3LPPA 2QXWA 1F8MA 1KBLA 1G4SA 2FTPA 2HS6A 1Z7AA 5CBBA 1XIHA 3RUBL 2ZXAA 2J78A 1HVQA 3HQ1A 5KSWA 4DBSA 1WE5A 2X42A 4Z08A 1BXCA 3LCXA 1WKYA 5LIKX 3UP8A 4LNCA 1JPKA 5C2XA 4N9BA 3PPHA 3W4RA 4CCCA 4PB3A 1ZQ5A 3TA6A 2J6VA 1KCXA 3NL2A 1DJNA 1W0MA 1QW7A 2RDWA 3QC0A 4P7RA 5I23A 1GWJA 3AMDA 5DQPA 2YW4A 4WY0B 3NL3A 4AZCB 4IGMA 2X1SA 4TMBA 3N3TA 4ZOAA 1A3WA 4GKTA 4IF2A 4B91A 3QY6A 5E6ZA 3BCFA 3KS5A 3SRDA 4QDWA 4M6UA 5F7UA 4NZ1A 3G1HA 3STGA 2QCLA 4I7VA 3BWWA 3CWOX 3PPGA 1US0A 1JI2A 1BVWA 4BQ3A 4H6QA 3SGUA 2BZNA 4FHAA 5HPOA 1QXLA 2CHOA 3MWAA 1GTEA 5CAHA 1OQFA 1JZ6A 1A5LC 3AS0A 3TN5A 3GS6A 1DORA 1W6TA 3VOCA 3WENA 4JKKA 3EMQA 1XIJA 3UQNA 4L1WA 4G6CA 2XVGA 1VPXA 4IPLA 2BDQA 2CW6A 1G4PA 3MJYA 5CJMA 2D0GA 2X41A 1W5OA 1YQ2A 1K6AA 2WK2A 4DJDD 1IWPA 2G95A 1FWFC 5AZ1A 4MG4A 4BI7A 3DI1A 2IXVA 4JTTA 2CPUA 1B5TA 3VU2A 2EEXA 2GGJA 3VC5A 4PMUA 1BRLB 3ISIX 1HJUA 1I2OA 1LQ2A 1XIIA 3DESA 3LHUA 3IGXA 4WDXA 3ZQ9A 5A6BA 4O1AA 3W6YA 1M03A 1H62A 3KE0A 4C6MA 4B4FA 1RPXA 3CZ8A 3WDRA 3VNLA 4AIBA 3EWBX 4IIEA 5EFFA 5CLTA 3NVDA 1PTAA 4MY9A 4O57A 2H3BA 3GR4A 4GY1A 3WD3A 4PTNA 5HUPA 1E6SM 1A5AA 1VBUA 3W37A 4CLMA 1ZLPA 3EEZA 3STFA 2G3IA 2NV9A 3ARRA 5DMLA 3T0AA 3QVQA 3B9DA 1UR3M 2DZVA 3ECQA 3LQLA 2CLOA 1WDQA 1MDRA 1RBLA 3ZMRA 3LTPA 4MFEA 2NSOA 1XH1A 5DANA 1E70M 1R9ZA 3HQNA 3I4KA 3BLOA 4M6VA 3CUIA 2QCFA 4OV9A 1VYRA 2DT1A 4XZMX 1RVKA 4JY8A 4F0MA 2VCCA 1Q6FA 2I56A 4EPBC 4LS1A 2E9BA 1K9FA 3MWCA 4D6EA 4FAMA 4AZ7A 1A5UA 4LB4A 2NZLA 4S2BA 1Y65A 3R10A 1SW0A 1T0OA 4XZNX 3B40A 3PSWA 4NJKA 4Q4KA 3WQ5A 1ITCA 5FJUA 3FIGA 4NNBA 1UUQA 4JX6A 3V5OA 3CGTA 3R7MA 3L0NA 2DT0A 4U28A 4HOZA 3TV8A 4TX9A 1ITQA 3TP4A 4IOTA 5XINA 2YXGA 2B4GA 1Z69A 1E1FA 1R3WA 4P7OA 4UBPC 2QV5A 5MHBA 3PFRA 1R3QA 4A3RA 3BMVA 4MADA 3N6QA 2Z26A 1QHPA 2HZGA 4ZTYA 3WDQA 4CD6A 1NAL1 3G8RA 5DLCA 1QFEA 2QKFA 1HZYA 4E2DA 3ONCA 1YRRA 4GG9A 1WXJA 3JUGA 2J7GA 1SZNA 3ZT7A 5E70A 1V7AA 3E2SA 3K8KA 3SRHA 1R3TA 3KBJA 1XX1A 3CO4A 3NQ8A 3NZRA 1Z44A 2V5LA 3EDKA 3QR0A 1H1YA 3M0VA 4AX7A 2QT3A 4Z0JA 1FWDC 1I75A 2AOSA 1VPYA 1VAHA 3MBDA 4IMFA 1E0WA 1IF2A 1TR9A 1MFUA 4S23A 3L4WA 1PAMA 5D02A 5A6AA 4XO7A 3VZZA 1UQZA 1QVBA 3TMQA 1F74A 2BASA 3UR5A 2E25A 4CEUC 1TZ9A 1NOWA 2VGBA 1REQA 3P8JA 1E3ZA 2IS7A 4J2MA 4ALDA 5LNVA 4OUIA 5EKYA 2YCIX 1O4UA 2DQWA 4M1RA 4RZ5A 1E1CB 1XDLA 3WUGA 4IX2A 5K7JA 1KGXA 5K2ZA 2G37A 3IIOA 4ZOBA 1CGXA 5FF7A 3WD4A 3KP1A 1GJPA 2HVNA 4Q3MA 4UTWA 3QGVA 3ZO9A 4NRSA 2X2YA 3V0UA 3V0SA 2GQAA 3G2GA 2IKJA 4QGCA 1VRXA 4DWSA 1D8CA 1KCKA 3PG9A 3T0DA 4YLWA 2DZPA 3F1QA 2D3NA 3M44A 2V38A 3NOYA 2OFJA 3PC0A 4V27A 3DG7A 4QE5A 3QHOA 4HK5A 2E9MA 4AX6A 1KV5A 5JH2A 1XINA 4GX9A 2J7EA 4JTIA 1AQHA 3N4EA 4MB3A 2Q09A 1AD1A 2Y5SA 4DJDC 4A8RA 1PIGA 1FWSA 3FVMA 3U4AA 5HMEA 1SQ7A 4RXGA 3C2OA 4IIGA 5B7YA 2DZBA 4KWUA 2R1LA 3UERA 3DH7A 4WDTA 3VCNA 1GYNA 3LD5A 1GOIA 3P74A 4XAPA 4WX2A 2BHYA 1H11A 4KFOA 3ATYA 1GNXA 4LF2A 1F3WA 4GJIA 3UJ2A 3BAXA 1O5RA 1VFSA 2VX4A 2EKCA 3C8FA 4GUJA 4UNKA 4UTJA 3TU9A 1CCWB 5F4XA 4HYVA 1BWKA 3BSMA 4FOUA 2YZRA 1CTNA 1N8IA 2A6NA 2CBJA 4MB4A 1TTPA 4Z17A 3CMJA 2H8ZA 2RJGA 3GC2A 1NDWA 1QDSA 1TX2A 3CPGA 4KBXA 2WVSA 3FEMA 2DJXA 3IUDA 5LKYA 4BI5A 3WL1A 4UMBA 4GVIA 4DM1A 5HR7A 2CLLA 3U2ZA 3LCIA 4UFMA 1E4IA 1LT8A 5CPOA 1VYPX 3BMWA 3WEOA 1IEXA 4AZHA 3F5LA 3GHSA 2FVKA 1C91A 1E1EA 3M43A 4UOZA 3S6TA 2WXDM 2VX5A 3VXGA 5BOOA 4XTDA 4RPQA 1IZKA 2ZUTA 1I60A 2PLCA 2XM1A 3LHWA 2OQYA 1UH4A 2X2GA 2Y85A 9RUBA 1ZAIA 1R47A 4M1BA 3SEPA 3WELA 1L6YA 2W67A 3FY1A 2QNEA 2X1UA 2YCLB 2FMOA 5F2IA 2XN0A 3RG6A 4UFJA 4K8GA 3WCZA 1ECEA 1XD1A 3PZNA 1QNPA 3KBNA 3CL7A 3K30A 4B5UA 4HNTA 3FNDA 1O1ZA 2DDXA 1B3WA 1E9YB 3E0IA 4KWWA 2ZCGA 3HIJA 1MYRA 1P0BA 3SCNA 3OBKA 4G9PA 1XGZA 4NXSA 4YWIA 4R9XA 3L4ZA 4B2DD 3LN3A 2CITA 3UWEA 1EJSC 1KD0A 4ACYA 1H41A 3POCA 3QBUA 2OSXA 3WLSA 5FSDC 4NJGA 2HPIA 4PB4A 4TR9A 3KDOA 2INEA 2ZXQA 4J40A