4ZMLA

Crystal structure of human p-cadherin (ss-dimer)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmlA01
4AQAA 3QRBA 1L3WA 4ZTEA 4AQEA 1NCJA 3K6IA 2A4EA 4ZMOA 5JYLA 2OMYB 4NQQA 1WUZA 5JYMA 3LNHA 2OMZB 3UBGA 4ZMVA 5KJ4A 4ZMZA 4ZMQA 2YSTA 2QVFB 2A4CA 3Q2VA 1NCHA 4ZMXA 4AQAB 4APXA 3K6DA 1Q1PA 4ZI8A 4AQEB 4AK1A 2O72A 4ZMPA 3LNEA 1NCGA 3K5SA 2WHVA 4ZMWA 3MVSA 1SUHA 1EDHA 4QD2E 4AQ8C 1OP4A 4APXB 4ZMLA 3FF7A 1ZXKA 4NUQA 3K5RA 4AQ8A 1ZVNA 3PPEA 3LNFA 2OMTB 4AXWA 4ZT1A 4ZMTA 2QVIA 5DZVA 4NUMA 2YQGA 1FF5A 4ZMNA 3Q2LA 4OY9A 4XXWA 5CO1A 2WBXA 2WD0A 5CZRA 1O6SB 2OMXB 2WCPA 3FF8A 3K6FA 3LNIA 4AXWB 3Q2NA 1WYJA 3LNGA 4ZMYA 3LNDA 2OMWB 3UBFA 4XXWC 3Q2WA 2OMUB 3UBHA 2OMVB 1NCIA 2V37A 4NUPA 2EE0A 2X2UA
chains in the Genus database with same CATH superfamily
3CLEL 3NYKA 4XNZB 1SY6A 3IMWA 1BXVA 1CTOA 1OAQL 1YEFH 1AXSA 2ITDA 4ETYA 1KXVC 3IPBA 3CDCA 3HMXH 4UWQB 5DHVB 5DJZB 2FWUA 1YEWA 1XEDA 3MZTA 4N0YH 3ZL4L 5SX5H 1BM7A 3STZB 1CK0H 3OHXA 4NM4L 3ZUCA 3QWOB 4H26A 5F9AC 2OW7A 1XZ0B 5TDPA 4DEWA 4KPHL 4HAFA 3QJHB 1LO2H 3S36L 2ICWI 2GBVA 4ALAH 3H7LA 3WNIA 4QYAA 4U3CA 4JPVH 3TCLB 4QHUB 2ZD0A 1A25A 2Z7WA 3HC4L 3L17A 2F1AA 3BGMA 1OAKH 1JF5A 4IRJB 4PJ8A 5T1LD 1J05B 4DGUA 4NWUL 1I1RA 4NKMA 1VGKB 3X13B 1RP9A 4TLKA 1CI3M 3OR6B 5IWLC 5DWUL 3CFIC 4H1LA 5INCA 5TQ0L 2BFGA 1RK0B 3TBYA 3HHMA 5KSAA 4Q74A 3AROA 2X4QA 4TQPA 2GUOB 1OAQH 1PZBA 1PSKL 3PQYB 3W57A 3DUSA 3P2DA 1MHHA 4Y8AA 2WLLA 4F8TA 3MV9B 3ZL4H 1JDCA 4GAFB 4NM4H 5DXWA 1IAIL 5TF1L 3LIUA 1T89A 2K45A 1BV8A 2VQ4A 2XPYA 5KN5B 4KPHH 3I6LD 4X80L 4EDXA 5JW5A 3WNNA 3S36H 3SE3A 4P23C 5JIIA 3ULUF 4M4RB 1XMEB 2XQYK 4HX1A 1V3MA 4FA7B 5D1XE 1F90L 4AK2A 1B4RA 4A2LA 2NNXA 3AB0B 4WRLA 3HC4H 3WS3A 1F3JA 2ODIA 4UDUB 1IEAB 3GMPA 5E56A 3HZMB 3T2OA 1E7VA 3V9FA 2X2HA 4NWUH 1OP5H 3UTQA 1MZZA 1BYNA 1ORQB 1YYCA 3S3SA 3K6FA 5IQ9A 3RURA 2YD7A 5DWUH 5FGCB 1NPJA 4ABVA 1A02N 5TQ0H 2JMRA 3BN9C 4IJ3C 3APDA 4LLWA 4ZMYA 5TFSL 2XTSA 4K5MA 4AC2A 1JBJA 3UGXA 1PSKH 4JM2D 4N0FA 2PW1B 1MREL 4TUOA 4PJFE 2NLJB 2FJSA 3QDMA 1T66D 4Y4HB 4NKDA 4NQSA 3DO4A 4K7PX 2BOCB 4LU5L 4MCYA 1UG9A 5AVXB 1T0MA 5TF1H 5I8EB 1IAIH 2FVNA 4WW2A 4N1CA 5D1ZD 1BVLB 4OZGA 2VERN 4X80H 1U3ZA 2R7EA 3PF2A 1M56B 2J5WA 3RJQB 4R4FL 4ELMF 1JPGB 1D6VL 3EDJA 3F62A 3SEPA 1F90H 1RZ8A 3ISRA 5E6UB 4E2OA 1PNDA 1P7BA 1QPKA 5DD3L 4ANUA 3AW5A 4ZMOA 4BSVB 2QLYA 3L3DB 4QLRA 3HLKA 4YEFA 1B0RA 1RUKL 2VZUA 1QSFE 1EXHA 3GI8L 5EU6A 1BD2D 4G1MB 4MNQA 1HC1A 2IAMA 5E4AA 3FOMB 4NNYA 5DYFA 5DK0A 4H7VA 5EF2A 5TFSH 4PGCA 3PGFL 3GJFH 3V52L 2XX0A 1LEGA 1CDGA 2VDRH 1MREH 2XWTA 2WBJA 1M1XA 1XBRA 4P46D 2YARA 5EO1A 4L8SC 4MDIA 3QDJE 1JGDA 1ETB1 1LJMA 2FO8A 4OVUA 4ADJA 4APQC 1TTUA 1SFDA 1ML0A 5GISL 2B77A 2RB8A 2DLEA 4FAAB 3CXFA 4L37A 4ZSOE 4R4FH 2KKQA 3WMPA 2A9DA 4RZKA 1D6VH 1NGXB 4V1DE 3OAUL 4ELKB 4Y4KC 3FN3A 2NCMA 4YE0A 3QG7L 2V9TA 5C0BB 5JW3L 3CN2A 3F2LA 3IAQA 2FEDD 5HVHB 4PRIE 5DD3H 4HD9A 1WSST 5FYJD 3DRQB 5B1KA 4AM0B 5ACMA 2OI9B 2QQQA 3U6XA 3KYOA 5CFHA 3C5ZA 1YUKB 2PW2B 1RUKH 1U8KA 4AL8C 1J5CA 3GI8H 3UGEA 5E5UB 3EOAA 3TEUA 3Q9PA 1E9PA 1HT6A 1OPGH 3R06B 1LQBC 4LCYA 4DIXA 5CR1A 1IBFA 4XX1E 3PGFH 3V52H 4IHOA 3BH9A 3IMUA 5E8EA 3EHBD 2YXFA 1ED3A 1QBLL 1ZVYA 1UFGA 3PP4L 2OXHB 4Y4FA 2CRMA 3BDBA 5DURB 4ZUWA 1DN0B 5GISH 5ABDE 5I6XB 3NZHL 1G0DA 2EABA 1T4KA 4MXVE 4YSAA 1OGAB 2LLNA 1A66A 3BZEB 1S7UA 1ZDSA 4ODSL 1B2WL 2UVEA 2QVTA 2QGCA 3QG7H 4HEPA 5JW3H 4P9HL 1TTGA 3JUZA 3QQ9C 3VQMA 1R5VB 1CD9B 4M6NH 5IREA 4S10A 1PQZA 4LP4A 1U3HD 3O3DA 3WEXA 2CJUL 2FECI 1DBKL 4XCYB 5KJRL 1IAOA 3RTQB 4NSKB 2XA3A 2ESVA 1TCRB 2EXWC 3FAWA 1UD6A 2GAZB 5AD0B 3MX0A 3HI5L 3UMNA 1QBLH 3RGHA 3PP4H 3RHWF 3E9TA 4X7FC 3HG4A 4GRLC 3SPCA 3PU7A 4P5MB 2ZUXA 3ZGHA 2V3EA 5EZJA 3MBXL 3NCYS 4HCIA 3SCMB 1T2XA 3NZHH 3ECBB 1F6LL 4YFLI 3PDOB 2NY5L 3NIFB 4G80B 1EMTL 4CJ0A 4ODSH 2BMKB 1B2WH 4XODA 5ANMA 2BVQA 3RY4A 3O3AA 1S7XA 1P4LA 2R1YA 3BP4A 1EZSA 4P9HH 5H2BA 4DAGL 1NUNB 2F54A 2QGBA 1P84K 3NTCL 3R18A 5C0DB 1NFAA 3F04A 3D85B 4KO9A 3MUGB 1B6UA 2CLVA 3D7PA 3TA4D 4DSYA 1Y0LB 4TULL 3N9GL 2LV4A 2ICEC 2Z31A 3CZKA 1Z3RA 2CJUH 2NY2B 1DBKH 4PJDF 1S7QA 4QRRA 5KJRH 3RY6C 4QHKJ 4JE0A 5I0YA 3ZE2E 1YVLA 1GZPB 4HC1L 3Q1SL 3WKPA 1TZIA 3HI5H 5D1XD 5HDQL 2J73A 1AO7E 1DEEB 3PWNB 1L9PA 3N41F 4MNHB 2QT6A 4XBGB 3LKPA 1IV8A 3OAYH 1GZQB 1CTMA 3MBXH 1NKGA 1ZOXA 4I9WE 3RFRA 1MZYA 4N26A 2L7EA 3IGAB 4MCZB 2NY5H 1UKSA 2IALA 3BPCB 4UT7L 1XGUB 3EYSL 1EMTH 4GSRA 4QAWA 4WTZA 1E40A 4ZYKB 2YOCA 3B6SB 4E0RB 4LF3B 3CMGA 3N04A 1YMMA 3TJHD 3FUKA 4MMYB 3IKCA 5B1AB 3RNKA 3NTCH 3N6YA 4FQHB 3MRCA 2MQ3A 5JHBA 3ZHDA 3WJMA 1OT4A 2YC1B 4TULH 4FQPA 3N9GH 1ZANL 4OZGE 1TIUA 4JCMA 1YAZA 5IEHA 3OKNB 5D8JL 5HY9B 1QABA 1ZSDB 2YGOA 4PJBE 3GTNA 4HC1H 1OANA 5E1AA 5IB5B 4L3AA 5HDQH 1JL8A 3TIEB 4RMVA 1MUJA 1NFDA 2K3TA 2QKSA 4PRHB 1LEKA 3VQ1C 2UZXB 4K55A 3UMTA 2UZPA 4ZK8A 2C3HA 2QQLL 4G70B 1CG9A 2W5PA 3KPSB 4I0PC 3RZCA 3CDZB 1FP5A 4LCCB 1CT8B 4QOKB 4MNQE 5JXED 1QSFD 5IHZB 1UZGA 4UNUA 5I19L 3EBIA 4L8BB 1B3JA 4NC0B 3UIYA 4UT7H 3EYSH 4K9EL 3P73A 2WVVB 2B9AA 4NENA 3BRGC 4ODWA 1BJ8A 3QQDA 3QEGL 3WUWA 3OZKA 4LLYA 4HZ1A 4WTQA 3ABKB 3TLRA 3UG5A 4LMQI 5ID0A 1BLIA 2DQUL 3QDJD 2YAHA 2BZ7A 3V7AG 1MCHA 1ZANH 3KVDD 4YBQD 5KJ4A 1MHEA 2XWJA 4YSTA 2CBPA 4U3SA 5AVUB 5D8JH 3FQRA 1E3FA 2MKWA 4WWNA 1Z3GL 3U0TA 5D1ZC 2VB5A 5T1KD 4L1SA 4V1DD 5D5ME 2DQHL 3O6FA 1TSRA 1HI6A 4CW1B 4D9LL 1FFOB 2Q9OA 3W38A 1DCEA 3IJEA 4X8JB 2H1LM 4PRID 3DARA 5FECB 2QQLH 4XXCC 3TBBA 2WSKA 2CAKA 3O3BB 2CO6B 4JFQA 1KTJA 3G6DL 2X3BA 1KY6A 1TTRA 5I19H 1PPIA 3HAEB 4F2FA 2X9WA 1J0ZA 1N6UA 4K9EH 2FL5A 3MRJA 3FFDA 2WTRA 2Z8SA 4HFWB 4KXZI 5CLYA 3QEGH 4OH2A 2GJ6A 2OTUB 2DD8L 3MLTB 3WTVA 5EZLB 4WI7A 2BS9A 2DQUH 3EO9L 4X5PA 4JKKA 3QI9B 5G4MA 5TF0A 1KPRB 1FL5B 4UT6L 5IB2B 1LO3L 2WLIA 4V2CB 3FB6B 2Q1EA 2EINB 3ARBD 1KZYA 2QHRL 4RMSA 2YD4A 3CVCA 1Z3GH 1RL1A 2QVIA 1RJLB 3AY4C 4WDIA 2DQHH 1C08B 1SDYA 3GSVA 3TYFA 3ZKSD 4D9LH 2X1PA 2XTLA 4RGNE 3ZDXB 2JNZA 1ESOA 4C56A 5B38A 4NQTA 2DTSA 1QBMH 3RWEB 5EIVA 3G6DH 3J2PA 2FEDC 5KBLA 1CTNA 3LRLA 1BZQK 1G7JB 2GJZB 3EGXB 4C8XA 3TT1L 1JHLL 5D7JC 2DD8H 3GSQB 1G1CA 4OSUL 4ESKA 2YSSB 3B2UD 3DPDA 1UWGL 3V4VA 1OAUL 2YAPA 1KOAA 4PJ8D 4EXPX 2V9UA 3EO9H 4X5WA 4ZRGA 3TS8A 3EHBC 4BFKA 3RE0A 3UDWC 3B7TA 3DNKA 5C0CE 1HILA 4KZ0A 2NY6B 4UT6H 5T5FL 1HHHA 2FD6L 5JORA 1LO3H 4H0IA 2QHRH 4BHUI 3QCVL 3DHMA 2OQJB 1MCWW 5KSAD 5ANME 2GB2A 4WI8A 2BY2A 3QRBA 5DQJA 2PPFA 2FEJA 1KCUL 2FBRA 5EN2A 4NKIL 3DTDA 1QBAA 2COVD 1A6UL 2VXQL 1TVBA 3CHPA 3VRLE 5KS9A 2JQAA 3K6IA 1G7IB 3D5OF 1BG9A 3L9EA 1R6VA 4N0RA 5CU9A 5CBAB 1E3ZA 4L4VE 2HG5B 4QUOA 3L3JA 2C1OB 2XTJB 3FO1A 2FWOA 4QRRE 3TOPA 3QO0A 1KTBA 2XNAA 2BSBA 2F7RA 4B9KC 4RRPA 3L1EA 1U3HC 1U8NB 1JHLH 3DBSA 3TT1H 4LASL 4E41E 4OSUH 2G9KA 1LE9A 3T1FA 1DR9A 4KY1L 1UWGH 1OAUH 1AO7D 2O72A 5FEBA 3L4TA 3MUZ1 3JYBA 1QI5A 3MRKB 3TPUA 2XN0A 3ATBA 2F8IA 2FD6H 3ZMEA 1EHXA 1DQJB 3ILEA 1KN2L 4I9WD 4MMZC 3KL5A 1RURL 3QCVH 1DJYA 2BXYA 4AYBA 2OCFD 4WUUB 2WZ0A 3S4SA 5F71A 2P48B 1U9KA 1KCUH 2BNRB 1YMME 3O4LA 4NKIH 3EH1A 1A6UH 2VXQH 4QT5A 3II1A 2BH0A 4HIHA 4UUJB 1IB5A 4AENA 4FNUA 2VDOL 3KM1A 3DVIA 3DMMC 3BEVA 3IB4A 5LKNA 4EJ1C 4Z23A 3KS0H 4YNYB 4FJZA 2ARJQ 2GBTA 4FYTA 1EEZA 2PCFA 3LN5B 2D0HA 2HKHL 2VLLA 5TJWK 4OKDA 3TU6A 4LASH 4LNRA 1G7PB 1NFDE 1WBYA 4KY1H 5AW9B 1MRFL 2XG4A 3CSPA 4LHJB 2HKFL 1ZEAL 2A9AA 2A73A 3OJDB 1QMUA 3S3PA 4PMFA 5JPNB 1PD1A 1P7QB 1A4JB 1TU2A 1NCWL 4P3WA 3W1ZA 1KN2H 3EDEA 1YUHA 4L3EB 4MNQD 1CD8A 3H3PH 1RURH 1SXBA 3UZEA 4HIQA 3ZE1F 1LDSA 1AGEB 2ZXAA 2BXZA 3G7TA 3WFDL 1CC3A 2IANB 2WBJD 2ATPA 2NXZB 2VDOH 5E8DL 5EEWA 1WH0A 1KTDB 3QH3B 3J8F7 3TJHC 2Y7MA 4OIFA 2WB1A 4QXTB 1ZV2A 1S7RA 2OSLB 4X4MA 4IIQA 4DF9A 3P4LA 4J12A 1L5GA 1EAJA 4KUCD 1QA9A 4UAOB 1BLNA 2HKHH 4RISL 4ICWA 4XN1A 1R3JA 3IFNL 4F8OA 2WO4A 2IEPA 3ESNA 4IRSA 1EHKB 3NDZE 2P24A 1BP3B 1H3XA 1X5AA 3O6ML 1ZLWK 3HLAA 1MRFH 1UOVA 4NN5C 2HKFH 1JPFB 1ZEAH 2CKBA 5JHLL 2N0KA 3HB3D 3FSAA 4RDQG 1N4XH 3ZDWA 4BQ8A 3C5ZD 5DK2B 5BXFB 1YEEL 1NCWH 1X5IA 4ZW7A 2YBRB 1L9OA 3HC2A 3HHSA 4L9DA 3C2AL 4P57A 4U4BA 3W9DA 3X3FL 3S5LB 1LP9B 3MRLB 3ZKXC 5ISZB 1UOWA 2ZYSA 3MFGB 4FLHA 1D5MB 2VR3A 5F7EL 2GC7C 4OU3A 4X98A 1AIFB 1IKNC 5A2CA 3WFDH 4MJHA 3MJ7B 4H0HB 3QJQB 1M3IA 3EO1B 1Z5LB 2DWEB 2XY1A 5E8DH 5HYJB 4Y4FD 4BA0A 1BA9A 5EIIG 2D3LA 3UTSE 3PXJA 3TF7C 1HQ4A 1ZHLA 4K73A 4N0UB 4IKNA 4HK3J 4L3CB 2HVKB 3BZFB 4LRIC 2YRZA 3POHA 3L48A 5F1IA 1T0PB 1MSPA 1XF2A 4RISH 2W0FA 4DP7X 4KZCA 1KB5A 3FTVA 3IFNH 3UACA 3TBCA 1I85C 1VADB 4X6CB 4ONHB 4ENZA 3O6MH 5BV7C 4C56E 3H3BC 1MJ7H 3QGVA 4RGND 5JHLH 2FIKA 2GT9B 1HESA 1XL6A 5IFAL 2AQNA 2J6WA 2XWBA 4QTFA 5BQ7B 1YEEH 3HC0A 2FYVA 3C2AH 3IMBA 2CH8A 1RCYA 3X3FH 5I75C 1PGRB 4P2YA 1KCBA 3GSXA 5DRWA 3IDMB 4W9EC 5F7EH 2KLTA 4NO5B 4NQEA 2L8AA 2GPZA 3QWQB 2ESVD 4KXAA 4U0RB 3WMQA 4ZAKD 2GVYA 1J5DA 4CJ1A 1F11A 2YPVA 3BPLB 1V3JA 2YAFA 1O6SB 1X6LA 3K4AA 5C0CD 4HCRL 5KVMC 4OFYA 4IBWA 4PB9H 2VIRB 1UJ3C 3IRCA 4EUPB 3NZUA 3D06A 2RIKA 1VEMA 2OMWB 2FQFA 4CMMA 4P2AA 3ARBC 1BF2A 4P2QA 2MPVA 4DJMA 1RZQA 3L1OH 5L8LB 3SPVB 5IVXB 5IFAH 4YXKL 3KWWA 3FQUB 3GSRB 5LBSL 1XXDC 4HIIA 2XI9A 3U36A 2WIIA 1E5AA 2ADGA 5DJDB 2Z31D 1ANUA 1F42A 2B0SL 1IIIA 4BH8B 1PL3A 4QRRD 4M5SA 3B9DA 2XSKA 2H9GB 4F8PA 2HTLD 5DQ9B 2APFA 1I7UA 3KWUA 4BZ2L 5CN3A 1BFOA 4E41D 2X41A 5CKAA 2C3WA 1L4IA 1KWKA 1DQTA 4G8AC 1OOWA 3VM5A 1FNGB 3I3EA 4KH2A 4MA1C 3B2UC 4ZNCD 3WY3A 4HCRH 2X70B 3QULB 2NW3A 4JO1L 3UOAB 3WTWA 3ECVA 4QCIA 4U6XA 3G5ZA 3HN3A 4NOFA 1KUMA 5CWSA 1N5AB 1ZT1A 4BUHA 4Z7VB 4XNUL 1HOCA 2DQMA 4O2EB 4Z3HA 4LPTA 3NSFA 1VESA 4HLZG 3VFRB 5F88A 3KD4A 4X7EC 4XP1L 2PCPB 5ICYA 1YMMD 3HI6L 4U49A 4L29A 4YXKH 3DO3A 2QEJA 5LBSH 4ANKA 3JV6A 1GSKA 7FABL 3MRMB 4K8RL 5EULV 4LSDA 4QRPA 4HUCA 2W0LA 3V7MA 1UATA 1JZ2A 3KEHA 2B0SH 2Q7AA 4JG5A 1HEZA 3DECA 2AQTA 1NAML 4Q9QL 2C1PA 4BZ2H 1DVSA 1OWWA 4G1EA 3SE3C 2UY6A 3VA6A 2PETA 2H45A 5F97E 2WXFA 5LNEA 3MODL 1ASQA 1WBXB 3MRNB 4HWNA 3ARGA 4FYRA 1QFWI 3E9UA 5K9OB 5LNGA 4DT2A 3RZCD 1JZ6A 4ZZFA 1EUTA 4JO1H 1ACYL 1TJIL 4M93B 1S9VB 4MMXB 3C8KA 1V8HA 3QNYA 3NIFF 1FUNA 2B5IC 1Z0NA 4XNUH 1Q9WB 2ID5A 4Z76B 3RUGA 1RZGB 3PWPE 2XIBA 3NG5A 4XP1H 2X38A 4G9FB 2PWHA 3NIDB 4GKOA 1G9ML 4NNXA 1SJMA 3HI6H 3LZOA 4A6YB 3RRQA 3LMJL 4XTRD 4FQLL 5IGXL 4U1KB 7FABH 4K8RH 5MEPA 5DZOA 1A6AB 4AIEA 1UB5A 1NAMH 3DXAE 4Q9QH 4FCAA 3IBEA 3QEQA 1NMAL 5F7HA 1R47A 4J2QA 4FFVD 3OLGA 4FQ2L 3O6FD 4UQ3B 3I3DA 3QUXA 3WL9A 2MHAA 1BYOA 5F9JB 5LGJB 1I8LC 4QLWA 2K6ZA 2WBWB 2X6MA 3MODH 2VR7A 3FK3A 3GBLA 3F12A 1D7DA 4ANWA 4X6FB 1TF4A 4L5FL 1T22B 4YPGA 4MJ5B 4P23B 1ACYH 1TJIH 2TAAA 3DA0A 3T8XA 3F7LA 1T5XA 2MOGA 2VJXA 4O4YL 4RIRA 4MAUL 2XXFA 2XWZA 1WGOA 4M6OL 4PYGA 4FNSA 3ZR6A 4ZMAT 2ZXEB 3TBWB 2HRGA 2ADIA 4B3VA 1G9MH 3NFPA 2HT2D 4P49A 3LMJH 4B6ZA 4FQLH 1ADQL 5IGXH 4JMNA 1D5XA 4M7LL 4PLKD 3UTSD 4IJ3B 3KBFA 2WBJC 1CGWA 3EAKA 3V6ZB 4RMBA 3BUBA 5BZDB 3MO1B 4NRZA 2GHWB 3VI3E 4TRPL 2PTTA 4MQTB 4G7QB 5BOJA 1NMAH 4B5EA 4EUPH 5J1SC 4FQ2H 5KSUA 1YEGL 3F7PC 3B5TA 4ZQKA 4C56D 1FVEB 1EZVY 4J4PC 4E9QA 4L5FH 2EILB 3ET9F 4IOIA 2X4SB 1A1OB 4TQHA 1RZJL 1PD0A 3HB3C 1MCBA 3HN8A 5CJXA 1PFCA 4PWHA 5ESAB 3C5ZC 4O4YH 1XXFC 1YRKA 1OP4A 3N1MC 4MAUH 4MXQD 4TNWF 4M6OH 2C9SA 1KXTA 4UZGA 2YQBA 1MHCA 1DVTA 3TC9A 1JWMB 1ADQH 4CAGA 3ZPDA 4M7LH 4PWEA 3D12B 2WAQA 4PFEA 1KXHA 2KBGA 3B7RL 4Y4FC 1JZ5A 5A6IA 2XBDA 4TRPH 2Y3NA 4QF1B 3FCUB 3RWIB 2EDWA 3BISA 1U8OA 1WLHA 2LU7A 4X7DC 4CU7A 1VJSA 4MD4A 3UROR 2ZKMX 3NSDA 4K7PL 1YEGH 4P2QE 1JMZA 1QTYT 4APQB 3OTTA 5DD1L 4MD0B 4M8QA 1BXAA 3DVFA 1TPXC 1G7HA 3GBNL 2VE6B 5FV2A 1RPKA 4RGNC 5FS5A 3QG6A 3ZMRA 4JLRA 3ZTJH 1RZJH 1QUNB 1E8YA 5TH2A 2Y2YA 3K6SA 1A6TA 4Y4KB 5EO0B 1YEHL 4P4KA 5IQ7L 2N7SA 2NY4D 3FFCB 3T1WA 3OKKA 2R29A 1TITA 1ZS8B 3D2TA 1MJUL 4QXGL 5GGRB 2A83B 2LGNA 4GLRH 4DVBB 4GAYA 4U2ZA 5DC2A 4TQEL 1YY9C 4JEGB 1ZLUH 3RFZA 1XD0A 5IMKA 4AMXA 4F7CA 3L4YA 3DIFB 4TS6A 4OD1L 1XF5B 2RH0A 4DERA 3RWHB 4ZAKC 1N8ZB 2NYYD 2QQKL 1KJ2A 2G9HA 3I6GA 5E95B 4ODHL 4CSZA 3LKRB 4ZX4A 1G7LA 3TO4A 3VFWA 4I48A 1S8DA 1ROWA 4K7PH 4FFZL 5F9WB 3O4LD 3VGDA 3MROB 5DD1H 2XPZA 3ZDXF 4GG8B 3U46B 1PCSA 1RI8A 3GBNH 3HZ3A 4M3JA 5EF1A 1I7ZA 4P5TA 5FYLE 4QRPE 1URZA 2JK5A 4XCCL 2ZZUT 1YEHH 3FBKA 5IQ7H 3IMRA 4MYWB 4JGNA 3VFNA 1XWVA 2YSTA 1AZBA 3MRRB 2Z31C 3S5YA 2FHCA 1MJUH 2ZOKA 4QXGH 3O3EB 2OXGB 1ZTXE 2VR8A 4HW6A 4KKRA 4TQEH 1R4XA 2A1WL 2YMXL 1TJHL 2G5UA 4UYPA 1AQDB 1RJCA 2FQDA 1DLHA 5G4NA 3ZDZE 4I0CC 4OD1H 1J5IA 3L3HA 3S7GA 3WNJA 4C4UA 2M1KA 1NEZG 3KLDA 4R9HA 2QQKH 1ODAA 3BEWA 4AQOA 4ODHH 3RUGE 2AQPA 3FUIA 2J72A 1E8ZA 4EUPG 4X99A 4FFZH 3PWPD 4GRLB 5KSBB 3LKOB 1ZHNB 5DFWH 3WY4A 4RFNC 4NJ9L 1C5BL 2X7LB 5IBTL 5IIEA 3EG9A 3RX8A 2OMVA 3GNML 2GI7A 2G5BB 3RWCB 4XCCH 4WFHE 1OF2A 2R23B 4HF5L 1ZA3B 3QEQE 4JHUA 1Q94A 3DXAD 1GY2A 3WKNA 4IRSD 1EFXA 1QPPA 1RP8A 4GIPD 4LBAA 4NNPL 1AOHA 1MVUA 4W9LC 3BKJL 5C0IB 5EOQL 1AGFB 3PY9A 3D05A 4BSJA 1NOFA 2A1WH 2YMXH 4NQXA 1TJHH 4PV8B 2ICEB 2J8OA 4HIXL 1ZA6B 1RZKC 4NIYE 4K2UL 2RHEA 3N1FC 4PW9A 1R5WB 3KZ8A 2VR9A 1L9SA 3PIQA 4B9CA 5FCUL 3RZCC 4J1UB 2D0FA 1EHAA 3KAAA 5DUBB 2IXQB 4WY7L 3TCTA 1E4KC 2XV2A 3Q8AA 3BP7B 4P5KB 5HI5D 1FIGL 1AS6A 1J0IA 3LXAA 1C5BH 5IBTH 5T1LB 1JTPA 4AL8L 5I1IL 3GNMH 1A65A 2GYSA 1M7XA 4FP8L 2UYLA 1E5ZA 1YN7A 3BH8B 3F05A 5DF0A 4XTRC 3ZHNA 4D8PA 3KPLB 4DEUA 2BSSA 3BKCL 4WSJA 3ZTJG 5LDSA 3MZGB 4HF5H 3OKYA 5BZWB 5F7DB 3S5ZA 4NNPH 3LD8C 3BKJH 3CH1B 5EOQH 2O1AA 3T3MF 1AGDA 2YBGA 3L54A 1AC6A 3OHMB 1ACXA 4HIXH 2F53B 4DN3L 4K2UH 4PBXA 1L3NA 5SWSB 3MACL 4C4KO 43CAA 1HH9B 4Z7QE 3K2MC 3EDKA 1NOLA 3DRTA 4AE0A 3DROA 3QAZC 4L9LA 4NC1E 5F9DC 5FCUH 4CMHC 1FO0A 4GG6A 5CIPH 4HS3B 1A9VA 1XGTA 5TE6L 4NQED 3H0TA 4WY7H 4WIQA 4U1LB 5K33A 3FRPG 4B7IA 5GGUB 1FIGH 1UH2A 3FFOA 1KB9K 2X6VA 5JW4M 4AH2A 4AL8H 5I1IH 5EC2A 2VN6A 2VXSL 4PJCA 3TV8A 2CDEA 1M71B 3ELAT 4FP8H 3T9WA 1KEML 4HUNB 3BKCH 2EDKA 3W11C 4LPCA 2A6DA 1NCTA 4WK0B 1TKWA 4U1JB 3RB5A 5I5IA 4F7TB 4PLKC 5T5NG 5EV7A 4AGQA 2J25A 4ABWA 2J2ZB 3WLBA 2HT3D 1QG3A 1JZDC 1N9PA 2PF6A 2PPAA 2XFXA 2XV0A 3FDWA 3O6LL 4P2QD 4JM2B 4OCMC 3BFQG 2CIIB 5IHBA 3WI9A 2WQ8A 4DN3H 4ZPTA 1RY7B 3GUTB 3WTYA 3MACH 4KKNA 5JZ7D 3T8VA 1DVUA 3SO3C 5D1ZB 4M62L 4RGMB 1LP9F 2O6EA 5EO9A 1YZZA 3BMVA 3MUJA 5DJ6B 5TE6H 1GY1A 2P5WA 4JRFA 4N5ED 1SHSA 2E9IA 1CDUA 4MXQC 4R0LA 1H3UA 2Q3AA 4RAUB 4LVOC 1G94A 1KENL 2VXSH 3SDYL 3UZVA 5DSCB 2LLGA 1OALA 2XDHA 1PZUB 1KEMH 3S3DB 2JJSC 1BD2B 4DKEL 3C9NA 3GTTA 2IOOA 2WXLA 2DEXX 2EQDA 2YEZB 3K8KA 1MAML 4GUPB 1M05B 3G04B 4K23L 1T21A 1A3LL 5LG1A 1MY5A 2BIHA 3O6LH 3GS7A 1N3NA 1OGSA 4X6CF 4EQ3A 1S9XA 1U2CA 1U8HB 3B7UX 4D0DB 4P46B 2X4RA 3N44B 3F00A 1CO1A 1R34A 3DPBB 1PLGL 5K59E 1QACA 3FQNA 1HOEA 5FYLD 1TYEB 4QRPD 2X4NB 1U92B 3IDJA 3MJ6A 3R8BB 3UBHA 4M62H 4WFFE 5JUEL 2FJHB 3MGTA 3H1ZA 5CSZB 5IEKA 4ZFQA 1JG9A 2JCCA 1GGTA 3JV5A 2DZEA 3A4AA 3CC5A 2NY4C 2Z92A 2JXMB 3D4ZA 1KFGA 2ZX6A 3L3GA 4DO6A 1B9KA 1KENH 3OKDA 3KM2A 3SDYH 2DKSA 3ARGD 4S11A 4P04A 1WS7A 1K8DB 2YD9A 3L9RA 3BDYL 3QJFB 5DMGD 1IGJB 4AVIA 4DKEH 5AL8A 4TPRL 4UQ2A 4E36A 4HJGA 1MAMH 3G08B 4S0SD 1MFMA 4A7GF 4BE6A 2AV1B 3ROLB 3GIVA 2NYYC 4K23H 1ZGLP 1F56A 1A3LH 2Z93A 4HH8A 4LHUG 4KO7A 4N2BA 5DS8A 3EHBB 4BDVA 2EVIA 4JFOA 2F58L 3QCTL 1NGWB 2J5LB 4FNPA 4PN6A 4UT9L 3GXDA 1PLGH 2Z7YA 4A7QA 5AKSA 4HV8B 1RQ5A 1C8QA 2WANA 3FU3A 2R2EB 4GXUM 4WFHD 5INDB 5JUEH 3C60A 2Q76B 4CA4A 1C5DA 3QEQD 4ZUTB 4APXB 1T1WB 4QHKI 5AYTA 1J88A 3QUXD 4QO1A 1T83C 2V0AA 1DDHB 2XBZA 3S2AA 2J3SA 5A2KH 5A2AA 4BFIA 4XC3L 3WKML 5DJAA 3QQ3B 2XY2A 5T3XE 2KDGA 1BQHB 4PJGA 5DTFA 3BDYH 1C1EL 1U3HB 5FKPA 5L0QC 1YEIL 4WGVB 1UM6L 5C09A 2D4FA 4Z7VF 4N2AA 5EOCJ 2AEWA 1HAWA 2WV3A 2AJZB 5B3JE 3KWTA 2WK2A 2F58H 2JQMA 3PE9A 5K69A 5TE7L 1QYGH 3QCTH 2WYHA 5DJ2B 3MAWA 2HMID 4MMZB 3V6FA 5ESVB 4GKSA 3SYQA 4G59C 2G4EA 4BGDA 1F1AA 4HS8L 4MGXA 3EXLA 5J1AB 4U1NB 2A9ML 1B88A 6FABL 5J6GB 2GI0A 1JS4A 3R8QA 2EP6A 2NDGA 3EOTL 5LJYH 1NEUA 1BEXA 4O02A 5DZ9A 3T77A 2FBOJ 4IIQC 3T8MA 1YNTF 4G8GB 3QXDA 2GTZB 1JUFA 2E9GA 5E9DB 1SRDA 4XC3H 3I02A 3WKMH 1G43A 4AYSA 3WAJA 3IGLA 2NY1D 4I5BA 2GFBB 4QHLA 2WZ5A 1C1EH 5L2KA 3KJ6L 3FT1A 4LCUA 4TUJB 4NUJB 4DETA 2BPBA 5ICXA 4KROC 3VD1A 3HRZB 4NBYB 1YEIH 1UM6H 2Z91B 5JA8B 1XR9A 4WU5A 2IGTA 1O7VA 3PWLB 5D1XB 4NYLB 4TXVB 4YEEA 4MQXC 5TE7H 4FLOA 3HZYB 3ILDA 5B1JA 4YXLL 3P77B 4PJCE 1P4IL 1OT2A 1DCLA 5HI5C 3IJHA 5GZOA 1UH3A 3PHOA 3AM8A 1Q9KB 4JPKL 5FYJL 4HS8H 5GGQL 3VH8G 3E0GA 5ES4B 1H6UA 2A9MH 3LZNA 2EIZB 4ELMA 6FABH 2CMRL 5CBEA 1HHJA 5T5NF 2QHLA 1MCDA 5FKAA 1HHIA 3ZY7A 3JQOB 3EOTH 4GO9A 4Q6IC 1CLZL 1JZFA 1MCKA 1NGZA 5E08L 3IDGA 4C54A 1I7TA 1U8CA 1XH2A 1BOYA 4PJFB 1W72B 5LAXB 1PLCA 3ARQA 3M88A 3D33A 3KJ6H 2Y69B 4MQ7A 3ZQ9A 3KPTA 5DGRA 2HPTA 1U93B 4P4KD 2ZNWA 1T1YB 1W9XA 2P5WE 4JZOA 3OPUA 2W65A 2CGZA 4NN5B 3U2IA 1EDQA 4PJXA 2VR5A 3HBZA 1HKFA 2HVJB 2OTPA 1IO4C 3H53A 4YXLH 1IGML 1P4IH 4A68A 2PP7A 4JQIL 1SXAA 4U1HA 5D7IE 3ZKXB 1NM9A 1SDDB 4KX7A 3UYPB 2DQFA 5GGQH 2VXTL 2RA1A 3IJYA 4JPKH 1RUAL 3VB8A 4UV7L 1QSFB 4LLMA 2ADJA 2CMRH 2F6AA 4G5ZL 3ZKND 3K72B 1XBDA 5FO7A 4G83A 2VM9A 5ABAA 3TO4D 1RIUL 3AG3B 2DQJL 1JK8A 5C0GB 4N2NA 2V33A 1PZCA 5AW2B 1ONQA 3ZOAA 3BGAA 1IFGA 2VMFA 3GM0A 3QJUB 5E08H 1G0YR 2YEVB 1VGEL 3HFFA 1OP9A 2QL1A 1J8HA 2YUVA 4P5TD 3RDTC 2WSDA 1E4WL 4BRVA 5BOPA 3QDJB 2WCGA 2R2CA 4G6KL 3ZSTA 5HJ3A 3TO2A 4YMPA 4AJWA 3QXAB 2DYRB 1U8JA 1U8IB 4WFFD 4FC3E 2X9ZA 5BV7B 4ZSOB 5T1KB 4R2GD 4V1DB 1KIQA 5BMFL 3Q2WA 3BKYL 3THML 1J1PL 4LLVA 3ZMNA 1N10A 4ZOEA 4O5LL 1IGMH 4N5EC 1MN4A 4JQIH 4PRIB 4C59B 3QUZD 3EOBA 1XB6A 2VXTH 5TGBA 4TQIA 1RUAH 4JAMA 1JV5A 4UV7H 1NINA 1F6FB 4G5ZH 4I77L 1T1ZA 3GZPA 1Q9OB 1RUPL 1RIUH 2WQUA 4TM9A 2DQJH 4MX7A 5ID1A 4HHAB 2CRYA 3U9UB 2V2TB 2A74C 1VGEH 2HX9A 3HI1A 2UV3A 5E2UL 2PWEA 3QC5X 4QHNA 4RAVB 3AFLA 1E4WH 4RA3A 4G6KH 4F7EA 5IW1A 1AS8A 4F9LC 4TVSa 3UPAA 2WWMC 3B3IA 5DFVC 1ECYA 2MWCA 3V0FA 1Y1DA 3ARBB 1F4YL 4RMUA 5AOKA 4GKNA 5DT1L 3O2DA 3X12A 3AU1B 4XO3A 1KLGA 1EFXD 5T1MA 3CVIL 1ETA1 5BMFH 1UUNA 3BKYH 3THMH 1J1PH 2ITDB 5MHSE 4LEEA 1AXSB 1WO2A 5FFGA 4O5LH 2OMXA 1EFQA 1FAKT 2ZX5A 1BF8A 3KPRA 3A23A 4HWEL 4PJGE 4WNSA 4Y19A 1YPZF 5T3XD 4YSSA 1DQKA 1CFTA 2P52A 4I77H 4H26B 3VACA 1G87A 5C09E 1S7SA 1RUPH 3V0EA 5IV2A 3VFGL 5DZLA 3SGDI 4A7TA 4WUKL 1JHKH 5E2UH 5HYEA 1X4XA 1P6WA 4MA1B 3OXRA 2VISA 3BGMB 1VFAA 4PJ8B 3C5XA 3KE0A 3VFOA 3FJTA 4NKMB 1Z9PA 2Y1VA 1WT5A 1CE1H 1AAJA 1SHWA 3MBWB 1BPVA 3EDDA 1F4YH 4XOAA 3QZNA 4H1LB 5INCB 3EYFA 2I32A 3T71A 5KSAB 1NLDL 3CVIH 4Y5VC 2WWKT 1A4KA 2KQNA 4OUUB 3Q2LA 2TSBA 3DUSB 1RK1A 3WXWL 3OMAB 5IB4A 1CXEA 4HWEH 2XX1A 3QCUL 2BIQA 3QUXC 4BK8A 2X2YA 4IMKC 4DCQB 4XMZA 2IWGA 3OX8B 5I16A 5EN3A 4EDXB 5JW5B 2AZAA 4MB4A 1X9UA 3VFGH 2FBJL 4UNVA 4L1HA 2VAJA 4HX1B 5D70L 1KCKA 3KH4A 3WEBA 3QUKA 5BV7L 4R7LA 3ABMB 4WUKH 1A7PL 1YN6A 3ETBJ 4WGWB 5KSBF 1CL7I 2BHFA 1J11A 3GMPB 1AO7B 1WD9A 1DJSA 2AEOA 2DMBA 3MN8A 1U2HA 2B5IB 2EVGA 3ME0A 1QRNA 3W5NA 5AVQB 1SLXA 1A8JH 2H6UA 2ZG1A 3IFOA 5DEFA 5IQ9B 3OD3A 1ZLSL 1HWGB 2FECL 3VNZA 2HMIC 5G5DA 4QKTA 2J1ZA 4LLWB 1NLDH 4GMTL 2FO4A 4HETA 3D0LA 4JUTA 1G9EA 4YOKA 3V0JA 2Q2LA 3NCBB 2NOYA 4N0FB 3OXSA 4TUOB 4F57L 1NGPL 4HUVA 2XIIA 4FHJA 3WXWH 2DDQH 3C6EA 1I53A 2QZQA 3O8XA 3QCUH 4NKDB 4NQSB 1NC2D 2RCSL 4MCYB 4HK0B 1T0MB 3CXHK 4XCNB 2DI9A 4OZGB 4B27A 2NY1C 4PU2A 2R7EB 3QUMA 1K4CA 4GW4A 2P5WD 3HMXA 4PJXE 2F08A 5D70H 5BV7H 5HGDA 4PJBB 1RZ8B 4NC1C 4NI6A 1A7PH 3G9AB 2CRIA 2QADD 1JV2A 4N6QA 4U6YB 1QX1A 3QBTB 1SY6L 3TWCL 2J57A 4QRTB 2BHUA 2DYSB 4RETB 1H6EA 1I1YA 3RVTC 3H9HA 4JK0D 4MNQB 1ZLSH 2X4PA 4NNYB 4AQZA 1U3YA 3IE4A 4NZ8A 4GMTH 5DK0B 5AWNL 4NXSA 2AQSA 4AIXA 4PGCB 2DTML 2ZXBA 1LEGB 3MNVA 4YDJA 5DD5L 4F57H 1NGPH 1Q72L 2XWTB 2WBJB 3BWUF 3ILQD 1M1XB 4UQDA 5I18L 2EYSA 4UB0L 5EO1B 3UJJL 2ZAHA 3BMWA 4MDIB 1JGDB 1JPEA 5BVJA 1KBKA 2RCSH 4LE8A 4DNLA 3FZUD 4G8EA 3FCGA 1GH7A 3VD0A 2EEAA 2A0LD 4L37B 4PCYA 4NAQA 3F58L 2VLJE 3CG8A 3V6OA 4O58L 2CBTA 5I6MA 1WD8A 2QTVA 1O6TA 3D0VA 4JG1L 4P4KC 1K5WA 2G3XA 4WI9A 1OD9A 1SY6H 3TWCH 3UAJC 4R83A 5I5RA 1BZEA 3KYOB 4CRPA 3VMNA 3C5ZB 3POCA 4WHTA 5LQBL 4FMVA 1XZWA 1QPXA 4GSDL 3B7YA 1VKXA 2D9CA 1E9PB 4CVUA 4PSPA 1S9YA 5AWNH 4LCYB 3ZKNC 4IHOB 2DTMH 3BH9B 1A1MA 5E8EB 5DD5H 4DKAA 5DHEA 1Q72H 4JM2F 1ED3B 3TO4C 5I18H 4QY8B 3X1BA 4UB0H 3B37A 3EGDA 3NOIA 4Y4FB 1PKOA 2Y0SA 4Q56A 3UJJH 3LHPL 3UH8A 3BUYB 4CBPA 1PIGA 4ZUWB 1IGTA 4PEEA 5DVNA 4KRMB 3WIAA 2VO5A 5J6SA 3HCVA 1IJ9A 1AE6L 1HQRA 3LRGA 2ZX8A 1T4KB 4P5TC 1GJIA 3C60D 2C4FT 3F58H 3WFCL 5D2LE 3CSFA 3DYOA 1S7UB 4H1LH 4O58H 5FGSA 1TQUA 1TPXB 1A7BA 1KJ3L 2E6PA 4JG1H 4LCWE 4JZNA 4JDTL 5MHSD 4RGNB 4CVZA 1MCEA 5JMOC 1SOKA 2H3NA 3KPRE 2C9UA 5LQBH 1UZ6E 2YD0A 1PQZB 4GSDH 3M45A 2WXIA 2H7WA 4HG4J 3NJKA 3WEXB 1E9OB 3QUZC 4A2HA 4EF3A 5I1LA 3KPNA 4LLAA 5C09D 1IAOB 1RHHA 3BP5B 1HWHB 2CO7A 2ESVB 4GP4B 4JRWA 1E5CA 1T3FA 3MX0B 3SODB 3CBRA 5H35A 1GIGL 3N44F 4PRBA 3LVTA 3LHPH 2EO1A 1VENA 4QKXB 1F18A 5E1HB 3HG3A 4K07A 4EI5C 5EZJB 1L9NA 3II2A 1AE6H 1D2PA 2ZX9A 3PREA 3WFCH 1KIPB 3WTUA 1MELA 4WAFA 4PJHE 5ANMB 1KJ3H 2BVQB 2PYEA 2V7HA 3DYPA 3O3AB 2ZG3A 1S7XB 1P4LB 2R1YB 4PGZA 1KGUA 2Z7UA 4JDTH 4QRFA 5H2BB 3CFJA 3R7RA 2J1XA 1T7VA 2VC2H 4XP9L 3GRWA 2VSDA 3PG2A 3QUYC 3EJPA 2QDWA 1HL4A 5F89A 3MRFA 1IC1A 4FQ1L 2Z31B 2IIJA 3C6LA 3BN3B 3S37X 1S7QB 4QRRB 3IDXL 4WO4A 3UBXI 3VW3L 1UUSA 1TZIB 1OLLA 3CN3A 4W68A 4E41B 2WKLA 3AREA 3IE9A 3QZBA 2F7IA 1GIGH 2IBGA 3WY1A 5I1CL 2WWNA 1YECL 5TK2A 2WVSA 1DQVA 2ZTBA 3QPXL 5HHME 4G8IA 1O6VA 2YD5A 3MLRL 4WENB 5GZOD 4N2CA 1QRNE 1XGRB 3ECUA 4IBSA 3TNNA 1PG7W 3M46A 3MREA 2IALB 3SDAA 2A99A 1IAMA 4KXZH 4RFNB 3HW7A 5FFLA 4G8FB 4N5UA 2XWRA 4JFDA 5E0FA 5DDHA 3J07A 5K39A 3GO1L 4LPXA 1YMMB 3WGVB 1XV8A 4XP9H 3RNKB 3MRCB 4YHYC 3Q3GA 2NT0A 3WJMB 1OCZB 1A6WL 1HCVA 4FQ1H 1RK0A 1OB0A 4JANA 3TNMA 1EGJL 5IEHB 5C0RL 4XPFL 1ZJAA 4ZFOA 3BZDA 3L4CA 3VW3H 2G75A 5E1AB 6PAZA 3MV9A 3W9EA 1MUJB 1NFDB 1LEKB 3CXDL 3VDCA 5I1CH 1YECH 4BFGA 1CD0A 3QPXH 2Z7ZA 1CG9B 3RZCB 3MLRH 4ZO8A 1G4RA 4BK5A 1QSZA 2NYZA 2IAAC 3W37A 3P73B 1HTYA 4NENB 4U7SA 3IMTA 5C07A 2YKLL 4ODWB 3O4OC 5T1DL 2DN7A 4W4OA 1Z0MA 3QQDB 3GO1H 4LLYB 3VFPB 1U36A 4KKZA 3N55A 2BX5A 1J8HD 5KEZA 4LGSB 5ID0B 2Y72A 3SPGA 3D69A 1A6WH 3RWFA 1RZ7L 3PV6A 3LZRA 3VXMA 3LD8B 3QFDA 1EGJH 1MHEB 4PPTA 4XPFH 5C0RH 4U3SB 3FQRB 1NMCC 1D5ZA 4YSRA 2PW1A 3U0TB 1CE6A 4Z8FL 1FL6A 3NPSB 3CFUA 1EDYA 4M7LT 3O6FB 3PGCA 1NIAA 1HI6B 5DA0B 2C4FU 4PLJC 2C8NA 4FXTA 3CXDH 4X9YA 3KWXA 3IJEB 3MUHL 3BUIA 3MKGA 1ASPA 2BWIA 2OR9L 5I8EA 3UPCA 1WZAA 1BVLA 5C6WH 2R4SL 1TYJA 1XH0A 1QRKA 2QADC 3HG0A 4JFQB 2ZF9A 2OK0L 2WNGA 3WFHA 2VRAA 2X5PA 4ATTA 2FL5B 1SPDA 3MRJB 2YPLA 1D9KC 2WTRB 1PLBA 1RJYA 3FFDB 5E4EC 5HD8D 2WWOA 1ZV9A 5T1DH 4N2HA 2YQ2A 4ZXBA 4R90L 4W9KC 2ZUYA 1H8SA 2BVYA 1H5BC 4KV5F 2WQAA 4PJFF 5FWRA 2KS0A 2VERA 3ATAA 4CILA 3UTSB 1RZ7H 3ILQC 4D0BB 2WCPA 3WSQL 3QNXA 3SO5A 2WLIB 3VFTA 2AV7B 1KBBA 1N2RA 1Z9LA 2P45B 4Z8FH 1F97A 3FZUC 3ORJA 5FLUA 3RL1A 4N28A 3U82B 2ITFA 4WDIB 3S2CA 2IFGA 2A0LC 2K9FB 2PUQT 3GSVB 3K74B 3TYFB 1E30A 1IT9L 4Y1SA 2F9BT 1NBZA 2J1WA 1BIIA 3C09C 4C56B 4ZOCA 2RQ8A 3IETA 2OR9H 3SO3B 5B38B 4U3XA 2ZCLL 1OSPH 2XETA 3NEEA 4NT6A 3KPRD 2H32B 2R4SH 1FFQA 1MF2L 5DHYA 3WN5A 4Y7OC 2OK0H 1ZT7A 2ZUSA 5E00A 4HUWA 4IK7A 1UKQA 4NCC1 4XXDA 2NR6A 1OB1A 3LPFA 3MRPA 1PZSA 4HWUA 4AM0A 1EIBA 4R90H 1NBVL 4GW1A 3T6VA 2HWZL 4DO4A 3WN6A 1RZKL 4XVUC 1J48A 1FJ1A 1FNEB 3GUFA 3V4VB 4X5WB 1I9IL 5SV4A 1MLCA 1A5FL 1HHHB 3KGTA 4KMTL 3WSQH 5JORB 1MFVA 4M61A 3DGCR 3US1A 3NN8A 1H3WM 3X1EA 1XAKA 3WFBL 4LCVA 4PG9B 4NO0A 4KOCA 2PYEE 2C7UA 3ALXA 2EAEA 4W9JC 1IT9H 3C60C 1TVBB 3ZZQA 5I1EL 4FD0A 1EEUA 4GBXC 2ZCLH 4PIBA 2OTWA 3RWFB 1MF2H 1IEBA 3AUVA 4BEIA 3BZEA 4PJAA 4WV1A 3P9MA 3L3JB 4I1PA 1GMEA 5H4YA 4FFWD 3IAGC 1WE5A 3FO1B 2FWOB 5TK4A 3QO0B 2XNAB 1MY7A 4HVBA 2NY4B 4Q6KA 4PD4J 5KVFE 4AKOA 1Y7VA 2IV9A 1K6QL 4HCGA 1NBVH 3AY2A 2HWZH 3T1FB 1KPVA 3BQUD 1RZKH 3LH9A 3U1SH 5C0AE 3MNZA 4R4ND 1OCOB 1ZXQA 5HDWA 1I9IH 1Z32X 5HHMD 5EMYA 1FCGA 3TPUB 3VCLB 1ZHKA 1JTTA 1QRND 4KMTH 2Y22A 1OZTG 4Y16A 4CADB 1N8OE 2B20A 2VDKL 4RBPK 3D87B 1TCRA 3ARRA 3WFBH 2GAZA 4MXVF 4TF4A 5F7FA 3BWZA 3QNFA 3FT0A 2ZSWB 3O4LB 3KPPA 4IKJA 5C1MB 4PSRA 5I1EH 4QT5B 1AGCA 1NEPA 2Q8AL 5D2NA 4GT7A 1YC8A 3QZOA 3SCMA 4JFYA 5ALCL 4AENB 4W6YB 5KBKA 3ZYJA 1FYTA 2LW3A 3O8XD 3PDOA 5CO1A 3BEVB 3LY6A 1OPOA 2J6EA 1Z9OA 4FKEA 4XH2A 3VSQA 3ARWA 5F1NA 1AVAA 4EIZC 1QASA 4JDEA 2VLRA 1EEZB 2PCFB 3KHQA 5GGRY 5I0WA 2VLLB 2C9PA 3UAAA 4D2NA 1K6QH 2P26A 2VW4A 1T2JA 3NJVA 4PAZA 2EXYD 2EDBA 2GJPA 2EUWA 1WBYB 4KHTL 2XG4B 1QWNA 4QXUL 2A73B 2OJ1A 4W9HC 5L0QB 3RQ3A 5EU3A 2CHNA 2YIHA 1TU2B 3AQZA 5L6YL 4J3TA 3EJTA 2VDKH 1YUHB 3OPZL 2VR6A 1ZHBA 4ANXA 3OLDA 2CO3A 1XTMA 2DQIL 3CJJA 2VAAA 3CLFH 1OQXA 3PWNA 3PWPB 2ORBL 4MNHA 1IGYA 4AQAA 3S8FB 2LE9A 3HBPA 1JXJA 1WTLA 3U2JA 4AGMA 4UT6A 1TNNA 2Q8AH 2ATPB 4K4KA 4ODBD 5ALCH 4J6RL 4M1CD 2ADYA 2CCWA 3D48R 3IGAA 3NJXA 4HMDA 3U25A 4A7UA 2HVBA 4AGLA 3BPCA 5J4MA 3VXME 2YLKA 2BLFA 5MERA 4GXVL 1S7RB 4DKDC 4IIQB 1SMAA 2LQRA 3C12A 1L5GB 4DUXA 3DHUA 4E0RA 1QA9B 1BLNB 5ALBL 3DXAB 1R3JB 2YGPA 2YO3A 2XVBA 5EIIA 4IRSB 2WBKA 5LG6A 1FNAA 4FQHA 5IT2L 2P24B 3FHQA 1JJUA 4KHTH 4DPAX 1RXLA 2N1TE 3DYMA 4QXUH 2CKBB 2UXVA 1AJ7L 1WV7T 4DOHE 1HZLA 4QWWD 1C12A 4KRLB 2H32H 3HHSB 4P57B 3K6NA 3W9DB 5L6YH 4RH4A 1RAMA 3HS0A 3OPZH 3GSNL 5L2JA 1MCSA 1OZUA 4AMWA 5TE4L 4KQ0A 2WMPA 1KGJA 2X4UA 2YPLE 4X98B 2DQIH 1RZPA 2ORBH 4HKZA 1MWAB 1OL0A 2IDCA 1URLA 2RBLA 1KTRL 2CBOA 3KLLA 3PWVA 1SMOA 4J6RH 1SF5A 2VQ1A 3OG4B 4P48A 1HQ4B 1ZHLB 4Z7UA 1DO5A 1ZS2A 4FXLA 4WW2F 2WVVA 4GXVH 3J27A 4MNGA 4OGQC 4OZGF 3LN9A 4M29A 3VI3B 2VXQA 3B5GA 5J13C 1XF2B 5ALBH 3B2VL 2W0FB 5E5LA 1KB5B 3FUEA 5J12C 3HPLA 3SE8L 5IOKA 3VFUA 5IT2H 3P3SA 3LDBC 1XDTT 3QWNA 4NQCA 2AC0A 4F3FA 4HPHA 3QIBA 2FIKB 1AJ7H 1WAPA 5JHMA 2XWBB 1S7WB 1KGCE 3KYNA 5SWZE 4UTCA 3HC0B 2QLVB 3GSNH 4WCYL 2ZXCA 1QZ1A 4TN9A 4WNQA 2Y7LA 5TE4H 2DLHA 3GSXB 5DRWB 3H2QA 2IBZX 2YAQA 3GWJA 2EDRA 4NQEB 4GUOA 4X8JA 4AVHA 4WKXA 1QKZL 2K8MA 3CFQA 3O3BA 3K8MA 1AYRA 2MSPA 4G2AA 4PS8A 3TEZA 1F11B 1HX0A 2ILLA 4B9FA 4Z77B 5K1JA 2YKKA 3B3BA 4V33A 3CFBA 4YDIL 4EIGB 1BZ7A 4PBVC 4YBLB 4IBUA 3B2VH 3MLTA 3OZLA 4NUPA 1SHXA 4GUCA 1K9TA 3DK0A 4MRBA 3VI4A 4BIKA 4CMMB 2MJWA 1JNNL 2X2UA 2PYED 3FCSA 4P2QB 4P0DA 1E90A 4ORGA 2D2CC 3KWWB 5IB2A 1BVNP 1KGWA 5FLVA 3FB6A 4HIIB 3U36B 2WIIB 2ADGB 3L3OA 4PJAE 4AKPA 4ETQA 1UWYA 4WCYH 4ABQA 4JFXA 3AITA 2DI7A 5AOIA 3C6LD 3D1MC 4WO4D 3O9WA 4RAHA 4R97C 2Y4SA 3RYMA 4NB7A 4OJYA 1I7UB 3F7QA 1T7ZA 3L2MA 1QKZH 4X8CA 3WCYA 1BFOB 1QFPA 3ARED 4UDTA 5KVGE 3QUGA 3ROOA 2MTAA 4O9HL 5C0AD 3FMGL 2RAMA 4QJ5B 5I1DA 1G1OA 2CKBL 3JT2A 2QR0A 2YHGA 1MCQA 2GJZA 3IWUA 2CBQA 4J3SA 3TVMA 1F4WL 2NW3B 2UVFA 5E0QA 4YDIH 4QCIB 4NCDA 4U6XB 3G5ZB 2V2XA 2AXHA 2MNWA 5CWSB 2BNQA 1KT2A 2A74B 1KNOA 1ZT1B 3SDAD 5JQIB 3S88L 4LVNC 5H37H 2B15A 2ZYIA 1HOCB 2XN2A 5GGTL 1CICC 3OKEA 1JNNH 4Y2OA 2Y1YA 2G3NA 4U33A 5F88B 1G84A 5ICYB 1O9WA 1MWAL 1FYTE 2ERJC 3JV6B 1A4BA 5LO7A 4QRPB 2FLMA 1VZIA 3S9DB 4BRJA 1UD8A 3K71A 4A55A 2VLRE 1HEZB 5JHLA 2C1PB 1JTOA 3TXAA 1ICTA 2VRKA 3BVWA 1CPUA 1E3XA 1KB5L 5B7MA 4LL4A 4FFYA 4G1EB 3SJVA 1KG0A 2UY6B 5F6HI 1FF5A 2R69A 4O9HH 2MEJB 1SXCA 1BFSA 3FMGH 3N91A 1IL1A 5D93B 3ARGB 2CKBH 3ZDYB 3ZDZB 1RLWA 3BQUC 4OCRL 4GINA 1B0GA 4UQEA 1F4WH 2CJ3A 4YL4A 35C8H 3JZYA 3Q5TA 4R4NC 5F7YC 3C8KB 3CHQA 4WSGA 1TO4A 3S88H 3N42B 4OCYL 5GGTH 3G9VA 3RUGB 2Y36L 4Z95L 3MBEC 1A8ZA 3V5KB 3DVNA 3MRKA 2K4WA 3ARDD 1MWAH 3VRLF 2YEQA 2P44B 4ZBJA 4IIZA 3RP1A 3U4KA 1NDTA 4ZPVA 3RGVA 2YD1A 4KKQA 5MEPB 3VXMD 1E50A 1FN4A 3O8XC 1UB5B 4WHCA 5CF3A 1O5PA 3QEQB 3FTYA 1H0DA 2EC9U 3GT6A 2A2QT 1BYPA 1KB5H 2B2XL 4RRPG 3QUXB 2JTYA 2MHAB 3GYRA 4Y5XA 4GT0A 2COQA 4UOZA 2OCCB 5AOLA 4JJHA 2A4EA 2I9LA 4YPGB 4YNYA 4OCRH 2F7QA 1P2CB 1KGYE 5I66A 5E6ZA 1Q38A 2OJEA 1X5HA 5PAZA 4TLSA 4DGWC 2CHDA 2EIDA 3TV3L 5CAYB 2I85A 3MC0A 3SKMA 2ZSVB 4OCYH 2YPLD 4RIRB 2JKTM 5F0MB 4PP2A 4Z95H 4ZXBD 1BBDL 2ADIB 2HT4C 2QKIA 3NFPB 5JPNA 2D7QA 3WO3B 4HCRA 1AS7A 3SOBL 1JF6A 2UX7A 1A0QL 1N0LA 2WYZA 4I9XA 1D5XB 3CE1A 1W80A 2ZP8A 4HDIB 7PAZA 3FT3A 3UJTL 1FH5L 4Z3JA 2YRPA 5EBWA 4NRZB 3H7BB 4G6JL 2YR3A 2F1BA 2PTTB 3Q43A 2I24N 5FUCE 2K3HA 3KH3A 1U8LA 3GLDA 1DL7H 2B2XH 2F61A 5KSUB 1AHWA 3LZFL 2LU5A 1NFDF 2W95A 1XX9C 5BZXA 1MQKL 3DI3B 4EQ2A 4XVTL 1E28B 4JKNA 4WWID 3UZQB 2DMHA 2NY1B 1BBJB 1BSIA 2ED7A 4YGAB 2ZE0A 3FS9A 4J3OD 4IOIB 1KGCD 1E5BA 1MCCA 4FKHA 4OZHA 4BZ2A 4Z7QB 1P6FA 3TV3H 1JD7A 2WB7A 5HDBE 1SZNA 5KOVC 1OXYA 1R19A 4BYHA 1W8EA 3O11A 4QWWC 1UXSB 2VWEE 2NR6D 4WWKA 2P7TA 2ZCZA 5H37G 3X14A 4FNLL 1KXTB 1JPFA 1QNZL 1BBDH 1X5XA 1K8IA 2C9XA 1MHCB 1J9SA 2X28A 3SOBH 4ECNA 5I8KH 1A0QH 4E68A 4YHOH 5LGYA 1ZTXL 4JDZA 3WHE1 5A7EA 2MPAH 3MRLA 5DVPA 3UJTH 1E4JA 5DJYA 1FH5H 5KYWA 3KJ4C 4WEUD 2UZYA 1B4LA 3N2JA 1AGBA 3HNTL 4G6JH 2YD6A 2MFNA 1U8OB 4NO0D 1TQBC 3RLSA 1K5NA 2WXPA 3PGDA 3LZFH 4JFVA 4HOXA 3DJRA 4M8QB 1MQKH 1MNNA 3B1UA 4XVTH 3CFTA 3KGSA 1NAMA 3B34A 4OJDH 1MW2A 2VQTA 3QG6B 4JRXA 4JLRB 4DW2L 3U83A 5IM7B 5TH2B 3K6SB 1FFRA 1T6BX 3WDJA 4P4KB 5L4IA 3UG4A 3TCXA 4OD2A 4KJQD 3MRBA 3DJ9A 1OTTD 4FNLH 1AKJD 1X9QA 3OKKB 1QNZH 5DJ0B 2GT9A 2DBLL 2FLRT 3WEAA 5D96B 1PTZA 4RMTA 3GMRA 4ZTEA 2ZOWA 1ZTXH 4CU6A 3RFZB 1NSNL 5IMKB 4F7CB 3ZT5A 3GRBA 1DE4B 4Y16D 2D4DA 3BUDA 1ILUA 3HNTH 1KJ2B 3VG9B 1SYVB 4G42A 5JO5A 3S34L 3I6GB 4A2FA 3QXUA 5HTSA 4L8CB 3VFWB 3TO4B 4I48B 1S8DB 3Q2VA 5C7XL 5IHHA 3S36X 1NEZA 3E1F1 4OJEH 1WGVA 3B9EA 1FYTD 5GSVB 1KCLA 1I7ZB 2EJ1A 4P5TB 1FGNL 8FABA 2O93L 4EUPA 2JK5B 4DW2H 3LS4L 4BINA 3ARPA 4NRYA 1T04B 2YD8A 2VLRD 3VFNB 5BUPA 2YA2A 2R0LL 5IVXA 5LBVA 3GMLA 4R2GB 2ZOKB 1CFSB 2E56A 3QZWG 3SJVE 1R3LA 2E9JA 3FQUA 4WO4C 4GP8B 4Y89A 1YCSA 3HUJA 4MCMA 1NSNH 3QUZB 1T80A 1DLHB 4J28A 3L3HB 3Q5YA 3AREC 3NIGE 3V4UL 5ICZA 2NNAA 1QI3A 1BOGA 3S34H 3BEWB 3L2NA 5AENA 5CSBA 2DWSA 4ZMTA 5C7XH 4CU8A 1RLBA 3B8SA 2D3NA 4X99B 5IKCA 1X5FA 2OSXA 3BUPA 2JKJA 5IW6A 4IM8A 5F0JB 1FFPB 2NZ9C 3X11A 5KS9F 1AZNA 1HJBC 5E94A 5IIEB 3EG9B 3FU9A 1FGNH 2GSIA 2G0LA 3C75A 5C0FA 1N5AA 3REWA 3LS4H 4ORZC 1OF2B 3VXRE 3T6QC 5CZXD 1IQWL 2AW2A 2GK2A 2CCVA 4X6DA 3KCPA 3IT8D 1Q94B 2ZT9C 2R0LH 4WI3A 5I1AB 1EFXB 4OM0L 1GAFL 1MVUB 4PJEE 1T0OA 3V6BR 4YWGL 3V2AR 4GSUA 4NQXB 4A2MA 4LDEB 1Z7JA 5FYJU 2WZPD 3V4UH 5JMRA 4NAMA 2FQGA 3NFSL 5BRZE 2WYIA 5JIKA 4BK5C 1WG3A 5BOZG 2HX8A 2WJ5A 3X1GA 1AR1D 3WD5L 4AJYV 1WBXA 5TDNB 1HL5A 2R29L 1SJHB 5CJQL 1KV7A 3KEDA 4HALA 4UM9A 4LFHD 4BUQA 3PPSA 1DQIA 2AKRB 3U9PL 4YDLC 5KBMA 4U7KA 1S9KC 5GRYA 2UYLB 1YN7B 4D8PB 2OLDA 3ARDC 3FRPA 3MLSL 2BSSB 2EEXA 3A0OA 1IQWH 1RZGA 3SE4C 1KJ2L 3FW6A 4OM0H 3LSOA 4PRAA 1GAFH 4YWGH 5I17A 1AGDB 5F21B 2V5RA 3MQIA 3WNLA 5IWLA 3OJMB 5I76A 5HSFA 1H3TA 3QIBD 5C2UB 3LZQA 4GSXA 1IAIM 2JJUA 5DVLA 4C57C 43CAB 1NCAL 3FU8A 2RALA 3ZZLA 3D6GA 1FVCA 4L9LB 2XKNA 3NFSH 1FO0B 4GG6B 2DMKA 1F6AA 3BD5A 1INQA 3GIZL 4FS0A 1XGTB 5LGJA 3D2UA 3H0TB 3WD5H 4FLRA 2R29H 4NQDA 4B3EA 1LD9A 1EHLL 5CJQH 1WWCA 1NA8A 3OF6A 5AKRA 4P23A 3TX4A 4OZIA 4AH2B 1OEZW 3GB7A 5EC2B 4PJCB 2P8LA 1PBYA 15C8L 4ZXBC 1N18A 3U9PH 2CDEB 1XVSA 4M9OA 3MLSH 1YAIA 4FFZA 4NN6C 3RJDA 2QVMA 3O4OB 3ML9A 2A6DB 3JTBA 1TKWB 2E8ZA 4PJ7A 1KJ2H 1FNFA 1FNSL 1UD3A 2PWDA 1MFEL 4MB3A 4IYKA 4E9VA 1KBPA 2XFXB 4IMLA 3AXIA 4KK5C 3BAJA 4B95C 5EC1B 3V6ZA 4ZPTB 1JPSL 4H8HA 1NC2B 3NCCB 1NCAH 3O3UN 4KAQL 4F92B 1BX2B 2Z0BA 5EO9B 4L18A 1YMHA 3GIZH 2ATAA 4J3OC 2IFFL 2UUDH 3FN9A 3WN5C 1KTCA 3O9WD 2P5WB 2AQ3A 2YA0A 3ULSB 2W80C 3AQXA 3MLVL 4BXVA 2WXNA 1HKLL 1AD0B 1CFNA 3QT2A 2OYKA 5BPPA 2QADB 1JGUL 1MI5E 1A7OL 2FO1A 3ULAB 5C3IA 1ORSB 4MAYC 4RBPH 15C8H 3AT9A 4UMSA 3UZVB 4YSCA 2EUXA 2H47C 5D7IB 2GIMA 4WEEA 5CJBA 4Z5RA 3TVMD 3VSUA 4MZ3A 1NFIA 5E4EB 5I6NA 4Q9CA 3C9NB 4HAGA 5T3XL 4GXFA 3MRIA 3VI3F 1WK0A 1FNSH 1OK8A 1MFEH 1T21B 5TDOA 1WF5A 2DBJA 1N3NB 4K5LA 1S9XB 1AH1A 2V17L 5D72L 1TR7A 2X4RB 1G7MA 1JPSH 4KI5C 2QPSA 1EEQA 3FQNB 4TUKL 3VX0A 1F2XK 2AI0L 4LHUA 3IDJB 1QVOA 4F2EA 1WFTA 2ED6A 5KVEE 1MOEA 3V4LA 2IDQA 2XWEA 3SBQA 3MGTB 2IFFH 3I2CL 4L8SA 4ODUA 2EEDA 4APQA 2A5UA 4TLUA 5IEKB 5KYYA 3C09B 2JCCB 5CEYA 1M7IB 1JPTL 3MLVH 3S0PA 1HE7A 1CGYA 1HKLH 1C5CL 3SJVD 4KJQC 4ZI8A 1JGUH 2Z92B 1A7OH 1OTTC 3L3GB 4H13C 4MD5A 2MCMA 3OKDB 3QEHA 5DC0A 5LHDA 2BO0A 5CIPA 4ZMPA 5E2JA 1TZ8A 2KI6A 4Y4KA 5EO0A 3H9SE 3VTTA 1WFIA 2CGYA 3OKOA 3AU0A 5T3XH 4UQ2B 2FTAA 2XJKA 4HJGB 3KS0J 4BFFA 1QHOA 3GIVB 1FO0L 2VDQB 3VE0A 2Z93B 5J9PB 5DS8B 2F2HA 1UC6A 4JFOB 2KZ1B 1OTUC 2V17H 1Q0YL 1BZOA 3DIFA 4JKPL 5D72H 1UWFA 3TM6A 1DBBL 1QNIA 2X6BA 4ZW5A 4TUKH 2AI0H 2EE9A 4TNGA 5IB1A 2BWDA 3RGVD 5FDYA 3CNKA 5E8NB 4X6DE 3VD7A 2G2RA 3DTUB 2LU4A 3I2CH 3C60B 1C5DB 1DVFD 4ZT1A 2EDHA 4OVVA 2D7TL 4H88L 3U46A 1JPTH 4G9DA 2IH1B 1W8NA 2NZ1A 2OW6A 4PCKA 1C5CH 3ZQWA 3D4YA 3UP6A 3NFNA 4QO1B 2EKSA 3TA3A 4M5ZL 1BVOA 2Y07L 4BFIB 5DJAB 4JHBA 4PJGB 2QV2A 4FI8A 5DTFB 4R26L 1UXMA 2GG1A 4XWGL 5FKPB 4PHZA 4AOFA 3BPOC 3MA7A 5C09B 2CHWA 3LQAC 3O3EA 2CSPA 2GHZA 5BRZD 4LSVL 4NUGL 1FO0H 1KCSL 1ZDQA 1I1AA 1AQDA 2HCZX 3IBOA 2OM5A 2ENJA 1DHKA 1Q0YH 4JKPH 1JOIA 2BIPA 3MJ8A 2FYYB 4KUZL 2XU9A 3MV11 5MEQA 1DBBH 4HT1L 3VFVA 2ZWKA 5IFHL 3V6FB 4Y9EA 4GKSB 2NW2A 1OCWL 1NKOA 3A6CL 3PAVA 5D7KE 5GRUL 1P1VA 3NMEA 2EDXA 4NO2A 4UI2A 1JXFA 2BIMA 4YVNA 2D7TH 4H88H 4O02B 1FIEA 5HHQA 5CZXC 3T77B 3VH8A 3QXDB 1T7YA 4P2OC 2ZIDA 4M5ZH 2G5BA 3T04D 2Y07H 3RWCA 1HSAB 1BMWA 1DVZA 3OGCB 3ZDYF 1E27A 3O45A 4FNQA 5E2WL 2X0UA 5L2KB 3T0EA 4R26H 4LCUB 3MV8A 4XWGH 4XPAL 1CU4L 5ICXB 3PP3K 3BAKA 2UWEA 2ZUQB 1JDAA 3RX5A 4PVMA 2CWRA 1XR9B 2VITA 1KCSH 3N42F 2QVFB 4LSVH 4WU5B 4WWKD 1RH8A 2FH8A 1KJVA 4GIOA 2W92A 1QATA 4M5YL 4XMUA 1XSOA 3RUGF 4NQDE 3L7FB 2BSCA 4KUZH 4OZIE 1S5HA 3RY6A 4ZUVA 4HT1H 3V9CA 1AR1C 1GGBL 4ZD3L 5JQHC 4WNJA 5IFHH 3PS6A 3IJHB 3OG6B 2JH2A 3PHOB 1WIUA 3FH5A 1OCWH 1G9NC 1XCTB 3A6CH 4P07A 1GYAA 3MV01 2WKGA 5GRUH 5DUBA 5CBEB 2J21A 4PJ7E 2NY7L 5FKAB 3M17A 4PREB 3IYLW 3EKCA 1QFUL 3BP7A 3EYVA 2Q6WA 5DHDA 2WTOA 5T1LA 2VDQL 3IDGB 4HUXB 1I7TB 5FUCC 2EIBA 3Q8CA 3BH8A 3WIIL 3SD5A 3KPLA 2P8MB 4M7ZC 3ZK0A 4AX3A 1I9EA 1AY1L 2AXGA 4J3WA 5E2WH 1SQMA 3US0A 2HFGH 3QIBC 3FU5A 3QIWD 4JRXD 1CU4H 4MQ7B 4XPAH 4UOJA 5F7DA 1E6JL 3SDDA 4UF7C 3VRJA 3WIFA 1I3UA 4JZOB 2W65B 4L23A 4M5YH 4KU1A 4PJXB 5FFOA 4HAKA 3W82A 4MS8D 4UAHA 1EAQA 2VWEC 1YEDA 1MI5D 1GGBH 4ZD3H 4U1HB 4B9GA 2DQFB 5CCKL 3NJLA 3BESR 3QFGA 3DGGA 3OR7A 4YLBA 4HKBA 5MEOB 4LLMB 4NHUB 2ADJB 4ENEC 2NY7H 5FO7B 2ZCHL 4HBQA 4OF6A 4I0PA 1QFUH 4P2RE 1MDTA 3TWYA 3EH3B 1JK8B 1ONQB 1SBBA 1U3JA 2VDQH 5J06A 1CL7L 5HHOA 1J8HB 3WIIH 3E2HC 3L13A 2CLRB 1AY1H 4I18A 3DX7A 4U1JA 5J13B 4JPQA 5HJ3B 5J11C 4Q0XL 4YX2L 3SN6N 2D7PA 1E6JH 4Z7QF 4OLWL 2J2ZA 4F7MA 5J12B 1WHOA 5BS0A 1F13A 1B6DA 1XGYL 3LDBB 3CLWA 3DX1A 4PS7A 3I6SA 4Y5YA 1KIQB 4O02L 3WS6C 4LLVB 2H6PA 3O9WC 4K7FA 1QW8A 5CN2A 3ZTDC 3EOBB 3TTYA 5CCKH 4HHWA 3VJ6A 5IB3A 2X0VA 5E6ID 1JV5B 1NCUA 3WTSA 1PD6A 3H9SD 3UCQA 2BZCA 4DKTA 3D39A 4OBRA 1T1ZB 2ZCHH 5K9JL 4JQVC 2QSVA 4EEEA 3CX5K 2DS4A 2WXJA 2Y2TA 4XXCA 4MX7B 5ID1B 4IBYA 5D71L 2XBTA 4L3FA 4LPUA 1M53A 1OSZB 5GRZA 1R1CA 1CL7H 3HI1B 1HZKA 3CHSA 3OSVA 3RA7L 5F7MC 2KERA 5EPMA 3WKQA 4NC2B 2JKWA 3FTGA 5IW1B 2WHVA 4F7EB 5HYSG 4Q0XH 3RWDA 4YX2H 5HHVL 4XO9A 4GUPA 2RJMA 2CM6A 2H26A 4OLWH 5A3ID 3RVVD 2X6UA 1XGYH 4PR5A 4CSTA 4GKNB 3X12B 5ACZA 3AGWA 5L4JA 1KLGB 2QSQA 5D2LB 3K0WA 3BC9A 5T1MB 4D0DA 5HYIA 5LXVA 4JKLA 4O02H 4JGJA 4XHJD 4OZFB 4GEJA 3W81A 5GGVL 3V8CA 4ES8A 3AY4A 1F4HA 2Q7NA 3KPRB 5I8OL 5ECGA 3IS1X 1HJCA 2EIKB 4HJSA 4QIRA 1UM4L 3BPNC 3QRGL 2WPGA 1CFTB 3ZBMA 5C6PB 1CXLA 1V3LA 5K9JH 3WV0A 1S7SB 3CN4A 4JHVA 1XIWC 3VMPA 3L1GA 5IV2B 3Q44A 5D71H 2WQXA 4WVRA 4M6ML 5I1KL 1NCCL 3NJFA 3OXRB 4UM9D 1P5UC 3RA7H 2VISB 1K8DA 2OMUA 3EZ8A 1VFAB 3QJFA 3UFIA 5D7JA 3ZQXA 2ICWA 5I1GL 5FA3A 4FABL 2BIIA 3CSTA 4LVNB 3ETBF 4N2EA 3G08A 5HHVH 5K59F 3FQ4A 2AV1A 1DLFL 3ROLA 1EA9C 1U95A 1SM3L 5D7KD 2MKLC 3BDXA 3EYFB 3KMDA 1BPLB 1L7IL 3ZJAA 5CLTA 5FOJA 5D4JA 3U4EA 3GSWA 4R5TA 2ERJB 3ENEA 5CUSL 1NGWA 1XCWA 3L6FA 4MHHI 3KCWA 4B50A 1DVFC 1N12A 5GGVH 2D7MA 1RK1B 3B9VA 1FDLL 1OAZL 4AT6A 5I8OH 3KVPA 5IB4B 3DUHA 1BFVL 3T0EE 3MV8E 1UM4H 3DX4A 4Y5XC 2DM7A 4ZUTA 2UWEE 2Y1AA 5I16B 4X2UA 4HUMB 2LFEA 4NFCA 1BZ9A 1CYXA 3AAZB 4M3HA 3KW8A 3L5HA 4GRWE 1DDHA 4JQIA 4YO0A 4B53A 3ARTA 3QUKB 4CGTA 2BVEA 4M6MH 5I1KH 1NCCH 4NQDD 4GQRA 3HIZA 3OF6D 4FGMA 1UEMA 4LSRL 5I1GH 4FABH 2Y5EA 5HHMB 1QRNB 2VM3A 1DLFH 3L7EA 3OKMA 1AQMA 2AXWA 1H3VA 2F74A 1RVFL 4G7VL 5DEFB 5FDWA 1SM3H 1TQVA 1L7IH 4TL4A 5KYXA 1B4TA 4PJIA 5DEZA 3SYPA 2KYIA 4O51B 1ZWIA 3BSHA 3LQMA 5CUSH 3D0LB 1WBZA 4HUVB 3N5AA 1AZVA 5FYKU 1U4FA 1EVUA 1FDLH 2H0PA 3KHOA 5J1AA 1OAZH 4U1NA 3O8XB 1RK7A 4AW7A 1BFVH 1KEGL 4XN5A 5D1QC 1HU8A 3H9YA 1F3RB 3SYCA 3TH4T 1U2YA 5KJ7E 5E7FA 3QUMB 1MAKA 1K4CB 5D6DC 1CGUA 2JCWA 3NCWA 3DMMA 5AG9A 3OAZH 4H2CA 2HJKA 4CSPA 4Z7OE 4L1BA 2MOQA 4HBCL 1U30A 5B3JF 1S3RA 2V8MA 1QW9A 5JTWA 5HGHA 4CN4A 4PJ9C 4YDNA 3D34A 1F5WA 1JHTB 4LSRH 4NUJA 4WWPA 1CZ8L 4O2FA 1I1YB 4MB5A 1PCXA 2CDFB 3H9HB 2X2JA 4G7VH 1RVFH 3GSUA 2VDPB 4LDOB 2X4PB 5I0DA 2B3IA 3K7UA 1TYRA 4P2RD 4EKJA 2EE2A 3BP6A 4RNRA 4WW1A 1WICA 2KHAA 4YDJB 5EHFA 5HHOE 4NZUL 4OBSA 1Q9KA 2EO7A 3IDUA 2EYSB 1CDCA 2EIZA 5BVJB 2BINA 1KEGH 3ARYA 2QDVA 1UASA 2WBXA 4LHUD 4PJ6A 1P9MA 2E9BA 4G8EB 4E9XA 1XHHA 3NSYA 4AY0A 5BS0E 4K5NA 3ARUA 4Y2DA 4GG6F 3S3JA 1CFMA 4MVBD 2GTQA 3QIWC 3IN2A 1Y1UA 4HBCH 4PJFA 3D0VB 4A2DA 2E4FA 5LAXA 5G55A 3Q7JA 2WQRA 3N0PB 4OZFH 2X4OB 2JI2A 3CPUA 1AQ8A 2DMGA 4PJCF 1CZ8H 1J5OL 4MS8C 4WHTB 1TG8A 1DSYA 4ZX5A 3TBVA 1IM3A 1SEQL 1F2QA 3D39E 3OM3B 1VKXB 2APWA 1DZ0A 4XPHL 4DZBB 4BV1A 4Q2ZA 1S9YB 3H85A 2EXSA 2PPDA 1FAIL 3GS0A 4I0KA 1ZIBA 3KDMA 2C5DC 3SDCA 5T33L 4IHBA 3O0RL 1A1MB 4FEMA 4PW3A 1VFBA 4NZUH 5ENWA 1M9SA 2PTUA 1L3WA 3US9A 3UYPA 4U4IA 2WWKO 3CQPA 3EGDB 1QSFA 4X7SH 4PGEB 2DLGA 4HIJA 3VD4A 4MZIA 5LB1A 3HCVB 4DHLA 1TQBB 2ZWNA 1LK3L 3LNHA 3UBGA 5A2LH 2K4AA 3WE1A 1IBHA 4QNPE 4X9IA 3BJ91 3RWGA 5E2VH 2VL4A 4JZNB 1A3RL 3K0YA 1ILSA 1FE8L 2F0CA 2W9EL 4N90E 3TA3D 4E9YA 2H3NB 4I3RL 4EBQL 1J5OH 1I85A 5DEJA 5AVVB 1PZ3A 1SEQH 1U8IA 3TPKA 4K5OA 4MA7L 4XPHH 5I1LB 1LLAA 3QQ9D 4A2GA 3KPNB 4E42A 2Z6FA 4V1DA 1GYVA 1FAIH 1RHHB 1X9LA 5E6IC 1NL0L 3QQXA 1WEJL 4M3KB 3QUML 1DVQA 2CO7B 5T33H 1I1AD 3NVQA 3O0RH 2HRPL 1T3FB 3KLHC 1R0AL 2P5EA 4PTTA 3NCYP 1XSKA 5H35B 2KUTA 3UABA 3NUKA 4PRBB 5E5RB 5JHDA 2ZAIA 3LZLA 1J18A 3RWJA 4X0NA 2X09A 1LK3H 2VDRB 1TSHA 3U9UA 1JSYA 2VDPL 1NCBL 5A3IC 1X7SA 2JCCF 1E5UI 2PYEB 3PUUA 1WFJA 1UJ3A 1A3RH 3QISA 1FE8H 3RKDC 2W9EH 3CFJB 3F01A 3JUYA 4I3RH 3E3QE 4EBQH 2M2DA 1JFQL 1WRFA 3QJOA 1P6AB 3H55A 3Q13A 3T0ED 1N70A 5F89B 3MRFB 3MV8D 3SDXA 2IGLA 5K5YA 4HA1A 4HCFA 2MTPA 3A4DA 4X42A 1CLCA 3C6LB 3ESPA 4UANA 4ZO6A 5SX4H 1ID2A 5F8QC 1NL0H 3D9AL 1WEJH 4WO4B 3QUMH 1ZMYA 4X83A 2HRPH 2G30A 1IAII 2CDGA 1R0AH 2CXKA 3AREB 3QXVA 5C0AB 4LOFA 4E9WA 4B9PA 1BQSA 1SOSA 1QSVA 3K4DA 4G8IB 4I1RA 1IX2A 3TZVA 1EJOL 3P11L 4HMCA 3TNNB 4OFKA 4XZUA 3MREB 1AOZA 5KUKA 1CS6A 2YXVA 2HRLA 5DA4A 3SDAB 4PJIE 5L88L 2VDPH 1NCBH 2OCJA 1QI4A 2NT1A 3VTMA 5TQ2L 4JFDB 4JY4A 3VGGA 3OAWA 5DDHB 4AG4L 5FGRA 5K39B 2F19L 2EKJA 3CBKB 3E7JA 4OZFG 2ENYA 1JFQH 2YJQA 3MBWA 3Q3GB 4DQOL 2CGRL 5DVKA 4PJGF 1MIEL 3EIFA 3SDDD 1P7HL 4JANB 1S6NA 1YQ2A 2CPCA 2BM3A 3TNMB 3CVHA 4WK2B 1KYOJ 1PG7L 3JSSA 3D9AH 3CFEB 3UBXG 4ZFOB 4OUUA 2CJTA 1KIRA 2G75B 3L08A 5K9KA 4N87A 4NPKA 3W9EB 3ZE1E 2X1OA 3ARFC 4Z78A 4QEGA 4XMVA 1LNUB 2OPCA 2Z3FA 4J3XA 4G7RB 1HYRC 2E4TA 2VUOA 3OX8A 3IFPA 1E6OL 1EJOH 3P11H 5HHPA 1CFVL 3IJSB 4RVBA 3N50A 2QSTA 5D7HA 4LPYA 1S78D 2BCKB 3I85A 5IHWA 5KSVA 4I0PD 5L88H 3NSXA 4JJ5A 1AMXA 5C07B 4KC3B 2N4IA 4KZEL 5TQ2H 1OGPA 4AG4H 1AO7A 3F3HA 2F19H 2Z1PA 3D08A 4B97A 5HHOD 1HCFX 2HJLA 3ARDB 3DLQR 4QJ3B 5E23A 4ZDHB 4JRYE 1X7QA 4DQOH 1HEHC 3D69B 1VFOA 2CGRH 2DH3A 2PNDA 2W9LA 4X50A 2EIJB 1MIEH 1TOXA 5DC9B 3PV6B 4PGBA 4DFIA 1GTNA 3VXMB 3QFDB 1PG7H 4XVSL 3WTXA 3PNRB 2OMBA 4PGDA 5BS0D 4QXVA 1T03L 2BS8A 1YJDC 4NKOA 1D5ZB 2VDRL 2WQSA 3QDGA 1CE6B 1CXFA 4JFHE 1FL6B 4TSAL 3WMSA 2I5YL 1J87A 1A7NL 3PGCB 2YQGA 5IJCC 3IDNB 1VSCA 4HXBL 4HULB 4HK0A 3R7QA 2PO6A 2IPUK 4UU9A 4XCNA 2EVHA 5LLIC 1BVKA 2QJDA 3IN0A 1E6OH 3DUUA 1X5KA 3GRWL 1CFVH 2C9QA 4DOHB 4EI6A 2WLMA 3WFHB 4ZFFA 1I8LA 3OLIA 3D39D 1M2VA 4AMKL 2EACA 3SBWC 4AZ8A 4PJBA 2YPLB 1RJYB 4KZEH 4TSBL 4U6YA 3SZ6A 1I8UA 1CGTA 5KYUA 2ARJB 4ZXBB 2WN3A 4QRTA 5KVFL 1XF3A 3WYRA 3EJCA 4B9YA 3ZU8A 1EAPA 4NN6B 2BNUA 1QEWA 5MP6L 4G6FD 1OPGL 3NT0A 3QNXB 4XVSH 3VFTB 4GMSL 1PDKA 3I74A 1T03H 5J57B 1HNGA 1N2RB 4YJZL 3EJUA 4XMWA 2HLEB 3EH2A 3RL1B 4TSAH 2I5YH 4PBDA 4PJXF 4JO5A 1ID5I 1A7NH 4I1NB 3IRPX 1NBZB 4TL5A 4HXBH 4TTDD 4MVBC 1BIIB 4L8DA 3IETB 4N90