4ZMLA

Crystal structure of human p-cadherin (ss-dimer)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmlA01
4ZMYA 4XXWA 1NCGA 1Q1PA 4NUQA 4NUMA 1NCHA 1FF5A 4ZMZA 4AQ8A 3K6DA 5KJ4A 4ZMPA 2A4CA 3FF7A 4ZMLA 2QVIA 2X2UA 4XXWC 1NCIA 4ZTEA 3Q2LA 5DZVA 1O6SB 1ZXKA 4ZMQA 4AXWB 5CO1A 3K5SA 4QD2E 4ZT1A 4AQAA 4AXWA 4ZMWA 3Q2VA 5JYLA 2O72A 2EE0A 3UBFA 3MVSA 4AQ8C 4ZMVA 2WD0A 2A4EA 1SUHA 2YSTA 3K6FA 4AK1A 4APXA 5JYMA 1WYJA 3Q2NA 3LNHA 3UBHA 4AQAB 4ZMXA 3FF8A 4AQEA 4OY9A 2V37A 2OMTB 2OMVB 3K6IA 1L3WA 2OMWB 3LNFA 3LNGA 4ZI8A 2QVFB 4APXB 2OMXB 3LNIA 2WHVA 3LNDA 2OMYB 2OMUB 3K5RA 1WUZA 2OMZB 1NCJA 2YQGA 4AQEB 3PPEA 4ZMOA 3QRBA 3Q2WA 2WCPA 3LNEA 1OP4A 4NQQA 5CZRA 4ZMNA 1EDHA 2WBXA 4ZMTA 3UBGA 1ZVNA 4NUPA
chains in the Genus database with same CATH superfamily
3S3BB 3I75B 1TJGL 3LZLA 3MUGB 1HN1A 3TH3T 2QKIC 2ZWYA 2X1QA 3F01A 4UT6L 4CSSA 3LKSB 3I9AA 3EYFA 4LAQH 1BQUA 1YECL 1F4WL 1W8OA 1YN7B 3QUKA 4JREB 1T04A 1XMEB 1Q8MA 1ZDSA 4W9JC 4DK5A 2VOTA 3VAEA 2P80D 2YGVA 5EFIA 5HI4C 4EI5A 1D5BB 3BYTA 1G6RA 1M05A 3EF7A 3MRGA 4U4BA 3KLSA 1IMHC 4PJAF 5CEZL 1CFQA 4Z95H 4AL8C 2O5YL 2OR9H 4H8WL 3T6VA 3PHQA 4PD4K 1F58H 3MNWB 4LHUA 5EDXA 1CDUA 2HPOA 1CFSB 3JWNC 3MLZH 4NXKA 4NPKA 3MBEC 1JPSL 2HTKD 4HF5L 3E1ZA 4JK0D 2CHZA 3SKOB 1I1RA 3AXHA 2YN3A 5F88B 3RBSA 2Z64C 1OSZA 4OQTH 1H3UA 4PS4H 1AP2B 4F57H 4QLWA 5EOCL 1Z3RA 2F54A 5F7NC 3VWKC 1QG3A 4XH2A 2VN5A 3BAWA 3T4AB 3U0PA 4N20A 5I76A 1AYOA 1BFVH 1KIQB 2FUQA 3X2QB 5KAQF 3QWRD 1YMHB 3C87A 4WFFD 3R18A 3K6FA 3RY5A 4N2NA 3D39B 4KNUA 4PGCA 2X4PA 3ZTJH 4Y5XB 1BJ8A 5I8CA 1NDGB 1YNTA 1G0XA 5GGVH 4FQ2H 3VRLF 4HHAA 2PLTA 4DTGL 5B7MA 3DUSA 5E2VH 1G6RH 3CFJA 3GXIA 5EBLA 3S36X 1WC7A 1TMCB 1VEOA 4MJID 2ZG2A 3EAKA 4RVBA 1K4DB 4KHTL 4W1TA 1CK0H 4OD3L 3WJJC 2ZWSA 2JKIS 2A6IA 5F44A 5ECGA 2AXFA 1TVBB 4OCXL 3QJHB 2ATKB 2NY2D 2WXOA 1GKOA 3PUUA 2NY5C 2P43B 2O61B 4AYFB 1KBWA 4QOKD 1MCRA 4M6OL 3K6SB 1I3RB 1LDPL 3VYNA 5F3BB 5TE6L 4X99A 5I6XB 1PZCA 3MV7B 5IEKB 4G43B 1EH9A 2IXQA 4YSSA 3CX5K 2AXGB 2R83A 2MEJB 3TPUA 1CFTB 3PGDA 4ETYA 1GOHA 4TPRL 1J1XH 4HDIA 5L4IA 2F15A 5A2KH 5LN8A 4M7KH 4XZUB 4A04A 2DQUL 4W4NA 3ZDWA 2PN5A 1UHVA 1RHHA 1UWYA 4G8FA 4AZUA 2FSEA 3OGOE 4F8LA 3IE9A 3G6DH 1OW0A 2A73A 4IOIA 4XMKL 3WFZA 4N0YL 5I73B 3BGFC 4QHUA 1SJHB 2C3WA 3NJVA 4Q7DA 2J8UA 3SO5A 5GS0D 4XCCL 4JNXA 3WFHB 2HFFB 2ZX7A 4Z77B 5IR1B 2WUCH 3IVKA 2VXTL 2Y22A 1OTTD 2BW4A 1YAZA 5D7HA 3M8OH 1RZGB 1DEEB 3GHPA 4F58H 1DBJH 5C0JB 3V5HB 5DRNB 3GK8H 3NCWA 3FT4A 3A6CH 4G6AC 3ZZQA 1EANA 2OBGA 4RAUA 1QHPA 1CTOA 2QL1A 1LO0L 4JS7A 4PRID 3WG7B 4HHWA 5CMAA 1R17A 4YSPA 2A4ZA 1E27A 4KK5C 4N8VG 5GISH 3UERA 3WXVL 5J1AB 1F1DA 3OR7B 2IGLA 1U2YA 3EADA 3T09A 1TTFA 3H2WA 4NO2A 4L8SC 1TTCA 4K23L 2JTDA 2O6PA 2Z91B 3LKNA 2G4GA 1RZJC 2FJUB 2D03L 1NCAL 4O2CA 1D5RA 3SQOL 3V0WL 1TQCC 2FBJL 1Z5HA 2OSLA 5TF1L 4PLJD 5HBBA 3OKNB 2XWJB 5K9JH 1LK2B 3I50L 4W9CC 3UJIH 5ECJE 3KM1A 3QISA 1TQVA 1UJTA 3ARTA 4JG0L 5HYJD 3QEGL 4CMMA 5E9DB 3LVEA 1XR8B 2MNWA 2AXHA 4NNYB 3NN8A 4D9QE 4I0PC 3BPOB 2VZUA 2BSTA 1ZV5A 3WDHA 4Q8BA 2X9YA 4GUPB 2H6UA 1HFUA 1IUZA 1R3JA 2P7TA 1BDYA 3EO1A 5GIRB 4N8VB 3GMNB 4AOFA 1IGFH 4U0QB 4Y4KB 5KYUB 3F7PC 5FYKD 4MMXB 2PPFA 3QI9A 4F93B 2HT2C 5JUEH 3E8UH 2YPKB 1QQDA 3FC8A 4KNSA 3TX4A 4LSVH 4QHPA 3HZ3A 2YBRB 4JQVC 5CKGA 3APCA 5DSCA 4HEPG 4PJDE 3BZ5A 4HPOL 5E2WH 3TNNA 4DGUA 4J1UA 4ONGL 4YHIB 4Q6IC 4MNQE 3IDUA 4H8UA 2FIKB 2ENSA 2V9TA 5TF0A 5DFVC 3F00A 1NOAA 3FT3B 3WTUA 1KTCA 3NEOA 1OHQA 2OMYB 3CSBA 2A1WL 3I75A 3LSOB 4GSDL 1DQTA 1MCOH 3Q13A 1CYXA 3FQ1A 3LKSA 5K9OB 2EC9U 5D4HA 2XVKA 5TFSL 2AJVH 1YN7A 3CHXA 1G7QB 3NIFF 3ESPA 3KXFD 1TZAA 1G7PB 1UZGA 3VWJC 2O30A 1H19A 2FE0A 4XX5A 4Z7VF 2FJFB 1OP4A 2Y06H 1MNNA 4XB3A 1J0ZA 3S4SG 1LE9B 2QSVA 1HCFX 2RCSL 5EU6B 2BHZA 2Y7QA 3D0VB 3PAVA 4OFKA 3EIFA 4N24A 4PLOB 4RMQA 5SWSD 3V0JA 4GXVH 5HSFA 4WSKA 1MCFA 5AKTA 5JTWA 3CN0A 3ESNA 3GMLA 4AYEC 4Q9RL 2R9HD 4DFIA 3MV7E 3NIDB 1VF5C 2XA3A 5F88A 2TAAA 5B8CC 4F7EB 4DKEH 2FWOB 1U6AL 1WWBX 4AYSA 2XV2A 3QFJD 4PGEB 3AY4A 3CXHK 3X14B 2MPAH 4MNQA 4QWWD 3GTTA 1E3FA 1YMHA 1MSPA 1FO0L 3B34A 1JG9A 5FYJE 4FG4A 2B1HH 4TSBH 1NDGA 2EYTA 2N0KA 4GYBA 5EC1B 4BCXA 2X4OA 5DMGD 4NO3A 1GJIA 1E6OH 2WLYA 3KJ4B 1EVTC 4WSGA 3S4SB 5CZXC 1ZANL 2GG1A 3IU4H 1IGML 3QULB 2ID5A 1K4DA 5LGHH 4QD2E 3QT2A 4L4VE 4N5ED 1T3FB 2Y5EA 1JN6B 4NBXB 5HD8C 3QQDB 4E9QA 2ATKA 1RZIB 1KELH 3BPLC 4NWTL 4QO1A 1VSCA 4HCGA 1S8DA 4CRPA 1YYLL 4AYFA 3E0GA 3HE6D 1ZS2A 3ZL4L 2O6CA 3K6SA 3REWB 4LPWA 1J8HB 2LGNA 2NY6C 5E03A 5F3BA 5DYOB 1II4E 1OLZA 3FSVA 3MV7A 4G43A 4ODBD 4OV6F 2AXGA 1QW8A 1CFTA 1K2DB 1XH2A 2ZNWA 3L3OB 1SXAA 2WW8A 3O8XA 1UUSA 4Y19B 3KBEA 4WSJA 2XVLA 4XZUA 1NKOA 3BAKA 2QZQA 3C6LA 4L4TE 4ZW8A 4LDEB 4J4PA 2Y5TA 4KUZH 4HXAL 4AEIL 2WQUA 2KT6A 3HI1A 7TAAA 4LQ1A 1SJHA 3BEVA 3ETSA 2CK2A 3B2DC 4HETA 2HFFA 5FO7A 4Z77A 5IR1A 2AHIA 3NP4A 4NJ9L 4POUB 1XMWA 3ILDA 1RZGA 1DEEA 5C0JA 1VGKA 4CU8A 3II2A 1XX9C 3V5HA 5DRNA 4L4VA 5AOLA 4AKQA 3HS0A 3DVNA 3OKDB 1JFQL 2X3BA 5I5MA 1FZJB 3FU5A 3HMXL 3L4VA 3T8MA 3EFFA 5JNYA 2ZOUA 2BMKB 3LNEA 4K73A 1FP5A 1JE6A 2XZAH 1FFTB 3LVTA 4FP8L 5J1AA 2VC2L 5GZND 1RIUL 4JPVH 5D1QC 1UH4A 1WO2A 5CBEB 1DL7L 2AVFA 4GW5B 5PAZA 2AFNA 2ZOTA 4FCAA 1AMXA 1CVSC 4F7PB 5D93B 3AQYA 3LDBC 1UD2A 4C54A 3SO3C 3OKNA 1DVFD 4KJPC 5I1IL 1X5FA 4GI8A 3EG9A 4JJOA 4KY1H 4GQQA 2F58H 4JBSA 4AQ8A 4FG6D 4AQ1B 1OGAD 1K6QH 4NNYA 3D34A 5JW5A 3O2WL 3QXDB 3KAAA 3DX2A 3HR5B 3MKGA 3DBXB 3QAZB 4KVCL 3SDCA 4ZTOL 3CQFA 5DEZA 1G7JA 4ODSH 4NZRH 5EU6E 1E3ZA 5GIRA 3ZPDA 3KNBA 3GMNA 3MPCA 4N8VA 4Z7QB 1FE8L 4P5TB 4Q0XL 3M7FB 4JHWL 4NT6B 4Y4KA 2H3NB 5E6SB 5KYUA 4MMXA 4XMZA 4DFHA 2X53A 5BOJA 5EBMB 2R1WB 4W68A 2A9AA 1CLVA 2ZUTA 2YPKA 4MAYD 3NSJA 2VW6A 2NZ9C 2PYFB 2P5EB 1SLVA 2W07B 1CL7H 2OCCB 2D3JA 5AENA 1MG2C 2BJMH 2JNZA 1TVHB 1WFIA 3QUGA 4HIXL 1PFCA 5J56B 2X6VA 5E9NA 3IFOA 1NBVL 1SMAA 4YHIA 5KVFE 1FVDB 3ESOA 1UXWA 4ZAKB 4CILA 1YMMD 2GY7B 3PWUA 4ALAH 1UD8A 2FIKA 3IDNB 1E5AA 2VDNB 4EO5A 1MVFA 2YR3A 3FT3A 2K4AA 2YD8A 4JO4L 4MNGB 2OMYA 3UTTE 3O2VH 4UOJA 1KOAA 1RPKA 5INCB 1DQJB 2IC2A 5CCKH 1ZE3C 4MA8L 3P3YA 4H88L 2P8MA 3WEXA 4DJMA 4YXKL 1UM5L 1G7PA 3IXTA 4LARH 4HWNA 5I1HL 3DMMB 1W15A 1LE9A 4K2UH 3VRJB 1UJ3C 5EU6A 2NSQA 3VXSE 5CSGA 1A1OB 1SGKA 1JNHB 4AGQA 4HMCA 4CNIB 4DPBX 2QADD 4GG6B 5DF0A 2BVYA 1J9SA 3NSXA 4FNPA 4HGWB 5TDNB 3B9KA 2A7BA 2EDDA 3B2VH 5J8OA 2VL5A 4HLEA 3VX0A 5C3TA 2VDPL 3EGSB 3T6ZA 4F7EA 2FWOA 2CLZB 2O4EA 3ML9A 4PGEA 1SVCP 3FU7A 5L8JB 4JG9A 2D9QB 3AB0B 3X14A 2YD7A 1Y0LA 2Y9RT 5FYLD 2V9RA 1F3JB 3H9HB 1MNUL 4GRMA 5ANME 2DLFL 3C6SB 1N12A 1MW0A 1RUAH 1THAA 5EC1A 2NZIA 3NFPB 1ZOXA 3OPUA 1K8DB 5ETUB 3P0YL 4NX0A 3QJSB 2D7PA 3GZKA 5HHMD 2WSPA 5FGBC 3S4SA 2EDJA 2X3CA 4FA7B 3QQNA 4ODWB 1E5YA 4G9FE 3QULA 1QSEE 4TLKA 4TTDD 3ZZ1A 1T3FA 3DJTA 2BS71 43CAB 3EXLA 2EIKB 3GHBL 3BN9D 1SXNA 3QVAA 4MJIB 1PLBA 1DJYA 3F5WB 4LCCB 2BWIA 2ZXEB 5F97E 2IPTL 3U1SL 5KSUB 1S46A 1D5MB 1AQKL 2NY2B 1Y1UA 3G7TA 1M53A 3KR3H 1J8HA 3MACH 1YYMH 4LESA 5DYOA 5F21B 3EH4B 2C9RA 2W8CA 3JTTA 3Q2CA 1JYXA 3ARRA 5KVFH 2VIRA 4FXKC 2ZUSA 4QOKB 3DIFB 1X9QA 4P59L 3KWVA 1K2DA 2ATPA 4AXWA 2YMXL 4Y19A 4FS0A 3MUJA 4P9HL 3ZDYF 1CDBA 1A7RH 2VXUL 5AALA 3WUZA 1DVQA 2VAAB 3KPQA 1WUNT 2ZPKH 4G6AD 2C3HA 2HYMA 3V9FA 3U9PH 2F6AA 4RGNC 3SPCA 4U1KB 2YMOA 4KPHH 3ZE1E 4JM2D 3UBXB 1ERNA 1JTPA 4R84A 5J4MA 4H8PA 4UUJA 3FCBA 1INDL 3OKEB 3S5ZA 2JI2A 2GY5A 1KTDB 3K2MC 3VYOA 4BK5A 5KZCD 4EZLA 2Y6TE 4G9FA 1RZPA 1QSEA 3R06A 1P4BH 4AJ0A 1WLHA 2BVQA 2GB2A 3N1MC 4K3HA 4Z7QE 5CFAA 5L6YL 3UZQB 5JR1H 2XOTA 2WQ8A 3C09B 4R8WL 3LY6A 4EI0A 4UOW1 4YHOL 1Z9MA 5CJQH 2OMTA 1EO7A 2BMKA 3RZCA 1OZTG 3FQNB 4F8PA 2RQ8A 1KXTB 4HCFA 1QFUH 3SCMC 4PRIB 4AMXA 1WAPA 2F08A 2Q2LA 4FZEL 3CFDB 4LSRH 2IFFH 5CBEA 3O11B 5AWNH 4GW5A 5ITBL 2B16A 3UL4A 3H7LA 1RUPH 4I0PD 1XF3B 3WL9B 1YEGL 3OKOA 1JWMB 1QKZH 2FSDA 4C4BA 4X6DE 5MHSE 1O5PA 2WKOF 4I8DA 1XIWD 2HT2D 4AQ1A 4OSUL 2JCCE 5EV7A 3TCLB 5DC0A 2W0PA 5HYJB 3EGXB 3QXDA 3HR5A 2DJMA 4YZFE 1UFGA 2CM5A 4FGMA 5C6TL 4M4RB 1KGCD 1Z5YD 3IRPX 4POYA 1XXFC 2A9BA 4R7LA 2OK0H 1Z0MA 1H8LA 2EDYA 2OS7A 4WW1B 5IBUG 5EBMA 3TO4C 1D5XB 3IXAB 5I9QC 3EJZD 4UYPA 2NNAB 1G9NL 2P5EA 3OAZH 4OW6A 4CBZA 3UZEC 3NACL 5D70L 4DK6A 1TVHA 2JWYA 4JO2H 2ADJB 3SD2A 1RZKH 1FVDA 4Q58C 1XAUA 2YWYA 4R0LC 4ZAKA 1TJXA 4PJIE 1GSKA 2ZKMX 1LE5A 3IDNA 3H56A 4L8CB 3MLRL 4PTTB 3CG8A 3D30A 3ZT6A 2LV4A 1TTUA 2RQEA 3P2TA 4MNGA 4Q2ZB 4MAZA 4ZFGL 1AHKA 5INCA 1RCYA 4AEHH 3BLBA 4UQDA 1FYTD 1F00I 4LO9A 5L88H 2CIKA 5DFTA 1IQWL 3N50A 4GUCA 4ZO8A 4ZZKA 3BFOA 4OLUH 3ZK0A 3QJRB 1AS6A 1U8LB 1OARL 3ARDD 4FJYA 1IZJA 1BVZA 4IBQA 3T0EC 2VJ8A 1N6QL 3LD8C 3B43A 4NO0D 5IBUB 3I6LE 1OOAA 3PDGA 4M7KL 1WFTA 1QRKA 1X5IA 3KXFB 4F3FB 3MLXL 4IU2B 3VRJA 1WWWX 2P80A 3C75A 5I8KH 4XVSH 4HULB 1JNHA 5IBTH 3SE4A 1ROWA 3GPEA 4AZ8B 3LS5L 5C2BH 4GG6A 4YDKH 5ILTL 2A5UA 4L37B 2VUOA 4L1LA 4L8DB 5SWSB 5BS0E 3EGSA 4F58L 5ADOH 2CLZA 2VDNH 3CVCA 2OCFD 2FD6H 3K6IA 3NIGB 5CZXD 3RG1C 1QPXA 1MRCL 1ZHNB 3AADB 3NPZB 1QRND 4JFHD 4YSUA 1F3JA 2DRUA 3EOTL 3H9HA 1A9EB 3NCMA 3QFJB 5DJZB 5KVEE 3MXWL 1DDTA 3KYAA 4XC3H 5DD3H 3OJDA 5F1IB 3NFPA 3WEOA 4A63A 1K8DA 1B2WL 5ETUA 5E0QA 1RZQA 1I82A 4LL9A 5SWZD 2GKIA 3K6NA 3Q3GA 3PREA 3TGXA 1SDAB 4ZUTA 1LWHA 2GSGB 4UU9B 4ODWA 5IHLB 1VPOL 2NY6D 3CDGB 2YZ8A 3BD4A 1T6VN 2HJKB 4AK2A 3WNNA 4YHZH 1ZCRA 32C2A 2HKAA 1EDHA 1FNLA 3F5WA 4LCCA 4WUKH 5AVWB 1E2WA 1FQ9C 1TCMA 1E40A 4OTXL 1JZIA 4GXUM 2IANE 1R5VB 1D5MA 3FONB 5BQ7B 3CIQA 2X40A 1N7ML 4JQXC 5C0BE 1Z1WA 4KO9A 4N0UE 3T9WA 4QOKA 5BS0A 3DIFA 3RY4A 1EAOA 5KG9B 4O9HH 5FUZH 3P9WB 1SHMA 5MEOA 5E1QA 3K71A 1A14L 3D06A 3DC0A 3BX7C 5F7WC 1A4JB 1AGEB 2O6FA 1F4YL 1SMOA 3EYQC 4XN8A 4LAJH 2IEPA 3K2UH 2FGWH 2VAAA 4RDQF 1QR4A 1MAML 4N9GB 5CJBA 4V11A 1PY9A 4KO6A 2EO7A 1ZA3B 3WLWD 4U1KA 1U8NB 2IMMA 2J2ZB 4G6JL 4WI3A 5E2WL 1NAKL 3FMGH 4OGZA 4K3DL 1TLMA 3MBXL 3Q2LA 3TA3B 5AVYB 4NOBA 3IMWA 2UWEE 4R7DB 4MJ5B 3DX3A 2D0FA 5D1QD 1NM9A 4BZ1L 1BZQK 1AE6H 4WZ9A 4IRJC 4TUUA 3BPCA 3O0LA 1JMXA 5F89A 3VFVB 1JD7A 3HZKB 5BMFH 3WY2A 1DLHA 3GEFA 3AM8A 3MZGB 5FYKE 4Z7OB 3SBWA 3FQNA 2IANA 1KXTA 2P42B 3KYKL 4WI2A 1JCKA 3CFDA 1WGOA 5C0BA 3QQ4B 3BGMB 3OSKA 3O11A 4UDTB 3Q9PA 4MMZC 3CBRA 1XF3A 3WL9A 5I1JH 4FTVE 5J13C 5KVEH 1A02N 3FN0L 3MLSH 1JWMA 3VB9A 1N9PA 1JD9A 1WF5A 1QBLL 3VXRD 4Z3JA 3H0TB 2MNJB 3CSFA 3QDAA 1FHNA 2F7IA 3CFQA 4FXGB 5GS0H 1NDTA 3V2AR 1NCCL 1URZA 3FSZA 5H94A 1Q9KB 4B9FA 3OQ3B 5E99L 1DVFB 3R1GL 4DKFH 4TSCL 2NZ9D 1AY1L 2R56L 3EGXA 2JFCA 4JO8A 2YHGA 4AYGA 1OGAB 3CD4A 4UAOB 2ARJA 3BLKA 3CWGA 2UWEA 5HVHB 4XE5B 2NT1A 1N5AB 3I9GL 4GOSA 1CIDA 1PIGA 4LGSB 1E5UI 2CK0H 2K45A 1FNHA 4PRNB 2AF2A 4WW1A 2APSA 4NLAA 4TSBL 5DD5H 5M94B 1D5XA 4OIBA 4PV8B 3F58L 3IXAA 3NZ8B 5MEND 1MHHB 1X4YA 1E6OL 1INQB 2Y2YA 4HIEA 1N8ZB 2BIQA 3AW5A 4GFXA 2YLKA 4MAYB 4P06A 2ADJA 1P84J 4ADGA 2XA8H 2J5WA 1R33A 4XMPL 4PWGA 4HIHB 4A2LA 4OZIB 2D7TH 4PTTA 2WN3A 5IB5B 4Y9GA 1YMMB 4Q2ZA 2DICA 2X6MA 4X6CB 1U41A 2L8AA 3ZSSA 4YC2C 4EBQH 1NINA 4E42B 3M1BA 3P02A 1DBKH 2Y69B 3PV7A 1FF5A 1VRSA 4KX9A 4XBEH 4GQRA 4ZMZA 3K6DA 4LSUH 1U8MB 1U8LA 5F70A 4LEOB 4HC1L 4L0ZA 3ARPA 5I1GH 2IBGA 4JPWL 4F3FA 3KXFA 1EJFA 2VN4A 4PREA 4FYQA 4IU2A 4IHBA 5HGHA 2E3VA 2Y7OA 2H1LM 1X5KA 3UC0H 2IOIA 4GT7A 4OCRH 5FYKH 5DHDA 3UEZA 5HYFA 5I8OL 4AZ8A 2ITDA 5IVXB 3IAQA 4JRXE 4NQEE 5IK3B 3WBDA 5JW3H 3CQQA 1O9ZA 4L8DA 4KOCA 5SWSA 2DMCA 1MVUA 2EXYC 3ZKXC 2Z92A 2QADB 4ABWA 4PV9A 2FNWA 1V3MA 1FHGA 3TV3L 4Z0BH 1E4WH 1Z9LA 3F7YA 5E8DL 2OYLA 4FABH 2K3HA 1ZHNA 2AAVA 3L9EA 4RWHA 1MAJA 2X28A 1B2YA 3U7YL 4AI7A 1VZIA 3W82A 5E2TL 5F1IA 2VTFA 2F5AH 4ES9A 3JT2A 4DGYH 2DIJA 4QRFA 2ZUXA 4U6VH 4N2KA 4OZ4B 2GSGA 4UU9A 5D7LD 4GPVA 1UWGH 2A3TA 4IOSA 2HJKA 3VM5A 4QNPE 5HHMB 2APXA 4QXTA 3U79A 1TMQA 3IJ8A 2F1BA 2P26A 3CZNA 1S4IA 3DPDA 3K8LA 1L0QA 1Q9LB 1Z32X 5G2NA 3CZGA 5FYJL 3RWDB 4ZDHB 1UXLA 5FAAA 1MDTA 4YHLH 1TZOA 2XRAL 2FCBA 4KQ0A 4LKCB 5BZXA 1H5BB 3FONA 3HS9A 4B3VA 3T6QC 5LUMA 3FU0A 2E47A 2X4RB 4XNMA 1FFNB 1KTKE 4DN4L 4BEIA 3HE6A 5CSZA 2YOAA 4RGND 5KG9A 1LYQA 4FYRA 4X6BA 5DJ0A 3FCUB 1TQTA 1RJZB 3HVNA 1NBYA 1SXSA 2X4NB 1JHKH 2GSIB 2OV0A 3QRBA 1A4JA 4A1RA 1HJBC 3QFGA 3T0XA 3L95B 3QDGE 5IB3B 1F2XK 4ZMTA 1P6AB 5E9AA 1CS6A 2CUMA 2GEEA 1XR9B 3ULUC 4CN1A 3B56A 5BUPA 4N9GA 4WW2F 3GXUB 5B1KA 4AUUA 5IY5B 2MCPL 4XVUC 4KMQA 3BT2H 3Q8CA 1AGBB 3N04A 2J2ZA 5C7XL 2IDCA 3P77B 4ZS6D 2VLJE 3B1TA 3E2HC 1OGAE 2HKHH 3BUPA 5B1CA 1CE6B 2BIMA 3FDWA 4J23A 4R7DA 1E90A 4JM2B 4UAHA 3SKMB 1CDJA 1AS7A 3LHPH 3QIWD 4Y5VB 2Y7MA 4I9WD 2X6CA 5SX5K 5KZCB 4X9YA 5AW0B 4AKOA 3IMBA 1L6PA 3HZKA 1M71B 3LZFH 4FQHB 4H8HA 4DPCX 3ZT5A 5CCKL 2LLGA 2GK0A 1CB4A 4MZIA 4A7UA 2V8LA 3I6SA 4IBVA 3FH8A 3U4BL 3ZYJA 2DWEB 4NFCA 4ORGB 2IPKA 3M1CA 5D96B 3V4UL 2B1AL 4IIZA 3QQ4A 1MW3A 3OXSA 2PYED 4UDTA 3DURB 1QWHA 3S3SA 4XB8A 3RPKA 2OULB 2VJXA 3WIHL 2NLJB 5EO9B 4B41A 2GC4C 2AJUL 2YAHA 4A6YB 1BAFH 3Q8BA 1FG9C 3CVIH 1JWUB 3QDGA 4ZFOB 2VM4A 3H0TA 4I0PB 1GIGH 3T0VA 3FQYA 2E6PA 1PGRB 3COOA 4FXGA 2H6OA 3B2VL 3J8F7 5HDBF 5JQHC 3CX2A 3L5HA 5EUKB 1Q9KA 5T3XD 3DHPA 1DVFA 2PP8A 5JIMA 4KX7A 2C9SA 1XIWB 2ZOLA 3JWNE 1UWEL 4GNKB 1GMEA 1OGAA 5IMMB 4LCUB 3DNKA 3L9BA 4OF6A 2A9MH 3VFGH 1WBZB 1SOQA 4W9DC 1GGBH 1N5AA 4DESA 1R75A 2XHNA 2OR7A 5KYXB 2C1PB 3K7UA 4PV8A 2HUEA 3CZKA 3NZ8A 4P2CG 1H3PL 1MHHA 1YNTF 3IBOA 5D9SB 3I3DA 4M5TA 1N8ZA 3VXME 4I85A 2UXGA 3OZ9L 5LAPA 4MAYA 3LNIA 3V5DB 1N4XH 3X13B 2ZXAA 3N85H 2WHVA 4ZO7A 4EDWH 2QKIA 4O58L 4Z7NB 1TQWA 3DI3B 2R2EB 4HIHA 4OZIA 3IGLA 2X1OA 1YMMA 4NN6B 3T2OA 4HVBA 2YLHA 4AQOA 3RIFK 2HRHA 2VRAA 2G9HB 1S2EA 4MCNA 2DF3A 3MFGB 5D7KE 5SV3A 2BSDA 1GYUA 4PRHD 4TSAH 5T5NG 2NYYC 4LEOA 4OGQC 1FYTB 2NCEA 3ILPA 1JRHH 2V5RA 1RK7A 2KS0A 3ARDB 5DEFA 5HHPB 4WUUE 2B9BA 4NO0B 3ZHDA 3ZTNH 4ZPVA 2PCYA 1WPCA 2IDSA 2OLDA 3V0GA 5IVXA 4MB4A 5IF0B 2XN9E 3R8BB 5E6ID 2BVTA 1O75A 2O5XL 1MCWW 2J8UF 4IIQC 2LLNA 5IK3A 2XFGB 3VWKA 4AJWA 2QQLH 2FO8A 5CN2A 4J3WA 1V3LA 1NC4D 1UM4H 4FLSA 1FH5H 1YG9A 2B77A 4JJ5B 2EKJA 4AM0B 1BD2D 5AEAA 3TASA 4HUXB 2OTPA 3HG0A 2X9ZA 5JHDD 1CG9A 3DXAD 4DGIL 4KHXL 4AH2B 4X0KB 1IEHA 2N1KA 5AYQA 1QRNB 2R8SH 1P4LB 3VGEA 5EC2B 2P28B 5AYTA 3JWNH 4LSRL 2IFFL 2XQYG 1SJMA 3BPLB 4KAQH 2XPZA 3WNJA 4KKLD 3RFZC 5SWZB 2DPKA 3D8MA 1ZHKB 4N2IA 3VD1A 1Q9LA 3O4LD 1QKZL 2YO3A 2NY6B 2A9NL 4ZDHA 1IBFA 5LNDA 3LIZA 2R59A 3BQVA 5DRXB 3WSQH 5C08E 3WNKA 3HHMA 1AZZC 1B6UA 4LKCA 3EYQD 4J5VA 2XN9A 4TULL 1B9KA 3TA4D 2XNAB 1IFHH 1YSOA 1FL5A 3W9DB 4G1MB 4RMUA 1DLFH 3FF8A 5FO9B 4KGLA 4UINH 3MCKB 4PR5A 2AK4D 2ZCLH 3TVMD 1RJZA 2ZCHL 3DLQR 1URIA 2GSIA 1TQBC 3QIBC 3WXWH 4WKZA 5E8OB 2L7JA 4NS0A 5B1JA 3L95A 2PR4L 1XR9A 3QP3A 1NFDE 4PB9H 1OCRB 2GTZB 4IRJD 1S7QB 3M17B 1RJLB 3VB8A 1O9WA 1UZ6E 1EFQA 4MQXC 4Y88A 3QB7C 1PEZA 2VITB 5AAMC 2WLIB 3HMWL 3ARUA 1A1MA 2ZYRA 5B38G 3LIZH 3QFDB 3SKMA 2QHRL 4C56E 4ZMOA 1AVAA 3GYRA 1JIBA 3ZSTA 4XI5D 1JDCA 5D1QB 3ZW3A 1KWKA 2NNXA 1QA9A 4AEHL 3OMIB 3EO9H 1UTDA 1OE1A 5DHVB 3ARVA 3ZKND 2NDGA 4YDLC 5JW4N 2DWEA 4ORGA 3BOVA 1T2JA 4LU5L 3P3SA 3DURA 4H44C 5DVPA 5BV7L 1EHLL 4E5XG 3APNA 3GF8A 3ZMNA 2GQHA 2NLJA 2EZ0D 1IARB 1MY7A 5I8KL 4AEFA 4PJFB 4XXCC 4S1QH 1EVUA 1AG0A 1IAIH 4PJBB 3BPNC 4A6YA 2CJUL 1IGCL 4DP5X 5C2BL 1EAJA 1J12A 4ZFOA 1GZPB 4NKDA 4I0PA 3GS7A 3GRGA 2W60A 5B38B 5B7FA 4Z3IA 4XAWH 4LLQB 1FVCA 3VXRB 2WP3T 3LH8A 4RGOH 5I6KA 2HRPH 4FMKA 1FYTE 1UEYA 2NY1D 4DOHE 35C8L 3NPSB 1NAMB 1F97A 3EFOB 2VO8A 4XMXA 4ZTEA 3TBYB 4LCUA 4K07A 2BVPB 4WJ5B 3WJMA 3B7YA 5C0RL 4JKMA 1WBZA 4YGVA 3VD3A 4JQVA 4HW6A 2PNDA 3UTSD 4NRXB 1RZJH 2C1PA 4PJ7B 2VDOB 3HLAB 3AS1A 3IB4A 5AW6B 1L0XA 2ICES 2QQNH 3GLZA 3FO1A 4LDOB 3F7VA 5IJBC 2EEFA 4Q6IA 3TS8A 3U2SB 5DZ9A 1VA9A 3QZPA 1ZTMA 1FGVH 3QDJE 3AQDA 4GBXC 4FJZA 5MENB 4H2CA 3V5DA 4X6FB 4BBWA 1BHGA 2J4WL 2JJWA 2LU7A 4WHCA 3TIEA 4A6YH 2VMCA 3GTVA 4U3SA 1FORL 1L5GB 1CYGA 1QUNB 2R2EA 3HFMH 4H2AA 2WZ6A 2E59A 3CMOH 1YEEL 1KLUB 3D0LA 4JFHE 2FGZA 3L6FB 3PPSA 2Y36L 2G9HA 4M7LT 1U8IB 3RUGB 1O9VA 4WLCA 1UJ3B 2K6YA 3WNOA 3DSFL 4OZFA 1FYTA 4JPKH 1XF5A 2EXYD 4GAYB 5D2LB 1IGJB 1BIIB 1SOKA 3SYQA 1GGYA 5ID1B 3PAYA 4NO0A 5F0MB 5B8CA 2BK8A 1FZOB 2X4SB 1WT5A 3V95A 1IBYA 4M62L 4PBWD 2CA3A 1NEUA 5IJVB 4OF7A 2PTVA 4HD5A 5LAXB 5E0FA 1L7IL 9PCYA 4JJ5A 4AM0A 1KDJA 4ABQA 5I19L 3GUFA 1E28B 1YN6A 3MV9D 4D9LH 5C1MB 4AH2A 3IDIB 5BMFL 4YXLL 4X0KA 1BF2A 4JY5H 1M9SA 3BUBA 5AVTB 4BFJA 2DQGL 3GLEA 4GKLA 4U0RB 3KLHC 1J5CA 4OZFH 1IKFL 3BYYA 4PIBA 2YWZA 3IJ9A 5EC2A 3SYPA 3OLGA 2BLFA 2Z0UA 2XTLA 2NTSP 4JE0A 5H2BB 5B39A 5HVWA 3RU8L 3LX9A 4AGLA 4WIQA 1A6PA 1ZHKA 5KVEL 3GUTB 2HRLA 3KPPB 3MZTA 5D7LB 1WK0A 2IH1B 4TVPD 4GH7B 2YEQA 1BZEA 4HKJA 4IKLA 4XP6H 1E7UA 2CR3A 2EABA 3M07A 4DVBB 1EPFA 4HJEA 1RUKH 3WIIL 1Z5LB 3IGAA 3TEYA 2FR4B 3BZ4B 3H1ZA 5F71A 2XNAA 4OZGE 2PWDA 4DKFL 1E6JH 3W9DA 4HH9A 4YUEH 3JV0A 4KROD 3I6KA 1C08A 3PFQA 3MCKA 1YJDC 3MVSA 1JK9B 4I2XB 4MCMA 2CDEB 1OM3L 4IGBD 5E8OA 4RGNB 1AKJD 3C6EA 3OG4B 4X5XB 3MA9H 4PJCE 5DD5L 1E4XL 2D3LA 2XQYA 2C8NA 4XMTA 1NPUA 4H40A 4HS6A 4Y16D 3WY3A 4E2OA 1S7QA 1AAJA 3M17A 4OFDA 1IM3D 3QEUB 4KQ3H 5F7AA 2C7FA 4B27A 4KXZH 3UIYA 2VITA 1WBXA 4G7SB 4XVTH 3WFCH 4NAQA 3MXVL 4ODXB 3EJQA 2D7TL 2QTVA 4JY6B 4LLWB 4AX3A 3AQXA 4LXFA 4P2AA 4LLVA 4XPGH 5D1QA 3EYSL 3US1A 1KB5L 5B7EA 3GXDA 1HX0A 3QIWB 1QX1A 4K8RC 2AS5M 1J8KA 5DHVA 4OR1A 3W2DH 2DQTH 3KPMA 2HT4C 3H3PH 5E4IA 1C7TA 3G5VB 4HU2A 1UKTA 1JXGA 4LMQE 1T0PB 1MCQA 1HHIA 3LIUA 3O0RH 1NCJA 2WQWA 2H8PB 1AIFA 5IIEA 1T7ZA 2LU5A 3FB6B 4XPFH 3ULVL 3V8CA 4L29A 2YD6A 2RH0A 3B9EA 3EJCA 3P69A 4WV1C 1S3KL 5DJ6B 5E23A 2OL3A 3KWXA 3MJ7B 3Q6FA 3VSTA 2PYEB 1T4KA 4X4YA 3PIQA 1U91B 3VD5A 4K3EH 1OPOA 4OJFH 4M7LL 3SDAC 4QLRA 2HVKA 3VI3E 1E50A 5B38A 1JXDA 4LLQA 4X8CA 1AO7D 3EBIA 1XGQA 4P3CH 2Q8BH 2P52A 3RWCB 1UEMA 2PCPB 4ONOA 1EEYB 4F1SA 1AC0A 1HTYA 1NAMA 3TBYA 3ZIYA 3MRBB 3P40A 4WJ5A 3SDDD 1JNLH 1HYRC 2BVPA 2J3SA 4NUMA 1MELA 1JGEA 5CGBA 3B4NA 4TNWF 2NY3C 3P4MB 4ELDA 4NRXA 3GSNB 4P2YA 3SDYL 5F9DC 1QABA 3UABA 3HLAA 2JK5B 2WWMD 3KCPB 3LQAH 1PKQB 4NC1C 5IFAH 4E5XA 4QMEA 3U2SA 1BG9A 4M56A 4JRLA 5DVMA 5I6MA 1I8KB 1S7WB 1SEQH 4UOW0 4BFEA 4PWFA 4AJVA 5MENA 1UWGL 3ESMA 2LFGA 4I1PA 4X6FA 5E8NB 2OL3H 4RQQA 1FGNL 2PCFB 3QR2A 2DMHA 4YX2L 4C8XA 1NUNB 4U1NB 4X0NA 3SOBL 1QUNA 1FCCA 3LXCA 1NUFA 1DQLL 5BZZA 4AT6B 4YHLL 1KLUA 5JYLA 5E2JA 2ICWI 2MQ0A 5C0AE 3WYRA 4XN4A 4JX0A 1ZLUH 4I18B 2ZICA 5DXWA 1EO5A 1JPTL 1NAMH 1U8IA 3VI3A 4BUHA 5IWLC 1LK3H 5E4OA 1U2HA 1WWCA 3W0WE 4ZMAT 1UJ3A 4U1MB 2W65A 1NSNH 4PJ6A 2K70A 3T0WA 5D5MB 4I77H 1MIMH 1T7XA 2WLKA 4GAYA 5D2LA 4PRHB 1MJUH 1IGJA 1VZHA 3Q6GH 5CEYB 1BZ7B 4I89A 5ID1A 3RPBA 4NJAL 3UBHA 3PU7A 4KKRA 1CO1A 4OLWL 1FZOA 4JFZH 4KXAA 5IESL 3KWTA 4UB0H 4X6EA 3ZL1A 1B0WA 3B9DA 3M6DA 3TYGL 3FPYA 4FRWA 5KSBB 4L2LA 1L3WA 2OI9C 4JANA 3C8DA 5LAXA 5E6IB 2QVFB 1ZE3H 1J0YA 2XZQH 1AOZA 1V5JA 1MAKA 4S1SL 3G6AB 4RGNE 1NC4B 1BM3L 2ZOKA 2UXTA 2PR9A 1E28A 3B7SA 4P23C 4PLKC 4Y1TA 2A6DB 3N43B 4BSWA 3P3TA 3IDIA 3PABB 4G70B 4LNVA 1J5IA 4TUKH 1BD2B 3FQWA 4F33B 1M6UA 5JHDB 3DXAB 5C0AA 2DD8H 2E8YA 5J6GA 2XYBA 3RNKB 2VYRE 3EBAA 3HC2A 4W9ZA 5H2BA 3VRIA 5GGSB 3W0WA 1YNKH 3NMEA 4Z7UE 2EVIA 3OAYH 2MHAB 3GUTA 3KPPA 2DQJH 2IH1A 1BAFL 2BSEA 1IE5A 3W5MA 5TDPA 4P46C 2EDWA 4R5VA 1U42A 4WK2B 1RIHL 4FXKA 4H0LC 3IPFA 3O4LB 2XT1B 3QUXD 4PRDB 5IQ9B 3S8GB 1Z5LA 4S0SD 3PGFH 3S36L 2O26U 1YEJH 5L4JA 4HBQA 2LVEA 1LMKA 2RHEA 5SV4A 3WNPA 3L5WB 5DYFA 1XL6A 1BXVA 1XCXA 2EXWC 2SEBA 3BAJA 4MJ6B 3JZ7A 3MGOB 3Q43A 1DQKA 1KWGA 5DUBB 4ODTH 4YBQC 3RL1B 4U1JB 1HXMB 1IGTB 4K55A 1JK9A 4I2XA 5FA3B 2CDEA 2EDXA 2IV9A 2O5ZH 4XCYA 2Y7SA 4H8WC 4N2EA 3MRNA 4Z7QF 2UY7B 1YA5A 3A23A 4X5XA 2AK4B 3TVMB 4JRWA 2BC4B 3IM1A 1L9RA 3T1FA 4BHUI 3ATDA 2Q1EA 3VGAC 4WTXA 4YR6B 1TJMA 3OAZK 4Q14A 2IBBA 1IBGH 4AKPA 4R3SB 3FOMB 2X0WA 1N4XL 4OCMC 3L2MA 4IRJB 1XDTT 2H6PB 1NGQH 4ZX4A 4QYOA 5JIPA 2QJDA 3H54A 3VFSB 1UACL 1OY3B 1E5BA 2ZUQC 4EDWL 4MDJB 4ODXA 3AY2A 2BPBA 4PMEA 3WE1A 1F11B 3S5YA 1FDLH 3KL3A 5CZVL 1NGZB 1EDYA 1C5DB 1KCVL 3T6WA 3VXNB 1W16A 3QIWA 3SE3A 1KT2B 2EINB 2AW2A 4P57B 2WSKA 3UYPB 5CF3A 4ILDA 2ZD0A 1W6WA 2YRLA 3B7TA 2B2XL 5KANG 5BOPA 5J13B 1S9XB 4L2YA 4BH8B 2H0JA 4FL4C 3KLAB 1U3NA 4R7VA 3BVWA 2H8PA 2ZKHL 3WTWA 3FB6A 5KBKA 3QE5A 4LRNL 3N41B 4XPTH 4YZFF 3R4RA 4R2GC 5DJ6A 1Z9OA 4ENZA 2R0LL 2GJ6E 1IC1A 2AK1H 3A4AA 4BFKA 3ARBD 3T0EE 3U6RB 1OV8A 5J12B 4FCHA 3L4UA 2DM3A 4GQZA 1LO2H 4GG6F 3S3DB 2X6AA 4RMSA 5CU9A 1SBBA 3QUYC 5IM7B 3BQUC 2WNKA 5D5ME 3MLTB 1MFBL 3RWCA 1UQSB 3OVUB 1Q94B 2ESVD 3EF4A 4QF1B 3II1A 3QRGH 2P44B 3SDXB 2VLMD 1AFVL 3MRBA 3TO4A 1DSYA 1ZKAA 3V0VB 5L2JB 1JVKA 3AWEA 1W9XA 2NY1B 3FUEA 4P3DB 5I18H 5BZDB 2GSMB 3BZDA 2MKLC 2YUZA 2YIHA 3P4MA 4KDTA 5H37G 1FIEA 1JNNL 3UZEA 2ZJSL 3AUWB 4AL8L 5JPMB 43C9B 3KCPA 4XO5A 3UTSB 1VFBA 4DETA 1T0MA 1I8KA 1S7WA 4JO5A 1MLCA 5A6IA 1N64L 5E8NA 3QG7L 4GW4B 5HDQL 1ET8A 1CGSH 2PCFA 4P9ML 1UM6L 3UO1H 2DLHA 1JYNA 3SQRA 1J11A 2OR8A 1DE4B 3BSZL 1ORQB 4N1EA 1G43A 4RFNB 2OTUB 3WSQL 4TOYL 2PF6A 4XPBL 4AT6A 2KLTA 2J12B 5FM5M 1HKFA 3T0EA 4N2OA 3FB8B 3CX5J 4JGJA 5GRZA 4Z3EA 1KLGB 1MJ8L 4I18A 3RTQC 4MLIA 1AHWC 5T3XH 1ANUA 1DLFL 5CEXB 3NAAL 1GJWA 3NRFA 4U1MA 3RJQB 4UINL 4ELKB 4APQB 2ZX8A 5D5MA 1M1XB 1NMAH 4PRHA 3WXWL 1BZ7A 1UT1A 4L3FA 4R97C 1T1WB 1PFOA 1TPXC 5IKCB 1DBBL 4L8BA 3PQYD 2VGLM 3C5ZD 5CP7B 5DUPL 3RWGB 1ACYL 2Q20A 4L3AA 3WHE1 1I7ZB 3CK0L 3LZPA 1NM4A 3KLQA 3DV6A 5KSBA 2NY5L 4G3YH 1F5WA 1FIGH 1MCJA 2VT0A 4O5LH 3U4EA 3KLHD 1PPIA 3DECA 4L9DA 1SN2A 5KVGH 1MCCA 2DJSA 5C09E 3G6AA 4PS7A 2H2SD 1MIEH 4MCYA 3NZHL 4J8QA 4UMGA 5C71A 3PABA 3HFFA 3GEWB 2VUYA 4PJEE 1BD2A 4L5FH 4OI9A 2FTAA 3MX0B 1MLBB 3MV9B 5JHDA 3JV6A 1NFAA 2FYYA 4HIQA 1RZ8A 4HCRA 3TNMB 2NX5E 4UZSA 1UD6A 3L2NA 4KWUA 3B2UC 4XVOA 1V8HA 2VW7A 3O81A 1ZS8B 2VLKE 2I25N 5GGSA 3F7QA 5AW8B 2GEQA 2AQNA 4HK3J 4KBPA 3S35H 3TBWB 5L9DL 5A2CA 3GMOB 2FAUA 3BP5B 1SN0A 4UCFA 1UCTA 2C3XA 5EBGA 4WF7A 1Q0XH 4JDZA 4KKCC 1MFVA 1QLEB 1CDIA 1HILA 1PZ3A 1CBJA 1ECZA 4KITB 4PJ8C 2Y72A 5IQ9A 3GSUB 12E8L 4XAWL 3FULA 1FH2A 1OGTA 5E56A 1OB0A 1R3KB 2HRPL 3L5WA 5CD5C 1Y07A 2V8MA 2VSDA 3D08A 2F1EA 3MGOA 3OHMB 4P2RD 4HAKA 5CZRA 1Q1JH 5DUBA 3RL1A 1HXMA 1E4XI 1IGTA 2Z7UA 4JDVA 5FA3A 5K9QI 1UFUA 3MROB 2UWEF 3DX8B 4MNHA 4URKA 4KROB 5F7EH 3C60D 1KJ3H 4HCRH 1I8UA 2XZCH 2BC4A 4H1LB 1H0DA 4CC1A 2X9WA 4KMTH 4PJEA 4IGBB 2EIEA 3E2HB 3FKUS 5DK3A 1AKJB 5D55A 1QLFB 3BEWB 4NUQA 4R3SA 3H9SE 4ZOBA 3RI5K 4Y16B 4PGJA 5TK2A 4K8RD 4IRJA 4PS8A 1W72B 3N42F 3VFSA 2HT4D 5HDOA 3EUUA 1J9QA 4OV5B 5EZIH 3R8QA 4LIQH 4M02A 5FGCB 1X9UA 4M5YL 3RVUC 1B0IA 3VXNA 3C2AL 1IEBA 1ECYA 5ISZD 2NW3B 2QV2A 1OQOA 4P57A 4AC2A 2FATH 7FABL 3D51A 3T1WA 2FEDC 3NESA 3SDAD 2F5BL 1Q72L 2ICWJ 1MFAL 3BWUC 3MNZB 1XGRB 5JOEA 5I30L 1KYUA 1QNZH 3EOBB 3GJFA 1F8TH 3Q8FA 1QW9A 4NI6A 5HHNA 5GZOC 3W11C 1MFUA 2NY0C 2DWXA 2EO9A 2QPDB 4G8GE 2NY3D 1J8RA 2YFOA 5DZOA 5IGXL 2VRQA 4RZCB 5IM7A 4W70A 3MLTA 4FQXD 2GTQA 3H9SA 1UQSA 4M43H 1JMZA 3KL5A 2NQDA 4KO5A 3BH9B 1EBAA 4QF1A 4TXVB 1AO7B 2ZQKA 3SDXA 4XODA 3W56A 1D2PA 1KJ2L 1FFRA 2Y07H 2VJ0A 4P3DA 1SYSB 5KTEL 1VGEH 3NFNB 5BZDA 4UQIM 3HUJE 4GRLC 1NCBL 3SDDB 2IAAC 4R26H 2BY0A 3VGDA 5ANHA 4PRPE 2EDTA 1MXDA 1QYGL 3LEYH 3MCLL 3BUDA 5KVMC 4GKZA 4G6FD 2CKBL 3UTSA 2OW6A 3GJFH 4YDMA 5LCVA 2KYIA 2A6JB 4HU8A 5I15L 4HFWB 4I3RH 1JI1A 2ICCA 3SE8H 4E0RB 3NSFA 1YUHA 4GW4A 1I9JH 3ASNB 2XBDA 2CO7B 3KBPA 4P4KD 4OLEA 4WI4A 1DE4A 1PLGH 1BYPA 5MEQB 1F4AA 2OTUA 3M45A 3CAFA 1GPOL 1IEAB 1WGVA 3CV5A 3B3IA 4IK6A 1R34A 5CGYC 5FS5A 5AAWC 4YUEL 2ZSVB 3GS0A 1ZEAH 5CEXA 3GIZL 2FX9L 5JPNC 3B5HA 3LKOB 1VHPA 4JHBA 1M1XA 2H7WA 5H37A 3VW3H 2NSXA 4LBEB 2VLLB 3N2JA 4A7SA 4PVLA 1Q1PA 4TYUA 4G42A 5F9OL 3HG1D 1YO4A 4UOZA 5IKCA 1E4KA 3ZY7A 1OCWH 1OTUD 3RWGA 5AB2A 3EHBC 2WMPA 3HUJA 4TVPE 5LCVH 4QUOA 4RCAA 4L18A 4WFGE 5I1DB 3W1ZA 1C8PA 2X05A 4PRPA 2Y1YA 4XP1H 4Y2DC 2LVCA 2XTJD 1BVOA 2FUTA 3ULUE 3B8SA 5GS2H 3L4XA 2AJYL 2EVJA 4OAWB 2HX7A 5CJXC 4L48A 4K5NA 3MAWA 4ZMQA 3K1KC 4Z5RA 4RNRB 2R4RL 4ZT1A 4OCNC 3D9AH 3MX0A 1MLBA 3FQUB 3MV9A 3OKMB 4Z7OF 1CXKA 4KZCA 2Q8AH 2WNXA 1GOGA 5EO1B 3TNMA 4ONFL 3UJTL 5H37H 2IO5A 5A40E 1SVBA 3SJVE 1GGIL 1ZS8A 1HVXA 4ZG1A 1I1AD 3PL6D 2FT8A 4FAAB 2F7PA 4XC1L 2W95A 2EXWD 2APBA 3TLRA 3BP5A 4IOFC 4IJ3B 1WE5A 1FZKB 1VFAB 1OAQL 4YBQD 5CEZD 5K9KB 1RUQH 1F4XH 3HZMB 3SY6A 2BNRD 4JY4B 4JKWA 5KSAD 1D9KC 4HJIA 2G2PA 3FUJA 2CO6B 4IMLB 1DN0B 1U93B 3GSUA 5I5JA 3VGFA 4A2GA 2J44A 1HCZA 1P6FA 2R23A 4P3CL 2F8XC 1R3KA 4ZUWB 1LQSR 1NJ9B 3QNYB 5HYSG 4CW1A 3BO8B 3QUXB 3QJZA 5SX4I 4DWHA 2OJZL 5IUSA 4M8RA 3LRKA 2G2NA 1LWRA 5EBWB 2HCZX 2GJZB 4YOKA 5F96L 2HLAB 3KYNB 4YDIH 3MROA 3DHUA 4PCSA 3U6XS 4F7MA 3IDGB 2E56A 5E4EB 4WI7A 2VW4A 4F80A 4OGAD 4AVHA 4IGBA 1X5ZA 5FGRA 2Z1PA 5ABDE 1AKJA 5C0NC 5LXGL 1JF6A 3LN4B 2BNUA 1QLFA 4HCIA 3DK2A 1MPAL 4UTAA 2ZP9A 3TFKC 4Y2LA 4LL1A 1W72A 1IM3A 2MIZA 5EF2A 1D7CA 1QLEH 3EDJA 4FQPA 5HHVL 5JIIA 2XG4A 5T1MB 4LCIH 2QHLA 4OZIF 2YXMA 4TVPH 5CIPA 2EDNA 5TDOA 3X3GH 3S9DB 4NWUH 3O41B 1RZFH 5EDSA 4OUUB 2KHAA 1XGZA 1ESOA 3FTYA 1OANA 1CF8L 3LKQB 1KCRH 4ZW6A 1P5VA 5HHQA 3ULUH 4WVRA 3K80A 1NSNL 4B97A 2XPGA 2WP3O 4WNQA 2DI7A 1MIML 2CSPA 4JFFE 3QUYD 4FFYL 1YY8B 1XGRA 1T1XA 3MNZA 1RIVH 2VR8A 3BQUD 3EOBA 3QWQB 5DJYB 5D4QA 2HAZA 4QDGA 3B1UA 2YPVA 5ESAB 1KC5L 3ZDZB 2L3BA 1FL6B 2EEBA 1OP5H 4KKAD 5IVXF 4UTAH 1RZ7H 1XSOA 1CE1H 1T1YA 3AG4B 3AITA 2CIIB 4V2CB 2J1YA 2XXCB 3OKLB 1KCUL 5BRZE 3VFPA 3ARBB 3D09A 1E43A 5EU4A 3TBTB 4DEUA 1KV3A 5D6CB 2RIKA 5C0GB 3O3AB 3RPIB 4BH7B 2CGRH 1MXGA 5CIPH 5DK0B 3FFCD 1DJXA 2HSIA 3W5NA 5FUCC 5I26A 5DO2D 2P49B 4P2OD 1IM9B 1SYSA 3NFNA 3FOLB 3EH3B 3KBHE 3EZ8A 5FYJU 4LOEA 4XMWA 4S1DD 3LS4H 5DQDH 1A6WH 4JB9L 3VVVA 2EC9T 4ZJ9A 3EYUH 3L81A 2LQRA 4CAGA 2VUKA 3NJIA 3PV6A 4E0RA 25C8L 4H5SB 3D18A 1H3GA 1U3JA 3RTQD 2WQRA 4G8IB 4JM0A 3ILEA 1DQDH 3BESR 4Y4FC 5JZ7D 2G60H 1ZSDA 1MEXL 2BDNL 5ADPH 1OL0A 3HJEA 1G9MC 2HFGH 3EW3B 1QPPA 4EXKA 3WKNA 1IEAA 1Z9PA 2E8ZA 5CS7A 3BAEH 5EIVA 5K39B 3WN5B 3CVHB 5BRZA 2FX8H 3BP7B 3J7HA 1Y7VA 5CN3A 4ANWA 4CU7A 3RVTC 1ZHBB 2CR6A 4IIQA 2NY4C 4D9RE 5DMIH 3KWWB 5J6SA 4F15B 4N2FA 4HXBL 2UYLB 3OSVA 4R4FL 3PWLB 2VERA 3DGDA 3PQYB 1T5WB 2VZ3A 3C5ZB 1NGQL 1Z7JA 4JN1L 5IQNA 3RX5A 3B2UD 4OCYH 3MUZ1 1QR1B 2C3VA 2FX7L 4XX1E 4YLBA 4JZOB 4YDNA 1LO4H 1GY1A 4HBCH 3O3BA 1KXVC 4MYWB 1SF5A 1DDHB 5GGVY 2BVOB 1G9NC 1KIRB 1U8HB 3HB3C 3OD3A 2IAMC 4M8VA 2E7LC 1HIML 3LH2L 4KKCD 1QAWA 5EO1A 1CBVH 4OGXL 1TZGH 1YEWA 2VXVL 2WNGA 2HH0L 4MFHA 4LSQH 2P4AB 4UYQA 3LMJH 3IJYA 1I1FB 1JDAA 1U4FA 2H9GB 4LCWD 4ERSH 1TF4A 1KMGA 1RMFH 3SOTA 2G4EA 2EVGA 4FOMA 4R4NC 3MN8A 3TT3L 5FB8B 3FSOA 1FZKA 4P2QD 1IGYA 1UURA 2CMRH 1BFOB 2H41A 3H2PA 2PXYB 1AGFA 1IC5L 4LCYB 1SZNA 4WTWA 5EIIG 5T1DL 3SGEI 3ABMB 4KVPA 3UP1A 1S78D 1JGLL 2MKWA 1M1SA 3V6ZB 4IMLA 1DN0A 3GI8H 1VFOA 1NKRA 1R0AL 4PRAB 2Z93B 2E7MA 2IADB 4ZUWA 1NJ9A 3QNYA 3UAJC 3BO8A 3QUXA 1B4JL 4F7TB 1CTMA 3QRGL 3IWVA 1TCRB 2ORBH 3FNKA 4HD9A 3N6YA 4C59B 2YC1A 3L5XH 3O6MH 5EBWA 4ZUSB 3HG5A 3U30B 4N25A 3ZHNA 4JZJB 2HLAA 3KYNA 2VISB 4P2RB 4ICWA 5DT1H 4B9PA 2XQBL 3ZTEA 3RVVC 4HPYH 4NKQB 5D6DC 2KI6A 3JUZA 3N5AA 1BJ1H 2J88L 5AAMA 3C60B 2C9XA 3RVUD 2XKUA 5BVPH 2ZUWA 3E8VA 1MFDH 5ESQB 4ZQTA 1ACCA 3O4OC 3ME0A 5EIIB 2C4XA 3UO1L 1SY6L 4ZODA 1QBBA 3LKPB 4MQTB 2X0UA 5T1MA 2ESVE 3VQLA 4Z7NF 2Y7LA 2VLME 1WZ1H 2CJTA 3I02A 4Z7AA 5HYSA 2IWEA 3DYOA 3O41A 1NC2A 1YEKH 4OUUA 4L9LB 4JO1L 3ET9F 2OW7A 1I7UB 4LPXA 1DVSA 3LKQA 3D48R 1PX3A 5ISZB 4OFYD 4XXCA 2VQ1A 3CFUA 1E0OB 3BC9A 3Q2WA 1YY8A 4WI5A 5H4YA 5DJYA 2K8MA 4QHMB 2BY3A 3UEQA 3SDAB 3SYOA 5C9JB 5ESAA 4JKKA 3ML8A 3ORJA 5EORH 1KZQA 1R3HB 3AXLB 4JFDE 5DS8B 3QEHA 1FL6A 4YFDB 1J05B 5F6IB 2V7HA 4BZ2A 4J3BA 4X80H 2Y5QA 3Q0HA 2XFXB 4LL4A 4G3YL 4GRLD 4OM1H 3BE1H 3P9MA 1IIIA 1GHFL 3OZLA 2FB4H 4N2CA 5IHUH 3ZMRA 4D8PB 4ENED 4QRQA 4BH7A 5DRZB 2E9IA 2NY3B 2QLVB 1KZYA 3SE6A 1VDGA 1CLCA 3S0PA 1T7WA 5DK0A 4D0CB 3VD0A 3FT2B 4NFBA 5DLMH 1G7HB 4X9BA 2H32A 2V5YA 4FQXB 1A7PH 5D71H 5DMKB 1S5IL 4NM8H 2ESVA 2J5LB 4OD1L 5F7LB 2F9BT 1UENA 4FFWD 1KFAH 3FXIC 3QDMD 4GBXA 4OKDA 5AYUH 5GRXG 5T5NF 4RH4A 6PCYA 4ZD3L 1F3DH 4M7JL 3QWNA 5CGYD 3V4VH 3QJFA 2GABA 3HNSH 4G6FB 4H5SA 4TTGA 4G8IA 3O45A 1RK0B 3Q5OA 4CBPA 1COBA 5L8LB 4GAGH 2O72A 1AQDB 1G4RA 5DR5H 4BZ2H 3VXPB 4LOFA 3FCTB 3VXQB 4Y5YB 3V52H 3AMLA 4P4KB 3K0YA 2CHWA 2D0GA 2V17H 4NHUB 5DVLA 5K39A 3EHBD 3WN5A 3CVHA 1CIUA 4LNRB 1M4KA 3VG9B 2H32H 4LOUD 5INDB 3D0AA 1Q1JL 5GGUB 4LVHB 1WBYA 4E9VA 1BEXA 2M26A 3MJ9L 5KYYA 2Z6FA 3FO9B 2DMGA 4R90H 1OWRM 2EC8A 4B0MM 1C16B 3ZE2E 2V37A 2XZCL 4KMTL 1CXFA 2UYLA 5HTSA 5GHWL 3H7BB 3ZDXB 4RSYA 3BUTA 3HG1B 2IV8A 3PWLA 5T33H 3NQIA 1T5WA 1V05A 2JJSC 3C5ZA 1BXAA 5C0CD 4N1HB 1T1ZB 3GO1H 4GO6B 3WD5L 3INUL 4U05A 2VDKB 5DRWA 4NHCH 3UOAB 2X1XR 1XGPA 1T21B 1MFCH 1O6VA 2XTJB 3F6JA 3GSOB 4NM4L 5EZIL 4A2EA 5I66B 2AGJH 1QR1A 2IG2L 1K5NB 2EO1A 4RFEA 5CLTA 4QJ5B 2QT6A 3FW6A 4BSVB 3BSHA 1DDHA 4W93A 2BVOA 4BQCA 5FO8A 3CVHH 1ILUA 4NDMB 4JR9H 2ICEC 3ALWA 3HE7D 4OCSH 2APFA 1ZJAA 2VL4A 3CC5B 4C58B 3TCXA 1TOXA 5F9JB 4G8EA 1ET7A 2H9GA 5EEYA 3FFDB 3WHXA 4NLHA 4FE9A 5FB8A 4HJTA 1MWAL 4LLAA 1V3JA 4IDJH 1AZVA 1I1AB 3JTSB 3PL6B 4PJFF 2EH8L 4JFPB 5JXAL 1VACA 2IOOA 2QVKA 3HKZA 4LCYA 2XYCA 3MRHB 3EJJX 2FBRA 5FW7A 1BBJA 2DKUA 4MZ3A 2H2PD 4PRAA 1MCLA 2Z93A 1WTGT 2BNRB 4N0RA 5KSAB 3CXDH 4G2AA 2X38A 5MP6H 5C0ND 4F7TA 2AMGA 1TCRA 3CU7A 2A0LD 4LP8A 4ZUSA 1DUZB 1PSKH 4CU6A 4XP5L 4ISVB 4JZJA 5L7XL 2ZX5A 3TFKD 1MRDH 3MR9A 4P2RA 3GBNH 3WO3B 1UVQB 4QRRD 4OF8A 1J0JA 5B4MC 3THML 4HWBA 4A66A 1K5WA 2J72A 5EOTB 4GKOA 3LEYL 4HKXA 1M3JA 3H4FA 4HGMA 4QRAA 4WHTB 1ZY9A 3C60A 15C8H 1RVFH 3MOAH 3W9EA 5ESQA 3RAJH 1AXTL 2E7DA 3TJHC 2WO3B 4DCQA 3ISYA 3SY0A 3LKPA 1BQRA 1ZIAA 4MDIA 2V9UA 1JHLH 1BMZA 3VFNA 1YEFL 1BPLB 2FQDA 5AZEH 1YEDB 3ZR5A 1ZLUK 4FL4B 4ZNEE 4FN0A 1I7UA 1T2QH 3DETD 5I5IA 2GHWB 3K4ZA 4XBMA 2ZXWB 2K7QA 2WCSA 4WV1A 1I1YA 3VI3F 4UQ9A 5FFOA 3S97C 2JELH 4OVUA 2B5IB 3VW3L 1P53A 5I1AB 5CR1A 2VZ1A 5IMKB 2MWCA 4M6NH 4HWBH 4U6TA 2R1YB 3SDAA 5D2LF 5LNGA 5C9JA 3H42L 1ASOA 1PQZB 2EDKA 1OCWL 1R3HA 2CPCA 3AXLA 3BQUB 5DS8A 4XZ4A 2ZXDA 1J05A 2CCVA 4Z3HA 3FO0H 4IMKC 2EYRB 4CKVX 5FK9B 1SN5A 5T8IA 3RRQA 2WC7A 2XFXA 3PWJB 1HOCB 2A99A 2BWDA 3KPOB 1VADB 3QZLA 4D94A 3IGKA 2VRKA 4PM1A 3BVNB 5DQJB 2DWYA 3DTUB 3GLAA 4K8RH 2ADIA 5DRZA 4D0CA 4M7ZB 4HFUH 4HK0B 3TWCH 4QRSB 5FDYA 1WIUA 1G7HA 3VGBA 2KZKA 2OQJA 4IRSC 5GRJH 1A0QL 2HVJB 2WANA 5DMKA 1N2RB 2NQ3A 3NOIA 2GPZA 1VLXA 2D7NA 3FFCB 4NQVB 3D9AL 3SBQA 3ENEA 4Y4FD 1VCAA 3MMEB 4X4XB 1NCDH 1O0VA 4P2OB 4ZNEA 1NCGA 3RYMA 1BX2A 1PEWA 5EN2B 3A21A 4EVNA 5GSVB 5HXMA 4FFTA 3U46B 3HNTL 4WAFA 3NRQA 1D6EB 1DO6A 4FNLL 4XP4H 1FZMB 1G1KA 1AQDA 4HJJH 4RGMC 4GIAA 3LRLA 5LHDA 3U1PA 1RUQL 3IU3B 2Z31D 3VXPA 2HFEB 3RTQB 5IWLA 1E9PB 1EO8L 3VXQA 4RISH 1AZBA 4WENB 1T66C 5M95B 3FTGA 1XV8A 4XGZA 5F7DA 1TR7A 3TWYA 4ELMB 2CQVA 2VDMB 4FHJA 4M6ML 4P5KA 3UGEA 3FBKA 5INDA 3CSGA 1X6LA 3HC0B 1IKNC 5GGUA 5CO1A 3TN0D 1IKOP 2VN6A 5DMJB 2BP5M 5LO7A 1JGUL 2QVMA 5D4IA 4GAFB 5BW7C 7CGTA 5FO2A 1F1GA 2GBVA 3H7BA 4OU3A 5D1XC 3HG1A 1DYZA 3BUYA 2BNRE 4XNZC 4AK1A 5IB2B 2CLVA 4E41E 4FDWA 4NOFA 5HGBB 1IBHA 3QPQC 4N0FB 4N4YB 4QY8B 3UZVB 3QUML 3MV11 1LP9B 3MLVH 1CU4H 4MXVE 4JCWA 4KRPD 1T21A 5I66A 3GSOA 5T5FA 1D7FA 2FLRT 1NCTA 1U8JB 2BY2A 2I60L 4LHUD 2XU9A 3MO1B 4QTHB 4XTRD 3B5GA 1K5NA 2ITEA 4NWUL 4GQPH 3US0A 2N56A 2F7QA 1RJYB 4Y1AE 2FHBA 4NQDD 3UFIA 4NDMA 1Z6JT 2BWQA 2NYZA 3TTSA 4LSTL 3L4YA 1DANU 2LR4A 2W5PA 1V7MH 2WXGA 5F9JA 2C1OB 4NZUH 5FDWB 5A6LA 1SLXA 4HAGA 1HH6B 3Q5TA 3QWOB 4NUGL 4UT6A 5E1AB 3UAJD 1VKXB 4XAKE 4LCWB 1LILA 3MLPA 4J2XA 3MQIA 3JTSA 3R7RA 5HJ3B 4NKMB 5I1EH 3QCUH 1JTOA 3MRHA 4W9HC 4XWGH 3TYFB 5HYEA 3VFWB 3DOSB 4P2QB 3VCLB 1YPZB 5KYNA 4TUJA 1UCBL 2BNRA 4PUBH 5T5FH 2VZSA 3WHE0 2G0KA 4E41A 4AMWA 3KS0H 2EUZA 3T77B 3DARA 2F2HA 4MXWH 2YAFA 3VVWA 1DUZA 4ISVA 1IC7H 5BVJB 4LSSL 2X5PA 1ZAGA 2ZZUT 1UVQA 2I69A 1JK8B 4HS8H 1PVHA 2NW2B 3HBPA 1CVRA 4JPQA 3X1NA 4S10A 2BSBA 1MHCB 1LO5B 1YY9C 2AXJA 1F42A 1TJGH 2HTLC 4UV4L 3TP4A 4UT6H 2WXIA 5FM4A 4XNXL 1YECH 1F4WH 4W9GC 4MQ7B 1FO0B 2FEEL 1P2CB 2XIDA 4QAWA 3E1F1 4ZMPA 3KGUA 3UGXA 4ZOAA 3A4FA 2G60L 4BKLA 1S9YB 7PCYA 5DJ2B 1XCQB 3L3JB 2CBQA 5C6WH 5GS1C 4R6UA 2O5YH 4U1GB 1YEDA 4GMSL 4H8WH 1JUFB 3V4PH 1FG2B 4YDZA 2WZ5A 4TQEL 4AW7A 1JPSH 4HF5H 3FAXA 1MUJB 2DLGA 3UBFA 2YXWA 2VM9A 2IOMA 4QRTA 5TJWK 3OBAA 4GMTL 2UXFA 1EEUA 5D5MF 5FX3A 5KSVA 3GXFA 5E8EA 5IMKA 2OXHB 5EOCH 2MRYA 2Y6SC 3HHRB 1CZ8L 1PQZA 4GSRA 2I7SA 3QUYA 5K59E 3OPZL 1WDAA 3BQUA 2CRYA 1WFNA 2BY1A 3PHOB 4LQFL 1JZEA 5IBLC 5EZLB 2HG5B 4M1CD 2EYRA 4MD4B 3FH7A 5IVOA 2O1AA 4LRIC 3PWJA 5KSBF 1GOFA 3CDFA 3KPOA 1VADA 1TTRA 2J6WA 3BVNA 3IBEA 3WTTA 5DQJA 4DTGH 2D4FA 4GRLB 4I0KA 4KHTH 4OD3H 1NWOA 1KBGH 3DVIA 2FZ3B 1RK1B 2YD3A 2H5UA 2XBZA 3N43F 5E00B 4OCXH 4ABVA 5IG7B 1QI4A 2GK2A 2X4QB 1I9IL 3F7LA 3MMEA 4GXUN 4X4XA 3PWNB 1ND0A 5E6RB 1Q4NX 3POCA 5F7KC 3R7QA 2WGXA 4M6OH 3QDMB 1LDPH 3RY6A 5TE6H 4WWNA 2BIOA 5L0QC 4ERSL 4QGTA 1FNEB 1RMFL 2VMJA 3LRHA 5GSVA 5I1KL 1K3ZA 5D7IE 5K5YA 4GAJH 1D6EA 3CFMA 1FZMA 2VC2B 3D3VE 4TPRH 3IU3A 2HFEA 1FWXA 3QUZC 1ETZB 3RTQA 1BWMA 1I3VA 1AHWA 4YXHL 3VG0L 3L45A 4M61B 4B60A 4PY8J 1AG6A 1T22B 4XMKH 1UH2A 3NBNA 4N0YH 4ELMA 3IDJB 2W81C 1MFNA 3LN9A 1S7UA 2XWZA 3NFSL 4XCCH 5IEHB 1TZ8A 3EYOA 3HC0A 2FH6A 3CLWA 3L5XL 2VXTH 1BREA 4DP7X 4M9PA 2AABL 1FRGL 5EO0B 1TQSA 4MVBC 4QKXB 5DT1L 3P2DA 4HPYL 5JLZB 4M8UA 4YWGL 2V2TB 4TLUA 5HYIA 2N0MA 4PJEF 3TF7C 3IMTA 1BBDH 5FOBB 2YPLE 4D9QD 5IB2A 5HGBA 3W38A 3WXVH 4N0FA 1HI6A 3AFLA 4QY8A 3UZVA 2APVA 1LP9A 4TVUA 1CLYL 1KV7A 5C0CB 4K23H 1U8JA 4N90D 3MO1A 4JHVA 4G7RB 4N6RB 4N2DA 3D3VA 1F6AB 1PNCA 3D4CA 4XMLL 4HKBA 2D03H 1NCAH 1RJYA 5HI3D 2L4OA 3SQOH 3V0WH 2FBJH 5TF1H 2MQGA 1ZDQA 2F53E 5HGAB 4I7ZC 2FO4A 3HR6A 2XVGA 1G7LA 2C1OA 1HYSC 5IFJB 5J3HD 3WS6A 3HE7B 3MYJA 5FDWA 4LKXB 5FV2A 5E1AA 1TUPA 3U25A 4HJUA 3IDMB 4PJ8A 3SGDH 2FL5A 2E0PA 3N41F 5D2NB 1BEYL 5HJ3A 4NKMA 3ZZSA 1KPRA 3FB5A 3RVXC 3TYFA 1O7DE 3VI4B 5I1CL 3BDXA 3MJ8A 4KZ0A 4GQ9H 4UT9L 5DURD 3ZRFC 3DOSA 2OMWB 4N2BA 3MJWA 1PY0A 3VCLA 1YPZA 3FRPG 4POZC 1UZ8B 3F12A 3UAAA 2UV3A 1DJIA 3MRMB 1GAFH 2YPLA 3UTPE 4IKNA 3ZBMA 3D52A 3CFEB 2CALA 4AUYA 4ZSOB 2OMXA 4EIUA 3T77A 2VABB 4HPOH 4K7PL 2FJHA 3SDXF 4GEJA 2VQ4A 4ONGH 1H6TA 3P2BA 5HI5D 5LG1A 4HUUB 2VDPB 4BFIB 4D0BB 1J0IA 3P9LB 2DLEA 4F27A 2NW2A 4FD0A 4ONHB 5J0BA 4FX5A 2X7LB 4G6ML 4F5CE 1MHCA 4FQIL 1XF4A 4WWKC 4JFQB 4QRRB 2A1WH 4GSDH 2EECA 3GJFK 3QXWA 4HKZB 3UPCA 3QJOA 3ZO0A 4KDVA 4R96B 4K71C 1EERB 5TFSH 3O8XD 1FO0A 1P2CA 1MCWM 3V4VL 2RR3A 5FHBL 1YDPA 2OTWA 3C6LD 2JVUA 4EI6B 2DAVA 4OUOA 4B5EA 1H8SA 1EWHA 1S9YA 3O6KL 3FRPB 4RZKA 3NGBC 1XCQA 2XC8A 5DJ2A 5FYJD 2RCSH 5K33A 2XWDA 4XNBA 3O9WD 4AVJA 1I8LC 3ULSA 1KBPA 4H8QA 4NN5B 1R4XA 5KEZA 1I4FB 4Q9RH 4Y1SA 2PW1A 2ED8A 3MRPB 1OVZA 4PJXE 1U6AH 3IFPA 1F18A 1N5YL 2FO1A 2B4CC 1N0XH 2LAAA 2OXHA 4OFYA 4PJHE 3T3PE 3WS3B 3TBSB 1CT8B 5LBSL 3VXTA 4G9DB 5IREA 3NCXA 3D69B 3DOIA 3DPBB 4WJG3 3HZVA 1WZAA 3PHOA 5I6OA 4N5UA 4WO0A 2BSSA 2HG5A 2UUDH 3HUJF 3KHQA 1FO0H 1HDMA 3EDKA 1CWVA 1C12A 3ETTA 2EDBA 4XCNB 4R9HA 1JV5A 5E7BA 3FH5A 3GO1L 1JERA 2Q3ZA 4YE0A 1LO3L 3DGGB 4Z76A 1ZANH 4GRLA 2WLMA 4KJQC 4HUVA 1CFMA 1B9ZA 4K9EC 1IGMH 4Q4IA 3I84A 2FZ3A 4L4TD 1Q9WB 1RK1A 1JI2A 3PDOB 2MQCA 5ACLA 1EGJL 3S37L 2EUVA 2X12A 5IG7A 4G8AC 4B96A 1FSKB 2X4QA 1MN4A 4NWTH 4OI7A 4OCSL 3PWNA 5C2UB 5TTRA 4Z9KB 4GRWB 5CD3B 2JKWA 3ZL4H 3MODL 2QR0B 2D2CC 3SDCD 1BXUA 5L2KD 3HMXA 4GXFA 1FNEA 1S9VB 1AZUA 4EQ3A 2K3TA 3G6JE 3DWTA 4OZHE 1FNSL 1RU9L 5FCSH 2EE2A 5FM8A 3VH8G 4PP1D 4J28A 3GSVB 4PJHA 1ETZA 5AAWA 3CZFB 2J6EL 3UG5A 5F1OB 4HOMA 3MRLB 3U0TA 1LEIB 3L3DA 2Z31B 4WW2B 3FUNA 3JWOL 1R46A 1T22A 2NUPB 3GSQB 3CXDL 3RHWF 1PD0A 4PV1C 5FYLL 5D1XD 3ULVC 4LHUG 2BINA 4NJ9H 2PUQT 3ULUF 5EO0A 3H4HA 4UM8B 4MA1C 1X5HA 2BHUA 3TN0B 3UO8B 5JLZA 3VGHA 2E74C 1OAKH 2ISDA 1JFQH 2WQVA 4WFEE 2OJ1A 3G5XB 2IJ0C 3C08L 3GSXA 5J6HB 3HMXH 3HRPA 2J57A 3QC6X 3NJLA 5FOBA 3VH8B 5CJXA 2WQAA 3TIDA 2HVBA 2BOBB 2VC2H 2FH8A 2X87A 3KGRA 4XCFH 1SXCA 4TMPA 1ID5I 2NXYC 1DL7H 3OL2A 3G6JA 1SLUA 3NABL 3GBLA 5C0CA 3MRGB 5C0EA 5MERB 3OMZA 1JHLL 2NXZC 5C0IB 1YJDL 5CWSA 4N6RA 4AUJA 3CDCA 2X09A 1F6AA 1PBYA 2YXFA 3I9IA 4KRPB 3WNMA 1TQUA 4M48L 3B9KD 3QHZL 3PHQB 4XNQA 4LHUB 3HAEA 1A6VL 2LW3A 5AOIA 4HALA 3PWVB 1X5AA 5HDBB 3UBXI 5I1IH 4OM0L 5EF3A 2KPWA 5HGDA 1XEDA 2VSMB 4RWYL 2YUWA 1OAYL 4NQDB 4QRBA 2CDGB 1OSZB 3HE7A 4XHQA 3O2WH 1NMCC 1D9KA 3IDMA 3QARA 4KVCH 4XH2B 4ZTOH 2NUTA 4HSQA 5BO0D 4XRCA 1K72A 1OP5K 1UUNA 3UTTD 3OJ2C 1FE8H 1Z9NA 4JHWH 4Q0XH 5CLXA 3BGAA 3LN5A 4PGCB 5I8CB 1GGCL 2OMWA 4IM8A 1AC6A 3W81A 1Z3GL 4O4YL 2EVFA 2FQGA 1WC7B 3CFEA 1WYJA 1T6WA 1DJWA 3DHJA 4KQ4L 2VABA 4HIXH 1UASA 2A6IB 4XNUH 4IU3B 1NBVH 5GRJL 3VXSD 3HAEH 3L1FA 3N06B 4HUUA 4BFIA 4D0BA 4ZMXA 3P9LA 3ZX1A 3FUFA 1MCPL 1ET5A 3QORD 4ONHA 4NAMA 2FEEI 3PG2A 5GRYA 1CGYA 2EEAA 4RIRA 2X7LA 4JO4H 1N3NA 5I23A 1L3NA 3MSPA 5FUCE 4JFQA 3KWUA 4JHZA 4QRRA 4HKZA 4KK9C 3EDDA 3OTTA 4XCEA 4HAFA 4KU1A 4R96A 1J0HA 3D2UD 4MA8H 4H88H 4RBPK 4U3CA 4PHXA 4DP4X 3HG4A 2IXQB 4AYMC 4KK8C 3QZBA 4PVBA 2DL2A 1UM5H 1VFMA 2VXSH 4EI6A 1BQSA 4ZX6A 2WJ5A 3LPPA 4HDIB 5I1HH 1U8QA 3FRPA 1PF3A 1RHHB 4TRPL 1TEYA 3EOAA 3AJ7A 4J3SA 4Z1PA 2A73B 4IOIB 1KN4L 4PB0L 3JXAA 1ZGLB 4QHUB 5DZLA 1I4FA 2WK2A 2O6DA 4F2ME 3HG2A 4G9FD 1JP5A 1QSED 3VJ6B 1A47A 4HH8A 4UQ2A 2VDPH 3ARGC 5DZJA 3IVKB 3NH7L 4EIBA 1H8NA 1KGYE 5H8DA 2F7RA 2NR6C 5ICZB 1KNOA 3WS3A 4JKNA 4KVNL 3RIAF 2VM3A 3TBSA 1CT8A 4JDEB 3K3QA 4G9DA 2AANA 4F8NA 3D69A 3DPBA 5KUKA 3KG5A 1MNUH 3GI9L 2QSCH 4JO3H 1ZRUA 2DLFH 5EPMB 3TH4T 4BQ6A 2DDQL 4UQAA 2WXKA 5E6UB 3OHXB 1SYVA 3MU3A 3APFA 4XCNA 1KUMA 1SQ2N 1YCSA 1SXBA 3P0YH 2KC0A 2VMEA 3DGGA 2GCYB 4XNYL 3RWFB 1XSJA 4S1RL 5CUSH 4X50A 3LKNB 1WVZA 3D25A 1KB9J 3GBML 4TV3A 1Q9WA 4CJ0A 3PDOA 2IQ9L 3GHBH 1CTNA 3HN3A 2AKRA 3KLLA 1FFOB 1GZQB 2W38A 2ERJC 1A3LL 1ETJA 2C3GA 1N19A 3U1SH 4DKAA 5ALCL 1AQKH 5CNHA 2BOLA 5DQ9B 4CMMB 1TJHL 4Y4FA 3QQ3B 3GXNA 3UTOA 4KKBD 5FR3A 3NN8B 1S9VA 5JO5A 3KCWA 4FADA 3ECVA 3GWJA 1T83C 4P59H 1JBJA 1U0QA 2EE3A 2P7TB 3GSVA 4J8RA 3CN2A 3WTSA 2YMXH 3CZFA 4P9HH 3RJDA 4NQXA 5I1LA 2VXUH 4KTEL 2Z31A 3IJHA 4YFEA 1QQDB 2XN1A 4LBAA 1D7DA 3Q2NA 3FQTA 5DSCB 1KGUA 2XPYA 4MHHI 5B3JF 1T03L 2HJLA 3C12A 3RP1A 5LG6A 4J1UB 1INDH 5I82A 5A7EA 1XCTA 2EJ1A 4FLRA 2WUBL 1XBRA 3TN0A 2ENYA 2OCJA 5MHSD 2ENQA 4J39A 3DKHA 5SX5H 3K8MA 4R8WH 5DS2A 3EBHA 3G5XA 1CGXA 5J6HA 5E24E 3FU8A 4YHOH 1RURL 1JPEA 4QPEA 1ZWIA 4HUNB 3VH8A 2JTYA 4JAMA 1YEIH 3OZKA 2BOBA 4KK6D 1KBVA 1DEDA 4FZEH 1KXVA 2AQ1A 4WI9A 3AAZB 5CBAA 2IAMA 5ITBH 5MERA 3KPSD 5E6ZA 5C0IA 4H7VA 4WRLA 1JZHA 4OIFA 1E2ZA 1YEGH 2QPFA 2Y7QB 3UG4A 4XPHH 1S7TA 3K0WA 1NANI 3V4PL 3HW7A 4XOAA 2M8XA 3PWVA 2ITFA 3GMLB 2ZKWA 1DJSA 4FNQA 3WUWG 1IFRA 2DKMA 2ZG3A 1TIUA 4NQDA 1A22B 3GNML 4PTUA 2CDGA 4OSUH 1ITBB 3STBA 1TYRA 4PJDB 3ZXAC 1MRFL 2BVEA 1A3ZA 5AKSA 4BRVA 1MCSA 4B5ZA 3HI6L 4MNQB 2VH5L 5C6TH 3ZDZF 4HOZA 3EJPA 3UAJA 4UQCA 4UZGA 1NA8A 1SEBA 3IAPA 1SFHA 4OT1L 2K9FB 4FQQB 3DRQB 3Q7JA 1M7DB 1PAMA 2EYTB 2FHFA 3L16A 2X4OB 2TRYA 4NO3B 2C9PA 1G9NH 1ZLVK 1VIWA 5DURB 4NSKB 1SDDB 4WWKD 3I6LD 3NACH 4F8TA 5D70H 1UOKA 1OO2A 2G2RA 3T3MB 4U7MA 1EXUA 1KBGL 3GMQA 1CDGA 4IU3A 3WUWB 3SZKC 1JGDB 3E9UA 4PJ9C 2Q9OA 1KF9B 3S3PA 1MG3C 4QO1B 3MLRH 5IFHL 1S8DB 4LDCA 2ZWZA 1BFTA 4J3OD 5BS0D 4PLNC 4JJHA 2NTFA 4ZFGH 5F7YC 1H9VA 1IQWH 1BVLB 4GAJL 1GMIA 1EHAA 1OARH 2COQA 2E7HA 3INOA 4TNFA 1GCFA 1N6QH 3TO2A 3O8XB 4M3HA 4X9GA 2R1XB 3C8KA 4KKNA 5B22A 3REVB 3MLXH 2HX8A 4CKQA 3C6LB 1OAUL 3LCYA 2Y5TB 2J8OA 4QYAA 1P1VA 3HI1B 4QRUB 1KIUA 3LS5H 2BOCA 3ABKB 3BEVB 4GP4B 4R4BA 2ZAIA 5ILTH 4C57C 5LWYL 3JBG7 2VDOL 5FO7B 1GTNA 3O9WB 3CPLB 3VJ6A 3JV4B 4KZDL 4I4WB 3QBTB 2PO6C 2CO3A 5DTFA 3F62A 3OXRB 1VGKB 5ICZA 4G7QB 1QWUA 1OIOA 2DH2A 4OFIA 4L4VB 2BRRH 2F7OA 1MQKL 3HS0B 3FJTA 4JDEA 3OAWA 3DVNB 1MRCH 1GC1C 4X8JA 2IAND 4JM4L 3GKZA 3EOTH 2QGCA 4PFEA 3CFCL 4FQLL 3US9A 3HHSB 5EPMA 2YQGA 1LMIA 3MXWH 3EFFB 4C4UA 5JNYB 1BBDL 5C0BD 3OHXA 1UA7A 1AZCA 2WYZA 3MJ6A 2HMIC 1B2WH 4FERA 3EJYC 4L23A 3RGVD 3SB3A 1V10A 2GCYA 4JL1A 3S6CA 3RWFA 2G75A 1VPOH 4IW4C 2HKFL 1BQLH 2J21A 1JOIA 3P11L 3FYEB 4A67A 3BRDA 2YQ2A 1P5UC 1FFOA 5LNEA 3SGKC 2KMWA 1GZQA 2J71A 1MHPL 1ZIBA 4L4TB 3DV4A 4OTXH 4BZ1A 4NP4L 3EG9B 4Y4HC 4MSWB 5DQ9A 3QXAB 3FUHA 3QQ3A 1N7MH 1FFQA 2IGFL 5JW5B 5D7SL 1NBZA 3HI5L 4RFOL 3UMTA 2X2YA 3ETBF 3SDCB 1IJNA 7PAZA 4DEWA 1G7JB 3JVFC 1A14H 3E7JA 4U2ZA 1WD9A 3KNBB 3MRJA 2DQDH 2E27H 4N90E 1IC4L 3DUUB 3ECBB 2B20A 4XBPB 3ZE2F 1F4YH 4FLQA 1G0DA 5HHOD 4GQ9L 2HT3C 1O6SB 2MOQA 1HESA 1CMOA 1RERA 1MAMH 2YRPA 4GLRI 2OXGA 1GAFL 3B2MA 2FQEA 4MBRA 4G6JH 3BKYL 1O7SA 2FT7A 4H0I