4ZMLA

Crystal structure of human p-cadherin (ss-dimer)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
b'DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmlA01
2A4CA 5JYMA 4ZMQA 4ZMXA 3K6FA 4APXB 4ZT1A 1NCIA 2OMVB 4AQAA 4ZMNA 3K6DA 4ZMYA 5DZVA 2V37A 5CZRA 3LNDA 4AXWB 4ZMOA 3K6IA 1ZXKA 1ZVNA 4ZMTA 2YSTA 2OMYB 4NQQA 3Q2NA 3UBHA 3UBGA 3MVSA 4AQAB 3FF7A 2OMZB 2WD0A 3LNEA 1NCHA 2X2UA 4XXWC 5JYLA 4AQ8C 1SUHA 2WBXA 3K5RA 4OY9A 4ZTEA 1NCJA 3Q2LA 2QVIA 5KJ4A 4AQEA 4ZI8A 1FF5A 3LNGA 3FF8A 5CO1A 2A4EA 4ZMLA 3K5SA 4QD2E 4NUMA 3QRBA 1L3WA 4XXWA 4AQ8A 3LNFA 3Q2WA 4AQEB 1NCGA 3Q2VA 4ZMWA 2O72A 1EDHA 1WUZA 4NUPA 4NUQA 1Q1PA 2OMUB 2OMXB 2WCPA 2OMTB 4ZMZA 1O6SB 4APXA 2YQGA 1WYJA 4ZMPA 4AK1A 3UBFA 3PPEA 2WHVA 3LNHA 2EE0A 4ZMVA 4AXWA 2QVFB 3LNIA 1OP4A 2OMWB
chains in the Genus database with same CATH superfamily
5T3ZD 1LO4L 4JRYB 3ESOA 5DD0L 3D2TA 4KV5F 1QA9B 2RCSH 1YNLL 2IBZY 3IAPA 3EXLA 1ZLWK 1CZ8H 3PP4L 4FNQA 4LVOC 1LQSR 3BKML 3KJ4B 1R0AL 5DLML 4QYOA 2H1XA 5LNEA 3RNQB 3BE1H 1I1CA 1FC2D 5KVFH 4IK7A 1E5CA 1ZGLA 3B7YA 3UO8B 1KXVC 5A43C 3VG0H 1L9TA 4Q0XL 2Z6FA 4DEWA 4NPKA 2R1XA 2AK4B 5DZJA 4XP4L 2WO3B 5HJ3B 3VWKA 3ULVC 4KGLA 4AQ1B 1BQUA 3NCYS 5BXFB 4HAFA 4AVIA 4NENA 2CA3A 2H9GA 4JFWA 3LDBC 1A4AA 4U4BA 1KZQA 3M7OA 5KUKA 1XL6A 4F57L 2AXFB 2VIRB 5EN2A 3NJJA 4ZUTA 2FQDA 2UZYA 3BXNB 1F4HA 1NGQH 2XWTB 4DP7X 5ITBH 1X5GA 1M7DA 1XIWA 2E46A 2XX0A 4HUXB 3KJ6L 1WP6A 2ZOLB 1H9VA 4QHNA 2A0LD 3Q06A 2IAMD 3ECBA 1PLCA 4A6YB 4PMEA 5B7FA 4U1SB 5HYFA 4D7BA 3BUYB 3ZIYA 1HCFX 3QI9C 3L3JA 1NZRA 3NCYP 1TYJA 3IMSA 1PCXA 4L4VD 5BUGA 3GSOB 3VXNA 1NBZA 1K3IA 1M57B 5F89B 4GG6B 2WWMD 4OM0L 5I2IA 1V55B 2YSSA 1PG7H 3ULVE 2FJSA 4LESA 5DQDL 2NX5A 3QDJD 5IUSA 3IFPA 3N42F 2ZSVB 4TKWA 4PN6A 3VQMA 5E1HB 1G7HB 1LWHA 3PXJA 1J9RA 5F7DA 4YHLL 1NPNA 3EG9B 1RIVL 1B88A 2A4ZA 1FO0L 1UWXK 1YEJH 2F74B 3BP5A 3Q2VA 5FYLD 4LPTA 3B3IB 5T3XE 1LO4H 5TH2B 2G9KA 4Q89A 1NFIA 3BVDB 1DJYA 2WMPB 4QHKJ 4XP9L 1I8IB 2H32B 5D4HA 5DD0H 3TC9A 3VXMA 5K1NA 1RHHB 5K9QG 1YNLH 4H0IA 5KWYC 4GNKB 4MNQB 5A2FA 1E8ZA 3ZKMC 1XCWA 3PP4H 5JIHA 4NO3B 1R0AH 5DLMH 1UATA 2GITB 3QWQB 5IBUG 5TJWK 5J6GA 4IGBA 4MJ5B 3QUYA 3NH7L 3GEFA 4E9TA 4P07A 1O7SA 2ODHA 2VN6A 4Q0XH 2BNQB 4E68A 3PGCB 2X0VA 2OSXA 4XP4H 1YEGL 1V3KA 1HZHL 2CBQA 3T2LA 3UTQA 1IQWL 2QSVA 2XVGA 4G70B 2M26A 2JI3A 4KJQC 2VISB 1MNNA 3NA4A 3D52A 3CFKB 3RRQA 3QQDB 3DK0A 4JM4L 2AVGA 1DANT 4N1CA 2VLRE 3FH7A 3LRSB 3FUJA 5B38A 4JVPA 3LB6D 2DWSA 5H94B 3RBSA 3VXRB 4ZFZA 3KGUA 2YXWA 2P42B 1W9XA 1J8SA 4M8QA 3TF4A 4HV8A 5CJ8A 3GXUB 4F7EA 2CDGB 1KWKA 3CSGA 4OZGB 1QLRA 4OTXL 5AYTA 4EJ1C 4OM0H 5CLZA 5JIMA 3TS8A 2CNZA 2W0LA 5E7BA 5DQDH 3JWDC 4BKSC 3IFLL 5HJDA 5TE7L 2KZWA 3UOAB 4AL8L 4OCYL 1AP2A 3W0WA 3SDAB 4NT6B 3QXAB 1MLBA 3RWCB 3WI9A 1OOAA 5I8CB 3NG5A 4PCTA 2XN9A 3I9IA 2PWGA 4MD4B 4YHLH 1N6VA 1RIVH 2WSPA 4HD5A 1FO0H 1DJGA 1SUHA 4HPYH 3WLWC 4EN3C 2JIXB 2OFQA 2OXHB 2I9LB 4XP9H 1D6VL 2BY1A 4G9FD 2VMCA 3C8KB 5E7FA 1CGYA 4R0LA 4ZPTA 1PZSA 2EKSB 4X6FB 2ADIB 3MRNA 3ULUF 2VE6A 2ZG1A 3TIDA 2ZXEB 3CFIC 3HG2A 4QDGA 1OP3K 4LO9A 3LV3B 3NH7H 2KZBA 2OV0A 5C8JB 3VFVB 1HTYA 1Q4NX 1XO8A 3ARFA 4F8NA 4HDIB 3V5DB 3FB7B 3L7FB 4H0HB 3V0FA 4N90E 4NQSA 3WCYA 1E2VA 1LMKA 1Z5YD 1VGKB 1U0QA 2GYSA 2WXGA 2V3DA 2OW6A 2D3LA 1Z9NA 4G6AD 4N2CA 5DC4B 4A04A 2OL3B 5DVMA 5IJCC 2C9AA 1AE6L 1HZHH 1OALA 1XGQA 1IQWH 3EYFB 4DK3A 5JIQA 5L4FA 3MYJA 1DZ0A 1OB0A 2IBZX 2X6CA 4JM4H 3MRIB 4E36A 2WBJA 1O6TA 1X5FA 4H40A 1Z7JA 3H3BC 4I89A 1ZLSL 5IMOB 3ZO0A 4HIPA 4DVBA 5I1LB 1JYWA 5MEQB 1QFOA 1FH5L 1XQ4A 1RJLA 1H3PL 4E5XG 3G6AB 4FXGC 5JDJA 3QIUD 3L9RA 3PHAA 3BGMA 3OR6A 3D3VA 1D5BA 3NIGF 3M17B 3AMKA 3FTZA 2QKIB 4GP4B 4OTXH 4ZW6A 1NAML 5KVGE 5J4MA 4GUOA 2VRAA 1NEZG 1RZJH 3VRIA 4NYLB 1SPDA 3G7TA 2FCBA 3FOLB 4WEBL 5AENA 1X4XA 3D0VA 1MCWM 4KJYB 3ZHLA 2F5BL 1ZEAL 2QZQA 2D7NA 2ZZUT 3IFLH 5TE7H 2BS71 4GAYB 4AL8H 3H9SE 2OJZL 4JFFB 4NDMB 4OCYH 2WXIA 3ZU8A 1L9NA 4K8RC 2IAAC 1NANH 4M62L 1HCYA 1DVYA 1ZGLP 1FI8C 4LPXA 3WJLC 2J55A 3SPVB 3TH2T 3MCYA 2P47B 4YX2L 1G94A 5DK3A 4YMPA 2E0PA 2HLAA 4ZSOB 5G5DA 1YC8A 3IDMB 1D6VH 1LNUB 5F93C 2I25N 3ZDZF 4UI2A 3KMDA 3ILQD 1XF3A 1KACB 1S8DA 5HGDA 2FWLB 5BMFL 3VGEA 3WO4C 4UOW0 4ZDHA 2BIIA 4Z77A 1SVCP 4FP8L 1ZHBA 2BSRA 3IYLW 3LPOA 1R5IB 4D94A 1LEIA 4PS3A 2JJTC 3O3DA 1J9TA 3RL1A 5MEOA 3G6JA 1R3JA 2NSQA 3DX2A 3PWVB 1AE6H 3PPSA 3M1OA 1FO0A 2WXLA 1N2RA 2NXZC 3DI2B 4DVRH 4L8DA 2E9BA 4JG9A 4LMQI 4U1HA 3LZPA 5IVOA 1KGYE 5JMRA 1OPOA 2VN3A 3QDAA 4U1LA 3MNWB 4IHOB 4M48L 3DV4B 3E6HA 1Z1WA 3N06B 2BVYA 4J4PD 5FO7A 3QJOA 3QZLA 4UZSA 4OZIB 4XWOD 5HI4C 1M3JA 5EZJB 5D7IB 1P9MC 3TM6A 5GRXG 1BZ7B 2JELH 2O61B 1FH5H 3LEXB 2FO1A 2CHXA 1H3PH 4G71B 5AYQA 4FMKA 4M1GL 1CF8L 4PGDA 2G0KA 5AUMB 4CC4A 4Z7OE 7PCYA 3FT2A 1ZK5A 2UY6A 2EECA 3SZKC 4EDXB 1KN2L 5C08E 1U3HD 4ACPA 5IJBC 1NAMH 2PW1A 2IVFC 4Y88A 1YN7B 3UGUA 4WEBH 4S11A 2F5BH 1EFXB 1HOCA 3KYKL 4DKAA 4D8OA 3WY3A 3F7LA 1DHKA 4E41D 5GS1B 2ROXA 4ZUWB 1T0OA 5JLZA 2BJML 1DE4B 4QHUB 1F8TL 4XOCA 3QRFM 4PJEB 2DWDB 5KBPA 5JXEA 5B7EA 2WXJA 1VACB 1WZLA 3EF7A 3KBEA 3MRGA 2CALA 3TO4C 4H8WC 4AZUA 5A16A 5E24E 2YO3A 1TOXA 4N2GA 3DPBA 1JCVA 4N2OA 1CBVL 1TO5A 4KU1A 5FGCE 5BMFH 1HYRC 3AY2A 1NC4A 3E6FA 1PLGL 4FP8H 2VABA 4N5UA 1B3JA 1ULVA 2UWEE 5CN2A 3U0PB 3ZKNC 1ZHLB 5F1IB 1S7SB 4PJCA 4Q2ZA 4A1RA 1S3KL 2H8PB 1GL4B 2Z93B 3DA0A 1JWSA 4QXVA 4F33B 3K6SB 4IRSC 4LPCA 5DK0B 2EKJA 3VXPB 4AI7A 4H13C 4FG2A 2D9QB 3RVTD 3CFCL 4ZFFA 3FU7B 5C3IA 2L7QA 1YEDB 4ONGL 3L6FA 5CHNB 1QI4A 4ZXBD 3U30C 1U8JA 2DWTA 2F68X 5HYJA 3BISA 4FTVB 4M48H 4PBVC 3PY9A 3ZMNA 2V37A 5JZ7C 3EOAA 3LNDA 3KCPB 4YVNA 3PQYA 2NR6A 3OKDA 1G7PA 3NRQA 2E59A 1AGCA 4A2GA 2NZ9C 4PI0A 4HQQL 2WZPA 1KGWA 2WGXA 4KDTA 2V7NB 1CF8H 3L5WA 1W72B 4TUJA 2X44D 4KKCC 1KN2H 5INCA 3HZVA 3U9UB 1KELL 4KJPD 1S7WA 3HMWL 3ARPA 3KYKH 3QA3B 1HJBC 2KZKA 3ZHNA 2XTJB 1BVNP 2WWNA 4IJ3C 1HI6A 1LGVA 1QD0A 2AI0L 2BJMH 5C6WH 2UY7A 1F8TH 4PGJA 1NCJA 1LTXA 2FSDA 3HMXL 3TVMD 3MRCA 1E27B 5D5MF 4AVKA 3TN0D 3A67L 3NCBB 4Y9FA 1CBVH 3UGEA 3UZVB 1YQVL 4FKKA 4PJ6A 3GM8A 2ID5A 1NAMA 5F0PB 5L2KD 4X0KA 3MYZA 2Q76B 2OMUA 1U95B 2R2EA 1PLGH 4XOAA 2QADD 4UAOB 2Q8AL 1FYTA 4Z3FA 1AGFB 1S3KH 2YOAA 1F4XH 4FHJA 3Q3GA 4JJHA 4M5YL 2Q87A 3CFCH 1QSEB 1QZNA 5EF2A 2Z7ZA 4ONGH 3QNXA 1VZHA 3O3UN 3UC0L 4JRXA 1IVTA 3BC9A 5DS8A 2HFEB 4LHUG 3ZE1E 4JPWH 5FAAA 1KGUA 1VHPA 2PWDA 2ICEA 4F80A 1I1AD 2W95A 3B3BA 4NKOB 1DN0A 5E2UL 3T1FB 4BZ2L 1TMQA 3TIEA 3LTVA 1FUNA 3EGXB 2PPAA 1E4HA 4K3JL 2E8ZA 1PKQA 1XXDC 3II3A 4J28A 4Y4FD 4ADIA 2FWSA 2X0UA 3VWJD 2FLBT 4QRQA 2K6WA 5I23A 1KELH 1OK8A 3BN3B 1T1YA 2C5DC 3FXIC 3HMWH 3INUL 1B9ZA 1EJ6A 3QORD 1AD9B 3NN8A 2WYZA 4R96A 5ERWA 5K9KB 4IBVA 4WKXA 4F7MA 3A3YB 1OTSD 3H7BA 3R0MA 4JDZB 3VD5A 1FZKA 5C0AA 1AZRA 1GSKA 1CYWA 2VW4A 4K7FA 3HMXH 4PVBA 3H9HB 3RWHB 2CUMA 4Y9EA 3DDGA 4M3HA 5AB1A 3A67H 2ZP0T 3K7UA 1QW8A 3NCMA 4XNZC 2UZXB 1YQVH 3HW7A 5LNDA 4E5XA 4P23A 4U4IA 1I3GL 1SY6L 3IFNL 5JHLL 4YBQD 2MKLC 4FYRA 1FFOA 3K2IA 1LP9E 3QEQE 3OGCB 1OE2A 2Q8AH 2V2XB 4N85A 4TQEL 3REWA 1NEZA 3MRKB 1LP9F 4YHYB 4X6BB 4GT0A 2IGTA 4NQDD 2JV6A 3WN5B 4HUWA 1QQDA 3F7VA 2QQLL 2WNXA 4HKBA 5JHDB 4M5YH 3D69A 3ARUA 4UQ2A 2BMKB 3FTGB 3D85D 1H6FA 3UC0H 1T2QL 2ISDA 1MCWW 4RGMB 1CDJA 1QFWI 3DIDA 3DMMA 1G1YA 4PAZA 3B9KA 4YDMA 3TZVA 3D0AA 4P3CL 3AXLB 4BZ2H 3KLHC 2K7PA 4H0LC 4NAJA 1Q9WB 3PDGA 3Q05A 1AXIB 4I5BB 4K3JH 5ILTL 3FFCB 1V7NL 4C83A 1MVFA 3F7YB 4TUUA 1MJJB 3L2NA 5IEKB 2M1KA 1QFHA 3ARBC 1A6AA 1UOKA 1EDHA 3INUH 2HCZX 5AB2A 1BQHB 4JFYB 5I66A 1BPVA 4KRLB 5FOBB 3PJNA 3AAZA 4JVUA 5D1ZC 4GXUM 4H88L 4UU9A 4G11A 4EI0A 3O2VL 1OB1A 2HWZL 4KK9C 2DWEB 3CVCA 3RL2B 4K55A 3WHXB 3G5ZB 4FNTA 2XWXA 4OH2A 4PD4J 4WI7A 3KWUA 4U6VL 3BPCB 3WNLA 4CVUA 2VR3A 3T6XA 2X4NA 4NOBA 2X4QB 3SPJA 3NSDA 2PXYC 2CLRB 4KZEL 3OSVA 3VFSB 1DFBL 3RZCA 3IFNH 1SY6H 1ZLEA 5I1EL 5JHLH 2A73A 4MJJA 4Q9RL 3HHSB 2RA1A 5E94A 4BD4A 4WUUA 4PJ9C 2DW5A 4TQEH 3AG4B 2YARA 1OW0A 5EU4B 4QO1A 2D9CA 5EU7E 4M6ML 1JHTB 3NEXA 2QQLH 4GO9A 4F2MB 3S9DB 4QRPB 4AENA 4JCMA 2AQNA 4LLYB 3D39D 3HMXA 1AZNA 2DYPD 2CJUL 4XCYB 1KENL 1T2QH 2L8AA 4QT5B 2ICWB 1OM9A 1Z5LB 2HFGL 4HU2A 3NZUA 3QR1A 4OSUL 1NCBL 4G8GE 4OVUA 4DKFL 5DMJB 4WLCA 5GGSA 2WN2A 4P3CH 2YSTA 3V4UL 5L6YL 3RI5F 3A24A 5T1LB 3C9NA 4TL5A 4J3BA 4YK4B 5EOCJ 3SKOB 4JFPA 4JO2L 1PGRB 1V7NH 4PWGA 3W39A 4HS6A 2PN5A 4JZOA 4F37F 3A6CL 3LH2L 3W9DB 3MV9E 4L1BA 4G80B 1UCBL 5J9PA 4YZFF 5A1AA 3X12B 5LN4A 4BFNA 2DRUA 4HSCX 4NUJA 1EFXD 4H88H 3QQ4A 1X5JA 3O2VH 1K8DB 4GH7B 5DRWB 2GABA 2HWZH 1I9EA 5C0BE 2N4IA 3ZX1A 5KTEL 1CICB 2V5YA 5CCGE 2ICES 4BZ2A 1T66D 3LNGA 5EC1A 1LXMA 4U6VH 1FAIL 1KTCA 4PJ5D 4M8VA 4P2QB 2IANE 2B1HL 2ITCA 3V6ZB 4OFVA 5I19L 4BKTC 4FQHA 3FOMA 4KMTL 1N3NA 4NNXA 4U6HA 1ZT7B 4NBXB 5EU6A 3KHOA 3AU1B 4K3DL 5C0GA 4B53A 4KZEH 2XKUA 2DQIL 5MHSE 1DFBH 5IVXB 4JPVH 4B0MB 3AJ7A 3ASNB 5I1EH 5J06A 2X53A 4Q9RH 1MFVA 4TYUA 5ISZA 1J7VR 1SHWA 2WLIB 2EIBA 4W6XB 1UZ8A 3RDTA 1L7IH 3RY4A 5DJZB 3D09A 3BGFC 1IQDB 3AITA 1M05B 3V6OC 1D7FA 5HYSG 4TUKL 5KYXA 4FD0A 1IL1A 3LRMA 2WVUA 4UYPA 4M6MH 2IV8A 4LCUA 3ARGC 2Y5TB 1TJIL 3FCBA 3ARYA 4K5OA 4O2CA 2Y1AA 2VAAA 4GOSA 3JZ7A 2CJUH 3ZUCA 4ENED 1CC3A 5F97E 4Z7WE 1KENH 3QWOB 3AS1A 2HFGH 1KB3A 3F5WB 4OSUH 1NCBH 3T0VA 4DKFH 1NQBA 1SY6A 5JHLA 2CCWA 3FB6A 5CMAA 2WGNB 1CFTA 5AZ2H 3V4UH 3B2UD 2NTSP 1BMZA 3IDNB 2G2PA 3HRZA 4OM1L 2K8QA 1YPZA 4JO2H 4HZAA 3HLAB 1FG2A 4KPHL 1IKFL 3V6OE 3A6CH 2VUKA 3BH9B 1L9PA 3PE9A 3LH2H 4XNDA 1HHKB 4TNVF 4M7JL 4KBPA 2F7PA 1NEUA 5DCCA 1UCBH 1PZ5B 2F15A 5FYKL 4S0HA 2FVNA 3DTDA 2P5ED 3UPRB 3T4AB 4HJIA 5FFGA 4ZMNA 3VYNA 4J2XA 1IUZA 3QYMA 4Z76B 2CO6A 5DQJA 2KH2B 4O00A 4PB0L 1VDGA 1VZGA 5EMYA 3VFNB 4F2EA 4HEMA 5KTEH 1ZXKA 4LHUA 4F9PA 3A22A 4EI5B 3GO1L 1FAIH 2IV9A 1Z6JT 4HX1B 2P46B 1XF4A 2VDOB 2B1HH 5I19H 1BVKA 4W81A 4KMTH 5E0QA 4K5MA 1EXGA 2A6KA 4K3DH 3KPTA 2B15A 3S3PA 5IWLA 2DQIH 1CTOA 2HTKD 3HFML 3AADB 4MTMA 4YC2B 3D2UB 2YJLA 4QI3A 3WNJA 1OCCB 4X9FA 1QKZL 4W9LC 5HDLA 4RSVA 4WNSA 3TNNA 3ENEA 1FL5B 4TUKH 1JL8A 2ZICA 3DJ9A 1IGMH 5TGBA 2QLYA 4OGZA 1TJIH 1ZLVK 2ORBH 4CSTA 5F0LB 3ZTNL 4OIIL 1IIIA 1ES0B 3RNKB 3JXAA 2P5WD 5AVVB 2QMJA 3FU5A 3QO1B 3AZUA 2V2WB 3PAYA 2VDRB 5BQDA 1JGEA 4PJXB 1SDDB 3RPIA 3CHOA 2ZNWA 1KFGA 4X7DC 3VSTA 3TPUB 4RBPH 4Y5VA 1BJ1J 1TF4A 2Z35B 4AYID 1AD0B 4U1MA 4ECNA 4OM1H 5F1SA 1IM9B 1K8IB 1P1VA 4GI8A 1GCYA 1IKFH 1YMHA 2EZ0C 4KPHH 4ZPVA 2ZWZA 2J8UA 4I0PC 4JZJB 2WYIA 5FYKH 3RGVA 3WS3A 3EZ8A 1A9BB 3GYRA 4R3SA 1FNAA 5DHMC 2X1XR 1NDGA 4XNYL 3CMGA 3RLSA 3PWUA 3CC5A 4OAWB 3HPJA 4JN1H 4PB0H 4W1TA 1VADB 5IUCA 3ESNA 5E6ID 4EO5A 3VXOA 5DWPA 3MLTB 1FIGL 3GO1H 2YQGA 3DRQA 1HDMB 1U2YA 2VITA 1EK3A 2YD5A 3ROOB 3X11A 4ELDA 2DJ4A 2YQ3A 1JZ7A 1CFSA 4MVBD 1QR1A 1TUPA 3V0HA 3WFEL 3HFMH 1FORL 3DGGB 5CSZA 2PPEA 3BKJL 1PLAA 3DX8B 4Z78B 4DF9A 3C6SA 1QKZH 5MERB 5C70A 2W1NA 1BFTA 3O9WA 2W59A 4OZIF 2YA0A 5JOFB 5AVYB 2G9HA 3QR0A 1O9ZA 2Z4TA 3P73B 3HAEH 4YN3A 1C7TA 3ZTNH 3VMOA 1BQSA 1U4FA 4OIIH 2VZSA 1WFMA 1O9VA 5E8OA 4AGNA 3WFHA 5K1JA 1BZOA 5HPOA 1UG9A 5E4AA 1SVZA 2NNXA 3ZO9A 3BPOC 1KT2A 2DS4A 1SXAA 4MA1C 4QYOB 5E5MA 2G3NA 5FKPA 4JO8A 4ANVA 1ZGLB 1Q72L 4YDKL 4E9XA 1QFWL 5DYFA 5DMGC 5CEZD 2R1XB 4D2NA 3UG3A 2MTAA 3OKYA 4HJGA 3FMGL 3T2PA 3VWKB 3OQ3B 4NJAL 1NKGA 5I9QC 4F5CE 4Y8AA 5H37G 4NENB 5EUOB 2H9GB 1PD1A 2IPKA 1KEGL 1O9WA 4O2FA 5E4EC 4XNYH 4C56A 5C92A 3ESMA 4OBSA 2BVEA 1A47A 5EN2B 5I75C 4ZUTB 5CO1A 2UZYB 3GQFA 5DMIL 3EFFA 2XT1B 1XIWB 1M7DB 3L4TA 2EE6A 1FIGH 4QHNB 4KFMA 5F8QC 1NGWA 3SE3A 1KPRB 4ATTA 3ECBB 3NUKA 5D7JA 3X3FL 3TJHC 1IGYA 3SIKA 4HLJA 2GIYA 3L3JB 4P46C 3QWRD 3EYVA 2DH2A 2WQXA 1BREA 4X7TA 3WFEH 2IMMA 3UXFA 1FORH 3VXNB 1NBZB 5KSAD 3BKJH 1NFDA 1LILA 5I2IB 1E7VA 2YSSB 1WD9A 1QBBA 4UBDD 1UADC 4P4KC 3BAEL 4DFHA 4RZKA 2NX5B 1PG7X 3WDHA 3IFPB 3EIFA 4Q6YA 5LQBL 4IKJA 2B14A 2J1ZA 5A3ID 4JJ5A 5A6LA 3BP5B 4QRPD 4WY7L 4AGLA 5LGHL 5BS0E 1CQYA 1NFIB 4Q7DA 3F7RA 4AEEA 1G7MA 4XPFL 5HHOE 1GC1C 5EU3A 5KVDE 3RFZB 2A83A 4LRNL 5D93B 1MRDL 3V0JA 5J6GB 4YDLB 4BFRA 3C09B 4CADA 5IKCA 2CO4A 4YDKH 3BLBA 1QFWH 5DD5H 1ZTXE 4U1KB 2YK1L 1ZHNA 1HSAA 4MASA 4ORZC 4PJ8C 4NZRH 3BZFA 7PAZA 3FMGH 5HYSA 1CXIA 4NJAH 1EO5A 1R46A 2IADA 1ZY9A 4WO4D 3UTQB 2Z0BA 1ZJAA 3K6IA 4NAMA 2BIOA 4LLAA 4DZ8A 5EB9A 5IMMA 1KEGH 4XCFL 3VXUE 4MLIA 2EXTA 4GIPD 2CJ3A 5DMIH 2Z92A 1AQKL 4GKNB 4QAWA 2AQSA 3VD3A 1RCYA 2X4UA 3ESPA 5B38B 1CICD 3MBWA 5F44A 3PHSA 1NMBL 3C75A 3X3FH 4L2YA 2MCMA 3VXSD 4CA4A 1ESOA 3UAFA 2GB2A 4M8QB 5HY9A 4HV8B 4N8VG 2C9XA 4KY2A 4MCNA 2XZAL 3VVVA 4F7EB 3K0YA 3EF4A 2H26A 5AOIA 1QLRB 3AC0A 4FQQA 1J1XL 1XBDA 3BAEH 3HEIB 3Q2LA 5MEND 3Q9QA 4S1QL 1ORSA 1F4WL 1AP2B 2D2OA 2V3EA 3W0WB 2Q7AA 4RFEA 2C4FT 5GQBA 1WWAX 2IOOA 5AYUH 3E9TA 5L2JA 2I85A 4B7LA 2W80C 4L3EE 2XN9B 4YEFA 5LQBH 4P5SA 2H2SD 2YUZA 2P52A 4WY7H 3VI4A 5LGHH 3RURA 3DWTA 3WL9A 4XPFH 2P5PA 4HJSA 4Y0GA 4ZPTB 3QT2A 3MRNB 1KB5L 2VE6B 4OKVA 4LRNH 3TIDB 1MRDH 1FGNL 1SOQA 2KMWA 3NGBB 3ARFB 4IBWA 5BOZG 3PRZA 3CZFA 4NUQA 4NQSB 3U4AA 2YK1H 1XGPB 2F54A 3LIUA 1JSYA 4MBRA 3MACL 4JCWA 3ULAB 4RMWA 5JNYA 1YJDL 4HEPG 5DVPA 1WH0A 1XGQB 4GP5B 4XBMA 3BVWA 2A5UA 3ARDA 4RDBA 3GSQA 1AZCA 2G5BB 3MYJB 5KG9A 2EDFA 2R2CA 5H37H 4HC1L 5J7CC 2WBJB 1VSCA 1AQKH 1I8KA 3P69A 1HL9A 1WFUA 2XV3A 5TPWL 4F37K 1SXZA 4X4MA 1NMBH 4KI5C 5INDA 1MAJA 4IDLA 6PAZA 2GSIA 2P9RA 3TX4A 1RJLB 2CHNA 3CFTA 3US1A 4L8SC 5ACMA 4P4RA 1U2HA 1R6VA 2IDFA 2GJ6A 2NDGA 3FKUS 3L9RB 3BGMB 2DMKA 1RZQA 2XZAH 3OR6B 4JHZA 3D3VB 1D5BB 3HUJA 4JFSA 1SJHA 3KXFE 5E9NA 3V5KA 3SGJC 3BPNC 1J1XH 4Q8BA 3VRIB 3WXWL 1E40A 2BNRD 2FWOA 3VRJA 3D0VB 4LDCA 2ZOKA 2DICA 4ALAL 4S1QH 4YDIL 1BF2A 2YKKA 1F4WH 3GSNL 4XP1L 4HWUA 5T1KA 3CFDB 1P7QD 1AYRA 2IWEA 2HG5A 4Y1AA 4JFHD 1YMMD 1AJ7L 4FL4C 4OJAA 3M8OL 4ZAKC 1P4UA 3VCLA 1H6EA 4R5TA 1T89A 3CFUA 3OHXB 4KI5E 5G5DB 3SDCC 3ZQ9A 3TFBA 3QULB 1KB5H 1XF3B 3B7UX 3SHSA 2D4FA 2GEQA 2H2PC 3H3KA 5HGDB 1BMWA 1FGNH 4ZDHB 4Z77B 3ZT5A 3GBEA 1ZHBB 2BSRB 3ZMEA 4W9ZA 4RRPM 3NSFA 1KPVA 4XGZA 1JV2A 1LEIB 3FZUD 4H2CA 4L4TE 2HVJA 3O3DB 1SMAA 3MACH 3RL1B 4APQC 5MEOB 1FSKB 3G6JB 1R3JB 4OF0A 1FHGA 2OCFD 1Q8MA 1YJDH 4X9BA 1FO0B 1N2RB 3QYCA 5J1AA 2EDQA 1LO0L 1MI5A 4XCCH 2XG5A 2PCFB 4L8DB 4YJZL 3B6SA 3K5SA 3MREA 4U1HB 2JCCA 2OMXA 1TVHA 1VCAA 4HC1H 3E6HB 4FFWC 4KRPB 4P48A 5B8CC 5FO7B 5KS9A 5TPWH 4L8CA 3RBGA 1I85A 2GW5A 1CGVA 1U8NA 4G6ML 4QNPE 3RQ3A 2LLGA 2R1WA 5I26A 1XFPA 3B8YA 4PGDB 4QNPF 2P48B 2VLKA 3FT2B 2UY6B 4G9DB 3KPRE 2K4AA 4D7PA 1WJ3A 3DDFA 3DHPA 3C5ZD 2PW1B 3FS9A 4BGLA 3TA3D 3WXWH 3NCFB 3P2TA 4K07A 4GRWH 5GGSY 2GK0A 4J8QA 1HOCB 4ALAH 1PDKA 4YDIH 1NGYB 1QNZL 3HZKA 4MWFA 4NC2B 5H37A 1C08A 3GSNH 2KC0A 4XP1H 1ZA6A 1N12A 2VLJE 1CK0L 1S7XA 4PM1A 2WQSA 4R2GB 4KUCD 5JLZB 4FKHA 4FZ8L 3LKQA 4ZMPA 4WWNA 3W3BA 4PRHA 3AACA 4AK2A 5IV2A 3O8XD 3ZKQD 2OM5A 1Z9OA 1AJ7H 3M8OH 1UZ6E 3WHE0 2PCYA 3ISRA 3MRGB 1BIIA 4QY8A 5A16B 5TDPA 5HI3C 2AANA 1UZ6F 3DPBB 3QIWC 5HDQL 5JW4M 2FEEI 5BO1L 3IN2A 3D51A 4HAGA 3RWGA 3FO0L 1TTBA 3MV7A 3U4BL 2WINA 2BP3A 1NC4B 3E6FB 3LKNA 1HJCA 2VABB 5KYWA 2BVTA 2DL9A 4PJCB 4Q2ZB 1XL4A 3UZEC 4F7KA 3QDHA 1JWSB 4GQQA 5JPNC 4J3OG 4OLZL 1KGXA 2VDKL 3DV6A 4MZ2A 5MI0B 4DH2A 32C2B 4W70A 1LO0H 4ZFFB 5FA4A 4OF7A 4ODWA 4XNBA 3GMMA 2F8IA 3L6FB 3KPSA 2ZOUA 1U8JB 5I82A 4UINH 3N1FC 5HYJB 3K71A 1KB5A 4QRBA 3VE0A 3EOAB 4LFHG 3BP6B 4WJKB 1IB5A 4WFGE 3PQYB 4G6MH 4AY0A 3OKDB 4WTZG 2F18A 1HSBA 1G7PB 1MJ7L 1ZLWH 1N8ZA 1A21A 1AGCB 4PLKD 5IBUB 6TAAA 3IB4A 2NY4B 3L5WB 1EO8L 3APCA 4V1DA 1O7DC 4TUJB 4AMXA 1OGAA 4KOCA 3L4CA 1ML0A 3HZVB 4BFBD 2EXWC 4FCAA 1S7WB 3R06B 2BZCA 2VLLA 4U7SA 4ANUA 3H9YA 1RMFL 1QNZH 3EJPA 4HC1A 5K9OA 1HI6B 1WZKA 1DN2A 3QRBA 3ZHFA 5DA0B 4N8UA 4FZ8H 2UY7B 2BRRH 4KH2A 1IJ9A 1BQLL 3JWNG 3SJVD 4F8OA 1SVBA 1XF1A 1WCBA 4UQAA 2X10A 1SBBA 3MCG1 3MRCB 1K5NA 4GRMA 5GS0L 2M83A 4M5ZL 1TJMA 3VXMD 2EDOA 1P7KA 4AKOA 3WN6A 5BO1H 5JQ6L 5IW6A 1N64L 1NAMB 1QTSA 1TQTA 1O7DE 4F8TA 3UMNA 3FO0H 4WW2A 4X0KB 3M07A 2OMUB 4JG5A 4N8VA 5I1AA 3U4BH 1N5YL 4MAYA 4IGBD 2R2EB 3KL5A 5I73C 3QUYD 3BDYL 4P9ML 5FW6A 3SB3A 4BE5A 1FYTB 3GSNA 3LRKA 5B21A 2VDPL 3FCSA 1F86A 3RGHA 1PNCA 2ZJSL 1T5WA 3Q3GB 4LSSL 4OLZH 3DVGB 4U1IA 4KROD 1XX9C 5FWRA 3DHMA 3U0TA 4AKQA 3U82B 3IGAB 3QNXB 4GUPA 5A2KH 4JRXB 5DS8B 3BHBA 4PREA 1UWXH 4CC1A 3GJEA 2ICEB 1NIEA 2E56A 1LEKB 2IG2L 3UTTE 1E9OA 1DN0B 1E4XL 3TIEB 5ES4B 4YR6A 4JL1A 4HF5L 1MJUL 3RTLA 2JKRM 3PUUA 5KBNC 1HFUA 1PKQB 3RVUC 1EO8H 2D3NA 3S48A 1CO1A 2XWJA 4U6YA 1MNUL 3E80A 3SYPA 4ZNEA 1N18A 4L9DA 4FXKA 3HBZA 5IROA 1KMGA 3NZSA 4XNAA 3FN0L 4X7CC 1CFQA 2EVGA 2YXMA 1DJWA 4K4KA 3BQUC 4HEPA 2OULB 3STLA 1RMFH 3FFDA 3Q8EA 2GBVA 3NN8B 4NQEB 2EYRA 2F53D 4R96B 5ERWB 5AVQB 1C9SA 4EVNA 5C09A 4F7MB 4UQIM 2DWXA 1FZKB 1BQLH 1UEMA 2VRKA 35C8L 4P5TA 4PRAA 5C0AB 1HINL 4XNMA 4K7FB 4HJ0C 2YUXA 4LL1A 5GS0H 1WS7A 2WXKA 4OIAA 2V5MA 4M5ZH 4JW3A 5SX4I 4OGQC 5E6ZA 1HESA 1H5BC 2H7WA 3TBTA 5I0XA 2K9UA 3BZDA 3NFNA 3CWGA 5JQ6H 1N64H 2YAMA 4P23B 4E5XB 3PWNA 1JGLL 2JFCA 5E9DE 3FQXA 2MJWA 2QVIA 1N5YH 1FFOB 2CXGA 4UM9A 3BDYH 4FEMA 1HILA 3IJ7A 5CEXA 3REWB 1G7LA 2VDPH 4XMUA 1MQKL 2ZJSH 1OP5K 4HUWB 1QQDB 3F7VB 3NZ8A 1QSFE 4HKBB 3L5XH 4LSSH 3D69B 3EHBC 3NA9L 4UQ2B 1AI1L 3MA7A 1IRAY 3MKKA 3PIQA 2WIIA 3IMRA 2B3RA 1MG3C 4J3OH 5AG9A 1UXLA 4NFDA 3KYAA 2K6YA 3DMMB 4N87A 1Q94A 1T5XA 3QIBA 2IG2H 2PYFA 3B9KB 3TZVB 4HU8A 4ZYKA 3DHJA 3S2CA 4HIIA 4NN5C 4HIJA 4XP6L 1MJ8L 3EO0A 1MJUH 4HF5H 1VFUA 1IGJA 1BVLA 2XQ0A 4DEUA 1T03L 1JGDA 3HN3A 5JHMA 4XMKL 1DSYA 1OP3H 4C83B 3KEHA 3T0EA 4JFDE 1DVFD 3FUNA 1G7IA 3AW5A 1MNUH 4WI8A 3U7AA 1CFVH 3NQKA 3FN0H 4WEEA 1A6AB 1QZ1A 3V0WL 1I1YA 4B60A 2EDXA 4LCYA 3CN4A 4IIZA 3BUIA 4UU9B 3B2DC 1RZFL 4FZEL 1OB1B 2Z0UA 1BW8A 3CZLA 4PTTB 4LVHC 1TZAA 1EBPA 4M3JA 4FQLH 5I1CL 1H8OA 1HINH 3ZYOA 5D1QA 4AQOA 3T09A 5I0YA 2X4NB 2OZ4L 2YPLA 2PO6D 3HPLA 1RSYA 3CFBA 1XB6A 3RB7A 3JWNH 4P2OD 2G4GA 3VQLA 2FO4A 3RZCB 4Y2LA 1JGLH 1FCCA 5EUOF 2A73B 2XJKA 4XE0A 3L17A 4ZMOA 3WAJA 4JQVC 4WUUB 1MIML 2R39A 1IEBA 4X9IA 4QRFA 4HG4J 4QLRA 4QO1B 1BIHA 3S2AA 1MQKH 4NRZA 1T6BX 1MHHA 1NGPL 4W9CC 2FL5B 1ZT4A 3NA9H 5LDUA 4AENB 1AI1H 1U8CA 1MPAL 1GJIA 2AEPL 1ID5I 2C9QA 3MU3A 2YMTA 1JK9A 3GS0A 3MUGA 5T3ZE 1PJ9A 4XXDA 1OCWL 5F9OL 1MKFA 5GGSB 3QEUA 1H9DA 4KRPD 1IC0A 1XCXA 1QFUL 4XP6H 1MJ8H 2A0LC 2WP3O 3CXFA 4NFBA 4MMYA 2IAMC 2FX7L 4NRXA 5EIIA 1T03H 4JFPB 5GS2D 4XMKH 2EE2A 3W39B 4HS6B 4JZOB 4M5SA 2WLJA 1WA0X 2E4TA 1P1ZA 1FV1A 5J9PB 3PCYA 4NUMA 5FM4A 2ZF8A 3V0WH 2AEIT 2WWMC 1S9XA 1B6DA 3T5WA 4NUJB 3QDGD 4MD5A 5EFIA 4JFED 2HT4D 3QQ4B 3S3BB 1RZFH 4FZEH 1DO5A 3ISWA 4X6CE 4R2GD 5FR3A 5I1CH 4OCMC 5EF0A 1Y1DA 3LYRA 5EC1B 4X6CF 4C4UA 1MHEA 2OZ4H 5JXED 2GCYA 4QRAA 1JI1A 4FQHB 2CHDA 3WEOA 1ZLUK 3FOMB 4WTZA 1N3NB 4NNXB 4PSRA 4U6HB 5EU6B 5C0GB 1QUNA 2XV0A 1A6ZA 1JAEA 3LQAL 4CU8A 3OB0K 4L4VE 4Y2DA 1DLHA 4YPJA 3RDTB 5ISZB 2YXVA 1MIMH 2DM3A 3QPXL 1IL1B 1F6FB 1WYJA 4H8PA 4LCUB 4ODSL 1NGPH 4MDRA 3QZNA 4HPOL 3QDJE 4O2CB 1T1WB 3B9VA 4ONOA 2VAAB 1MPAH 5AAMC 1ZV2A 2X2HA 5DFAA 1GKOA 2AEPH 3BVNA 3S5LG 1EZVX 1B90A 5FYLE 4OIBA 5J56B 3MNVA 3L5HA 3MV01 1G5GA 4I2XA 3ZL4L 5EEWA 1OCWH 5F9OH 4CL7A 1G9NL 4ATWA 4V2CB 1NUDA 2IGFL 5BV7C 3FB6B 4JBSA 4Z18A 3QUXA 4NN6C 5BVJA 1ZPUA 1CFTB 1W0WA 5DZNA 1QFUH 5E1GA 5F6IB 3LB6C 4A2DA 4XWGL 1QRNE 2FX7H 3HRZB 1YPZB 1CDCA 5ECGA 4ZS7L 1FG2B 3HZYA 5BOJA 4P05A 1G9ML 2NY4D 3TLRA 4XXCA 4Y5XA 5LLIC 3I6GA 3EDFA 1BD2A 3A6OA 2KS0A 1AHWA 4W4OA 2YBRA 1UVQA 1LE9A 3IDUA 3FF7A 1JPEA 4DK5A 4JUSA 2CO6B 3NFPA 2Z31A 5DQJB 2VMDA 3PWPD 4UDTA 4LHUB 2KLTA 2Z34A 2EACA 2YD6A 3LPFA 4HK3N 3FT0A 1KDJA 1XF4B 3QC6X 1TTCA 4CKVX 3GZPA 1BVKB 3CU1A 3FDWA 2H0JA 2X6UA 3M1CA 1D5MA 4PRPA 2D8KA 3U25A 1XZ0A 1WWWX 3FF8A 4E9YA 4LCWA 1AR2A 4F8PA 2YPVL 1J8HE 3IU3A 3QPXH 2XBZA 4QWWD 3TNNB 5IHUL 2IH9A 5TGBB 4YBLB 4G6AC 4ODSH 1RZKC 4AQ8A 4HPOH 2WXHA 1TVDA 4KKAC 1Q90A 2EINB 4UAHA 4PG2A 2OZ4A 3VGFA 3BAXA 3JWOC 4JRXD 3UAJA 1JGEB 3RPIB 3ZDWA 5IB3A 1G9NH 3WFZA 1FNEA 2IGFH 2VR6A 4G7QB 4G9FE 5LB1A 4PJBA 1L6ZA 1URIA 5ITFA 1OSZA 4KWUA 3QGVA 2PNDA 4BZ1L 1PZ2A 1QFPA 4Y5VB 2YHGA 4PD4K 2OI9C 4U1MB 4XWGH 4BK8A 5HXMA 1U8OA 4XVTL 3ULVL 1KGCD 4KTYA 3VI3E 4ZS7H 1QP1A 3U6XA 1G9MH 1YMHB 1TYRA 2C1PA 3QIUC 4ZPVB 5CJXA 2J8UB 5J6HA 2BINA 5KSBA 3QUZA 1G1OA 1GS8A 3RGVB 1KV7A 4XP5L 3VGAC 3WS3B 3FRPG 3E2HB 4R3SB 2F1BA 3SGKA 4DK6A 5FB8A 1ET5A 4RCAA 1NDGB 2WWKO 1MFMA 5T3XL 4ELME 1HL5A 3CC5B 3PWUB 2E6QA 3GUFA 3HPJB 5C0FA 4EN2A 1KV3A 4GT7A 4ELMF 3DRQB 2VITB 4ZT1A 5FYJD 3X11B 4QRRA 2AJYL 2ADJA 2IH8A 3G6JF 3KM1A 1CFSB 3EBGA 3VFPA 1QR1B 5LBGA 1TZGL 3V52L 2WB7A 3ILQC 3CBRA 1F4AA 5CSZB 2YPVH 4P23D 3S6CA 3GFUA 3C6SB 2D0FA 4LGRB 4ZW8A 1X4YA 2BS8A 5D7LD 4NX0A 3O9WB 3UBXI 1SOKA 3WUWG 4NQCA 5IHUH 4Q9BA 1IV8A 2DOCA 2G9HB 2ADGA 4KXCA 2UVEA 3R19A 3QZOA 4LAJH 1K6QH 2H0FA 1CI3M 5I16A 1HHIA 5E8OB 3WFHB 1XHHA 2W91A 1K4CA 4D8PA 1KT2B 4IOSA 3C8HA 3WKML 1EHKB 5FKPB 4KX8A 5E5MB 2JLPA 3B9KD 1XD1A 3FT1A 4J4PC 1MRCL 4BZ1H 4XC3L 2AJUL 2A9DA 2BOLA 2HRPL 3CN3A 4WHTA 4XVTH 3ULVH 4EXPX 1AOZA 1HIML 4LCCC 1D6EA 2BXYA 3DX0A 3DO7A 4HJGB 5ENWA 2JJSA 2VW7A 4MDJA 1U3HC 3ILPB 4XP5H 1NUGA 3L95A 3NP3A 5SWQA 3CSPA 3L48A 1NCGA 2IPKB 1DQLL 3EJJX 4N8PA 4O2FB 4C56B 5T3XH 3MRPA 3V79C 4POYA 1NKOA 2DB8A 3CZEA 3EFFB 4ZQTA 3S8GB 5CLYA 2V9QA 2B59A 2X38A 3V0EA 5AW3B 3G04A 3KR3L 1NGWB 4JRLA 2NY3B 4PPTA 1L0PA 5D7JB 1NMCC 2AJYH 4TN9A 1IGYB 3GXNA 2O1AA 2IC2A 1GZHA 3SGEI 4RH4A 3NSCA 3EYVB 3FYIB 4URTB 1TZGH 4X7TB 3L5JA 1GYVA 3V52H 4N9GA 2E5EA 3E1F1 1NFDB 4LBAA 3Q8AA 4GAGL 1AOHA 3HJEA 2FRGP 4OIFA 5SX4H 4F93B 4OR1A 4M56A 5AFAA 6FABL 2X4PB 4O9HL 2YD2A 4L9LC 3TCXA 4JDVA 3HG4A 3FRUA 3QB7C 5DUBA 3O6FA 1KIQA 5AOJA 4U6TA 5AW8B 4E41E 4JJ5B 5F21B 1D3CA 3LZQA 4FNPA 3WJMA 1F1GA 4AQ1C 3BCDA 5LGKA 2WAQA 3VD7A 1G7MB 4K5NA 3X1NA 1ZSDA 4GQRA 5EU3B 3TEZA 1HHGA 4UZUA 4FADA 2YPVA 2IGLA 3QI9D 4MA8L 1AR1B 1F5WA 4CADB 1MRCH 2JWYA 4XC3H 4EKXA 5IKCB 1DJXA 2AJUH 5KVGL 4ISVA 2HRPH 2NOYA 1CL7I 5JIIA 3FUIA 3ULUD 2QDWA 5FO2A 4F91B 1EERB 1ZHNB 1HSAB 1LK3L 2BW4A 4BK5A 3BFOA 3WJJC 1LVEA 3BZFB 3ZR5A 1MW1A 1BAFL 5HYSB 3HAEB 1NM4A 4N0UA 3SE9L 5EDSA 4DPRA 5KZCD 3MUUA 3D18A 4XMLL 5IB1A 1A1OA 4KJPC 3ES6A 1DQLH 2X4TA 3BESR 4DZ8B 3EDJA 5IMMB 4D0BA 5GJSL 1W6WA 2DV6A 3P30L 1E0OB 3S5LA 2Z92B 2JKNA 2ZUQB 2X4UB 3MBWB 3OGOE 3KR3H 3ZKMD 4BZ1A 2WVSA 4RX4D 3AXHA 1KCRL 3TVMC 2HRHA 5HY9B 3NRPA 3EFOB 5JPMA 3F6LA 3TN0C 1EZSA 4RMBA 4KDVA 3U6XS 4AV4A 4DGWC 4FQQB 5KYYA 2J71A 4GAGH 4EBQL 3KL3A 1L3WA 4UQDA 4K8RL 1S7QA 2PTVA 4U33A 4NJ9L 3RDTD 1ORSB 2OKMA 1BPLB 2DZEA 6FABH 4O9HH 1I8LA 1YN6A 4V11A 3LZRA 5F7MC 3L9EA 4RFNC 5L2JB 3A5VA 5D2LB 5ID0B 4I18A 2X05A 3VI4B 3KPPA 4PV9B 4PR5A 5EH1A 5AD0A 3WL9B 5IG7A 3FU3A 1U36A 3T2QA 4HUVA 2CRZA 3ATEA 3L4XA 4OKVB 1FFNA 1WFIA 4MA8H 2L7JA 1I1AC 3QCVL 5C0RL 4XNUL 1JFQL 1JF5A 5B39G 1SLUA 1XSOA 5L2KE 5KVGH 2DLIA 3ZE2E 3CZFB 4AMWA 3T65A 1QACA 2QQKL 2R0KL 2F54B 4BKLA 1LK3H 1KC5L 3UJIL 2R29L 3EOTL 3QS2A 5JNYB 3JQOB 1U9KA 1BAFH 1U92A 4Y4FC 3SE9H 2VLRA 1UB6A 3KS0J 4XMLH 1M42A 3ARDB 1E28A 3EJZD 4DTGL 3GSQB 4ZMQA 5BRZB 1QBAA 3ALXA 4EDWL 1S9WB 5KG9B 5GJSH 3H3PL 3IXTA 3WLWD 1QEWA 2F6AA 3FFOA 3QORC 4HWBL 3P30H 1B2YA 3QJVB 1I8KB 5J3HD 1PW3A 4HFWA 1J5CA 1P53A 1OTSC 4KC3B 4AVHA 4ZS6C 2X4OA 1PF3A 2ZKMX 2QPUA 2FBJL 4K7PL 5E2JA 5INDB 1PX4A 3NJXA 4HJEA 1KCRH 4P4RB 1WAPA 4AYFA 2B1OA 1W80A 1N67A 1SF5A 2GJ6B 4JPIA 1NA8A 1KG0A 4PJ7E 3HUJB 4R7DA 1SJHB 3V5KB 2B77A 2FNBA 2CK0H 4EBQH 3SD2A 1GYWA 2FWOB 1QLFA 4K8RH 4O51A 4YBQC 5D96B 4NJ9H 3VRJB 2ZOKB 3LNEA 4Y2NA 4FQXD 3AG3B 3LD8B 3QZWB 3FRPA 3UBXG 2UV3A 5T1KB 2IDSA 4BSVA 2HG5B 3X3GL 4ACTA 3BD3A 4JY4A 1J8RA 3MRHA 3SCMA 3VCLB 5CP7A 4AX3A 3QUGA 3E8VA 4YHPA 2YIHA 2ESVD 4BQ6A 4DEPC 3Q13A 2VZTA 3HVDA 4S2SA 3O4LD 2QEJA 4WFHD 3QXVA 3QCVH 3FQTA 4XNUH 5E6UB 1JFQH 3F7QA 5C0RH 1U33A 2DJUA 3MUHL 1ZRUA 5CIPH 1SGKA 4FHBD 4JPQA 2PR4L 4F3FA 1KPVB 4XGZB 1JV2B 3EH2A 3H7LA 2QQKH 4J39A 2HVJB 2R0KH 2FLMA 1KC5H 3UJIH 4BSWA 2R29H 4EN3A 4BSJA 2BSED 3EOTH 2F8VA 2UXVA 5A7BA 4MZ3A 3WUWA 3A4EA 3DX1A 1FIEA 2ZAHA 4NQDE 4RA0C 5J1AB 1MI5B 1AZZC 2XG5B 3AQXA 2VXUL 4DTGH 2DBLL 3AB0B 3B6SB 3MREB 4EDWH 2J1KA 3HC0A 2JCCB 2OMXB 1TVHB 3QFGA 3H3PH 4I85A 4OJCA 4UB0L 4XTRD 2X7LA 5EBWA 4HWBH 3TH4T 4JHVA 4ZX3A 5KS9B 1T2JA 1GZQA 1SOXA 4L8CB 4FQCL 1U8NB 2EE9A 4CVZB 4K7PH 2FBJH 5DF0A 1OAQL 5EHFA 1CI5A 1T7ZA 3RVXD 3D30A 3GD1C 3JTSA 1M9SA 2VLKB 5HVGB 3H9SA 4R83A 4H5SA 5IVNA 2AXGA 3ARVA 1WBYA 2PF6A 4W6YB 3E1ZA 3M86A 2GK0B 2WAHA 1GOGA 1PDKB 5CJOL 1YUKB 4HW6A 3ZJAA 3HZKB 4MWFB 1C08B 1R47A 4Z0BL 1ZA6B 2Q2LA 4I9XA 1S7XB 2DKMA 2FBOJ 4B9YA 2Q86A 4WV1A 4OLXL 3L08A 3IAGC 1BWWA 3PJLA 2QELA 3LXBA 3BIBX 4PRHB 5IV2B 1SLVA 3X3GH 4WWOA 2DLTA 2VXTL 4MCZA 3ARED 1UFUA 1ASOA 1NUFA 2C34A 2DWYA 1BIIB 5HI4D 4QY8B 1AO7E 2DIAA 2OR7A 5TDPB 3ETBF 4CN6A 4FLHA 5I8KL 1R3LA 2O6EA 3RWGB 5DUJA 3MV7B 2I7OA 2WINB 1OF2A 4IU2B 1V7ML 1I4FA 1KXTA 3LKNB 3SDDA 5KYWB 3D1MC 1HHHA 4WFFD 4BH7A 1MF2L 5ADPL 1JXFA 3MLYL 5IHZA 2WXMA 4DPBX 2Y6TE 3DV6B 1LYQA 3FAWA 5I5IA 2JJVA 4PTUA 5FA4B 2VXUH 4ODWB 3GMMB 2DBLH 3HZ3A 3D39E 3KPSB 3OWEA 2Y7MA 3K71B 1KB5B 4C56D 3VE0B 2PWHA 5T5NG 4ZUVB 3KWVA 2MHAA 3BN9D 2FHFA 4FQCH 4TSAL 1UD6A 5CIPA 5C08A 1T66C 1OAQH 1HSBB 2A74A 4G43A 4NWTL 1GGTA 1N8ZB 2KLSA 3ZDYF 1K85A 1J1PL 1TQSA 4OD1L 4BHUI 2WZ6A 1KJVB 2PTUA 2R29A 5D7IE 4V1DB 2MOVA 3ZKND 2A6DB 1OGAB 3NESA 4MCMA 5TQ0L 1D9KA 5CFAA 4Z7UB 1F1DA 3HI1A 2BC4A 1EX0A 1QUPA 2GTZA 3MOAL 1MW0A 2VLLB 3J27A 5A40E 3ECUA 5CJOH 1FA4A 1WBXA 5E8PA 2AAVA 2P24A 4PS8A 1IIKA 1BGXL 4HWBA 3VDAA 4Z0BH 5K9OB 1BBDL 3P2DA 3P4NA 1QWUA 4GXUN 3KDPB 4OLXH 2W0FA 5LXGL 2ARJA 1KB9J 2UXGA 3BYYA 3NEOA 1YPZF 5GRVK 5LNGA 1WCBB 2VXTH 2ZUWA 2Y22A 4GJTB 2YAOA 4GRMB 5I71B 1K5NB 4ENEC 1M3IA 3V2AR 3VGDA 2YFNA 4H25A 2UWEA 3SOBL 4OI9A 1P7KB 1UASA 2EABA 4PJ5E 5I8KH 1C8PA 1NDTA 1AS8A 3TOPA 2O5NA 2R2HA 3HBGA 1WF5A 2NPLX 4WW2B 4YDVA 4N8VB 2C4XA 4MAYB 1V7MH 4GRWB 8FABA 2W94A 2ZYHA 2WSDA 3B2UC 1BYNA 4IS6A 3GSNB 3WTUA 3FCSB 5ADPH 1T5WB 3MLYH 3TO4A 2VMFA 4EQ3A 4U1IB 2VN4A 1Z32X 3OF6A 5E2VL 3HC4L 2DQDL 3U0TB 4AC4A 1F00I 4GUPB 4X5PA 1IM3A 2ZYIA 4KZDL 2ED7A 3BHBB 3I6SA 1HAWA 2RBLA 4H8HA 4H7VA 4PREB 1AKPA 3GJEB 1YA5A 2XTJC 1TKWA 1U8LA 1E9OB 4ZX4A 5I74B 4TSAH 5CCKH 3TEUA 4LLWA 1NCAL 4YR6B 4NWTH 4EEEA 2B39A 4JREB 5HJGA 4PWKA 1J1PH 2BH0A 3N41F 4KK5C 3QXDA 3P11L 2CCLA 5B39A 2XWJB 4U6YB 5C3LD 1MREL 4ODBD 5TQ0H 3AWGA 4FXKB 4X5RA 4ZW3A 2HTKC 3H2QA 1P5UC 1R3KA 3U9WA 1CFQB 3MOAH 3SGEH 1BAWA 3STLB 3KLQA 1LM8V 3FFDB 2EYRB 1BGXH 1JMZA 4YXHL 2CQVA 2R0LH 2ZX7A 2P5EE 1BBDH 3IPBA 1KGIA 5C09B 4EVNB 2NT1A 2XZCL 1NJ9A 3H85A 3JT0A 5LXGH 2KERA 2C9SA 1HE8A 4PRAB 5BZWA 3WO3B 4P5TB 3VACA 4XNMB 1I9JL 3CAFA 1JF6A 2FR4A 4PW3A 1VLXA 4PJFF 1S4IA 3OKLA 3VH8G 2L3BA 3MRLA 2J8UF 3SOBH 3WY2A 2NNRA 3MTXA 5ESVA 3TBTB 3PWJB 3NFNB 3PWNB 3FQXB 4AE1A 2QSQA 1V5JA 4ZW7A 4XC1L 2GY7B 2WY3B 4UM9B 1J48A 4FS0A 1E7UA 1HILB 3OZKA 3CFEA 5ACZA 5CEXB 5GJTL 1O6SA 1WGVA 5F2FA 5KANI 1G7LB 4M5TA 2FQFA 1IBYA 3NZ8B 1E8WA 3JV6A 3UBXA 3MA7B 3PIQB 1L9QA 1CL7H 4HAKA 5E2VH 5LO7A 3HC4H 3U9PL 2DQDH 2WIIB 4FFVD 4KTGA 1SBSL 1TITA 1F45A 2HVKA 3IDXL 4KZDH 2R7EA 3D6GA 5FECA 1JGVL 1Q94B 1T5XB 3O6LL 2P5WE 3QIBB 2HA1A 3TEWA 2PYFB 4G1EA 4JGJA 4ZYKB 3SQOL 4NM8L 2NUPA 3CN1A 4HIIB 5EC2A 1A02N 1IGFL 1NCAH 4NO2A 4DOHB 3CC1A 3EO0B 3RVWD 4XVUC 1IGJB 1BVLB 4TVSa 1JGDB 3H56A 4KKLC 1TEYA 3P11H 3T0EB 1OAYL 3B9AA 3ZSTA 1G7IB 1V3MA 3OMAB 5JUEL 1MREH 2Y1VA 1EXUA 1ID2A 2EYSA 4MJID 2Q0ZX 4JLRA 4MVBC 3PL6B 4K9EL 2I24N 2DTML 1I9IL 2OSLB 2ZOTA 2HUEA 4XN1A 1I1YB 4LCYB 1S5IL 4AQAA 2X2YA 3LN9A 1M1XA 2J5LC 1TLMA 5KBKA 2HYMA 2XZCH 3WDIA 3G9VA 3OJDA 4KNUA 1RL1A 1I9JH 4Y1AD 1LO2L 5D1QB 2Q3AA 1XMEB 3IBOA 1NPUA 1WHOA 1ACXA 1PZ3A 1GRWA 2YPLB 3HPLB 3ILEA 1KTBA 5F7UA 3ZGHA 1WFJA 1LP9A 2W5PA 3QEQA 1FC1A 5L4MA 3TH3T 4GIAA 4G5AA 2ZP9A 4PJAE 2A6IA 2FO4B 2I07A 1BVOA 4RGMC 5AKRA 1IU1A 2YAEA 4PJAF 4JG0L 1PX3A 4Q6IA 1OM3L 3ARBD 1IEBB 2E7CA 5GJTH 3SDYL 4YH6A 3KH4A 5TDNB 4NRZB 3K8KA 1MHHB 4FF9A 3PP3K 5D1ZD 4M3KB 1ZT4B 3U83A 4U2YA 1U8CB 1PY9A 5IMKB 3IGKA 3V6BR 1SBSH 2WVTA 4M9OA 3IDXH 4DW2H 4ETYA 3JSSA 1DCLA 1JK9B 3MUGB 4XN2A 4XXDB 1NFDF 3O6LH 2UZIL 1KY6A 4QXWA 3FULA 3SQOH 4NM8H 5JORA 1DUYA 4CVXA 1E43A 1IGFH 3GRGA 1KTKE 3UDWA 3VD1A 2DLEA 4MMYB 4NRXB 3VB9A 5EIIB 1A4JA 1T6WA 2VDPB 3CDFA 1OAYH 2NQ3A 4JL2A 4D9LL 5IJDC 3TF7C 2EDHA 5CEZE 1P1ZB 1FV1B 5I76A 4K9EH 5ESAA 5KSAC 2AK4A 1I9IH 5FGRA 2WQWA 4HOWA 3MSPA 1QPKA 1P7HL 1S9XB 4UBDC 2N7AA 4MD5B 1S5IH 4OB5L 4KHXL 5EFIB 4N68A 5BXFA 2DKSA 3BGAA 2JE8A 2BSTA 4AG4L 2JKIS 3QFDB 3MDJA 2XKNA 3K2UL 5A3IC 1MHEB 1LO2H 4ZOAA 3T1WA 3JT2A 3O0RH 2GCYB 2XVKA 2WLNA 3KGSA 4GEJA 3MV8E 2ZOLA 4ZMVA 2JNZA 3UCRA 1TQWA 1QUNB 2K78A 2WXFA 1A6ZB 3LS5L 1M9WA 5CR1A 1JJUA 3TO2B 3PLYA 4YHOL 1E6JL 4PEEA 3FHQA 4DKEL 4LVNB 4Y2DB 4JG0H 1DLHB 1SJVA 1OM3H 1SOSA 5HHVL 4OT1L 3SDYH 2V5SA 3NCXA 1BJ8A 4YK4C 2QGBA 3K6DA 1LWJA 4G8GA 1NDMA 3GC3A 1OK0A 3IE9A 5HVHB 3VFWA 2OSWA 1JPFA 2PXYA 2HFTA 4QLWA 3F85A 1ZTMA 3BVNB 5DFVC 2WKLA 3S97C 1G7HA 4QRPE 5AKVA 5B1AB 3MNVB 4I2XB 2ZXGA 4ICWA 2UZIH 3FTSA 4PJ9A 3Q2NA 1SN0A 3GINA 2AK1L 1OPGL 5BVJB 3QUXB 4UQCA 1W0WB 3BAJA 3MV9A 4IBLT 1CICC 2IWFA 3CZKA 2XG4A 1IC7L 3ZN6A 3HNVL 1F41A 5EEUA 3HKZA 3ESVF 1G6VK 1PZBA 4PW4A 4WF7A 1M71A 2F5AH 5D2LF 1IMHC 3FQ4A 4FLSA 4D9LH 4Y5XB 2FGZA 1WHPA 3I6GB 5C0BA 1BD2B 3II2A 1UM6H 4IM8A 4ANWA 1LE5A 4QHMA 1AHWB 2PR9A 3TWYA 2YBRB 3QQ3A 1UVQB 4ZW5A 4EUPG 3MRMA 1LE9B 1QMUA 4OB5H 4KHXH 3ESUF 5I1DB 2IANA 2ENJA 3BEWB 3NFPB 2Z31B 4QTIL 1WT5A 1NBVL 2FO8A 3ZE0B 4AG4H 3P3YA 2WOYA 4JKPL 4UDTB 5SWSB 1X9UA 3RU8H 3BWUC 3K2UH 2J72A 1EVUA 5DO2C 4AIZA 2H2SC 1GPOL 3OPUA 3STZA 1GGIH 3DJTA 1KYOJ 1IZJA 1DVXA 4LSDA 5EZOL 3VRLE 3N1MC 3P4LA 2XBDA 1D5MB 4PRPB 2DEXX 1TQCB 3VXSE 3LS5H 2VQ1A 2DM4A 1XZ0B 5DEGA 4YHOH 1E42A 1E6JH 4LCWB 4WENB 1E3XA 5CGTA 4JEGB 2CDFA 4M6OL 3BWSA 3IMUA 2G3XA 1U41A 1T21A 3IU3B 1K5WA 5HHVH 4OT1H 4Z7WA 3U4KA 3R18A 3C8DA 5KANG 1U8MA 2MQ3A 5MENE 2PYED 4LDEB 3U46A 3VMNA 4JY6A 5HJBA 5BW7C 4Q9QL 5DJAB 2VWEE 5I8CA 4F7CA 3QHZL 5HGHA 3DX9A 2XFGB 4C54A 3VH8A 1EDQA 5IB3B 1FNEB 2BHYA 1NGZA 2AK1H 1MFEL 1OPGH 2H5UA 1WWBX 4PJBB 5ITFB 1OSZB 2HN7A 1KPUA 3ARGA 2ADIA 1IC7H 3HNVH 1I7RA 1ZOXA 1U8OB 5AAWC 1H15A 3EYQD 1HHJA 3LXAA 4F1SA 3BLPX 2N0MA 3AY4C 2C1PB 2Y23A 3NCEB 3MPCA 2FJUB 5J6HB 1GJWA 5KSBB 3L7FA 2OA9A 3QUZB 3NJHA 1VGKA 2EIMB 4RVBA 2FHBA 4P59L 2FSEA 1W72L 2BWIA 4KMQA 5FB8B 4FG0A 2G3ZA 3K8LA 2O5ZL 4MXVE 5C0FB 1NBVH 4HG4K 1S9YA 4JKPH 1TCRA 2Z91A 4DETA 5CXPA 1AS7A 1CGXA 2JF1A 4KQ4L 2C3WA 5KVDL 3ZTEA 1GPOH 3W5NA 4QRRB 3RUGE 2ADJB 3OLEA 1UTDA 3OZ9L 5EZOH 4P2RD 4XVOA 4RRPG 3RUGF 2WVVA 5LVEA 3VFPB 3MGOA 3BT2L 1ZTXL 5ELIA 1G0XA 3G6AA 2BOCB 1QFWM 2JCCF 5GSVA 4M6OH 5FS5A 3T6QC 4UM9D 3NSXA 4XRCA 2FTAA 5I0DA 4NQCB 2BNRE 3FZUC 5HDOA 1LDSA 2YMOA 2ADGB 4P9HL 4QPEA 4BWTA 3VSVA 2XTLA 5B3SB 3WSQL 4G7SB 2WLZA 3WIHL 4NO0D 4GAYA 5DRZA 3C5XA 4NDMA 5BCAA 3QPQD 5I16B 5SWZE 2ZF9A 1HHIB 1JYVA 1ZA3A 4Q9QH 4JZJC 1DUZA 4G5ZL 4WHYG 5EF3A 3S0PA 4JFHE 1K4CB 1YMME 4D8PB 5ABZA 3QHZH 4RNRA 3P0YL 4FNLL 3U2SA 1JD7A 1RLWA 3WU1A 3ZKXB 2VR7A 1EWHA 1UH4A 3MX0A 3ZZSA 4R4BA 2ERJB 3LPGA 1XAKA 1T1XA 3C6LD 3QO0A 4GQZA 1CGTA 3FQNA 4WHTB 4E9VA 2C3HA 3RDJA 3NEEA 4XOBA 3F7PC 1D6EB 5IOPA 1KTJA 1VZIA 5KYUA 2OMTB 1QI3A 2JKLA 3K46A 4EPSA 5K59E 4MDJB 5IHBA 2XV2A 3L81A 5DS2A 5D1XD 2AQ1A 3QZMA 3HHMA 4P59H 4G7VL 1OP5H 3TA3C 1NIBA 5SWQB 3WKQA 3PWVA 4XT1C 4F15B 1RPUA 4H1LG 4XMTA 1F3JA 2O5ZH 3MRPB 5B1JC 2VM4A 3WY4A 4DFIA 2YC1A 2B59B 4KQ4H 5GISL 5KVDH 1AC6A 4NQXA 4KITB 3O8XC 4CBPA 3FQWA 1G87A 3DV4A 4MA3A 2RFXA 3X2QB 3OZ9H 4I0PA 1Z66A 2J8HA 4DO5A 4OZIA 4LPVA 5JYMA 3M1BA 4AYGA 3BT2H 2E27L 1ZTXH 4GSDL 2X3CA 4N9GB 5C0NC 2IDTA 1Y7VA 2BVQA 2NYKA 4BHUA 3K8MA 2H3NA 4ZTOL 3R1GL 4G6KL 3BYTA 2IOMA 1NCOA 3L8QA 4MZIA 2FYYA 4DUXA 3ECVA 1ZJBA 4N1EA 3FQUB 3D9AL 1HN1A 3FRUB 4P9HH 5DUBB 3O6FB 4OFIA 3PGDA 1KIQB 3WSQH 3WIHH 3K72A 4IK6A 1DTUA 2AEOA 4IJTA 2DD8L 4GS7B 3BEVA 2FQEA 3QXUA 4G5ZH 5GS0D 1LHZA 2BVPA 1S78D 1L6PA 4KUCF 4J5VA 2ZKHL 5KOVC 2CHZA 3LAFA 3P0YH 4FNLH 1ZSDB 3GHBL 1B4JL 4WVRA 2YD8A 2ZQKA 1S7UA 1HHGB 4Z7UF 2X87A 3UP1A 2IPTL 4P46D 5AG8A 4GUCA 3F6IA 5JMOC 2EEFA 1OLLA 2QL1A 4R4FL 4X4YA 3WTSA 2F7QA 5CP3A 4ISVB 3LQZA 2M2DA 4N2KA 4WNJA 4K7PY 4PLKC 3TA4D 3MC0A 3QG7L 3UZQA 2EIJB 2A1WL 5EBMA 3QH3A 2BWDA 4N0UB 1JGIA 4PRID 2XETA 5IB1B 1E90A 3G08A 4P06A 1A1OB 4LVOB 4G7VH 2BDNL 3ES6B 1OD9A 2X4TB 3VXPA 4D0BB 4M6NL 2WXOA 2O30A 4BUGA 3S5LB 4I1NB 5JA8B 3R4RA 5FHBL 2V6HA 4NPYA 5F0JB 2D2CC 2UXFA 1KCKA 3CIQA 1JZ6A 4IMLA 4L37A 4ZMWA 3KCPA 5JPMB 3HE7D 2MWCA 2E27H 4HYTB 3RWDA 3QVAA 4GSDH 4PWEA 2XSKA 2GJJA 4JZNA 1J05A 5I8OL 1SF3A 4X8GA 1E4JA 1P84K 2V7NA 4ZTOH 5D93C 1S7QB 1W72A 3R1GH 5GZOD 1D5XA 4G6KH 4IGBC 3MXVL 3OAWA 3QUYC 4POUB 1JXGA 1CVRA 1AGDA 1CD0A 4CN1A 1YN6B 2NYZA 3D9AH 3QQXA 4EUPA 3A4FA 5HHOA 1WAAE 1XSKA 2QBWA 4MMXC 2ALWA 1GKEA 2B4CC 1UA7A 4JM2F 4I18B 4KROC 2DD8H 3KPPB 4IRJD 1NCTA 4PR5B 5AD0B 3SJVE 3SE6A 2A9BA 3N9GL 5IG7B 2ZKHH 3BWZA 4HUVB 4P4KA 3GHBH 1B4JH 4X4ZA 5JW4N 1FFNB 2IPTH 3M6DA 3UTSD 3VXME 4R4FH 4LSQL 1TFHA 2DQHL 4MNGA 2O5XL 1YYML 3IMBA 5IEHA 3T65B 2DEYX 4AUYA 2V9RA 3BX7C 4BKLB 3QG7H 4AV0A 1XGYH 3OB0H 2EVFA 3WG7B 2A1WH 3CFMA 3JV4B 5DYOB 3VXUA 3WIHA 1U92B 2VLRB 1UB6B 3OKMA 3REVB 1MZYA 1MCKA 1E28B 5FFOA 5C0JA 2BDNH 4WDIA 4HBQA 4BUQA 1RH8A 3OXRA 4KXAA 4M6NH 2APXA 3IXTB 4NCC1 3QFJD 2Z31D 4HFWB 4ES9A 5FHBH 5TE4L 2Z4QA 4JFXA 2C9VA 4H1LH 2MFNA 4MRBA 2X4OB 4PJ8A 2ZX8A 2ZXQA 4QRTA 4YE0A 4R5VA 4HIEB 5FKAA 4A2HA 5F7YC 3SZ6A 1B0IA 2K9FB 4WI9A 1XT5A 4AYFB 1EDYA 4JPIB 3P54A 5AOZA 1KG0B 1YY8A 4PRPD 4R7DB 4B9PA 3CXHJ 3MODL 4R0LC 5I8OH 4ODTL 3FB8A 2VMJA 4PV1C 4KXBA 2YQBA 3J2PA 4L3EA 2Z64C 1B3IA 3D12B 1QLFB 3GLEA 4O51B 1SHMA 3MXVH 2K70A 2PW2A 2APTA 1LLAA 3SE4A 3KWWA 3N6YA 3ARFC 4PJDE 5FWQA 3FRPB 3OKKA 4L1TA 1BXXA 4BSVB 1D7DA 2F53E 1T20B 1Q38A 4WSKA 2G3MA 5CR8A 5C7ZA 5IT2L 4XMXA 4JY4B 5K9KA 1GYCA 3MRHB 3SCMB 5CP7B 4NCC2 4WI3A 4YHPB 4JDZA 5K5YA 3N9GH 4GBXD 4TV3A 3HE6A 4S2SB 1EV2E 1I75A 2Y3AA 2DLHA 1X9LA 1ZVYA 3O2DL 5DD6A 4Z7VE 1M6UA 1IC5L 4RRPA 3FQTB 1MY7A 2CG9X 4LSQH 2DQHH 4KQ0A 2O5XH 4F3FB 3NRFA 1VFAA 1YYMH 3ZOAA 4UNTA 4XBPA 3LXCA 4AJVA 2BHFA 1I7UA 4PMFA 4BSWB 4EN3B 1AG0A 1DVFC 4OGYL 4X4KA 1SDYA 4YZWA 3WUWB 1UURA 1OCOB 3DNKA 3CSFA 3VJ6A 2DQEH 3T04D 5JHDA 4J2QA 4QKXB 3V4VL 3V7MA 3HC0B 4ABWA 4ZZFA 3UACA 2ATKA 2BO0A 2X7LB 5EBWB 1U91A 4ZAKD 5FW8A 4J7RA 1M2OA 2EJ1A 1SRDA 2P80D 3KPLA 5TE4H 1GZQB 4XBGA 3KXFA 2VH5L 3CUPA 4L2LA 4S0TD 4K7PX 5MEPA 3K0WA 2PO6C 4WKZA 5DK2B 1FYHB 3U79A 3JTSB 1KBPA 1AKJB 1R17A 3H9SB 2X89D 4FG4A 4K9JA 3HI6L 3MODH 4H5SB 4NKIL 4I3GA 2E9WA 4ODTH 3VAEA 3CPLA 2AXGB 4AMKL 1MCHA 4KO5A 1N6QH 5DFTA 1L0QA 5GSRB 4CN4A 2VDLL 3CX2A 3NPZB 5F3FA 3EZJB 1Z5HA 4PWJA 3LPWA 4WV1B 5E99L 3TV8A 4L8SA 4Y16A 4H1LA 4GQ9L 4LF3B 3WIFA 5IT2H 4QJ4B 1R24A 1RKRA 4MCZB 1ZLVH 1BP3B 3BAKA 3T6VA 2MNJB 3SGJA 2C3GA 4K15A 5CUSL 3ML9A 3RKDC 4PY8J 3APFA 4L4TA 4PP2A 1BF8A 1R3LB 3O2DH 1TZHA 1AGEB 1HKFA 2WBXA 1QRKA 4MAZA 4PV8A 1VRSA 3TJEL 4FA7B 1IC5H 2GG1A 4KRPC 1OF2B 1I4FB 4EXKA 3SDDB 4C57C 1ZK9A 3TEXA 1C12B 1HHHB 4WSJA 4BH7B 3CN2A 1SXSA 2IBGA 4OGYH 1B2WL 2VM3A 5ABAA 3SDCA 4XBEL 4CC4C 1KYFA 1I1FA 4PTUB 4Z9KB 2X6VA 5EOCH 3LPPA 4NBZB 3W37A 2R59A 3V4VH 3D06A 1ZT1A 5FGSA 4F2MA 1MQ8A 2XXCB 2J20A 2P26A 4HHGA 1EZLA 2HT4C 3NSJA 4Q52A 5CILL 4RGND 5FK9A 4Z7OB 2MHAB 4R2GC 1Q9OA 2ICWA 1J88A 3QEHB 3KPRA 4APQA 2VH5H 3FO2A 4LSRL 5CIPB 5C08B 1CFBA 2Z8WC 4G43B 4AYDC 1QEXA 4XNXH 4IOIA 2NXZB 5JXEC 3TNMA 2JTYA 4K3GA 4NKIH 3HI6H 2VLJA 1D9KB 5F7LB 4AMKH 3CLFH 3HI1B 2BC4B 4KVPA 2EIZA 1BXVA 3CDCA 5E8PB 4N22A 2P24B 2P4AB 2VT0A 5FUCE 3VQ2C 4ZRGA 5TD4A 2QTEA 3NVQA 3V55A 1GTNA 3P4NB 2D0GA 5E99H 3QDGE 2W0FB 3RA7L 4JFEE 2ARJB 3I6KA 4FFTA 4GQ9H 3LNIA 1A4BA 3OLGA 5HDBE 5FGCB 1M4KA 3N44F 1K8DA 4N0FB 5HDBF 1SMDA 3V8OA 5KSVA 1XB3A 4H25B 5CUSH 2UWEB 3MBED 4D3CL 4HH9A 4TTGA 2IQ9L 4PBXA 4X5XA 4W6WB 5F7FA 2NW3A 2R2HB 4LLDB 3TJEH 4MB5A 1MFDL 4YDVB 2CJSA 4Z3GA 3VD2A 1I3RA 8FABB 4OCLC 5GIRA 2A9ML 3HBPA 4IS6B 3O6ML 4FHKA 4LP8A 1OTTD 2Y06L 1B2WH 4KDTC 3TO4B 2NY4C 1H0DA 4XBEH 5SV4A 3Q0HA 3QIWA 4PJCE 3NIDE 1I7ZA 2W9EL 4L1DA 3NYKA 1A3RL 1IM3B 5DEJA 4QHLA 5IQMA 2IPUK 1IEAA 2QQQA 3O2DA 2PCXA 1TKWB 5CILH 2J1XA 5AW9B 5K33A 1U8LB 3B5GA 4XMPL 5LBSL 4GLRI 4LSRH 3SBPA 5GZNA 5JPNA 4LLWB 1CDGA 4IRSB 1YEHL 1UGNA 4FOMA 2ZAGA 4BDVA 2WQRA 3QXDB 5MP6L 5B39B 2MNUA 3R4DA 3KD4A 2ZWYA 4HJTA 2EIEA 5AW2B 1AACA 4J3UA 1XCQA 5HD8D 3VFRA 3K6OA 5DT1L 5F7BA 5LBVA 1KTLA 1NFAA 4PP1D 3V4VA 2Z8RA 1NSNL 2ENPA 2FJGA 2YD1A 5T3XD 2MCPL 4NLHA 1EUTA 3RA7H 1NJ9B 3UPRA 5T3ZL 3DJZA 4HISA 1IBFA 5BZWB 1PZDA 3EKCA 3WS6A 4ODXA 3EYOA 5C6TL 2O72A 3PWPE 2FNWA 4CJ1A 25C8L 3OKLB 1QNIA 3AABA 3P3SA 4L0ZA 3T0AA 3MRLB 3LXUX 4NRYA 3S5YA 5KN5A 3QAQA 4D3CH 5JHBA 1A2YA 4TRPL 5ESVB 5CD3A 4K3HA 2IQ9H 5DJ2A 2XYCA 3D5OF 4BELD 2VJ8A 2VUOA 1MFDH 4X83A 4IJ3B 1MVYA 1V3JA 3CHQA 2HRGA 3CFEB 5ACZB 1O6SB 3EDKA 3O6MH 3CHSA 3W56A 4BBWA 2Y06H 3ZE1B 3BKYL 3GMLA 2JMRA 1C5BL 1BJ1H 1LO5A 2NT0A 3JV6B 2NUTA 4Z0XA 2JB5L 3TBVB 3UBXB 3FB5A 3UTTA 2W9EH 4O02L 1A3RH 2HVKB 3FH8A 3N43B 3QNYA 4LB8A 3ZBMA 1WIPA 1L6XA 1E65A 4DCQA 3C5JA 4G1EB 3HB3B 4XMPH 5LBSH 5I1GH 2NUPB 2V2WA 5EC2B 1JBJA 3FU9A 3QHFH 4NO2B 1YEHH 4BQCA 2JLLA 4N28A 3HA0A 1UA3A 4CDGC 1Z3RA 5MP6H 3SKUD 4RA3A 3D07A 2EDRA 1EXUB 2EYSB 1AD0A 3TYFA 4JLRB 1KGCE 3SPIA 1FAKT 5DT1H 3H4FA 3IETA 2CA4A 4P23C 3UG4A 4MSWA 5C2BL 3H9ZA 3G5XA 2N1KA 4AQAB 5DURB 3US0A 1M1XB 4LSUL 5EBLA 2WD0A 1PEWA 3MNZA 3AS3A 1TJXA 5FYLL 3WTXA 5T3ZH 3OJDB 1FNFA 5C6TH 1M56B 1TMCB 3DC0A 3KPQA 4LEOA 2LQRA 2RB8A 4F8LA 25C8H 3T3ME 1OY3B 3SCMD 2BM3A 5A2AA 2BZ7A 1LP9B 3QEQB 5FYJE 5FC9A 3RTQD 2OSYA 5FGBC 3P4OA 4TRPH 2AQ3A 1TLKA 3LN4A 1U42A 3T3MF 3I6LD 3BQUA 3DXAE 4HT1L 4NZDA 2I07B 5KJ4A 1E5UI 3RZWA 3GTNA 3NJLA 2WN3A 4G72B 4CW1A 1QW9A 1OANA 5D8JL 3ZRFC 1QSFA 1QWHA 2CCVA 3B9KC 1BYOA 3GNML 5LN8A 3T71A 1KLUA 4GAJL 4Q6IB 1J5IA 2L7UA 1ZHKA 2ZXWB 5MERA 5D7LE 2CKNA 3FHEA 2ZWSA 1T4KA 2Y9RT 4ZZKA 3BKYH 1C5BH 3Q2WA 1H5BA 2JB5H 4XNZB 1RU9L 4IRZL 4O02H 4U7KA 3CBKB 3RIFF 5I1KH 5BV7L 3L54A 1GR7A 4L0PB 3M45A 4NGHL 3IDIA 3CX5J 4I87A 3OKNA 5AW4B 4FJYA 4JFDA 5HGGS 3HNTL 5JORB 1ODAA 3MCLL 1DUYB 4CVXB 1UACL 4KX7A 4WSGA 1RD6A 2AF2A 1E4WL 2H0PA 1A4JB 5DO8A 4YSPA 4IYKA 5EO0A 4YXLL 1OAZL 5C07D 1COBA 2X6MA 4BZYA 1WD8A 4WW1A 2B2XL 5I76B 2SODB 5ESAB 3VD9A 5LUMA 2AQPA 3DO4A 4G7YL 4GO6B 4AWJC 1JZ3A 2G4EA 5C2BH 4YBHA 1YDPA 1F6AA 3FO1A 3D48R 4LSUH 3NK4A 3EOBA 5J8OA 1A9EA 3HOGA 1P0SE 4B9JA 5FYLH 2BSTB 5EUOA 1J9CT 1OW0C 5LBSA 5B3JE 2XKNB 3V6FA 3HRPA 1VPOL 5G4MA 1TTRA 2XFXA 3QC5X 4W9EC 1RERA 4Y4KA 1BVNT 4QXGL 3RPBA 1UM4L 5L88H 1KPRA 1Y6MR 4HT1H 3CVBA 3MJ9L 2OJ1A 4TMPA 1EH9A 1M7UA 5D8JH 4M00A 4W9FC 2N59A 3GNMH 1IAII 3BOVA 4GAJH 3QE5A 4L23A 2HJLA 3NPSC 3UX9B 4IDJL 3ULUC 2XWEA 3IJ8A 1RZ8A 2Y6SD 4B7IA 2BSSA 1D5ZA 5AB0A 3KW8A 3DRTA 4G8GB 4IHBA 1QPPA 4GG8A 4IIQC 4JFVA 1NDMB 5I1IH 3JWOL 3ULVF 2Z65C 3VFWB 1JNLL 1JPFB 1RU9H 2PXYB 4IRZH 4NBYB 1A6UL 2D7OA 2DEWX 2IFFL 3WELA 5BV7H 2CRYA 4OD2A 3L9BA 1DYZA 5DVNA 4NGHH 5FFLA 5GRVL 4HPYL 4JQVA 1OGTA 3K2KA 4PJ9B 2EXYC 4L05A 4XO4A 2A6JA 1JNNL 3HNTH 3LN5A 2W65A 1IGIL 2COQA 3KLKA 3MCLH 3MV9B 4JY5L 4TNFA 1UACH 1ROCA 2XG4B 2IDQA 5A2IH 3RFZA 4PIBA 1E4WH 3VD0A 1FNGA 1QG3A 3CQQA 1PZUB 5E6YA 4YXLH 3VNZA 1M71B 4DQOL 4GINA 1OAZH 5IQ9A 3ULUE 4Q97A 2B2XH 2CM6A 5C0BB 4X6CA 4U1KA 1W2KT 2QR0A 1JDCA 4NKMA 1D9KD 1PIFA 3GBLA 2CDEB 4G7YH 4O02A 4QHMB 4B9FA 4MQSB 4UV7L 1LE5B 3QQ3B 1XDTT 3IMWA 4NM4L 3MRMB 4PJGE 3VM7A 3RY6A 3RDTC 1R34A 1EA9C 2IANB 3FPYA 3K4ZA 3PAUA 4A55A 4PJGF 2IAMA 5DJYA 3HIZA 4X5WA 5AOKA 4DP9X 1RVFL 2JI1A 4AIZB 2XPGA 2RTTA 1VPOH 1TSRA 3F05A 3SGDI 4HXBL 3STZB 1HVXA 4GKNA 1VERA 4JB9L 5I18L 4L4VA 2OMWA 4QXGH 3WEMA 3TBSA 1UM4H 1WZAA 3MJ9H 1DQJA 2VQ1B 3AG2B 4A2MA 3DVNA 4XX1E 5DEGB 3N40P 4DP1X 2CDFB 3QDJA 1RZKH 1T21B 1WEJL 1ZPLA 3I50L 4PW9A 4KJWC 4XH2B 5F6IC 3VFTA 4IDJH 3HG1D 1VEOA 4YWGH 4Z7WB 1F11A 1RZJL 1U8MB 1TG8A 3ASWA 3U46B 1H19A 4JY6B 1OCZB 3JWOH 2GC7C 3V4PL 3ELQA 1JNLH 1WBZA 3L7EA 3OF6D 2APVA 1XR8A 3WYRA 1A6UH 1HOEA 2X9ZA 3EJZC 2IFFH 3RY5A 4F7CB 2BSBA 5HGHB 3DX9B 4JHWH 1QRNA 4PGBA 3KYNB 5CZVL 1THAA 3VH8B 2VZ3A 3BGFB 5EDXA 4QGYA 1NGZB 4YFLI 4YSTA 5J3HC 3CIAA 1JNNH 4P0DA 1IGIH 2HN7B 4JY5H 1FFQA 1KPUB 3ARGB 4KQ3L 3MRFA 1HC1A 5IHWA 4F9PC 3D4CA 1BLNA 5IY5B 1I7RB 1H15B 5GRJL 1HHJB 2PPDA 4DQOH 2QKSA 1OD7A 2H6UA 2VERA 5D2NC 1WA2X 5CJQH 4ESKA 2HAZA 4IRZA 1XGPA 5GGUA 5D72L 2NY2D 4UQEA 4KKAD 4UV7H 4R4ND 2FSEB 4JRWA 4NM4H 3KVPA 5FF6A 4XXWC 2B3IA 4FQXC 4X0NA 3FT9A 4DVRL 4R84A 1M7XA 5F3BB 5AVRB 1MW2A 3IDYC 4Q58C 4Z7NE 1S9YB 1TCRB 3FTVA 2G5BA 4ZO9A 1QVOA 2Z91B 1GOHA 1RVFH 3P9MA 5DXWA 2OS7A 4XB7A 4YBLC 2E9JA 1HXKA 2NXYB 3CFJA 3QJSB 4HXBH 2Q3XA 4JB9H 5I18H 3L3HA 1YEKL 4K94L 4BE6A </