4ZMLA

Crystal structure of human p-cadherin (ss-dimer)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Cadherin-3
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmlA01
2QVFB 3QRBA 1ZXKA 2OMZB 3LNEA 3LNHA 4ZMNA 4AQAA 4ZI8A 2OMWB 2EE0A 2WD0A 3Q2LA 2WCPA 1EDHA 4XXWA 3UBFA 5JYLA 1NCJA 2OMYB 2OMVB 3LNDA 4NUMA 3LNFA 1ZVNA 3UBGA 4AQEA 1WUZA 1NCGA 3K6IA 2X2UA 4AQEB 2V37A 1NCHA 4ZMVA 4ZMYA 3MVSA 2OMUB 4ZTEA 4AQ8C 2WBXA 5JYMA 4ZMLA 2WHVA 2A4CA 3PPEA 4NUPA 4ZMZA 3LNGA 4ZMTA 1O6SB 1WYJA 4OY9A 5DZVA 3Q2WA 4XXWC 4AXWA 4NQQA 3Q2VA 4QD2E 1NCIA 3FF8A 1OP4A 2A4EA 2YQGA 3K5SA 5CZRA 4ZMPA 4AQ8A 4ZMWA 1SUHA 4ZT1A 4AXWB 2OMXB 4APXA 3FF7A 3K5RA 3LNIA 3UBHA 3Q2NA 4ZMOA 1Q1PA 4APXB 3K6DA 4AK1A 4ZMXA 3K6FA 5CO1A 1L3WA 5KJ4A 2O72A 4ZMQA 4AQAB 4NUQA 2QVIA 1FF5A 2YSTA 2OMTB
chains in the Genus database with same CATH superfamily
1IM9D 4KTEH 2HJFA 2RMNA 3LQZB 4JO3L 2VL4A 4HIEA 5CEZE 1KGXA 5AB9A 2VLKB 1CYWA 2E9JA 4JFEA 1IEAA 4JG9A 1K8DB 1WC7A 2GEEA 1JDAA 5B3SB 3C60A 3L3IA 2Y7QB 3O0RH 5E2JA 1Q1JL 1AZVA 4QI3A 3KS0H 4ZSOA 3T6ZA 3KH4A 4XWGL 4IBTA 1H3GA 1HEJC 1RD6A 5HHNA 3DVGB 5SWQA 3E7JA 3QPXL 4YWGL 3QXWA 3VU1A 3FB5A 2XG5A 3L6FB 3MRIB 3UYPA 2RD0A 4JPQA 2B08A 3QORD 4U33A 2P8PA 4Z7WB 1XSKA 4FFWD 4NUMA 5AVVB 3EG9A 4RVBA 2XWXA 3C5ZA 4ZFFA 2VAAB 3QXUA 1WFMA 2DWDB 3WE6B 3MJGX 5HI4C 3TCLB 2R2EA 2ZOOA 1B0GA 2P5WD 1FAIH 3DECA 5INCB 3U2JA 5HHPA 4I4WA 3BAWA 3VRJB 5CEZL 2YPKA 3Q8FA 1R3HB 2A9NH 4TNGA 3L3OC 15C8L 4HOZA 4UAHA 1YEGH 2WBJB 1QFPA 4AQZA 4DP0X 1FZOA 1KGIA 4TQHA 3OJMB 2A38A 3G6AB 3STLB 4NNYA 4EI6B 5T3ZE 4TRPH 4ANVA 1NCUA 3PWPE 3CFCH 4NHCL 5I1EH 2E9GA 3X13A 3RRQA 4FNQA 4OW6A 1JFQH 4NAMA 4YO0A 3E8VA 3OR7A 5PCYA 2CCLA 4HWEH 3P54A 3LEVH 3QDAA 2NQ3A 3U48A 2VXTH 4X6EA 5DJ8A 3NA9H 4U6VH 3DNKA 4N86A 4QHKJ 5G5DB 4BFOA 5FUOL 1KB3A 4MA3A 2PYFB 1RZKH 4Y1AA 4E5XA 2XZAL 3EW3B 4WU5B 5HVHC 3CV5A 3VFNB 2XU9A 4HEME 1A7RL 2NXZB 4N2HA 4PW9A 3VDCA 5CF3A 4N8VG 1X5ZA 4LSUL 1A9EA 3MROB 4P49A 3FUKA 4MAUL 1F45A 2VZ3A 3WNKA 3EBIA 3T0BA 3X3FH 1YYLH 2DTMH 4EI5C 3OB8A 4HBCL 2MNUA 2XBTA 3KYKL 4N5EC 4LHJB 3V4PH 3I9AA 4Q52A 3Q2NA 4O9HL 3CFJB 2EECA 5CGBA 2H6PB 5AVTB 3BKCH 3VXTB 2UY7B 1N5AB 5C07A 1FPTH 4J3OG 5F2FA 3WDHA 5JHDD 2Z3FA 2CUIA 2EDWA 1X5JA 3GMPB 4EUPB 2AJSH 2XBZA 5CP7A 5BO0D 5MI0C 1VCBC 3P4MA 4LDOB 4LQ1A 4JQXC 1MCBA 4M93B 5DMGD 5HHQA 4HBQA 3FCTB 1U92A 1YQVH 4YAQA 3QUGA 2RACA 3ETTA 4KGJA 1KGCE 5H37H 1QFUL 4WFFD 2GSGB 5CCHE 3MJ9L 1A4CA 1A9VA 5KVFH 2P5WB 3VXME 3ETBF 5DD6A 1AQDB 3SDDA 3ZTJH 5GJSH 1OT2A 1QFWM 3IGFA 3RVXC 3DX9B 5HY9B 4Y2DD 4P2OB 5FDWA 4HIJB 4RRPA 1S7XB 2HJKA 4LRNH 5EO1A 1CDIA 3VB9A 1JZHA 3B3IB 2E6JA 1S7UA 3BEWA 5F6IC 4MMYB 2BHZA 2R2BB 3IGUA 1HWGB 1CS6A 1DUZB 1F3DJ 1CICC 1OXYA 3ML8A 1F13A 2H41A 4I77H 2GI0A 2ZAIA 2GY5A 3AITA 5DO2D 3ZE0E 1FVCA 3MRPA 4QY8A 4UU9B 3VWKD 4CW1A 2VJ8A 5I1JL 2Y1AA 2DYPA 2V3EA 2DLTA 4JMXA 3W39B 3KLLA 1EFQA 1E2WA 1TJXA 3QUYD 1ACYH 4CJ0A 1WSST 2OA9A 1I31A 4LEBA 1MCPH 5FV1L 2ENSA 3ZHFA 1QP1A 3DROA 1S7VA 4HSCX 2R1XB 5JXEA 1JPTL 2D3LA 4KZDL 4EQ3A 3KPQB 3OAYK 5L7XL 1DBJH 2VDLH 5E5MB 3QIUD 2KZ1B 3VFRB 4J3SA 4U1HB 5HYJE 5E6ZA 3QPKA 3QULB 1BMGA 4A38A 4L18A 1I3RA 1J5OH 4WGVB 1AHWA 4OU3A 2WIIA 2ZUYA 4KKQA 1DBML 1QWUA 5DJAA 1VZGA 2WO4A 3U30C 1DVFA 3MRCB 3L4CA 3I3EA 2X4PB 4P5SA 1J5CA 5D2NB 4B5EA 3PWUA 4L9LC 5E0FA 5EU7E 4R7DB 3GSOA 1ZT4B 4PB0H 2BHFA 2Y06H 3IU4H 4DVRH 4V33A 3BUTA 4R3SA 1QVOA 4TSCL 4GSRA 4I18C 4H0IA 1H8LA 3U0TB 1G9EA 3AADB 4R7NA 5H37A 1WVZA 2AC0A 1ET7A 2Z9TA 3L4UA 1MQ8A 5ADOH 1XAUA 1C5CL 4QYAA 4OM1H 3S5LA 2ITEA 1PQZA 4NQSA 1PDKA 2XTSA 3FC8A 4I0CC 4Z18A 3IAPA 4XOAA 5CUSH 1KJVB 1X5GA 2CPCA 3ARFD 3DK0A 4FJZA 4MZ3A 4ENZA 3CLFH 1SXZA 5EC2B 1TETL 3IDJB 4OGAD 4YFLF 4OCSL 2P45B 2DMCA 4NNPL 4OJDH 4WWKC 3BT2H 2MPVA 4X7TB 4XNUL 3A6OA 5DD3L 4KY1H 3RWJB 4Y5VB 5KVEE 5A40E 1E6JH 2X4SB 1P69B 3HPJA 4XAWL 5IB2A 2XIDA 2H45A 3MLWL 3HC0A 3N9GH 1IEAB 5FYKH 3CFKA 2QDWA 1NMBL 2ZXBA 3VW3L 3BIKB 5ESAA 4YHNB 3UFIA 3EJYC 4FI6A 1ID5I 2IWEA 2CGYA 1R34A 2DOCA 1KELH 3KHOA 5E6IA 4LRIA 4MYPA 3WTXA 4HD5A 3SPCA 2OJZL 4ZFZA 4HCFA 2E3VA 2I26N 1ND0A 5SX4H 3OMZA 3PXLA 3EADA 4I85A 2EIDA 2PYED 1L0XA 3NFSL 1PLGH 1G9MH 2DIEA 1ZLEA 2NYYD 2FGZA 2BH0A 2PN5A 3O6FA 2KL6A 1RK1B 2VB5A 1ZLVH 4MNQE 1VFBA 3U4EA 3M7FB 3QEQD 1O0VA 3O2WL 1J9RA 2ODIA 4Q4IA 5FYKE 3M8OH 5C07E 3NIFF 3RP1A 3PPEA 4HEPA 1VADB 1PW3A 2PWDA 4UQ3B 4BZ2A 1FP5A 4ES9A 1WZ1L 4WIQA 2A0LD 1KGWA 4I9WE 2B5IB 1BZQK 1L9OA 5I9QC 4OV5B 4AZ8B 4X4ZA 1CE6A 1OGAD 3DVNA 2Y6TE 1ZD6A 2RIKA 3BO8B 3O9WB 4U31A 4W9EC 3VI3E 3SKOB 1KCRH 4X6BB 4IK7A 4ZW3A 4AEFA 4A6YB 3D3VE 3PP4H 3OKMA 4PCKA 5T1DH 4RCAA 4ELDA 3B2UD 1I1FA 2BP3A 1VSCA 3VFOA 1DQMH 3QUXB 1TJHL 2JVUA 1T3FA 3UAJA 5GS0D 3EHBD 5BMFH 1MFAL 2CMRL 4X6DF 2Y6SD 4MXWL 1BVLB 4WK0B 2VDKH 5K1JA 2ZCHL 1I9JL 2ARWA 1FZJB 4PJ7B 5EBGA 3ZL4H 2OXGB 4YDKL 5ACZB 3CIAA 3QUZA 4IRJD 3JT2A 4XTRD 1U8KA 5AUMB 5D4JA 4OGAC 5FW6A 2WQUA 3WSQH 5TF0A 3KBPA 3ZZSA 1AHWC 3U7WH 3W0WE 5L4IA 1RZIA 2VR4A 2F6AA 2KYIA 5GRVK 4EEEA 3N1PC 3QPXH 4RMRA 3VWKC 2G3MA 2QQNL 1ODUA 1DE4A 3VM7A 2V6HA 3CFJA 5DMKA 3VXRA 4UZSA 3U7YL 1JTTA 3ILQC 1CR9H 2OLDA 4NKIL 2CGRH 3ULAB 1HQ4A 5LGHH 1ACZA 3TASA 4X2UA 2L3BA 1E90A 1QNIA 3ARTA 3HZKB 4QKXB 5DVKA 5MEOB 5DRWA 4CDGC 1GZQA 3ESOA 1QLFA 4OQTA 3HE6B 1YYLL 5FB8A 1MAKA 4ORGA 4YUEL 2VZ1A 3TURA 2PYEE 3T04D 1HSAB 5HGHA 2PW1B 1HIMH 4AYMC 3IXAB 3S88L 1TO5A 1WITA 3Q2LA 1L7TL 1J1XL 2QSVA 3CFCL 5EC1A 3NCFB 3VXSA 1KWGA 5IBTH 5IJKC 1I1RA 4NQCB 2OR9H 4H8PA 4WTQA 2W92A 4MD5A 5EFIA 4A2LA 3D39E 4XPHH 4BKSC 3DJ9A 3HCVB 4ZW7A 1DQTA 2JKJA 1SEBB 2X4RB 2YPVH 3C6EA 5D5MF 5I1KH 1ETB1 4MA8H 1BZEA 3AVEA 1Z3GL 4L48A 4ZS7L 4WKZB 2XFXA 1TEYA 3GNML 4XB8A 4OFKA 1GC1C 1A6ZA 3E6HB 3W56A 4V11A 4E5XG 1KENL 4PJ5E 2MQGA 1E50A 4KRPC 5F7DB 4HHAB 3PHOA 2EDQA 4ODHH 4OFPA 3TTYA 4LHUA 5EO9B 3PFUA 2GITA 2EEDA 1FYTB 3OHXC 4KTDH 1B2WL 1CC3A 1JGUH 4YXLL 5HI5D 4L4VB 5D2NC 2N1TE 4KI5C 4E0RB 3R19A 3QWQB 3T2NH 3QFDA 5CGTA 3C5JB 1JV2A 2WO3B 1N70A 2ZE0A 2EIZB 2O1AA 5AZUA 4HCRH 4LOUD 1DN2A 1HCFX 5JXEC 4N25A 4XP4L 2APTA 1PAMA 4DUVA 2MJWA 1SHMA 3P2BA 3N1GC 5GZNA 4QRUA 4BSVB 4TVSa 1FN4B 2JIXA 2UY7A 3VXUD 5F0JB 4EE2A 1ZOXA 2ITFA 1TTGA 2QLYA 1R46A 3L48A 1JK8A 4CA4A 1OAXL 3GPSA 2MKLC 3S36X 3DK2A 1SUHA 4LPCA 4XPGH 2UXVA 4PRID 1PG7L 3WDIA 2ED7A 2ZWNA 1T22B 3LKPB 5LCVH 1KXTA 2UX7A 1TFHA 3EFFA 4M7ZC 4E9VA 1QSEA 5CHNA 4H88H 1Q9WA 3SDXA 4MJ6A 4NM4L 2VWEE 2ZWLT 1BLNB 2FWSA 1X5KA 4H40A 5D8JH 1DHKA 4MA3B 3ZKMD 2VDOB 2BNQD 4ZMQA 1FYHB 3D2UB 3KL5A 3O6LH 3F7PC 4X5PA 3NRQA 5DJ2A 3SB3A 4EDWL 2D3JA 5CU5A 1A64A 1KYUA 4OF8A 5I8OL 1HOEA 1JZ4A 5I1JH 1SJEA 2PXYA 3CK0H 4FMFA 3ARSA 4PH8A 4DGYL 4B9JA 3B5TA 1DFBH 3JTTA 1IC7H 1WWAX 4N26A 3QSKB 5F8QC 1I7TA 1EEZA 1Q0YH 5CLTA 3SKJL 5CEYA 5F3BA 3ILDA 4QRRA 3NFNA 1LK3L 5IOPB 1GYCA 5AW9B 3CXDL 3R06A 2YMTA 1E2ZA 3ARGC 4HWBA 2ERJB 2YR3A 1KTLA 4UM8A 2VDKB 2XKNB 4YBLC 3LNFA 1JZEA 3ORJA 4WQOA 2AKRB 1T1ZB 3ZRSA 3HN5A 4FX5A 3L3GB 4X7SH 3TCLA 4LVHB 5SV3A 2NY2D 3UOAB 1A6VH 4P99A 4E9XA 5F3BB 3MBED 1BOGA 1SJEB 2PXYB 4P5TD 2WINA 4UOW0 3E2HB 4AKQA 2V2XB 2VDPL 4WI0A 4PV9B 2IBZX 3ALWA 1KN2H 4MXVF 1QI4A 2A74A 5ICZA 2E56A 2XTLA 4Y19E 1TTUA 3TOPA 3OX8A 1RJLA 1BIIA 2HRLA 1KMGA 2AXGA 4L0YA 4NQUA 1EEYA 1U8PB 4KXZI 1QPPA 3GTTA 2JJSC 4PJCE 2EYRA 4NWTL 2R1WB 5EOCJ 3UJIL 2WTRA 5JA8B 3NN8B 4OKDA 1P9MC 1NM9A 3K0YA 2UZIL 5DHVH 5E6YA 3P0VL 4U7KA 3KPRA 1G7LB 4OM1L 3BH8A 2DYRB 3MNVA 4L2LA 4MS8C 4QY8B 4UU9A 5E24E 5T1KD 4U2ZA 2WLYA 4GEJA 1P5UA 2R69A 3PAYA 4P59H 2DEYX 5I1DA 3S5ZA 5DDHA 4BUGA 1KCSL 4L8DB 4QTHB 4FAAB 3OZ9H 1JS4A 4XP6H 2O5YH 3DJSA 1CBVL 5F8RC 1DSWA 5IHUL 43CAA 5K33A 1H8OA 1VB9A 2FIRT 4G8GD 2ZCKL 4FXTA 4JNXA 1NBCA 4KK8D 3I6GA 1D5MA 4M1DL 2MHAA 3OWEA 3QDGB 4UQ2B 3VH8G 1TTAA 4Z7QF 2B59B 2AXJA 3P77A 1Q9OA 5I75C 5ABAA 1D5BA 2HCZX 1MQKH 1ZTXE 5DMIL 1U8LA 3K72B 4OBSA 4ONHB 3WU1A 2DMHA 2NQCA 4KUCF 4R26L 2WKLA 2HTKC 1L9NA 5I1IH 5I0WA 1H19A 1J0JA 2I60L 3Q5OA 4XPFL 5F9WC 3ULUH 3TGXA 2IANE 3BJLA 1A6PA 2ADIA 4J3VA 1MJUL 2HKHH 2GY7B 5B1KA 4N0CC 1MG2C 3LMJH 4B3EA 1BMZA 4X9FA 2HVJA 3GS4A 3M8OL 4LSRL 1UXSA 4V1DA 1CT8B 1WHPA 3IBOA 3JWNH 1NIDA 2HA1A 4DVBB 4RISH 2AVFA 3VGBA 1HSBB 3MOAL 4GP5B 1JYXA 4JFDA 4RESB 5E7FA 3FQNB 4PJ5B 4D9LL 4JHVA 1N8ZB 1TCRB 3MRNA 1HKLH 2EIJB 1PJ9A 2IAMD 3BPLB 4NO3A 3LEYH 1TJGL 2B9BA 2B3IA 5GGQH 3LZPA 5DJ8B 2BOBA 1R0AL 2HH0L 4LCVA 1EJOH 1AQHA 2XG4A 2BWIA 4XC3H 3IGAA 4HVBA 1OL0A 1NBVH 1YC8A 2WZPA 4XMKL 3TJPA 3WL9B 3VACA 4IRSC 4PV9A 4FI7A 5LHDA 1CT8A 5KSBF 5KSUB 1KB5H 1Q72H 4LLDB 3QE5A 2JI3A 4K0OA 3ZE0F 5DQJB 2FNBA 5EG6C 4J2QA 1KFAH 1JF5A 2XUWA 3CSYB 2VL5A 2X4NA 3FCBA 3HUJB 4BWUA 2AV7B 3VRLF 3T1FB 1URIA 4Y9FA 4F2EA 2X89D 3P3RA 3V9FA 4XNMB 2QQNH 3RURA 3HG5A 4BZ1A 2YRPA 5AVQB 3OM3B 5IJKA 4MA8L 4D0BB 4PMFA 5HDLA 4G6AD 2EDYA 1YNKH 1FH5H 2GQHA 5GGSB 2J72A 4FG2A 4F7CB 4N5UA 3ZDZF 5CEZH 3BD3A 2VABA 4AJVA 2WUCH 1AE6H 5JOPE 1E5BA 1U91A 1NCIA 3NIFB 2ADGB 5IMMA 4NO0B 3S6CA 1PVHA 2IWKA 5FK9A 2Z31A 5KSAD 2F54D 4ATWA 4ZMWA 2OBGA 3KXFA 2VMDA 3J27A 2LFGA 4HC1L 3SE8L 1DQLH 4Y1AE 3LNIA 2XLLA 5CSGA 3MRKA 3OR6B 3QDGD 1IO4C 4Z5RB 2VLLB 2PNDA 3E6FA 3ZHNA 1UB5B 5CBAB 1IGFH 4CVUA 4QHUA 5T5NG 2XBDA 2YBGA 3L4XA 4OFIA 4GKZA 3BMWA 1QSEB 4XAKE 3BFQG 4R6UA 5D5MA 1GYUA 3SDCC 8FABB 1IILE 3D0VB 7TAAA 1EH9A 3FN0H 3JV6A 3W0WD 2EO9A 4QRPB 1LDPH 4LVNC 2HPTA 1FQ9C 1PG7X 4GW1A 3IDUA 4HUXA 4CNIA 1U58A 3F7VB 4ZUTA 5BZXA 1VFUA 5AVYB 1BBDH 3OHMB 5DK0A 1JTOA 2LAGB 3FU5A 1CFSA 2GJZA 3P4OB 2PCXA 2ZG1A 4MAUH 1IM9B 2VN3A 1Z66A 1D5XB 2X38A 2ZP0T 4KK6C 1INDH 4D9RE 4E36A 4KI5E 5K1NA 2GYSA 3P2DA 4UT9H 4ABWA 3KYKH 3G5ZA 4ODXB 5EEVA 1G7MB 4JBSA 2BSSB 2JKWA 3MJ7A 3FTWA 4N0YL 3WTUA 2AGJL 4IBUA 3MXWL 4POZD 2NY3B 2GIMA 3V5KA 4NP4L 4KROD 3NCMA 1SEQH 4B9KC 3X12B 1U8QA 5D7SH 5EBLA 3O6LL 5I0XA 5CINL 3T2LA 1MLBA 5C0RL 2XTJC 4N2OA 3QXTA 4BFFA 2XQ0A 1DQQA 1CQYA 4MVBD 5AAMC 3OSVA 5B4MC 3L13A 4Z7IA 5AVWB 5FUOH 1PNDA 3MCKB 1URZA 4F93B 3J07A 4JPKL 2NR6A 1U8JB 4AYID 4HPHA 1U3HC 1A7RH 4U1NA 2IBZY 4ODSH 3RWGB 4N68A 1ZV2A 1F1AA 2C1PB 4YQXL 2YD5A 5C0BD 4EZJA 1IC4L 4LPWA 1OAXH 2VDML 5BW7A 3HUJA 1DSFH 3BWUF 5DJ6A 2DQGL 2Q3ZA 3X3FL 5BUAA 3C6LA 2FIKA 1YPZE 2F8VA 1GJIA 3IPFA 4EKXA 3MMEA 5HHOA 2ZUWA 4DP7X 3TJEL 4PQXA 4U1GC 3VFTB 2IPTH 1XGUA 1VA9A 2IQ9L 3TIDB 3BKCL 3C9NA 4FTVA 3KYOA 4B96A 3GRWH 3AS1A 3AAZB 3VFSA 2EADA 1MCLA 1WFIA 1X9QA 1P0SE 3SDAA 1NCDH 3OF6D 2B8OT 2NY7H 4GBXB 3FQRB 3TBWB 5GRYA 4V1DE 3ZGIA 1MHCB 2C3XA 3GD1C 4LCWA 1NLBL 4MJ6B 1ZVSB 5TGBA 5HHOB 3MO1A 1T04B 2VISA 3BDXA 4K5OA 2E7DA 2VABB 2C9PA 1DJIA 1RJZB 4G9FB 1UATA 2NR6C 3IYLW 3LAFA 2W60B 4K5LA 5CU9A 3WD5H 4DFIA 5LN8A 4YX2L 3O0RL 3D4GA 1USZA 4PP1D 1XVSA 1ZT7A 4JRLA 3FONB 4PJEA 5KVFL 5DMGC 4D8PB 4PJ8A 4MD4B 3T09A 4FABH 2PMZA 3QJHB 1A9BA 4WHDA 2YRZA 4MAYC 5E8OA 5T3ZL 3MA7A 3C75A 3B37A 1SDDA 3T0WA 1NCWH 4L23A 2GBAA 1NOAA 1ZHBA 2GBVA 1YEDB 4HUKB 4NBXB 4G9DB 3C6SB 2BWDA 5D9SB 3CUPB 3FOLA 4XCYB 3PNWA 4QRUB 4EIBA 1J1OL 4AEIL 4EDXA 1Z7JA 2WQRA 3NABH 3PL6A 5IY5B 1GGUA 1XF1A 2Q0ZX 4KKAD 3FHQA 3QEGH 4PUBL 3VGFA 4HKXA 3WJMA 4OCRH 4P2OD 1HWWA 2Y5QA 2Q8BL 2WLHA 2B5IC 3RKDC 1SJHA 3FT3A 3D25B 2HFFA 5I8KL 1XQ4A 1AXTH 2GEQA 5JW5B 4UT6A 3S4SB 5SWSD 3BKJL 3IBEA 3B2VL 1F4XH 3GK8L 1JWMA 4G6AC 1A4KA 4FFTA 1FL3A 3MYJB 5AKRA 1D7FA 2Q20A 2YZ8A 4TNWF 2WYHA 2W9DL 5A16B 4OV5A 4F58L 4DHLA 4JHUA 5D4HA 4R8WH 2ZUSA 3LEVL 1SJHB 4OSUL 1JSYA 4MSWA 3MODH 5GHWH 2IWGA 1MLBB 3RWHA 2UZYA 4MCMA 4WUKL 2R0LH 2YPLD 2CKBH 3QIWD 4HJGB 4LNRB 2R0KH 4OCWL 3RIFF 3S0PA 5MP6H 3SZKC 3WIIH 5DEFA 4EOWL 2J73A 4Q89A 3ULVH 2GHZA 2VMEA 3QH3B 1UWXK 3OAZK 1AHKA 3SE4C 3KPRB 2C1OB 3CMOL 4Y1SA 3WLWD 1QFWI 4M48L 2JK5A 5IB4A 3SDCA 3ESVF 4F9LC 3RY6A 3QUKB 2DLGA 4JRXA 1X4YA 1F0LA 2LQRA 4HLJA 2WLLB 3ATDA 3K8KA 5LNEA 3US1A 3NIFE 1VZHA 3QG6A 4YL9A 3L1OH 1PSKH 4G7YH 2UYLA 1ZCRA 2ZUUA 4W70A 2QMKA 3NFSH 3U4AA 3BZEA 4A04A 5GGQL 3SN6N 1Q8MA 1MLCB 3K2KA 3V0WL 4FEIA 2G75A 2R4RL 2VC2B 2CK2A 3VXMD 3UPAA 2Q86A 3Q2VA 3QZNA 4OCSH 3FT4B 1A9EB 1CG9B 1L7IL 4JKPL 4WI4A 2F58H 3KPSA 3FB6A 3FFCB 4XGZA 5LGJB 1IFRA 5L88L 3DO7A 4M7JL 5IQ7H 4LVNB 1G0YR 3RX5A 1F1DA 3HZMB 2NSXA 3GHBL 4Z7VF 2PETA 1AXSA 1OO2A 5KAQG 1UWXH 2A9AA 2GT9A 2QDVA 4LE8A 3AZUA 3NH7H 3N44F 3MLXH 4H20L 1NGPL 2XQBL 1WJ3A 3C2AL 1R47A 2OZ4A 3RJQB 2M1KA 3FAWA 5SX4I 1ASQA 3BVXA 3ULSA 2O72A 1HEZB 1H5BA 2A6JA 2FUQA 2YD4A 5B1JC 3HNSL 4XMPL 4UANA 5FWQA 5HYSA 2IFFL 5JO5B 5C9JA 1TMCB 2VLKE 3WXVH 2O5XH 1KB5A 1MY5A 4ONGL 4Y1TA 5J8OA 2ZXAA 4JY6A 3RE0A 4CVXB 1ZANL 1CFNB 4ZQKB 4WSGA 3AXLA 3N1MC 3HNVL 2NMSA 2G5BA 3JSSA 3H85A 2OMBA 1U33A 4YPGB 1KB5L 3N55A 5SWZB 1DVTA 4PJBF 3WI9A 5B38G 5A2IH 3VSUA 4Y5YB 5BZWA 2WTOA 4J1UB 1WZ1H 3P40A 3WL9A 2YC1B 2D9CA 1R3HA 2ARJA 2CBTA 1SVBA 2JELH 5E1HB 4XNXL 5E8PB 1KCRL 3QZLA 1JCVA 5LBVA 2OSWA 3UGXA 1CVSC 4R4ND 1ZXQA 1XO8A 3PWPD 3MRQB 3NTCL 1YPZB 2Y0SA 4LHQB 1KCBA 4PBXA 2EAEA 4A6YH 2BFVH 4DO5A 3CCHA 2AANA 3ZX1A 5I17B 2Y7QA 4YZFE 4AQ8C 4N1CA 1PIGA 3UJJL 5B1AB 4I5BA 2GC4C 5DEGA 4PB0L 3DVGA 2A6DA 3CFEB 3KD4A 4Q6YA 1G6RL 5HDRA 3NCJL 1F11A 3E8UH 6TAAA 1A7OL 5E4IA 4Z76B 1YJDC 3MZTA 3SEPA 3BKML 5D6DC 4F2ME 1A6WH 1DZBA 3SQOL 1KBGL 2DI7A 2WTRB 2NY4C 5D7SL 1EEQA 1TVBA 4M4PA 4A2EA 2CU9A 4PJCF 3HZYB 5DQ9B 4TSBH 1G7LA 4B95C 4GUPB 5I8EA 2FHCA 4WCYH 1NMAH 2MFNA 5E6UB 1S8DA 1DO5A 1ZVHA 3C5XA 2H32H 3BH9A 4IRJB 3LH2L 4WHYG 4KDTA 1JZ8A 4X7CC 2AJ3B 3DRTB 2D2OA 1YNTF 1LHZA 2DMKA 2JV6A 1J9SA 1TZGL 1LEGA 3E0GA 1CD8A 2DEXX 3VXSD 1IBHA 2NY2C 4UQAA 3HUJF 2VLRD 2ERJC 3GMPA 1ZV9A 4Z0BH 1CFMA 4HS6A 4XZ4A 4UQCA 4FA7B 3HB3B 1GMEA 1WBYA 1MNUL 1LK2B 1BJMA 2IQ9H 2ZKYA 2ZICA 1G4MA 2BP8A 4WFHE 2Q76A 4ZMXA 4XO9A 1IL1A 1E5YA 2AMUA 5T1JA 3EYOA 3S8WA 2JLLA 4R0LB 1T4KA 2AHIA 1ZTXL 4M1CD 4PJDA 5L0QB 4TUJA 4MQXD 2Y07L 1W9XA 4EUPG 1XTLA 5FDYA 4MBRA 4JG5A 2OYKA 5DEZA 1RUKH 2A9CA 1EUTA 3GMLB 5GS2D 4PJIF 5F9AC 5CCGE 2J5LC 5CCKL 4HJUA 1BZ9A 1Z2KA 3QJRB 2YKLL 5F3HA 2WXJA 3QCUH 4LDLB 1ZIAA 4EF3A 2ZSWA 4RWHA 2JCCA 3H3PH 1JRHH 2F1AA 3QRGL 5D2NE 3MJ8A 3QNZA 4K23H 4YQXH 2R1YB 5EUOA 3D2UA 5DJ2B 1TPXB 4PJEF 4WI9A 3EF7A 3WLBA 4UV4H 4PP2B 5T3ZH 3NESA 4N0FA 1HC1A 4QLWA 2MQCA 4CSZA 1HJBC 4B53A 2GSMB 5IUSA 5JQ6L 5J3HD 5JXAL 1BZ9B 1T83C 2IAND 3SYPA 4G6KL 4F91B 4A68A 1HHKB 3ARPA 4APQB 1F6FB 1DP0A 3O6KL 3PDOA 2OYLA 1TQVA 2FIKB 3NK3A 1T5WB 4J3WA 4UZGA 3V55A 4A37A 4KAQL 1IAOB 3G5WA 4AEIH 3O4OC 4AJ0A 2O4EA 4XBEL 2BC4A 3ROLB 3CX5K 3IDYB 4MJIE 2BSTB 3GSXB 5H94A 4HIJA 1SY6L 5HHPB 4HX1A 1WFJA 2CDFA 1AQDA 4LSSH 4QO1A 3SDDB 1Q0YL 1NLDH 4PTTA 4DKEH 4CN6A 5DI8B 3TPUB 3UYOD 3F8UB 4EPSA 1N6UA 5EWIL 2HJLA 3W11D 4PW4A 3LIZL 2E6PA 2ZPKL 4XOCA 4O02B 5IFJA 1R5IA 4DK6A 4YIQA 4WWKA 3VAEA 1XIWC 3IJHA 5DZVA 4Y9GA 1EGJH 4TQEL 2X41A 1B0RA 5E8DH 3WFHB 3S3BB 1T1WA 2ATKB 4B9IA 4B97A 4BFBD 5JQIB 4PRIE 1PMYA 3LQAH 1INQA 3WMPA 4PJEE 1PS3A 2CKBL 3D85B 4N2DA 4AGOA 5DQ9A 3RNQA 2V4LA 5FKAB 2VDPH 3CSBA 1M7DB 4X8JB 5IFJB 2NXYC 2D31B 2XA3A 3KL0A 1T89A 3U2IA 3TPUA 5E2VL 2ZQKA 3RDTD 3MREB 1JPST 1MCCA 4QRTB 4LL4A 2IJ0C 3OLEA 3ZDZE 3BVWA 4UQDA 1OW0C 2VDLB 3DSNB 3AWGA 4Z7OF 2NZIA 1IFHL 4GSQA 4QTFA 3A6BH 3GSNA 5C0AB 1AD9B 3PHQA 3RZWA 3S37L 4LCUB 4QHKI 1AO7B 1L7TH 5JLZA 1BJ8A 5EU5B 4FD0A 3E6FB 4L3EE 2HFFB 2EO1A 4AKPA 3I02A 5CFAA 3CVIL 1P7BA 5KBKA 1YEEH 2FDBP 4R2GB 2FK9A 4ADGA 2QVFB 4RAUB 2P1YA 4O00A 2ZSWB 1DBKH 4NYLB 3FQUA 3HLAA 3OB0K 3KPOA 5KYWB 3SQBB 2O5YL 2BP0A 1KXVC 4I3GA 5EO0B 5EF2A 4PJHF 5LB1A 3QXAB 3ARQA 4QCIB 1MAML 3QYCA 3ZQWA 4JK0D 1KBKA 5TQ2L 3UBXG 1H3XA 5DD5L 5EU3B 4F9PA 2EVGA 2B0SH 2G5BB 4O4YL 4NQDA 3CVHL 2JI1A 5HHOD 5CMAA 3REVB 3ZUNC 2XACC 4A66A 2YRLA 1YCSA 1H0DB 5I0DA 1MXGA 2K70A 3ASOB 4J1UA 1EJ8A 2ZOWA 1UOKA 4UILH 1MCRA 3UBGA 1JWUA 3FB8A 3QG7L 3SDAD 2DM2A 3FYEB 1SF3A 1NPUA 2Z1PA 4QR7A 5TDOA 3WJJA 4KVPA 3QWRA 4JM2F 3WXVL 4DKFL 1RZKL 1FVEA 5GGRB 3UO8B 2WGXA 1MJUH 1QEWB 5L0QC 4U1IB 1DN0B 2F74B 3FDWA 3MRRA 3EHBC 4IU2B 1T3FB 1OCOB 3MV11 2KUTA 4Y4HA 5I26A 1FIGH 2VDRL 1BVKA 3K2UH 3VG9C 4NO2B 3NSFA 4PG2A 5TFSH 3JZYA 1I3GL 3O4LA 2CO7A 2GCYA 2K0RA 5FHBH 1JVKA 3LDBB 5I1LB 3A6CL 5F9JB 2HFEB 3BIBX 3G5VA 3IVKB 3HE6C 2OYPA 3C9NB 1SXAA 2XRAH 3P0GB 3KPSB 1X5HA 3FUFA 3FW6A 5LVEA 4B9GA 1MH5B 2X53A 3WEXA 1TG8A 2WQXA 4Y16D 4Z76A 3B34A 3H9YA 3HI6L 3U9UB 5GGTL 3A23A 3DO3A 1UA3A 3LSOA 2ZAGA 1RXLA 3B6SB 4DGVH 4POZC 1PYWB 3WKQA 2D31A 5L6YH 1J0ZA 3BHBB 1ID2A 1YEIH 3ARRA 1DJGA 2YAEA 5DK3A 4N1HB 2V7NB 5GGTA 3TU6A 3ZYZA 2H2SD 4ZXBC 2NSQA 4H1LG 3ZDYE 1O9ZA 3MRCA 2X9XA 4ONGH 1SLVA 4NPJA 4PI0A 4DNLA 2R69L 1Q72L 5CZRA 1ZA6B 1JGVH 32C2B 1WE5A 2DAVA 3O3BA 4YVUA 4LSDA 3FNKA 2IAMB 4LLUA 1A7OH 3SKJH 3NPZB 5EOQH 3STZA 5KUMA 2G2NA 4UB0H 4FGMA 2XN9D 5C0AD 1K2DB 2YUZA 3L3KA 2YD9A 1OGAA 3WKNA 1I7UA 1Z9SB 2J4WH 1CICA 1OTSC 2IG2H 5AVUB 2BFGA 2JELL 3C60D 1HOCB 3DSFL 2ZP8A 3QJSB 1CTOA 2H0FA 4POYA 1QO3A 3MN8A 2FJUB 1N2RB 3U4BH 3KG5A 4AC4A 1NC2D 4X7SL 2FWOB 4TVUA 3NTCH 3AXIA 3UBXI 5BJTB 1MPAL 2P46B 3UAJD 4I2XE 4F7MB 3UDWA 3FUJA 1I1CA 3X11A 4MAYB 1QTYT 2YOCA 3ZKXC 3CVHB 3BIKA 4G5ZH 3BP5B 1RIHH 3PUCA 2DD8L 3QDJB 4BHUA 3BSHA 2QQLH 3NSCA 1GGCL 4JLRB 2Q87A 1OLZA 1XF3B 4BWWA 4URKA 3MNZA 3SY0A 1GMIA 3MBXL 1SDAB 5F1IB 1P4IH 5TDNB 4MZ2A 1P1ZA 1IGFL 4MBOA 2H0EA 2EIKB 1XTMA 2Y07H 3G04A 2MCPL 3ZE2F 4MCZA 1NCGA 1QLFB 4LOUC 2UUDH 3W5NA 4TLTA 3EGSA 2PABA 1A7BA 4ZO9A 5T1LD 4P59L 3HW7A 2KERA 3AREA 5DURD 3H3BC 1CDGA 2WUCL 2WNKA 3SPIA 4KV5E 4MNGA 3FQWB 2EP6A 4O2EB 1UVQA 2OKMA 4FXGA 2AABH 4HMDA 5I24A 5BRZD 3RPKA 3L95B 1AI1H 4G9FA 3DI2B 3T3ME 3RL2A 3IPEA 1D5ZB 1SBSL 4YDMA 3FU8A 3CDYA 5HHMD 2DDQH 3SE9H 3WAKA 4JQXA 3QG6B 2JB5L 4NP4H 1CGTA 1VRSA 3S7GA 1TNNA 4X99A 2CJUH 4X83A 4G6KH 3SCMB 3TNMB 1OSZB 4X4KA 3SKUD 3RGHA 1OGTB 2GG1A 4XCFL 1NGXA 1IGIH 2VR7A 1T1WB 2ATKA 3LOWA 4RGOH 5GSVA 2ITCA 3DRQA 2WVUA 3QJZA 3S36H 1UVQB 4K71C 3MX0B 3NDZE 4GRWF 4NIKB 2X1WL 4ES8A 2VDMB 3QDMA 2YMXH 4GT0A 3WKML 1A02N 5F93C 4N8CL 1E6JL 1H8NA 2FEEI 3JWDH 3MJWA 2EH7L 5IHLB 3GRWA 5EWIH 3SDAB 1NMBH 3VW3H 3LKRA 2AMGA 2IDSA 4PLJD 4F7EB 3PRZA 4H0LC 4IYKA 4NDMB 2WLKA 4PJCB 4X8GA 5TD4A 1BZ8A 2W5PA 5CZKA 1JWMB 3S5LG 1GPOH 3GJEA 1N2RA 3GSNB 2ATAA 2Y1YA 3WNOA 1QSFA 1RSFA 3IDNB 4MNQA 4XMLH 4LBAA 2QL1A 3OWRA 4FS0A 3V0VB 1HT6A 1TVHA 1RZGA 3C6LD 2ATPA 3LTVA 1G1OA 5L2JB 2WXKA 5D70L 3WD5L 2XIIA 3DYPA 4JE0A 3LKOB 4W6YB 4B0MB 4OCNC 1S3KL 1AY1L 1W6LA 1Z9LA 2NX5A 1NLDL 5C6TH 1EANA 4TPRH 3EBGA 1GTNA 5C0JB 3D39D 2IQAA 3V4VB 2ARJB 3OF6A 1EEYB 4UWQB 5BVJA 4HMEA 1O7DE 5E8PA 5BW7C 3ARXA 1OAKL 2AQTA 4JCLA 4X8XA 1SZNA 3EDDA 5AW8B 4OZ4B 4X6CF 4PJAF 1Y6NR 4HJIA 4KPHH 3P1VA 1B4TA 1A7PL 1YAIA 3CZFA 4N0UA 4OLYH 4RBPH 4J6RH 1P5UB 4TVPL 4BZ2L 4E41B 1DQDH 2P43B 4R90H 1QABA 1T7VA 4R4BA 3MNVB 1PCSA 4KFMA 2XY1A 1AXTL 3WYRA 3I85A 3QUMB 1LMIA 4FNLL 1JHKL 4QRRD 3R06B 4AYFA 4YVNA 3L7FB 1KN4L 1WFNA 4K8RH 1YG9A 5HP5A 4FTVB 4NWUH 4WJG3 2E4FA 5E9DD 4PJXB 4YDIH 1WYJA 2CO7B 5I1CL 1SOQA 1WH0A 3TT1H 3GMNB 1VJSA 5FA4A 3IVKA 3QFJD 2MH4A 1GHFL 4RLDA 1HH6B 1QVOB 4OSUH 5JPNC 1OSZA 4PIBA 2PO6D 2J88H 3S3CB 1SYVA 4RGMC 3UAFA 4PLJC 2ZP9A 5C6WH 5IFAH 3NDYE 1NGXB 1H5BB 1HEZA 3OKMB 4OIAA 2C34A 4Y2NA 1EO5A 2FO1A 4JFZH 1CZ8L 2V17L 2XJKA 4JHWH 3X1NA 3L1FA 4NUJB 5K9JH 3BP4B 3MV7D 4FYQA 4F7CA 1SYSA 4TNVK 4K7FA 1VKXB 1V27A 5ISZA 3NQKA 5TDPA 4NFCA 5CNHA 1UWYA 2DKMA 4IJ3B 3ZO9A 3VWJB 3TEZA 2XOTA 4UT9L 2DKUA 1J86A 5C08A 1F4XL 3GK8H 2VZOA 3APDA 1IAKB 1J1XH 4Z23A 5DWUH 3HS0C 4PD4J 4UT9A 1SVCP 1RZIB 5KOVC 5D2LB 1BQHA 4AQAB 3H7BA 2HXAA 4BIKA 1KTCA 1ETZB 3GBMH 4IJ3C 4NJ9L 2K8QA 2R0LL 4JPVL 4LAQL 4RFNB 1N3NA 3N3EA 4ZAKD 4ZUVB 1ZLVK 3UTOA 3ARFC 3LNEA 3VH8A 4FFYL 4P4RA 3F6IA 1TVHB 4ISVA 1ZV5A 2BW4A 1F4HA 4CC0A 2EDBA 1KENH 3AY4C 3BDBA 1T2QL 5EUOB 3GINA 4NC0B 3CTTA 2X2YA 5C09E 3LV3A 1IC4H 3D4ZA 4WI3A 4QOKB 1NDMB 5T5FH 5I71C 3QDJA 3NSXA 2OMTA 5G4NA 1JGUL 4YXLH 3AWFA 1RY7B 2HX8A 3UC0L 3CZJA 3HE7D 1XXFC 2XCMC 1GOFA 2R2BA 1J9QA 4YSTA 4AGLA 4XVUC 3OKLB 1UEYA 3B3IA 1E40A 4FI8A 1MCSA 4UBDC 3RVWC 4YSOA 3PGFL 4HJGA 3V7AG 5J5EA 4GSDH 2EVHA 3NCYS 4PY7B 2UWEA 3QQ4B 4BK4A 5E51A 3N85L 4XP4H 2ZUTA 3VX1A 2EE9A 3CC5B 4ZMVA 1CGSH 4NFBA 3RVUD 4R7LA 3RTQB 2ZG2A 1H3TA 4EN3A 4GG6A 2IVFC 2VRQA 3TJHC 2ZOKA 4KQ0A 4QYOA 1HILB 4N2LA 3CFDB 4UM9A 4AV0A 5DI8A 3DOHA 3BGMA 3T0ED 2CDFB 4ANKA 5FO9A 4ENED 3NFPA 4QHMA 2O93L 1VGKA 4UINL 1U91B 3QJQB 1J5DA 4FABL 5BZDA 1MJJB 2HLEB 2OJ1A 1EO7A 2VZSA 3LEXB 3QHZL 4PRHA 4W9GC 1XHHA 1GYAA 3HS9A 4WRLA 3D4YA 5ISZE 1HHIB 5B7FA 4JFOA 4LQFH 3DX1A 4WNSA 2X7LA 4OD1L 3DSFH 1WFTA 4ALAL 2IAMA 4LLUB 3HA0A 5A3IC 4P2RD 3S3PA 2GK0B 5ITBL 3BAJA 3S37X 4FOMA 5IHWA 2QKIA 1Z32X 1O75A 3F6JA 1J9TA 4MQTB 3HFMH 1R24B 5DMKB 2ZSVA 1CXLA 3CXHK 4K7PL 5HSFA 1L0PA 4MD4A 4FKHA 2G3NA 3BGFC 5C1MB 2KS0A 4ZZFA 4N2NA 5ICXA 1OP5H 3ARBD 3KPPB 1S7TB 1W16A 1B4JL 4HSQA 2FO4B 1XSOA 2YFNA 3S5LB 1H3VA 3WLBB 1RIVH 2EXWC 2G2RB 2X3AA 4LSTH 4OZHA 2P48B 2HSIA 2JB6B 5I15H 1KNOB 2AS5M 1OAUH 4G6MH 1BG9A 3AG4B 3T08A 4YHYB 5KJ4A 2LVCA 1BWWA 4K15A 4FF9A 3TO4D 4HS8H 5FA3A 3VYNA 2ICEA 2OZ4L 1BQHB 4L3ED 1NCAH 5IK3A 3MV7B 2EEBA 1CF8H 3HG3A 2YD7A 2LLNA 4EZLA 5HGDB 1K72A 4PCYA 4Z95L 4LU5H 5EUKB 2VN5A 1FO0B 5A1AA 4Q6IB 3NPSC 3X17A 3BPNB 4L1BA 2XWZA 2KZKA 4V1DB 4QCIA 5KBLA 1YUKB 1S78D 2AABL 3B7SA 2NYYC 1IIKA 2DQIH 2R4SH 3EYVB 4JRYA 5EO0A 3RAJH 4ACPA 2MTAA 4YHZL 2ROXA 1MFCL 4J39A 4GSUA 2VDQH 1ED3B 2OQJB 4IK6A 4XXWA 3MLZH 5C0ND 1N18A 5C0JA 3JV4A 3GZQA 4H5SB 4U1HA 4YDZA 1IM3B 4XMLL 1UOWA 2ICEB 5K93A 5E0QA 1K5NB 2VXUL 3MV8E 2NXYB 1D5IH 4XZUB 4QUOA 2FQDA 5DXWA 4OAWB 3VTMA 1YAZA 4LARH 4MA7H 2QHRH 5AQ0A 1G6RB 2ZXEB 5IG7A 1GGBH 3MCG1 4G3YL 2XN0A 1IARB 3MVSA 4LEEA 4YFEA 3N2JA 5HPMB 4QWWD 5FOJA 1MHPL 1Q1JH 4X9BA 1ETA1 1J88A 3LYRA 3D50A 4MRCA 3UAJC 2EYTA 3D09A 3FCGA 1I3VA 5HDOA 2C4FU 2NZ9C 1SFDA 2E8ZA 1KIQB 1ORSA 1BFTA 4JFOB 3WFBH 5CZXC 3MV9D 2P26A 2QMJA 1G84A 4XN2A 4DPRA 1QFWH 1E5UI 1IGCL 2VXVL 2NOYA 4OBRA 5D72H 5H37G 4E5XB 4KAQH 4P2AA 3U9UA 2J1XA 1UACH 4WZ9A 3QB7C 1LYQA 1PDKB 2AJXL 1JHTB 1KBBA 3VCLB 4MS8D 3V6FB 2ADGA 4OLZH 5AYTA 1G9NC 1OLLA 2R29H 2Y2YA 4TUOA 4MMXC 3VFTA 4QRPD 4LHUB 4LSSL 1JERA 4AYEC 5CLYA 1OE3A 3NCWA 1R3JB 2WXIA 4HDIA 2BM3A 1JGDA 1S3KH 1BJ1H 4H2CA 5IUCA 4LL1A 4X99B 5ADPL 1G7QA 1N59B 1WWCA 3C5JA 4ZMOA 3B2DC 3TBBA 5I1CH 1XMEB 1RZQA 4TUKL 3NIDE 5JIIA 1U8NB 2ZG3A 3NZHL 4Y2DB 1MCJA 4XNXH 3GHPA 5BV7H 2L7QA 5TH2B 1XF2A 4Z7OE 5CEYB 2H3KA 2YBRA 3K2IA 1OTUC 1J0IA 3CHSA 3BQUB 1FO0A 3S3SA 4R9HA 1KB5B 3HNTH 3WNPA 3DTXA 4WFHD 4L3CB 4RIRA 1RJZA 2BFVL 1CFNA 5ICYA 1MCWW 1BAFH 2LHAA 1JZ6A 3H2WA 2W0LA 1OPGH 1BQKA 4BCYA 5CD3B 2AJYH 3LS4L 4XO5A 1HQRB 1EZUA 1G7HA 1P7QA 1BD2A 3BUIA 8CGTA 2Q7YA 3TFBA 5IQOA 4E42A 1DBAH 4KK5C 4MX7A 3ECUA 1IGJA 4O9HH 5LGKA 1F4YH 1BLNA 5TQ0L 4C56A 4DUXA 4K8RL 2CKNA 3DTXB 2A74B 1BA9A 5I1EL 5I6LA 1ZSDA 3OD3A 3RUGF 3WENA 1EJ6A 2BY1A 2I32A 2FD6H 3FQTB 2J8OA 5GZOA 1FE8L 2ENYA 2D73A 1ZVNA 3C8KB 3CVIH 3UZVB 3D3VD 4O58H 3MR9B 4K3GA 3B4NA 3KR3H 5J6GA 1WAPA 1SHWA 5M7QA 4LAQH 3QJFB 1ZGLB 5CD5C 1YNKL 3IMBA 2XZAH 3N1QC 4OLVL 3U6RA 2G9KA 2V17H 4OVUA 3RZCC 4CC4C 3REVA 5AKSA 2WQWA 4X4YB 4Y9BA 4Z3IA 4BKLB 3I9GL 3FT2B 5DHYB 1YN7B 2H8PA 5AAWA 3LRKA 3GB7B 3QR1A 2WJ5A 1MLCA 4YFDB 3WTWA 1OM3L 5ACZA 1H15A 1LP9B 4HF5H 4AGMA 4ZK8A 4BZ1L 1I8IB 3TN0D 5CR1A 4TKWA 1CDCA 4NCDA 1JI1A 4MAYD 3S37H 1MCOL 1PZ5A 2NLJB 4P9MH 4RFOH 1TSRA 2DRUA 3OG4B 5BZDB 3LKNB 4IRSB 43CAB 1QSFD 5D4IA 1EQWA 3SBQA 4MD0A 4J4PA 3GM8A 1FORH 3HC4H 5DLMH 2NDGA 5IT2L 3FQXB 1BF2A 1YA5A 1TQBB 3SE3C 4FMKA 3VA6A 4YHYC 1ZWIB 5CCKH 5KYYA 3DVNB 3ENEA 4KZ0A 2VLKA 4ICWA 4JFEB 4UUJA 4Z7QE 2XHNA 3FJTA 3VFGL 1XWVA 2MKWA 3KBHE 1OM9A 1XGRB 4PVNA 3VD4A 3QQ9C 2W88A 5DC2A 4E9SA 2DH3A 4UBDD 2V33A 5SX5H 3RVWD 3CX5J 1AG0A 1S3RA 2OMXA 4P06A 4PJCA 3TL5A 4BFKA 4AY0A 1XSJA 4LRNL 2DQHH 3WKPA 2H9GA 1JGLL 4MD0B 4TL4A 3BLKA 1BWMA 1I9RL 4U1GB 4OJFL 3BE1L 3FZUC 4PGDB 3RPIB 2E76C 3QNXB 4KRPB 3VXUA 5ETUB 2AXFB 1PZ2A 3VB8A 1UWGH 4EUPA 4Z78B 2AJZA 3N91A 3KPSD 3QO1B 1RZGB 2FLMA 2B2XL 2E7CA 3CCHB 3VYOA 4Y2OB 4K7PH 5C3IA 3VWJA 2Z8WC 2NX5B 3QZOA 4I3SL 4ZOAA 3T2PA 4GQ9L 5DYOA 3TA3B 3APFA 3IFLL 1CXIA 2ED8A 1A66A 1JK9B 3US0A 3PHOB 1AGDB 4R5TA 2OMNA 3DMMA 4UTAA 2DIJA 2YXWA 3EDKA 3RG1C 1GGIL 1F90L 1FNGB 1FZMA 5L7XH 1TEFA 3CHOA 5JO5A 3KEDA 1N0LB 3O11B 2XKNA 3QHZH 1UWEL 3TT3L 2NW3A 4F57H 1EHKB 2WKOA 4YDLB 3F58H 3FO2A 5J6GB 4JJHA 5HYSB 3BSGA 3FQTA 3Q8BA 3IGKA 2AEQH 4LXFA 4NSKB 2BW5A 5DUBA 3SDXF 3UZVA 1L6XA 5TTRA 4JCWA 1AMYA 2I9LA 5I74C 1Y1DA 2H3NB 2XQYK 4XCNB 5B4MD 3VGDA 4NZUH 4WI6A 3RKPA 1NLBH 1BVKB 5ACLA 3P30H 3PABA 1TYJA 3AGVA 1IC1A 2GCYB 3HC3L 4XCCL 2EDKA 5DHXB 1NSNH 1SNRA 4RAVB 4IRJC 1N0LA 2H1LM 3O11A 5FGBA 4QXUH 4X6BA 4M5YL 5G4MA 4UTCA 2ZSVB 1KXTB 1AZBA 4GIAA 4WJ5A 4NFDA 1VFAB 1ORSB 2JKSA 5L2KB 3KVQA 2YGVA 3PV7A 1NGWB 2VC2L 1WEJL 4R2GD 4KK8C 1G9ML 4MA7L 3FQYA 5G55A 2XXMB 3L95A 5F3FA 3ZYJA 4P9HL 5F6IB 4I4WB 3SE6A 4LDEB 2C26A 3FFCA 3DHJA 1D3CA 1FFNA 2VAJA 5HD8D 3O2WH 3WEMA 1MHPH 4NXKA 4XN1A 2Q86B 3RNQB 2YSSA 4KKPA 1M7DA 2Z7YA 3C09B 1KJ2B 4WI8A 4X8JA 2Q8BH 3B9KA 1RIHL 5IJBC 3CSGA 2HKFL 4FHJA 1JG9A 3PWJA 1GXEA 3RAJL 2Y1ZA 2K6WA 2B59A 2QTEA 1HHIA 4PJ5D 3EOTH 1CFTB 3T4AC 1P5VB 5IJDC 3UTQB 2ESVA 1UJTA 2J8UA 5E9DE 4F15C 4HOXA 5L4FA 1M2VB 2IH1B 4PS8A 5CO1A 1RPKA 2YJQA 4RDBA 2CE6A 1HCVA 1J18A 4I3RH 2F7PA 1OCWH 1ZHLA 3IU3B 3QI9B 3RWEA 4PGBB 2B3RA 3GZOA 1AG6A 3H9SD 4NRYB 1S7XA 5EO1B 3L3OA 4DP9X 4QGTA 4ZFOL 2HJFB 5D1XA 5LAXB 3T0DA 2BC4B 1KWKA 1CIDA 3IDJA 1JFHA 3LPFA 4L1SA 2DM7A 3Q6GL 4KXAA 1IEHA 1UOVA 3JVFC 1WRFA 3QO0B 4MMXA 1Z1WA 3PJSA 2BIHA 5K5YA 5EU7C 1C16B 3AS3A 3N50A 4FQIH 2VXSL 5MHSE 2ENQA 1EXHA 2CR6A 4H0GA 5EIIG 2WPGA 3VGEA 5HPMA 3TF7C 1FWXA 5EFIB 2H6UA 2AEPL 1JN6A 4K7PY 1U92B 1QACA 1VF5C 4HGMA 2APBA 3UG4A 1MIML 4DP5X 2EE3A 3QVAA 4IIQA 2IGLA 1XCTA 2IDTA 2WSKA 2YD1A 3GS7A 2QQKL 4NRXB 2X2UA 4AVIA 4IGBA 5HYJD 4BQ8A 1G0DA 3KGUA 3GSVB 3PXJA 2EXTA 5IEHB 5KN5B 3EFOB 3GXDA 4RRPG 4U1SB 1R3LA 2I9LB 2D4DA 3FS9A 2C9SA 4G2AA 1K5WA 5E03A 2QV2A 3HAEA 5DC0A 1DEEB 2F58L 4MXWH 1DDHB 4WW2B 5LBSH 4ZMLA 5H35A 3ZSTA 2WIIB 2BY0A 3CNKA 4Z7NF 3LS5H 4IBWA 2ZXQA 1T5KA 2CRZA 3L9EA 3T1FA 2CPUA 5DMJB 4AG4L 3P73A 3RA7H 1PX8A 5AW4B 4Z3EA 1SXNA 3EZJB 3G5VB 4TTDD 3GI8H 5KJRH 1E43A 3E80A 3LSOB 3FONA 4PJEB 1RHHA 2NTSP 1EAOA 2YPVL 3BVDB 3HN3A 4W9DC 3TVMB 3ZGHA 5I1KL 4UYQA 2LU5A 1R3LB 5EOTB 3U4BL 2DIBA 1A5FH 4OLYL 2X6UA 1IGML 3D39A 1AIZA 2V2WA 5M94B 4NNXA 1S7VB 1OSYA 2GPZA 2QSTA 2IIJA 3KYAA 1LEIA 2VITB 1AY1H 1Q90A 5D5ME 1DBAL 1AQMA 4BM7A 4XRCB 1R3IL 4W9CC 3TIDA 2VH5L 3NEOA 4X5WA 1WISA 1FIEA 2X4PA 4TUJB 4QTIH 4F8TA 4K3JH 4PGBA 2EDTA 3NUKA 2IDFA 3D0LB 5FYKU 1GS8A 4FQLL 5LWYL 3IFNH 1K4DB 4Y9CA 1RMFH 5DUPH 5LAXA 5BRZE 1RIUL 5EUKA 4WUUA 1OK0A 1R5VB 4XP5L 5M95B 4H8UA 2OMYA 2X4QB 3AT9A 3BX7C 5D1XB 5ETUA 4HWUA 4LPTA 3CU7A 3W5MA 4QYOB 2QTVA 3VXRE 1OE1A 4AQAA 1GY1A 1CO1A 3MBWB 1DQKA 5GS0H 3H9HB 3EH2A 4OTXH 4POUB 5EU5A 1WGVA 4WUUB 2GB2A 1JUFA 1MFNA 3VG0L 1FPTL 2XIBA 2OMYB 1KBGH 3G6JE 4HEMA 3UL4A 3TT1L 5EDSA 4NUGL 4XVSH 5D1XC 1XIWD 2NCEA 2Q7NA 4Q4EA 2HTLC 3TBTA 3UBXA 5IBLD 2AV1B 2K45A 4ZMYA 2PPEA 2YXMA 3QGVA 5FLUA 1G6RA 5IB2B 2W0PA 2WV3A 3PV6A 4ZXBD 4OF0A 5E5UB 1DFBL 4W9JC 1LP9F 1NCNA 1PD1A 4Z7VA 1F58L 2TRHA 4YHNA 3ATEA 4XPBH 1PLAA 3B6SA 4N8CH 3PF2A 3RB5A 2OXGA 1TLMA 4FG0A 1KYOJ 2BWQA 3GMNA 3IWVA 3W9DA 5HDBB 1NGYA 3ZE0B 2Z7UA 1FVEB 4MZRA 1R5IB 3ECQA 3NZUA 3OV6A 2B1HH 1LO2L 4M8UA 5FGRA 5GGVH 1J1PL 1Z9NA 2DLFH 1YO4A 3AG2B 4UOJA 4CC1A 3WY1A 2WBJC 3SCMA 3TNMA 4X7DC 2GT9B 2V5TA 3D4CA 4Z9KB 1GKEA 1QEWA 3MUGA 1XGPA 1CGSL 3PLYA 5FGCB 4A63A 1IBYA 1NFDF 2CO4A 3MUY1 3MC0A 4UMGA 5E08H 3QPQC 4TYUA 4AVKA 3BDYL 3HZKA 1MWOA 4NI6A 4W4OC 3ZDWA 5ICUA 2XZCL 4HCGA 4AZ8A 5A6LA 5GSVB 4IIZA 5DJXB 1GKOA 4UTAH 1VGEL 4XB3A 4D8PA 1GYWA 1JRHL 2P9RA 5HGGS 4PGZA 1YN6A 3D48R 2UV3A 2D7TH 3MSPA 5FM5M 1D2OA 3OGOE 3OVUB 5FO8B 2HFGH 5DSCA 1UWEH 3TBSA 3VXMB 3SBPA 2ZOTA 4PRPE 1EV2E 1FZKA 4H1LH 4WFGE 4P9HH 5EBLB 1A14H 5KTEH 3F6LA 4MD5B 1WV7T 1Q9LA 2QSCH 2A3TA 1QRNE 1Z9PA 3FB5B 4MZIA 1I85C 3A0OA 1WT5C 4ONFH 2XNAA 5KZCB 4KJQD 5DFTA 4J7RA 3HLAB 3QEHA 3JWNC 3Q05A 2WXLA 1FL5A 3BZDA 1KBVA 3OKOB 3QDJE 1AXSB 1BREA 4HXBL 1X6LA 4GG6F 1XEUA 1WAAF 1ITCA 4LLMB 3D0VA 4FNLH 4KKCC 4WKXA 4XOEA 5CJBA 4JVUA 3PP3H 5EIIB 1KIRA 4P46A 4YGAB 1WZMA 4UINH 1RUML 1DBJL 2HT3D 2VDLL 3BUDA 1G1YA 3WLWC 3EZ8A 5GJTH 5DCCA 1UADC 2Y7SA 3AT8A 3MLTB 2RGSA 3GXUB 4MAYA 2DQDH 1BG1A 5JORA 4H7VA 3CFEA 4Q9RH 2W0FB 4I3RL 4S1RH 4FXGC 3O4LE 2VTFA 3LRSA 2KLTA 2GIXA 4FXKA 2BRRL 4M6AA 4IOSA 4X5XA 2XV6B 5CIPB 5B8CB 4XE0A 3LRMA 4ETYA 4F7TB 1U6AH 1A3LL 1F4WH 2MPAL 4S1QH 1BX2B 4QHLB 2YN3A 4HKJB 4FQ1H 1DL7L 4F8LA 4M02A 4IDJH 1R33A 2PWHA 4A7SA 1JHLH 1TIUA 1OF2B 1YECH 1IAII 5IVXF 3D33A 5DS8A 4XP6L 1SXCA 3KVPA 3QUKA 4GAGH 4LCCC 5I8EB 3CN3A 1QLRB 4KHXH 5DHYA 4MASA 2L7EA 2XETA 2ZX7A 5C92A 1KELL 3SGDH 3DRTA 3MLZL 3IAQA 4XNAA 2NLJA 1J8HA 1A25A 3MOBH 3WN5C 4O51A 2FB4L 4D0BA 4PB9H 1SEBA 5KYNA 3VVVA 4AKOA 5TE7L 5A2JH 4KX9A 4DTGL 1EHAA 1GC1H 1I8MB 4O2FA 2XZZA 2WNXA 2CDEB 2ZX9A 3BH8B 3L3HA 4MNGB 3EYFA 2H7WA 4NJ9H 1TETH 2BZCA 1WFUA 5AAMA 1IKNA 4JFQB 3UZQB 2V7NA 3DHMA 2L0DA 2GW5A 4IKLA 5DDHB 5GS3A 3BP7B 4RDQG 1YLBB 3C08L 3T1WA 1ZHLB 4XX1G 2CBMA 5IMLA 3VFSB 2V9QA 1JV5B 1F3RB 1E4KA 2WM0A 1MAMH 3FH7A 3DUSB 3UIYA 3FT3B 3HMXA 3ES6A 4ZAKC 3R8BB 4YHZH 1P84K 2O61A 5F3HB 4KJQC 5B39G 3PGDB 1IGJB 5IOKA 3UC0H 3HI1A 2HWZH 2WGNB 1MRCL 4FZEL 5FOBB 5B38B 5DSCB 2AK1L 1MIMH 4AMXA 3IWUA 2C3WA 1HKLL 2XN9E 3BUQA 3LN4B 4OLZL 2YGQA 5ITFA 1PLGL 4A7TA 4I18B 4WV1C 1FL6B 3RIAF 3BEWB 1E4KC 2VDKL 3EJRA 4OF3A 2B4CH 4KQ4H 2RR3A 3G6JB 1BVNT 3TA3A 3V0AC 3DV4A 1P7KB 3KM2A 3ZL1A 1BJ1J 3GMQA 3EJYD 4AUYA 5GPRA 4ZNEE 3ZZLA 3QXAA 5KN5A 5F7EH 2NZ1A 1JGEB 4MJIA 4Q9BA 4YSRA 1GTFA 1FNAA 3SGJA 4AYBA 1N67A 4I18A 3GMMB 4E41D 4YBQC 4W4OA 3VD3A 5F96L 3MRIA 3QUMA 5INDB 5B3JE 1OAYH 3IEAA 3O2DL 1KCLA 1NFKA 3MRJA 2CA3A 4YR6B 1CLOL 1UACL 4MHHG 3RTQA 2E6QA 4DGVL 3DLQR 2JKXA 4JFVA 2CCWA 4N0CD 2VE6A 4WU7B 1RHHB 3B5GA 3UZEA 1FSKC 4YUEH 3ZMNA 5EF1A 2FLBT 4KUZL 3PV6B 5D55A 4JQVC 4I5BB 4MJ4A 4UYPA 1HXMB 3PNRB 5BVJB 4HC1H 1TO4A 4NKQB 1DQLL 4L8DA 4OF5A 5B22A 3RIAK 1A1MB 1PEZA 1DVSA 4FA6A 5CJ5A 3O41A 5F9JA 1B9ZA 4ODVL 3N44B 4LVEA 3OC5A 4K3JL 2NNAA 2GK0A 4XVJL 4FYRA 4YSEA 5IZ7A 5BV7L 2PYFA 3DPDA 1FFTB 1L6ZA 2OJEB 2JK5B 4CL7A 2X7LB 2DJ4A 4BHUI 1GCYA 2FNWA 3LY6A 3R1GL 1NCAL 1TQCB 1JK8B 1FYTE 4PJIB 5ICZB 3ZZ1A 1H15B 1LP9A 3P77B 1DLFL 1SOKA 2HKAA 4AIOA 1FN4A 1FVDB 2JIXB 3I9GH 4LU5L 1JZGA 4X4XA 1YSOA 2CAKA 5C0CA 4W9HC 5I6XC 2D03L 2HJLB 1IGTA 4PJDF 3AXLB 2FQEA 3L3JB 2W9EH 4NQVB 5LO7A 2E0PA 2XWBB 5HPOA 1FFOA 2IWFA 4WI5A 5C0BE 2X12A 4RSYA 1WD9A 4G43B 2P24B 3IJHB 3DPBB 4F7EA 4FERA 2B1HL 3MV9E 2P28B 3H4HA 3LPWA 1MHEB 4D3CL 4BJLA 3CFKB 2JKLA 3IMRA 5KYYB 1MJ7H 2BX5A 4GNKB 1MI5E 1AGBB 5ISZB 1MCKA 1MKFA 5T5NF 5FYJD 5DJDB 4YMPA 4UAOB 2BDNH 5I16B 4N85A 3K80A 2XV2A 4JQIH 3BP4A 2VR6A 3FAXA 3KR3L 5F7AA 4K94L 4I13B 3BDYH 5CWSA 4ZW6A 3MV7A 3IF1B 4JPKH 2FWOA 2OTPA 1DQIA 4KKRA 1FGVL 1FO0L 3M7OA 4NO3B 3GSRA 3JTTB 3D07A 2VDMH 1AI1L 1X9RA 3DX8A 3O0LA 1OCRB 2KI6A 2R1YA 4KK9C 3BQUC 2RH0A 3EO1A 4X4MA 4Y19A 3MRRB 5FCUH 4I0PD 1JGLH 1AGEB 5D7IB 3ZKXB 1ETZA 3ARGD 3WELA 2DBJA 2D0HA 2QKSA 3G08A 2YAPA 1LTXA 3ZJAA 4BGDA 3ZO0A 4HJ1A 2AV7A 1UXSB 3NABL 3ARDD 2ADIB 4U1SA 3BVTA 1EAPA 1D6VH 5A43C 3VD1A 1MFEL 2XPYA 4DP1X 3FRUA 3WUWB 5K69A 3BOVA 2MCG1 5I8KH 3NJLA 3HAEB 5EU3A 1RUPH 4U6XB 2YHGA 4HK0B 3CZEA 3MROA 3CH1B 1QTSA 3WIFA 1X4ZA 3FSWA 2FQFA 1PY0A 3VUAA 1DEDA 3DKHA 3PAZA 2V5MA 3QJVB 1BM7A 1T21A 4PRDA 2QKIC 4WTZA 3KYNB 4F3FA 2XG4B 3O8XC 4PJXA 4CN4A 3K1DA 5DGQA 1I7ZA 1BZOA 2D3NA 3MLRH 2UWEB 3B2UC 1INEL 4GJTB 5I30L 2HT4C 4ANUA 3NZSA 1U8KB 5D8JL 1MY7A 2H1PL 3NRFA 1IKOP 1HH6A 1QWHA 4LLVA 3OKNA 4J2XA 5FECB 1TMQA 2CO6B 1YMMA 2W8CA 3G5YA 1LWJA 2Y5TA 4NQQA 1PLCA 5KS9E 3QR2A 1U58B 2DPKA 4ONFL 1UWGL 1PX4A 1WIUA 3N43F 2G4GA 4UQ3A 5BO1H 5I66A 3KE0A 5ABZA 4OZGE 1G94A 4Q8BA 3FQ2A 3PY9A 3TVMC 3UJIH 4LMQI 3UP1A 1BV8A 1H8SA 4TPRL 3IS0X 4NQVA 2XNAB 4U1KA 4TLUA 2Y36L 5IMKB 4O2CA 5F7YC 3RVTC 4LO9A 1QNZL 5JDSB 2P24A 3AMKA 5DVLA 1CWVA 1I9IL 5DK2A 1A8JH 3AUWB 5F7KC 4H1LB 3PNWB 4FADA 2CZNA 1OP9A 5EZOL 2Q6WB 3NZ8B 1NKRA 3FN3A 4QKTA 3R4RA 2DS4A 3QBTB 3NG5A 5DVMA 4Z78A 5FHAL 1Y1UA 4FQ2H 4PV1C 1PKQE 4JKPH 5MP6L 3SGEI 4Z8FL 1NBYA 4Z7UB 2YXFA 1IBFA 4FQ1L 32C2A 4M8QB 3VH8B 3C08H 2W0FA 4R96A 4XE5B 1YZZA 2FHBA 3H0TA 4HXAL 2X4SA 4HX1B 5CIPH 4PJDB 3JV6B 2YQBA 1HDMB 4FEMA 3BWUC 3BWSA 1NGPH 1R5WA 1FC2D 4FQCH 5BQ7B 4U6TA 2X87A 5AVXB 3DIDA 2WXNA 1KIQA 4YDIL 5E6IB 2F7OA 3B8YA 2APVA 2FEEL 5FA3B 3LNDA 3CU1A 4A67A 3GBLA 3A21A 3ZMEA 4OJEH 1L3NA 1SM3H 3ULVF 3U9PH 3NJVA 2APXA 3AAZA 2WB7A 4O02H 4BDVA 4Q9QH 4Z7VE 3UTSD 1OT4A 2R4RH 2X28A 4G7VH 2BOBB 5EZJA 5HYFA 2JKNA 4LCWB 5JYMA 4HJJH 2WLIB 2JJVA 2BNRE 1WIOA 3FL7A 3QORC 5A6MA 1WQVT 5HGHB 4XMUA 1SGKA 3FQRA 1KCVH 4TNVF 3TO4B 3U7AA 1HYRC 4OJAA 4JY5L 1CLZH 3KYNA 4K5PA 5AD0B 1B0IA 1TVBB 4ZMTA 3FTGB 4JFPA 5HDQL 4JVWA 4JN2A 3AB0C 1B2YA 4HPOL 5IVNA 1N68A 2HWZL 3R18A 3QQ9D 3COOA 1NPNA 4F24A 1REIA 1WF5A 5J11B 1JZ3A 4Y4KA 3L2LA 4A6YL 1R0AH 4KX7A 4TQ8A 4OGXL 1DVXA 1PZDA 3CG8A 4PLOB 4JHAH 2BCKA 2GJRA 4XMXA 5DU7A 5KYUB 1L9MA 1L5GB 2N3JA 5A2AA 1YC7A 5AW1B 4LSPH 4LHUG 5AW7B 3UJJH 5MHSD 5EEUA 1CD1B 4OIIL 1FG2B 4N2GA 2WNGA 1CYXA 2BP0B 1JJUA 2GI7A 4Q74A 4YHKH 4GRLA 1NFDE 5JPNB 4NQDE 4X6DE 2ESVB 1XR9B 2VDNH 1UOLA 4XMWA 5F88B 3V2AR 2IGFH 4M1GH 4KMQA 2ED9A 1NC4B 2EIZA 4ZTPH 3UCQA 2KBGA 4AK1A 3GBNH 4H25B 4BUHA 4F57L 4Z7OB 1BD2B 4D9LH 1BBJB 5DK2B 2BIMA 2CWRA 4DQOH 2HT2D 2DQJL 2EQDA 2KPNA 1FC1A 2JJTA 2C3VA 3F7LA 3KCPA 4TULL 2Z91A 4NQED 5F7MC 2B1AH 3FTSA 4JY6B 1NEPA 2AV1A 5DR5H 4BD4A 5FYLL 1BW8A 3RYMA 3WEAA 5FGBC 4UT6L 5I82A 7FABL 4JM2D 4QXGH 5DEFB 5C9JB 5DD6B 3H1ZA 4XMKH 4TNWK 1C16A 1P6AB 4ELMF 1XF3A 5SWSA 4YS4A 4MSWB 2FJHA 3K7UA 1LWRA 4X5RA 3KCWA 4N90D 2Q8AH 4FG6D 1G6RH 4JFFA 4J3OD 4EN3C 5C0GB 2A73B 2VH5H 1KFAL 4LCYB 1PJWA 1HWHB 1E3FA 4PJHB 3V95A 3GJEB 1DTUA 3CLEH 2CQVA 3IXAA 3BN9C 5I1LA 1YEKL 3ME0B 4G71B 4F9LA 1RURL 4D0CB 4WVRA 3UEQA 2DLIA 2R0WH 2FEJA 2JXMA 2OL3H 3IFNL 4NN5C 1ZLWK 2H26B 1JPFA 1RUKL 4DFHA 4AOFA 5ALCH 1I8IA 3RWCA 5CIPA 3VTTA 1QFHA 4YHIB 2NNXA 4AVJA 3F04A 5E00B 3ZZQA 2EDFA 2OCCB 2DICA 5DZ9A 2WBXA 4GQRA 1D9KC 2XWEA 3HG1D 5L9DH 5IHZA 2HVBA 1S6NA 2OXHB 4TUUA 1EDYA 3NYKA 4WO4D 5GIRA 1LJMA 2PO6A 3E9UA 4OLUL 3SOTA 1X5LA 2NW2B 5E9NA 5AW6B 5FEBA 3U30B 3L3DB 3X1GA 3HE6D 3UIZA 1OGAE 1MUJB 3PJNA 4W9LC 4QTHA 4WJ5B 2F53A 1U3YA 1F6AA 3BVNA 4M43L 5FV2A 1WDAA 2AXWA 4G83A 4OLXL 3PCYA 3O6ML 3EH3B 3UTTE 4Y1AB 2YD6A 3OR7B 1RZKC 5L2KA 4FQLH 5LWYH 1R75A 4DP4X 4AMKL 4X6EB 2BDNL 1A2YB 2UZPA 3UAAA 4KRMB 3SPVA 4EVNB 1OARL 2BK8A 2QPFA 2YPVA 3BPOB 3DX7B 1ACYL 2YKLH 4GRLB 1E9OA 3UTPD 4HULB 3LX9A 1FGVH 3LRLA 3D2TA 4UIKH 3L08A 4DGUA 3CVDA 2F53B 1KCUH 1X9LA 1QW8A 3G3LA 4RNRB 5ERWA 1ESOA 1Q9WB 2E8YA 1UCTA 2J8UF 2XVGA 3JXAA 3SDXB 3PWLB 5JOFB 5LXGH 2KLSA 2ADJB 3SY0B 1CXHA 1E5ZA 4YE4H 4YHML 1FNGA 1FZMB 4K71B 3BZEB 1P1ZB 1UUSA 1PZCA 3IU3A 1A3RH 3QUXD 3D30A 4D7PA 1CVRA 4GP8B 4OZIB 4Z7WA 3FO2B 4Y2LA 5BXFA 1T4KB 1TKWA 3L5HA 5EBMA 3VFWB 3PQYB 1UM4H 3L3KB 3EO0A 4JFTA 3SD2A 3PREA 1SMDA 5TF1L 1RUQL 2WQSA 5AYUL 2MQ3A 2OMWA 3FFDB 4A7QA 2GJZB 3L9YA 3WN5B 3U2SB 2E4TA 1OEZW 4F37K 2NSMA 5DA4A 2EDEA 4PGEA 1H3PL 1BEXA 4AG4H 2HFGL 4GG6E 4L4VA 4C4KO 3QUYA 3QQXA 2QZQA 4LCWE 2G60H 4ZFGL 4WNQB 3F7YA 4HLEA 5EZOH 3MLRL 3RGVA 2QGDA 5E8DL 3V10A 2NY6D 4UT7L 3SSGA 3WIHL 3AW5A 1KZYA 3T65B 2V37A 2NY7L 3ETBJ 4A55A 3EJPA 2EUWA 2VDRB 3D18A 4PJGB 5HHVL 3S4SG 1KIRB 5DO8A 2VRKA 5CBEA 3CZFB 4N0UB 3QI9C 4DEPC 1E8YA 2WWNA 1X7QB 3ZRFC 3VWJD 4PWJA 5JIKA 4P23C 1AKJD 3L4ZA 4JE4B 5LCVA 5G5DA 4JZJC 1JAEA 1D2PA 1RJLB 1MFDL 3X3GL 3J2PA 2Z0BA 1M3IA 2V8MA 2VOTA 2ZKWA 3FSAA 1FDLL 3PP3K 4CC4A 2W1NA 3DVIA 2R83A 2H3NA 4XCNA 4XC1L 1J5HA 1VACA 4NKOA 5BVPH 1QNZH 1A3ZA 1KJ2A 1NWPA 2XQYA 4NSKA 5D2LF 5E2UH 4O02L 5DS8B 3AQXA 3BZ4A 3FU7B 3QUYC 2GAZA 4IRSA 1FZOB 4J6IA 4MQSB 1T0MA 2WOYA 2FSDA 1A3LH 4ZW5A 3GTVA 1NA8A 2Y2TA 1Q38A 4J3OH 4DGIL 2YD0A 1GIGH 3K6SA 5ITFB 2O6EA 2TRYA 2LW3A 5DJAB 3OAZH 1S7QB 2CBOA 1KGJA 1QFOA 3S34H 4MA1B 1HNFA 1IAMA 2FX7H 4M61A 1T4WA 4LAJH 3VXUE 4F20A 4WWID 1E4HA 3BSZA 3V7MA 4C58B 5AKTA 3FH8A 1BDYA 4O4YH 4X7FC 1F4YL 1KOAA 5H2BA 4NQEE 7CGTA 4K4KA 2G30A 3VG0H 3EXJA 3FU7A 3QFJA 5AKVA 4PGDA 2YGOA 3NRPA 2HYMA 3ULUF 3BLBA 3MZGB 2LU7A 1UGKA 3B5HA 4LFHG 4APQA 1GY2A 3NIGE 4Y1AD 1B88A 1HINH 2JJUA 4L8CA 1QTPA 2QBWA 1GZQB 1U6AL 2VQTA 3EFFB 4ICXA 4N2MA 1UXLA 3MRPB 5IEKA 5KS9A 1UASA 4L3CA 3WJLA 1VDGA 1U2CA 5TK4A 2DYPB 3SGKC 1M6OB 4JDTH 3TWYA 4YHKL 1MVUA 5BRQA 2P3YA 3CDCA 2FRGP 1HQRA 3BPOC 3Q7JA 4CUCA 1UD4A 1EHLL 1NDGA 2G9HA 3EOAB 1TTFA 1KG0B 1IL1B 1AGDA 3AXHA 4JFDB 4NN7C 4U1NB 1SN2A 4CVZA 4XXCC 1UB6A 3TA4D 1J0HA 3MOBL 3G08B 4RFOL 4XWOD 5C0DA 5DHEA 3VGAC 1UJ3A 2Z8VC 3V6ZB 35C8L 4BK5A 2ADFH 4RMVA 4B9YA 1UD8A 4HH9B 4JKMA 2BIIA 1RK1A 3TWCH 5JMOC 2IQAB 2YEQA 3QJOA 4NGHH 1LILA 1OIOA 1QZNA 2VLJE 3HB3C 2BSEA 2DD8H 4TS6A 3AABA 4FRWA 4H8VA 1MFBH 2ZOKB 2BRQA 5JZ7C 1IVTA 4XXCA 2FEDC 7PCYA 3D9AL 5LXVA 5D7LD 5EOQL 4TUOB 5FGSA 3LPPA 2O6CA 3O3UN 3SKOA 1ADQA 2IGFL 1HFUA 2F5AH 2CKBA 3MLYL 5I73B 2JTDA 1NCBH 1D5MB 4YHPB 3RZCB 1QR4A 3O2DH 2OL3L 5EU4B 5FW8A 1PD0A 3H9SB 3S5YA 2DEWX 3B7TA 1A7QL 1ADQL 3TV3L 4P2QD 4X0KB 4M6ML 1D6EB 4DQOL 2Y5TB 2E75C 1HN1A 4X5WB 4LCCA 1WK0A 3S48A 1KC5L 1ZGLP 4IBSA 1T1YB 3EOBB 4DN4H 2DTSA 2X2IA 4FG6C 4J3OC 1I82A 4EN3D 5KVEL 7FABH 3I75A 5D96C 1CCZA 3APNA 1CFTA 2QQLL 1O7DC 4HFUH 4TRPL 2DY2A 3ZPDA 3FF7A 3PL6B 2Q8AL 1W80A 3H56A 2G2RA 3BUYB 4N87A 1EFXD 3BKYL 5EIQA 4GIOA 1IU1A 4MQ7A 1FLRH 3VJ6A 3F7KA 1JWSA 5SWZE 1BMWA 2Q2LA 1E6OH 4IMKC 2EE2A 1OAYL 4R0LA 2KZWA 1N26A 3P3YA 1NMCB 2WQAA 4GKOA 1T04A 2Y4SA 1JWUB 4MDJB 2NY3C 3CHRA 5CMAB 1Y07A 1YYMH 3G5XB 4N9GB 3S36L 4JKLA 1GL4B 1L0YA 1MELA 1F4WL 3JBG7 3F7VA 4ZUTB 5HDBF 5T33L 3T6WA 2BINA 3H0TB 5C07D 1ROWA 3EOYG 5J0BA 4X80H 2QFRA 2ZT9C 5IQNA 4PJ8B 3F62A 2BJMH 3MTXA 4L8SA 4GAGL 2K4WA 2CIIA 5KSUA 5ESVB 1QPKA 4Z3HA 1MNUH 1BFOB 4MWFA 1KTLB 3GSWA 5EUOF 3KLHC 2N4IA 2PCYA 2XFGB 1DVFC 2C4FT 4OGZA 4P23B 3KPOB 1BXUA 1XCTB 3I2CH 2ZXGA 1OT1A 4D94A 4OD2B 2CNZA 4BWTA 4U1JB 1RU9L 1RJYB 4PRPB 2FBJL 5I8OH 1NGYB 1E5AA 3RVTD 2J3SA 4GYBA 1CE6B 3QUML 5EZJB 3RY4A 1YQVL 2D7NA 3MCKA 4XP9H 3DX0A 3VFOB 2K9FB 4KHTH 2BZDA 2IALB 1HSBA 3QPQD 5EV7A 1QRNB 2CXKA 2BY2A 5JPMB 2K8MA 3JWOH 4IDLA 3X1FA 3QFJE 1AZRA 4Q6KA 2KPWA 5I1GL 3WS6A 4GAJH 2WBJA 2R27A 1IRAY 3DO4A 2BHYA 3FT4A 2E5EA 2ZX6A 4OCXL 3TEYA 2K6ZA 4NI3A 4XMZA 4C4UA 4HIQA 3M45A 5ANME 1QQDB 1NINA 4HISA 5D6CB 4RX4A 2J2ZB 4KVNH 5CP3H 2GUYA 3GJFB 1A6VL 2BIPA 1VADA 5HVWA 1JF1B 3BAEH 1TXKA 4G8FB 3B9VA 5HHVH 3WIFB 1N5YL 3RIKA 1QSED 3NZ8A 3U1SL 4PJFE 3VCLA 4Y4FC 1DQDL 4XNYH 1MRDL 1K9TA 1NANH 1C1EL 5B8CC 5EA0H 3VI4B 4EIUA 2R56L 1FJ1A 2DJSA 2YSSB 2PPDA 3BP7A 5KVGE 5KSBA 1IM9A 2HRHA 4NDMA 4M5ZL 2JI2A 2VXSH 1SDDB 1JYWA 5BS0D 12E8H 4JFED 2DB8A 3BHBA 5JR1L 1N6QL 1FNEA 5CXPA 2YAQA 2ZF8A 3SKNA 3TEUA 3T9WA 1ORQA 5E2TH 2WAQA 3D05A 2BVOA 3UAEA 1PQZB 4NQSB 3M6DA 4BQ6A 1L9SA 1YHPA 1T5XB 4D2NA 2XJLA 1MW1A 3DX7A 2BERA 1ZXKA 1JL8A 3IJEA 1FI8C 4EIGB 1KCSH 5DRZA 1E9PA 1JNLH 5E4AA 3HG1E 5K9JL 1UD5A 2JJWA 5TPWL 4NQCA 1FAIL 3GSRB 5F7UA 4Z5RA 2DZEA 2XN1A 1IT9L 5HVFB 1YNLL 1CK0H 1KJ3H 2VW4A 1NDMA 3ILPA 4R4FL 5I9QB 4PGCA 2X4RA 1NUGA 5B3NA 1WHOA 1SMAA 3AS2A 4UQIM 2AQNA 4ZTOL 7PAZA 3V4PL 1IFHH 4MJIB 1OGPA 4WENB 1U41A 1L6PA 2EE0A 3LS5L 3MACL 1QA9B 2WD0A 3QNZB 1BAWA 4PV8A 1UT2A 4WHYH 3SBWA 1U3JA 1I1AA 1EAQA 1EDHA 3C87A 3UBFA 1ORQB 1YMMD 2X2HA 5DMYA 4KKBC 2VLJB 4NO5B 3GXNA 1CXFA 4ODVH 4PJ9D 1UQSB 1DBBL 3AG1B 3SDYL 2DKSA 1OZUA 3PHSA 2TSAA 5KSAA 3ARVA 2EXYD 3ESPA 3RNKB 4L8SC 2ZUXA 5JOPD 1T5WA 3WNMA 2YPLA 3QIWA 4KY1L 3VSQA 4ZZKA 1SUJA 4BSVA 1TNMA 3DIFA 5PAZA 2MNWA 3IRCA 4JDTL 1NGWA 1IMHC 1UM6H 3EFDL 1E0OB 1EO8H 3CPLB 3DDFA 4K9JA 4XXDB 5TQ2H 3B1UA 3AQZA 4RGNE 1YDPB 5JHDE 2W9EL 5KAQF 1IBDA 2BS9A 1BXVA 3PWPB 3X1EA 3NA4A 2NY1D 3ZE2B 1IJNA 3HLKA 2Z4TA 4MCZB 5LNDA 2WLLA 1I1FB 1U8IA 3N6YA 3VFRA 3QG7H 3ZDZB 1PX3A 1TQUA 3QUXA 3D3VA 4AXWA 4DESA 5J57B 3O45B 4FFZH 3V52H 1KACB 2GTWA 5CHNB 2W80C 1AO7E 1NBVL 4NJAL 2Z91B 5HYIA 4GB9A 3JVGA 1X7SA 1WCQA 4WNJA 5JHDA 4RZCA 4D9QE 4AQ8A 2JSFA 1KEML 2HRGA 2JKIS 3PQYD 4CMHB 1IQDA 2ZUQB 1EMTH 4G43A 3U36B 1VERA 4KQ3L 4AC2A 2X0VA 4PJAA 5T3XE 4LLQB 4QHUB 5AOLA 1G9NH 3FCTA 1HH9A 3Q6FB 1TDQA 4FQCL 2YAFA 4ODTL 5IOPA 3HI5H 4HU8A 3UTSA 3W81A 1SF5A 4HC1A 4JW3A 3PP4L 1C08A 2CJSA 1E8ZA 1I7TB 4AMWA 3ZDYB 3T71A 1KYFA 1Q9OB 1EAJA 1U8HA 4JREB 4JO4H 4M62L 2W65B 3BH9B 4IRJA 4P2YA 1QO3B 4I77L 4GLRI 1AZCA 2M83A 4Z7UA 1N0XL 2H47C 1V7NH 4GI6A 3P4OA 1KLFB 1K8DA 1WC7B 3FUDA 5EULV 5CN3A 1MFMA 4RAUA 4M7ZB 1GRWA 1KIPA 4Q2ZA 2VO8A 2VSDA 3G5ZB 5HHXL 4W6WB 4C57C 5FYLD 3RWJA 1TEGA 2P5WE 3K2UL 3FOLB 2NT1A 4XCYA 5GQBA 4EXPX 2H6PA 3MFFB 5LJYH 4WV1A 2C3VB 2EZ0C 3QUZC 4HLZH