4ZMNA

Crystal structure of human p-cadherin (ss-dimer long)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
b'DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
molecule tags Cell adhesion
source organism Homo sapiens
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmnA01
4ZMPA 4ZMOA 1NCJA 4XXWC 3FF8A 2A4EA 5DZVA 3FF7A 3K5SA 3LNFA 3MVSA 1L3WA 1ZXKA 1O6SB 2QVIA 3Q2LA 4NUPA 4XXWA 3UBFA 4OY9A 2O72A 4AXWA 1OP4A 5KJ4A 1WYJA 1SUHA 3Q2NA 2YSTA 3LNEA 3K6FA 1NCHA 4ZMYA 4AQAA 2OMZB 4ZT1A 1EDHA 2WHVA 2A4CA 4AQ8C 2WBXA 3LNHA 4ZMVA 2OMYB 1Q1PA 3K5RA 2WCPA 4NUMA 4APXB 3LNGA 3UBGA 4AQ8A 2EE0A 2OMVB 2QVFB 4AQEA 2OMUB 5CO1A 3Q2VA 2X2UA 5JYMA 2OMXB 4AXWB 2OMWB 2OMTB 4ZMXA 2V37A 3UBHA 2YQGA 3PPEA 3Q2WA 3LNDA 3QRBA 4ZMLA 4AQAB 4NQQA 4ZI8A 4ZMTA 4NUQA 5JYLA 2WD0A 4ZMNA 3K6IA 4ZMZA 4AQEB 5CZRA 3LNIA 4APXA 1NCGA 4ZMWA 4QD2E 1FF5A 4AK1A 1NCIA 4ZTEA 4ZMQA 1WUZA 1ZVNA 3K6DA
chains in the Genus database with same CATH superfamily
1CD8A 4PJCF 3T65A 4B50A 3D2UB 5ANHA 4LKXB 1PAZA 3VE0B 4HWBA 5F7LB 3BLKA 4R7NA 3CLFH 2NCEA 4XNDA 1OSPH 3B37A 4G71B 5IK3A 5A7EA 1S9XB 3VACA 5T3XD 2DN7A 1XFPA 3F7YA 3CDGB 3FAWA 3SYOA 4NUPA 4GSUA 1KBPA 1G9MH 4JHVA 1MVFA 1RU9L 3MGTB 5F7DA 4HKJA 4OIBA 3C5XA 1KCKA 3L3DB 2YUXA 4G6KL 1GC1C 4NDMB 2KC0A 1PZ5A 3PAYA 5C07A 2X6CA 4AQ1C 4W9HC 1AI1H 2GK0A 3KW8A 1YEFL 3MZTA 1RZJC 4FULA 2HN7B 2IXQA 2LOEA 1W0YT 2ZUYA 3WAJA 3MUGA 5AAWA 3OKEB 1U3JA 4KI1A 1L7IL 2A0LD 1DVYA 2R56L 4LB8A 3US0A 1FV1A 1G7IB 1IAKA 4XP6L 3KPPB 1S5HB 3VX1A 1MW3A 3CHPA 3N42B 4GUCA 5IK3B 3VSUA 4XI5C 3X17A 2H1PL 2K1MA 5CJQL 3ARDB 4F9LA 1G1YA 2UUDK 4PJGE 1KWGA 3H7BA 4G7QB 4NZ8A 4N2BA 2WYIA 4OZIB 2HTKC 2ZG1A 3T2NH 3EO9L 4R4BA 4X83A 1J0KA 1I8UA 1S7TB 2WYZA 4O02L 1LO3L 3RFRA 3UTTD 4DGWC 4XPGH 1IZKA 3QI9B 4UINH 7TAAA 1YYML 1K4DA 4AOFA 4HPOH 3UAFA 5IQ9B 1NCCH 4XVTH 1C16A 1AD9B 5E8NA 3MROB 4CMMB 3WIIL 3GGWB 5DO8A 1NOLA 3QZNA 5IMMB 3T1FB 3H0TB 2BNQA 5TE4H 1E0OB 2ADIA 4WNQA 2FBJH 4GUQA 1MJJB 4WGWB 3SJVB 1T4WA 3CVDA 3HTLX 4KJPC 5TDPB 5KVGE 1GZPA 3DX0A 5C0IB 2R0ZL 3KNBB 3SGDH 2W1NA 4C57C 1EZSA 1JK8A 1M7IA 1E2ZA 3ULVD 2X4RB 1KTJA 1P5VB 4Z5RB 4RWYH 3EADA 1UACH 1A7OL 1EXHA 3PWUB 4R0LC 1TFHA 1HOCA 1VERA 3STZB 4JZJC 2RCSL 5B39G 2DIBA 2V7HA 4H0HB 4NQDD 3NABH 5AW3B 3T6ZA 2WXGA 1DCLA 1DUZB 3H3PH 4GFXA 3WL9B 3QIUC 1NCBL 2CUAA 5C0JB 1PX3A 1NMAL 3U46B 1LE9B 1C9SA 3KWVA 2VKWA 1Q0XL 3QDJB 3WG7B 1WQVT 4FG4A 3QJOA 4TS6A 2Y36H 3POCA 3MNZA 2IOMA 2OPCA 4ZSOA 3D1MC 2BP3A 2Y7NA 5JW5A 1G6RL 3WKNA 1U3ZA 4C56E 4AQ1A 1WG3A 4OZIE 3G7TA 3FZUC 1EEQA 5IUCA 5J3HC 4TQIA 1MFMA 3V6FA 4GY4A 4PJFF 1JPTL 3QUXB 4I3SH 2AERT 4OZFA 4LK4A 3DSFH 3Q05A 3MROA 1KJ2B 1VACB 1X7TA 2LV4A 2YPVL 1BWWA 1VFMA 2CUIA 3CLEH 3ILQC 3P0YL 2N0KA 1C7TA 3IAQA 5FYJU 2WLYA 3PPSA 4H2AA 1PCXA 4KKAC 2Q3XA 1E4XI 3MRNA 3NJGA 4IIZA 5EORL 5DO2C 3UO8B 4M6OH 4U6XB 2J5WA 5DHXB 1VCAA 3PHOA 1MIEH 2PPDA 3GIVA 3VXQA 4BSJA 1E50A 4ZUWB 5JHDD 1KENL 3DTXB 1TITA 2WWNA 4I77H 5B39A 1BQRA 4YE4L 3FFCA 3GF8A 5KS9E 3TBCA 1GOGA 5JHDE 4N68A 4M00A 2VR3A 4JKPL 4N8VA 4YDIL 3Q3GB 1BD2D 3R8BB 3HMXA 3GDCA 3HFML 4U4IA 4XN9A 5DVKA 5F1NA 3QRLA 2QQLL 4MBOA 2UVEA 3MCLL 5IW1A 1BOGB 3OXRA 5FO2A 4PREA 4QKXB 2QL1A 1UEYA 5DHMC 4ZMXA 4NO2B 5DR5H 4QXWA 1SJHA 3K74B 5L8LB 4XZUB 4FOMA 5JDJA 2ZNXA 1DBAL 4XP9H 2VIRB 3WEMA 4CU6A 2DJSA 1J5HA 2R29H 1PIFA 4OH2A 3HZMA 2R8SL 2WWMC 3S88L 1MXDA 1T22A 1KC5L 3CN0A 4HIQA 4OD3L 5DS8A 1L3NA 1W72H 4Z7UA 3MREB 5AG9A 4NP4L 4MMZB 5I16A 1A6AA 1UOWA 4P5TD 2BVQB 1IX2A 5FDWA 4ONOA 3T2PA 2FT6A 4NC1E 1XIWA 4HGWB 2BP0B 5D4QA 5IJDC 1JF1A 2NNFA 1T20B 4KQ4L 4J12A 3KPRD 4QGTA 5DRZA 2DJMA 2I5YL 2WP3T 4LU5H 5F7EH 1S78C 1KCRL 3ARBD 1U9KA 4PN6A 1CXIA 5ALCL 4K23H 2MQ0A 3C5JA 2F5AH 4PHZA 1OZUA 3GSQB 3QNYA 5ITFB 4MQTB 2MCPH 5SWZA 1NFKA 2GIXA 2ZUXA 4PJ9C 3ZO9A 3PE9A 2QADD 5BV7L 5GGRB 2K9FB 4I5BB 1OP9A 4HHWA 4MVBD 5LXVA 4WWKD 1T22B 2AQ2A 3H54A 3VMNA 5BJTA 4HEMA 3HNSH 2VR4A 1QFUL 3DDGA 3CLEL 1A2YB 4NZRH 4KV5E 3TWYA 1EGJH 2FHCA 4X99A 3M17A 4NUGH 4FFTA 1WS7A 3EFOB 5CILH 3L1FA 3DSFL 4OKDA 5I0WA 5IVZA 4JE4B 1OTTD 4UTAH 4B9KC 5JQ6H 5E2VH 4ZMAT 4PV8B 2OMYB 3HS9A 4OVUA 1IAOB 1E7VA 3MUUA 5MEQB 1E6OH 4B41A 4LOUD 4IKLA 4JO2L 3O45B 4FI8A 3ECBB 2BNRE 3RGVD 1KIRB 2OW7A 5LWYL 1NPNA 1IQWH 2ZCHL 3FYIB 2GTWA 1HEZA 1U3HA 4DPBX 4YDLC 5D4IA 2GIYA 4KK8D 2Z93A 1MFVA 1F3RB 1UWYA 1A65A 1Y0LA 2IALB 3A6BL 5AENA 4JFHD 2OLDA 2X2UA 2WK2A 4RAUA 1AR1C 4X8XA 5MEND 5F3HA 3DXAA 1P0SE 4AW4A 3DTDA 4Y7MA 4TPRL 3OG4B 1JPST 1HXKA 1HESA 2CJ3A 1TZ8A 5FHBH 1GIGH 4IRJC 3V5KA 3S34H 3DX7B 1DEEA 4JRYE 4CAGA 1KEMH 4QOKA 4OCRL 1T83C 5KG9B 2N7BA 3L3DA 5E4EB 3SDDC 2FLRT 4WI7A 3SKOB 4HULB 1NOAA 5GIRA 1WZMA 3DV6B 1NCNA 3CN1A 5FM4A 4H8PA 1JHKH 4M3JA 2VLME 1I9IH 3NJJA 3HG1D 4IRSB 4MJ4A 2UZYB 4GRLB 3KGTA 5HGAB 2OULB 3ASOB 1E9QA 4PY8J 3QJXA 4WWOA 1S9WB 2FX7L 3EGDA 1SJHB 4MAYB 5FO7B 3LXCA 4Z8FH 4JL1A 9CGTA 3HRZC 5DFWH 3L3JB 5DZJA 4YSAA 5I75C 1OCWL 3MOQA 4XNYH 1UWEL 4PG2A 3HS8A 4ZMOA 1PKQE 1CS6A 1XCTA 1CMOA 3KYKH 3LS5H 4HDIB 4JZNB 3ALPA 3OKOB 4Y1SA 2PYEB 2EKSA 2JK5A 2X7LA 2CHNA 3EBAA 3NIGE 4NKDB 1OPOA 5ESAA 4TLSA 1J87A 4M8QA 4HZLA 4TULH 1BAWA 2A77H 4WFGE 1WBXB 4DESA 2A6KB 5B8CC 3L1GA 1NA8A 2YSTA 4UV4L 3KM1A 4PCSA 5LB1A 3WE1A 1K5WA 3DURB 2IPTH 4NCC2 5KWYC 4IM8A 1SJMA 3DYPA 4P4KB 2FX8H 4ELMA 4PJ5D 1S7TA 2DF3A 1X4XA 1MQKH 3LTVA 3O2DH 5BW7A 1MFAH 1WTLA 3ZIYA 4XPFL 5DSCB 2JELL 4LBEA 4PLKD 3KS0J 1P4BH 4JPVL 2C3XA 3TBYB 5DJZA 3KVDD 2QHRH 3DETD 3BIBX 5T5FL 2QFRA 4XVOA 5FC9A 2B3RA 5DI8B 3HZMB 1R4XA 1IBHA 4HBCH 4IGBB 5DT1H 2XNAA 3O6KL 2ICWB 2G3XA 4ABWA 2G5BB 2VDKB 3HZVB 2NW3B 5PAZA 3WXWL 4M3KB 5LNDA 2VRKA 1OKEA 5I8EB 3F6IA 3N85L 4KX7A 3VXME 2VDMB 3L3GB 4FZ8L 3FB5A 4TNGA 5E1IA 2VDPL 1HDMB 1EVTC 2WXJA 4P06A 1W6WA 3BAIA 1V3JA 4NQXB 5EU5B 3T08A 1F58H 4B53A 3VFSA 2IDCA 1VKXA 2IH3A 1F4XL 2B39A 4Q2ZA 5FK9B 1UM4H 4EN3C 4NPJA 2J6WA 4MA3B 2YEZB 5LBSA 3DBXA 1F2XK 1AS8A 3I3BA 3PXLA 1J88A 3L3OA 2KZKA 3CU7A 5JXED 4HC1A 3V55A 4MWFA 1MFCH 4P05A 1DVFA 3F7RA 4Q6IB 5JIDA 1WAAA 4JHBA 5E1HB 1MFEL 1NIFA 5I0YA 3EJZD 4JFZH 4AQOA 4MNGE 1JWSA 3OAUH 2DZEA 5DC9B 4X9YA 2XNAB 3MLZH 4JRYA 5EO1A 1DJIA 3GM0A 5IW3A 4UIKH 3VQ2C 4LCCC 3BVVA 5BZWA 3LEVH 1A14L 2ZP9A 3ULAB 2V3EA 3BKYL 4N90E 4ZDHA 4DN3H 3OKLA 5E6RB 1RZ7H 3P54A 4Y1AB 4PI2A 3ZO0A 2BZDA 2AS5M 1QFPA 4OT1H 2EH7H 2H0FA 3APFA 3HAEB 3LKOB 1A4AA 1B4TA 3BP6A 4HWUA 2YD1A 4KXBA 2BSEA 5GJTL 4JZOB 5JR1L 1MCSA 2D9QB 2W8CA 4HV8B 2VC2H 3UTTB 3GK8L 1ULVA 3SDYH 3AS3A 1AQKH 4PJFB 1FCGA 5GGQH 3TBTA 4TNVK 4V2BA 3RVUD 1BMGA 3OKKA 3VWJD 4QHUA 1MELA 4P3CL 4ZNEE 2MOGA 3HRZB 1I8IA 1E5AA 2UZIH 4P2QD 4E68A 2C1PB 2OMBA 3WFCH 1T7YA 2DRUA 2QADB 3LZRA 3OX8B 3CN4A 1RVFL 5FO7A 2SODB 3QG7L 3N55A 4J3WA 5C0AE 5CBAB 5L9DL 3U0WH 4TNWK 5GQBA 4PGEB 2VM4A 4P2QE 2YSSB 4PJDA 3PWUA 1B4JL 3PHQB 4ZFGL 2DLIA 4XZUA 1OAXL 2JMRA 3WFCL 1I75A 2DWEA 3QC5X 5EO9A 3W5NA 5IB3B 5B8CA 2W59A 1OCOB 4UT9L 2Y7SA 1WD9A 1IFHL 5BQ7B 1MCQA 4PJ5A 4A38A 3QUMB 3MRBA 1G7MB 3GK8H 2E56A 2IDQA 5JR1H 2AGJL 2N1KA 1SYVA 3KMDA 1JGEA 1TO5A 2LVEA 2WUCL 2JTYA 2EH7L 2Y22A 3CXFA 2NUTB 4LRNL 5DJYB 4RRPA 3QI9A 1AO7B 4YDKH 4NM4L 1XD1A 5E70A 2A7BA 4PFEA 1AR2A 4RNRB 1GAFL 1NAMB 3F58H 3QQXA 5FGSA 4UM9A 2JQZA 3NRFA 3H0TA 4YPGB 3LEVL 3D2UA 2DYSB 2K70A 4ERSL 4U1JA 1DN0A 3GMNA 2NLJB 3HE7C 4ZFFB 1EFXD 1QBAA 4YDLB 1FNAA 2OXHA 4YX2L 4DO6A 5EDSA 3H9YA 4JO3H 4GB9A 1JFQL 1EXGA 6TAAA 4H26B 1L4IA 2HJKB 3D7PA 2GI0A 2APWA 1ROCA 3LS4H 2PW2A 1MN4A 4Y7OC 4X6DB 3IAPA 4YK4C 2C9XA 4OLXH 4NXKA 4WTQA 1NAMH 1E27A 5HI4D 1ZKAA 4E5XB 4WI6A 3DVGB 3B9KC 4J3OC 1H15A 1YEEH 5K1JA 2B4CL 4UDTB 4MLSA 1A6PA 2MTPA 1E3XA 2CK0L 3KR3L 3Q8EA 1EZVX 4FQLL 3P73A 3RKPA 3WN6A 4E9YA 4Y4KC 2J20A 2BX5A 1KYOJ 1KIRA 3IDXH 2RHEA 1YMMB 4H8UA 3TO4A 3W5MA 2CRMA 4EOWH 2HFEB 2HN7A 2IXQB 4FQ2L 5D2LF 3BH8A 2RTTA 3O3EA 3QJQB 3UTPE 4FXKB 3LH9A 1NH6A 2C9VA 3VXOB 1IKOP 4HIXH 3AMKA 3VFUA 4HG4K 4HBCL 1MVYA 2QELA 1FZKB 1N12A 4Z7WF 2J73A 4O5LH 3X1BA 2W92A 5E00B 4YMPA 3BAWA 2BNUB 4P5SA 3BH9A 2RR3A 3ATEA 4FQCH 4BZ1A 3US1A 4XAWH 5JQIB 5L88L 1G7QA 1JGVH 3O2DL 4H26A 2F5BL 5I18H 1MWAL 4NM4H 5IEHB 1CN4A 1L9RA 4D8OA 3EYQC 2PCYA 3UTQA 3WLBA 1IJNA 4LRNH 4LHJB 5E9DE 4PB0H 2YOCA 5C6WH 2WXIA 1HQ4A 2NUPB 4PG9B 4X6DE 4HPYL 3MDJA 4LSQH 2FHBA 1MLBB 5HGHA 2UXTA 3C5ZB 5D1XB 3P1VA 3I85A 3UG4A 2EC9T 1VZHA 4K5MA 3R18A 3GO1L 4OM1L 1YY8B 4LSTH 2X87A 4Y19E 1RJLB 2HFTA 3H8NA 4A2MA 3HC3H 3HE7A 5F72S 1OEZW 4L37A 5LCVA 3Q5OA 5BZDB 4QTHA 4ABUA 3WIAA 2OMXA 4NEHB 4MQSB 5AD0A 1SOQA 3JTTB 3UAJD 1W16A 4CKQA 1JTOA 1Y18B 4Z7NE 2VB5A 2A9NH 1FAIL 5I0DA 2VLRB 5E2UL 3IFLL 4WO4C 4Z7OE 1EZLA 1N18A 3L3KA 1GPOH 1RK1B 4KY1L 4V1DE 1IO4C 3FSZA 3U1SH 3SDYL 3ZUNC 4LMQE 3FRPA 3WY4A 5HHMD 1EBAA 1WFMA 3AGWA 1HOCB 1F1DA 1U8MA 5TJWK 4BE5A 2YAFA 3GUTA 4LSUL 2CHZA 1ZT7A 5L8JB 2NZ9C 1DEDA 4AUYA 1CDJA 4L1BA 3DX6A 3LKPA 3UJTH 1CG9A 3KPMB 2CIKA 4NZUH 4P57A 3V7MA 5IV2A 2HRHA 4MJ6A 1NCUA 2TRYA 3KGUA 4XRCA 2WLNA 3RUGA 2VISA 5FYKE 1UH2A 2KT6A 3KLKA 2JKSA 3MLZL 3QUYD 4FLQA 4HHGA 2J72A 3TBSB 3SPCA 1GIGL 1T1WA 3QHZH 2FDBP 4MX7A 3QAZB 5TH2A 1GPOL 3OHMB 2EO1A 1JI2A 2DS4A 4FQQA 2AEPH 1HH9A 3IFLH 2H7WA 3KL0A 2ARJQ 3LV3A 2VDRL 3U9PH 2NY0D 4BBWA 4K7PY 1B90A 4I0PA 4WKZB 3QW9A 2EDHA 2B59B 1R3LB 3IM1A 1GC1L 2APXA 1E8WA 4PJEF 3FO9B 2A73A 3A67L 3MLVL 1Z5LB 4G8GD 3T0WA 4UDUB 3ZKXB 3GO1H 2D03L 4MD0B 1PLAA 1Y1UA 4NAMA 5LNGA 4AKPA 4BZ2A 5FA4A 4FNUA 4G8FA 4R3SA 4LCCA 1J5CA 1NGZA 2QVMA 5HDBE 4GBXB 1A3LL 4UANA 4UTAL 1XGYL 4ZX4A 3G6DH 1AJ7L 2HFEA 4ALAC 3JXAA 4KOBA 4LARH 5I82A 1RZKL 2EXYC 3S48A 3GUTB 2DWSA 3BZEB 2J3SA 5C09A 4ZYKA 3O6KH 3BXNB 3ECVA 3FU3A 1WWCA 3U82B 4PWGA 1CL7H 2LU7A 4V1DD 1BQUA 4G8GB 2ATKA 3QIUD 5F88B 1S7VA 2DMBA 1GS6X 5CU9A 3D39D 3UFIA 4AMKH 3O6LH 2LE9A 4MXQC 3AW5A 3AQDA 3I74A 3W39B 5D6DC 3A6OA 3KYOA 4E2OA 2HZHA 4P9HH 2BINA 1DR9A 5DC0A 2J44A 1G7HA 1RIUL 1WIUA 4KKBD 4TVSa 2CPUA 2Q7YB 3LRMA 2BIIA 4JANB 3ZDWA 2JJSA 1XSOA 4XBPB 3MCKB 4C83B 1EDYA 5DDHB 3O9WC 3F62A 4LARL 4A6YB 3WHXA 2WSPA 1W2KT 1A9BA 5ALCH 4LESA 3CFEA 4J39A 1WFTA 1L9QA 3BEWB 2MOVA 1LO5A 4QTFA 2XN9E 2NCMA 3GIZL 4HFUL 3PY9A 2R2EB 5I9QC 3L8QA 2XDHA 2VT0A 2V6HA 1BBJB 3TYFB 1COBA 3TASA 3V4VB 1MFDH 2CR6A 5FUOH 4BZ1L 3MMEA 4UZUA 4R2GB 4Y4FD 4P2QB 3G5VB 3MV9B 3O8XD 3QO0A 4XNYL 2V3DA 4F7PB 5SWQA 4OKVB 1Z9SA 1J8SA 4GKSB 3FQWB 1WITA 3PWVA 5J3HD 1YEJH 3K6IA 3ATAA 1A4KA 2AEPL 4G6FB 4TQ8A 4NCC1 4AGPA 3QUZC 2J71A 5ILTL 2Y23A 3DRTB 5AZUA 3T8XB 1CLOL 4D0DA 1DTUA 1DO6A 4YX2H 2BDNL 5IVZB 3DV4A 4Q58C 5ERWA 6FABH 2XV2A 4PGEA 3FN9A 4GOSA 4NWUL 2J43A 5EO0B 1KZYA 4G9DB 5D93C 5DMIL 2QBWA 3ARPA 5T33L 1OSZB 1XF1A 2NX5E 3HPLB 3II2A 3HS0A 5D5MF 3FB5B 3AG4B 4F7CA 3FFOA 4G1MA 1UA6H 5GGSA 5FYJE 3S34L 1XXDC 3O3AB 1KENH 2GY5A 1FVDA 2UXGA 3RVTC 3ABZA 2HCZX 4HMCA 4HIIB 4M7JL 1C8QA 3HC4L 1I1YA 4GKZB 4QPEA 4UB0H 1UOKA 2AQQA 2A9NL 1OAUH 5A2LH 1UURA 3HN5A 4N24A 4ZFGH 4RGMB 4E42B 5AOJA 5EU7C 4LGPB 4M8UA 2O5XL 5DQDL 1ITBB 4GBXD 4WK2B 5C7ZA 3PHSA 2Z65C 3U0WL 3ZL1A 3ZU8A 3QIWC 4LSTL 1JK9A 1VF5C 4E41E 1USQA 3GSVA 4RMRA 2FZ3A 4POZD 2ZYHA 4JCWA 1XAKA 2Q86B 4XNQA 5JNYA 4IDJH 3H9HA 4Y0GA 1OB1A 2AKRB 2NY2C 3C6SB 1C7SA 1DO5A 2A9AA 2EEAA 4U31A 5AKVA 4LEBA 2FUQA 4LSQL 1D7FA 2GJZB 2CM5A 4L4VE 3CWGA 1PNCA 2Y36L 1UXWA 3NJKA 1ZA3B 4D8PB 1UTDA 3O9WD 1D2PA 1Q9KB 1DBJL 4URTB 2WN2A 2ILLA 4HJUA 3V9CA 1R46A 1TQTA 2FJFB 3W37A 1FLTX 4QRQB 4JPKH 4OF5A 2XPYA 5F6HJ 4UIKL 4K3DL 4FKEA 1NMCC 3TT1H 1A5FL 1JYVA 3QS2A 4MXQD 5CEYB 2I7OA 3TA3B 3OAUL 2BHYA 4PJ8D 4U1KB 5I8KL 4RWYL 1DDHA 4IW4C 2FO4A 1SXZA 1UASA 3GMOB 3TNMA 2ZXDA 3HMWL 1RV6X 3ZDXF 4MKMA 4PTTB 2AQ3A 4IIQB 3HCVB 2MKWA 4KK8C 2FBJL 1CDUA 4OZHF 4NN6C 2AAVA 3M8OL 5JOPD 3QPQD 2I5YH 2CCVA 4K07A 3FUJA 5TD4A 3PP4H 5B21A 2K3HA 2DDQH 3DX8A 5CD5D 3KCPA 3VVWA 2NTFA 3SCMD 4PGBB 4Q89A 2XN2A 3ZT6A 4Z7AA 4ELME 1YEEL 1N6VA 2DBJA 3NESA 3O45A 1XGUA 2DQCH 4ZO6A 1GS7A 2AW2A 3BE1H 4OLXL 5ECJE 1DQJB 1NANI 1SMAA 3P30L 4M56A 3CQPA 4E41D 2ICEC 5DU7A 5DMJB 1NFDA 3BRDA 2VXVH 2DLFH 4HUKB 3VXTB 4FQXC 2GSGA 4Y5YB 2UY7A 3CZEA 1Y0LB 2VDOH 3GLAA 5EZLA 4YN3A 4JDTH 3UDWA 4P23B 3MRPA 3VXMA 2CZNA 5K1VA 1B0IA 1LK2A 2C9PA 2VTFA 3N3EA 1UD8A 3MCLH 4XCCH 5K39A 1KGIA 4M1CD 3TCXA 1SHMA 3MLTA 2QQLH 2YXFA 1G7JA 3M1BA 1WYJA 4LVHC 2W81C 1D3CA 4MMYA 4LNVA 5EU6E 1AHKA 2IFGA 4G6KH 4A2DA 5EA0H 2PCFA 3U7WL 4E9QA 3LH2H 1CBVH 2E0PA 3EUDA 1AD9A 5IMMA 2P43B 4N3TA 5AVUB 4Q0XH 3UL4A 3WFEL 2JH2A 4IK6A 1IKNA 1NBVH 5IM7B 3ZE1F 5KYXA 1SM3L 4XCFL 4YL4A 3ULSA 2R2EA 4PCTA 3NJFA 4TSBL 5AW4B 4OCWH 3KNBA 3OR6A 4PJBE 3JZ7A 2HLAB 4YEEA 5GIRB 4H88H 3FCTB 4AZ8B 4AE1A 1JHLL 2Y0SA 1QOKA 1ED3B 3ESVF 5F96L 5HY9A 3MRKB 4UWQB 5I9QB 3KXFB 4I13B 2OMVB 4IHBA 3QJTB 3LS5L 3UTSD 3I6SA 3VMPA 4U3CA 1RVFH 2BZ7A 5L9DH 1UWEH 4Q9BA 2XPGA 2BIPA 2UZIL 4L1HA 4PJ7B 5GSRA 4X2UA 5E6UB 3O9WB 4MQ7B 5AOLA 3KS0H 1QSEE 3QO1B 3MRQA 1W0VA 5IHZA 4GMTH 4BK5A 3ZR6A 3NG5A 1KV7A 5ESAB 1PZCA 1Z9NA 3NJIA 3Q2WA 3VGAB 2G0KA 1MAMH 1I9IL 2NZIA 1ZANH 2IIJA 1K8IA 3A4FA 1I3RB 1TCRB 3RA7H 4Y16B 1MH5B 5F7DB 4PRPA 4MMXB 1CGYA 4WTZG 3T6WA 4LLUA 2P7TA 4IHOA 1NCBH 2V2TB 3H3PL 4KFZC 4M8QB 1MRDH 4YDZA 1TJHL 4HXBL 4APQA 3CQFA 3PV7A 4PY8I 3T77B 3JVGC 3MBXH 2OQJB 4HJ1A 4BKLB 1NDGB 4JFZL 4HJ0D 5F9DC 3CH1B 5L4FA 2VWEC 3CX5J 2GFBA 1I1FB 4X80H 5IOKA 3UBXB 3GI9L 3F7PC 4PSRA 4BQ6A 1X5AA 4KGJA 1GXEA 1RJZB 3UAAA 2JKWA 4HD5A 2R83A 4NAQA 5TE4L 1DSWA 1XAUA 2A4EA 5J5EA 3RBSA 1IBGH 3GSVB 3LN9A 4M61B 1KJMB 4HPOL 1JOIA 2IWGA 4Y89A 1YYMH 1G4MA 4UQEA 2VLRE 1QSVA 4QHNB 1ACXA 1L3WA 1QWNA 2G75A 3JUYA 3GPEA 2J56A 5EHFA 5DTFA 5CIPH 3LVEA 4FXKC 1BMWA 5ID1B 1J8HB 3IKKA 4JFED 5TE7L 5JPNB 2AFNA 4PRPB 3HR5A 3D4YA 1SFDA 3CFCH 4HVBA 3QAZC 5CCKH 1MAKA 4X5WB 4GXVL 3VU2A 5J11C 1KYFA 4DP6X 4GQRA 5D7KE 5D7IF 3D07A 4R2GD 1QACA 4IJTA 5IROC 3SKNA 4RWHA 5T5FH 3AABA 2CBPA 4N5UA 5ERWB 4HIJA 3UZQA 1LHZA 1RXLA 2Z31D 4L4VA 3VI4A 4MMZA 1F6AA 1SM3H 4XCFH 3WS6A 3N1PC 3MNVA 2MNWA 1QZNA 3L48A 4R9HA 1TJGH 4I9XA 4YUEH 3U2JA 1U3HD 1L7TH 2WLHA 3A21A 1QPXA 3WNNA 1RUQL 2WMPA 2X3AA 2NY2B 2AVFA 3DGDA 2C7UB 1FG9C 4D0DB 4EUPG 2O1AA 1DE4A 5MHSD 4OFYD 1NCAH 5HHPA 1HK6A 3T6VA 2J8UE 2YD5A 3NFSH 1BM3L 1XSIA 2AJXL 2G4EA 3SCMA 4JPQA 1L9SA 4PLNC 2VDLL 2V37A 4MB1A 1GOFA 4KGLA 5MHSE 4YSDA 5TK2A 5DVMA 3TZVD 3I6GB 4CMMA 1INQB 3ENEA 3Q8FA 2A9BA 3B34A 3MKKA 2PO6A 1HH6A 3P3YA 4KKRA 3D85A 1SHXA 4LL4A 4F2MA 2WVSA 2Q3AA 3E6FB 5HTSA 1YMHB 3QC6X 3UG3A 2W5PA 1JV5B 1N0XH 3TX4A 5JZ7C 2R2BA 1DQML 2FLBT 1G7HB 2QDVA 1IVTA 3ARTA 5EPMA 4GW4B 1OAKL 2YD9A 1K6QH 3IDNA 1YEKL 3MBED 4ELKB 1F1AA 2EIZB 3ZL4H 2EH8H 3ULVL 3NZUA 2OZ4L 3QUMA 4N22A 1FNLA 5TDOA 1CICC 5DZPA 2N01B 3MJ9A 1WA0X 2MIZA 4ZAKA 4E9RA 4GG6F 4OCSH 4JN2A 3PFQA 1KXHA 1ONQA 4XNXH 4YVNA 5JW5B 3JWNH 2WWOA 4ZXBA 1B0WA 3DURA 1JZEA 3CCHB 2WB1A 5IB5B 1QLEB 1YMMD 1M2VA 3SBWC 4M6OL 5I8CA 2OR9H 5ID0A 3PFUA 5D1QB 4JPKL 1SJXA 2F58L 1CFVH 4YHYB 1ET5A 2O72A 1SNRA 2C9UA 1PW3A 3A6BH 2XN9A 4H1LB 1BBDH 3S96B 4WWKB 3BIKB 3FTXA 3GTTA 1U8QB 3L5XH 1IQWL 2ZCHH 5HHXH 4RGOH 1BLIA 2VJ0A 3REWB 3W38A 1UT9A 3BKMH 3CFTA 5ETUA 4NN7B 2ZCLL 5IB4B 5T1DH 3CZFB 4X7TA 3KPTA 4WV1A 4MD4B 3L4VA 2FEDC 2MNUA 5CIPA 1BXXA 2DQTL 3BP4B 3IETB 1E27B 5JQ6L 4LLYA 2R27A 3IDYB 1H0DA 3UJJL 5KVDH 1JG9A 4G6MH 3D52A 4LCVA 2IDUA 5HHNB 2CUMA 4YO0A 3MXVL 1Q0XH 3K2UL 3ELAT 1J10A 2W60A 3LKQA 4OQ1A 2NSQA 4X4YB 1CXFA 4NZTL 3TBBA 3CC5B 4I4WB 4KRMB 4L4TE 3TH4T 7FABH 4UB0L 5AKTA 2KL6A 4FFWC 3VFTA 3GMNB 4ZFFA 4U3XA 4MJ6B 1M6UA 2RCSH 3QB7C 4HUXA 4N2HA 4NQSA 5B3NA 2N3JA 4XR8C 5A2FA 3MBWA 4RMVA 2F54A 1X9QA 2M26A 3A4EA 5F7YC 1J5OH 1WA1X 4YHML 1OLLA 2GCYB 1FRGH 2WWKT 2R1YA 1AP2B 3QH3A 4IGBC 3OLIA 4XNXL 4XC1L 1IBZA 4LHQB 5KS9B 4XO3A 3MXWH 5JHBA 3PYCA 3VXRB 2GKIA 3HI1B 4L3EA 3TFKD 1DZ0A 4GP4B 4YHPB 4H1LA 3MRHB 1LP9B 1PTZA 3VDBA 4PS4L 1DVTA 4OW6A 1RK0A 1HE7A 2UWEB 4NWUH 3RGVC 2PTTA 2V7NA 3WFHB 5KSBE 4Y4HD 4TSAH 4UINL 2C3HA 5ETUB 4WTWA 5HHMB 1LO3H 4YFLF 3UZVA 1LQBC 4QRBA 4HKJB 4CSPA 3VWJB 3QFJB 2HTLD 4G8IA 3NA4A 2BHFA 2NUPA 4H0LC 3O0LA 4X6CF 5I6NA 5B1JA 2MHAA 1FYTB 1I9RL 2E7CA 3CFDA 3HW7A 3N1FC 5KTEH 3NCWA 3P77B 3G04A 2WZAA 3K91A 4I1RA 5C0GA 4BE6A 1KB5A 2OZNA 4Y5YC 5E51A 2XQBL 1WSST 5DR5L 2ZP0T 5DD6B 4MHHI 3NFSL 3MN8A 5EPMB 2RFXB 3Q2LA 4YC2C 3DGGB 1A1OB 3PL6D 2Y25A 3U36B 1BF2A 3Q2CA 1CLVA 3QIUA 5E1AB 4PJ9D 3OAYH 1ASQA 3LSOB 4PRHE 3HMXH 2CO2A 2HFFA 2EIZA 3K6FA 4U1HA 1QUPA 3PWLB 3BWAB 3MLYH 3G6AA 2B1HL 3B8SA 3KEHA 4O51B 3SDCB 5HHPB 3LRSA 1GW6A 4U6HA 1JZHA 1Q9LB 2IH1B 5LO7A 5HVHC 4C4KO 4F8TA 1IVLA 1PX4A 2HJLA 5JOFB 2WBXA 3QFJA 3DPBA 2QPFA 5AYTA 4BQ8A 2OYMA 1GGTA 4JNXA 4ODSL 1MLCA 2WGNB 5KSAA 2VDML 2FNWA 4Z76A 5EORH 1AGEA 4H8WH 4EZJA 1BD2E 3X2QB 1ES0A 1WZKA 3QJFA 3MCYA 3N40F 3QXVA 5CP3H 4BFGA 5ADPH 2MNJB 3TA3C 4FFVD 2MWCA 3LXAA 1RZKH 1A0QL 2D2CC 4DGYL 2IGFL 4G6AC 5CAYB 3BVTA 3VXRD 3U7YH 1H6FA 4UDTA 3P77A 1ZTMA 1K8DB 4WDIA 4XN2A 2LABA 5KEZA 3WN5B 3ETBJ 5D70L 5INCB 3U79A 4GQZA 1ZSDB 35C8H 2WVTA 2VLKB 1CZ8H 5LQBL 4P0DA 3FOLA 4LLQB 4ANVA 1Q72H 2V17H 5AKSA 3TXAA 3IGFA 5IW6B 4XH2B 3PAZA 1GC1H 3BPOB 5ICYB 1A9EB 2X9WA 4LSDA 1WK0A 4PWFA 1ZAGA 1KLGB 1DBKH 2X1XR 3EBHA 1D9KD 4G8GE 1KBVA 5MENE 4JN2B 4TLUA 5HGGS 4X4XB 4YO0B 3MGOA 2BIMA 4OGYH 3FC8A 5CR8A 3T2LA 2ZKXA 1KFAH 2B08A 3UZQB 5T5NF 1QX1A 4P2RE 1HU8A 1X5GA 2PYFB 3DX9B 3BHBB 4KU1A 3H3BC 4PJXB 5IR1B 2AHIA 2ZOKB 1LVEA 4ZMQA 3DX2A 5IEHA 4PGDA 4F58L 1YPZB 1ZHKA 3QUYC 4MXVE 1K4CB 5EG6C 3LOWA 4JRXB 1U8QA 5BQ7A 4ODWA 4RQQB 4QWWD 3RA7L 1Z9LA 1YN7B 1S9YB 2QSCH 5JORA 1KGUA 1OAYL 2Y6SC 4XAKE 2VNCA 2R1WA 3PQYA 1O7SA 3QG6A 3B3BA 1E5CA 1T21B 1L5GB 4JY5L 3SE4C 4JJ5B 3TT3H 3OKYA 5CUSL 3ZUCA 4D0CB 2MCMA 3R06A 5BS0E 1F5WA 1K72A 4LLYB 5I75B 5J57B 3FUNA 1KN2H 5E2TH 3QCTL 1E9OB 3L95B 4P2OB 3J07A 3IU4L 4PIBA 1OP4A 3ASWA 1ECYA 1RUPL 4UOW1 2PUQT 4OF6A 5IT2L 2E4FA 2EYSA 1TU2A 4UTBH 4KNUA 4P59H 3GD1C 3B43A 3QUZB 4ANKA 1IM3A 4HK3N 4XP6H 5ENWB 5BO1L 4F9LC 3I9GL 4WW1A 3V8CA 4XOEA 4DUVA 4WFGD 2A6JA 2WM0A 1FFNA 2X5PA 3BDBA 2F53B 4OCXL 4JM2A 4ABVA 1A6WL 4AIEA 3QORD 1JWSB 3PGDA 1NBVL 4BFIB 4PJ7A 3WTTA 2D0FA 1MCPH 3FU0A 4HS8L 1S9VB 3UC0H 4F37F 1MI5B 4FFYH 4KDWA 4R96B 1LJMA 1NL0H 4OV5A 4XP1H 1XD0A 1AR1B 3TVMD 1I8KB 5LCVH 4UTCA 4PJDE 5IFAH 3U2SB 2ZXQA 5JPNA 2WWKO 3MFFA 3UAEA 4B0MB 4KZEH 3QPXL 3HBQA 3R7RA 3JYCA 4L2LA 3VFPA 3W1ZA 2X1PA 5I17A 3RGHA 1EXUA 3BPOC 1OSPL 1PG7H 2WLLB 4QYOA 2E4TA 4RH4A 4F5CA 2Y7QA 4G42A 4LVNC 5IMKB 3HVDA 5D1ZA 1E65A 1IM3B 3MV01 2LTQC 3DTUB 3PDGA 4U1NA 2AI0L 3P30H 2P45B 3ZN6A 2J1KA 2Q2EB 5FYJH 2KLRA 3ZE2B 4KITB 3UMTA 2KI6A 4RAVB 3L1OL 5IB4A 1GGIL 3QZPA 4KVNL 3O4OB 5DZLA 5EWIH 2CLRA 2OL3L 1XR9A 3FT4A 5T3ZD 3WNIA 1A1MA 1M4KA 2V5TA 4LLVB 2WIMA 3BLPX 2P26A 2HG5A 4KHXL 2X42A 4U3SB 4P3WA 1JZ5A 4PS7A 2YMXL 1GHFL 2EVHA 3QDMD 1KF9B 2VYRE 1JGDA 4KJYA 5ICXB 5CD5C 3H2WA 1G7JB 3ES6B 1YEDB 3SEPA 1IV8A 2ED8A 2GIMA 2XIIA 4KTDL 2ZKWA 3QDGE 4O2FB 1WZAA 2AITA 4UMGA 3TYGH 3ATBA 3AAZB 4IU2A 5F7FA 1YECL 2XHNA 3NFNB 5F1IB 4TRPH 2G5RA 2NDFA 4M6MH 2YAPA 1F4YL 2ODHA 4W6WB 2DYPA 7CGTA 1VGEH 2B16A 1ZA6B 1O5DT 1U8PB 3OF6A 5DJ6B 1BMZA 2KDYA 2AXGA 3NAAL 1M1XA 3B7YA 2ADJA 3ARGD 3VH8A 3HG4A 4ACTA 4EI5D 5GGTA 5DD0H 3A6CH 1R3JA 1JNHB 3HEIB 2EDKA 4OJFL 5BMFH 1QW9A 3VFNB 4AEEA 3WUWB 1NGWA 1UB6A 4F9PA 2VW6A 1AR1D 4U1KA 4XP5H 1EAOA 2E76C 4PUBH 4W9ZA 4K7FB 5ANMB 2FRGP 3K2KA 4YBHA 3PWPE 1NCOA 1EHLL 1B3IA 1V55B 5CMAA 1J1OL 2YXMA 2N0MA 2QHLA 5KYYA 3I50L 3O8XB 4N0CD 4TNVF 4U2YA 3CX5K 1OGSA 4UU9B 4YXHL 4CL7A 3PP3K 3QQDA 3KPQA 1T1XB 1K2DA 2R39A 1AO7A 3FU7B 1BZEA 1WP6A 3FPXA 3RVWD 4YSRA 1KXQE 4L5FE 1U93A 5KBNC 1BV8A 1T1YB 1QUNA 2YBGA 1TCRA 5GJSL 3OMIB 2D4DA 1I7UA 3U9UA 1KOAA 1FWXA 1DANU 2KZ1B 3DROB 3ZRFC 3HC4H 3AXIA 4PGCB 3K4ZA 4P3CH 4XMPH 3GSOB 3SE9H 5KS9F 4PLKC 5E6IB 5LGHH 2YD2A 2BNQB 4DP9X 1XMEB 4JVPA 2VC2L 4PRIA 3QRBA 4XE0A 1WPCA 3U9WA 4Y4HC 2F1EA 1NCWH 3GJFH 2JJTC 2RH0A 4RRPM 3ISYA 5KBMA 3UIYA 5CM1A 4C55A 1TJIH 2ARJA 1R17A 3UPRA 3WYRA 1SHSA 3INOA 1EWHA 3D69A 1LEIB 2J8HA 2CMRH 3D3VE 3IJ8A 5CMAB 2IJ0C 3II1A 2VO8A 1CD1B 1LD9A 2CXGA 3H4HA 1A1OA 3SKOA 2XTSA 3NACH 3QNFA 4ENED 3EGXA 3GMQB 3N0PB 1J9QA 4F7CB 1BG1A 3NFPA 5B4MC 2L04A 2X10A 1H6TA 2V2WB 1QEXA 1F13A 3QUXC 2K78A 4KJQD 1CFNA 3SQRA 1VJSA 4NM8L 2VQ4A 4N87A 4OZIF 4DOHB 4XMUA 3REVB 2VLJB 3VVVA 1ZDSA 3V6FB 3P4NA 1NWOA 3VD1A 2FBRA 2RBLA 3IRCA 2VERN 1A6ZA 3GHBH 4LCYA 3TF4A 3AU0A 4PRBB 4DHLA 1R9FA 4UQ3A 3RGVB 5DQ9A 4ZPTB 1OF2B 2HFGL 1A9VA 5GGVY 1F11A 2BRRH 3GSOA 2FWSA 1FI8C 4PJEB 3S4SB 5HD8C 1ZHNA 2FTAA 3VD2A 2NW2A 3N85H 4MYWB 2N56A 3QHFL 1WV7T 4FG0A 2VN6A 4M1GL 5IWLC 3DXAE 4NHUA 3CDGA 4KK5C 1TCMA 4TOYH 4ICWA 4Q4EA 5EOQL 4N2FA 1QASA 4MHHG 2IGTA 1BG9A 2FX9L 4UOJA 1A9BB 5SX5K 4LAJH 3ZE0B 3DTXA 5AZ2H 3ZKSD 2CO6B 4ONFL 3FCSA 3FQWA 5ISZA 4Y16A 4IBVA 1SEQH 4TUUA 4L8BB 4HU8A 1AXTL 4DW2L 5C08D 1NAMA 3FQNB 2Z7ZA 3GSRB 2JV6A 4J2QA 3UO1L 4X9BA 3NCXA 1W6LA 2LU3A 2H9GB 1AJ7H 5DLML 4WI3A 2VLJE 3LMJL 4UQDA 4JDZA 1S5HA 3B9EA 4RFEA 2A77L 2DQEH 4BCZA 1YN6A 2WNGA 1C5DB 3BSZL 3N42F 3EGSB 3B3IB 3L17A 3NMEA 4QOKD 3G5YA 3MV7D 1EZVY 2IH9A 1OGAA 2A6DA 2ITDB 3S36L 5DHVH 3VI3B 2DTSA 3HBPA 4D94A 1I9JL 1DFBL 2R69L 2Z9TA 3P4LA 4GSQA 4ES8A 1XR8A 4ODBD 4JKWA 4CSSA 1FE8H 1M6OA 3SYPA 4ZMLA 3HC2A 4ORZC 1P6AB 4ZO8A 3CFJA 4QHLB 3TPKA 5IBUG 3AG3B 4I8DA 2FYYA 3V6ZA 5KSAD 2AK4A 4XTRC 1S7RA 5I1HL 2DIJA 3X13A 3IT8D 4HC1L 5D1XD 1UA3A 8FABB 4DETA 4Z8FL 4L0PB 2FX7H 3FB7B 4NYLB 4HJTA 4J4PC 5BZZA 5D7LD 3TN0C 3WIFA 1KN4H 5B4MD 3RU8H 1U91A 3H9SD 2D7TH 1PDKB 5BXFB 2DLHA 3CCHA 2C8NA 3QAQA 3BVUA 1DYZA 1CCZA 4YDVA 3GNMH 4S1RH 1AMYA 1KBGH 3WNKA 3T6QC 2X44D 1ZVNA 5D1ZC 1QLEH 4R84A 2IANB 3UEQA 5LXGH 4H0GA 5DJ8B 2MEJB 4AVJA 3CFBA 4X7FC 2FB4H 1AKJB 2JKJA 3ML8A 1H0DB 2EIEA 5E5LA 1XF4B 1MLBA 4ADGA 5HGHB 5JO5A 2P5WB 3RX8A 3ZT7A 2HWZH 1B88A 3L4YA 3VRIA 3K1DA 1T6WA 1E7UA 2B0SH 3L5HA 3HZKA 1IGFL 3NPZB 4KH9A 4ZSOB 1Z7JA 2CR3A 3D0LA 3CFQA 1FLRH 1T0MB 3GKWH 3ARQA 3VD0A 5IB1A 1NFIA 4NP9A 1EAJA 3D25B 1FJ1A 3DRQA 1EANA 2QR0B 3MLWH 3D85B 2XWJB 2DQHH 1TVHA 2P9RA 1ND0A 1IKFH 5IVXE 2XBZA 3ZYJA 2AK4B 2V9QA 4FFVC 4RDBA 2HT3D 2PKDA 4PM1A 4XI5D 4G6FD 5FOBB 3T8XA 1W72B 3F7VA 4AGLA 3FUMA 1JUFA 4XN1A 5E2VL 5CGTA 2X2JA 4KUZH 4WHCA 2C4FT 4KRPD 5DVNA 1CT8A 1SDYA 3SYCA 4DK5A 1J1PL 2C7UA 1S7QA 4A7TA 5E23A 5D7LE 2XTJB 4XH2A 4MXWH 1ZHLB 1HHGB 2HKAA 5E5MA 3MOAH 5E8NB 4Q74A 3VB8A 4DP7X 2PR4H 4PREB 2CH8A 1MFBL 2ESVD 3L9RB 2CCWA 3L95A 4P2OA 3RTQC 2P5WA 4F7TA 1AANA 4MDIB 4R4BB 1YJDC 1OL0A 2Z6FA 3CFKB 4WFHE 1JGUH 1S8DA 1TLMA 1RH8A 3ULUF 2F7QA 2VUKA 3M1CA 2XZCH 2C9RA 5DFTA 1I85A 2R7EA 3BESR 3G6JF 3TIEB 1P5UC 5DK3A 2PW1B 3RTQD 2BIOA 3FONA 1EEYA 2VXUL 5DHDA 4PMEA 3NN8B 4X8GA 2E27H 1FFOA 1FIGH 2R9HC 3MRRB 3BIKA 1SFHA 4KVCL 1XGZA 3L2NA 4LU5L 3MNWB 1L0QA 4JFXA 1FL6A 1YUKB 4WEMB 2YPLA 5ACZA 2BNUA 3MACH 1LO4L 4TTDD 1SJEA 2WO4A 3H55A 4K3EL 4MZ3A 3M1OA 4K7PL 4U6HB 4NKDA 2YD0A 4FDWA 1OWWA 4MJIE 4QHNA 2Q0ZX 3UTQB 2P3YA 1FC1A 2CRYA 3EFDH 5E5MB 1C08B 1TZHA 4OD3H 1NAML 3BXNA 4Z3EA 3T4AB 5SWSD 2OX5A 3SQBA 4Y19A 4KAQL 1UZGA 3KWXA 1YNKH 3EG9A 1TT6A 4R0LB 1WIOA 2DQDL 3N40P 4JB9L 2D7NA 2IAND 2I26N 3VI4B 1IAIH 1HYSC 5F7UA 5BOZG 1J1XL 1OCCB 5EZOH 4ERSH 1DL7L 4FQ1L 2KDGA 3S37L 4QRSA 2XXCB 1QA9B 1JN6A 2NXYD 2AXWA 4G80B 1U8JA 4M4RB 2E9GA 3HFMH 3AC0A 4LVNB 2MJWA 2YPLB 1EIBA 1R75A 2GT9B 2ESVE 3VA6A 2VMEA 3WE6A 1H3PL 4P9ML 5AB0A 2AGJH 2D3JA 4AQ8C 4H44C 4F2ME 3IXAA 4IKKA 4MA8L 1CGVA 4X7SL 3FMGH 4IOIA 5HVWA 2HT3C 2E9BA 3GXTA 2PTTB 2YRZA 4XCYA 2OCFD 3CMOL 3AUWB 4L8DA 2ENQA 1WCBB 1LLAA 2WZ5A 4DOHE 5FUCC 3W9DA 3FRPG 3P0YH 2EE0A 3MNDA 3Q1SH 2XKSA 3IJ7A 5IQ9A 4OZFH 3HVNA 4RZCB 5I6XC 3HKZA 2MMXA 5IVXA 4K9EH 4UNTA 1AGBB 1DQDH 4PH8A 3FUHA 1PD6A 5E1QA 5FOJA 5F3BB 4WF7A 2YJLA 4GAAA 3NVQA 3PV6A 1HSBB 4PWKA 3B9KA 1T6VN 4K3GA 4MNGA 5IBTL 4ZPTA 5JLZB 3ABLB 4N9GA 4Q6IA 4QRFA 2YAOA 1P5UA 3PXJA 4HAFA 1FN4B 2RMNA 4Z3IA 3QCVL 2JQAA 2G9HB 3TBVA 2B1AH 1UD4A 3LZNA 4WFEE 3VI4E 4DFHA 1F4WL 1KSRA 2P5PA 3BVNA 4L9LA 3TNNB 4BIKA 1NBYB 3VSVA 2GC7C 4P2OC 2BHUA 1CYGA 4BK8A 1S7QB 2VABA 3GMPA 2BSRB 1BQ5A 4K3JL 4Z3JA 3O3EB 2EZ0C 3AXHA 3GJFK 3DVNB 4JFOA 1R24B 3CVIH 4OCYL 3ARSA 3CQQA 4M48L 5ACLA 1Q38A 1TPXB 1GVIA 2V5SA 4OUUA 4QRRA 3IRPX 3DYMA 4E9XA 1FORH 3P0GB 4U1GB 1NOFA 1S78D 4Y4FA 5FFOA 2IQ9H 3OHXA 3MOAL 4PJHB 2Y5QA 2XWJA 4GYBA 4RIRB 5DHYB 4QRTA 1EAPB 4J3VA 3RY4A 5HDLA 5DMGC 1MHHA 1T89C 4DKEH 5IMOB 4IJ3C 4HF5L 3GBLA 2O61B 4GT0A 1F6LL 4PRID 3NJNA 3NQIA 1AHWB 4O02H 1AZVA 4HCRL 1F58L 2B59A 1EAQA 4NO3A 3W9EA 1H6EA 4PJAF 3U4KA 4OZFG 3UPCA 1KT2B 3D06A 3W0WA 1IBBA 4G6AD 3GB7B 1KXQA 3H6JA 4O02B 4KXAA 3VFWB 3PF2A 3CBKB 4Q6KA 4HBQA 1IKFL 3O0RH 3CZKA 1OANA 4YHNA 4A7SA 1FFPB 3DMMA 5D7LB 1U8CA 2GJRA 2AEQH 1MH5A 1NMCB 1HZHH 1MRCH 2B8OT 3K71A 1IMHC 1AGDA 4O4YH 2CHXA 4KNQA 2ZUUA 1AGFA 1XBDA 1XZ0B 1H8NA 2NY6D 1X7QB 3V4VH 2JELH 3OM3B 3QQ9C 2ZX9A 4XPFH 1M42A 2PO6D 1HOEA 3DOSA 2IANA 2E7LC 1A6TA 4R7LA 1EXUB 3OKMA 4NKMB 1MQKL 4K8RC 4Y1TA 4FTVE 2FX8L 2MTAA 4Y4HA 4OD1H 1WDAA 4JG1H 3EJYC 3MRHA 4AYGA 1KBWA 1YO4A 4XBGB 3HZYB 5SWSA 3RNQA 5CO1A 3RPIA 4EI5A 2XCMC 1U91B 2HJFA 2VN4A 3NSXA 4IGBA 4JUTA 2CHDA 1XGQA 4UM9D 3RDTB 2EE6A 1CQYA 4NQXA 5FHAL 4QCIA 1MUJA 1T66C 1W8EA 2NTFB 3SDDA 1H6UA 4RGNC 1SOKA 3THML 4WKXA 5EC1B 3S8GB 2D7TL 4MXVF 2OMTA 5JIPA 4KZ0A 4OFPA 3LQAL 3RU8L 5EBMB 3BKJH 4JG0L 4JVWA 2JKXA 1LYQA 5E08H 3IDUA 2ZXCA 3G5XB 1DANT 4K15A 4HKBB 4AQAB 1DEEB 3LIZA 1RHFA 2NYKA 2YAMA 3PWNA 3WJLA 1RK7A 1OF0A 1NKOA 2AV7B 1FNHA 2EIDA 1QBML 3EF4A 1CLZL 3WUWG 1G9MC 1KXTB 2HTLC 2DQIL 3ARBA 3TM6A 3N44B 1CE1L 1MG2C 3QDMA 3TA4D 5CZRA 1TTRA 3WBDA 4GKZA 2I9TB 1UEMA 1KB9K 2FNBA 4PP1C 2WZPD 4A39A 1NCGA 2Z4QA 1IZJA 4Z7WE 4GQPH 3EAKA 3GSRA 3TC9A 1MHEA 4EDXA 3ZSSA 4G6JH 5F8QC 5G5DB 4DUWA 2EUXA 4DZ8A 3EDFA 2XLLA 1QSFB 1OF2A 3V0WH 1A4JA 5IBLC 3LZLA 2H41A 3RP1A 3WE6B 3RFZA 2X4NA 3QI9D 2X05A 3KYMB 1XGRA 2ESVB 3CV5A 4I3GA 3RWHA 1MY7A 4P23C 2QPEB 3SIKA 2FECL 4LAQH 4JFFA 1F00I 1M05B 1UM5L 2BCKA 3L9EA 4R7DA 4UOW0 5HJBA 3UYRL 3ZDZE 2OTUA 3B1UA 4MNQE 1HXMA 4RDQF 2XZQH 5FHBL 4AVKA 5T5NG 3HRZA 2DI9A 3H56A 2A2QT 5JXEC 3V4VL 3MYJB 3CFJB 1FL5B 4G82A 4YQXH 1CYXA 1G7LA 3U0TA 4F57L 5I1GL 4HLZG 5KYWA 5ABZA 4LBAA 4QXGH 4AM0B 2VLRD 4MZ2A 5SV3A 5MP6L 5IQLA 3IJYA 3ARFD 3V5DB 1OQOA 5IKCA 4TSCL 2IDFA 5FYLE 1BFOB 4JFYA 4XPBL 1KXTA 2A4CA 1FFNB 1N5YH 1B9ZA 4F1ZA 4MNQA 5IGXH 2PCPB 3IDJB 3GMOA 3TNMB 5FWQA 4EUPA 3SDAD 3MJGX 3FTGA 4XMKL 4W9GC 3NZ8B 1A9EA 3RWDB 4LBEB 5BRZD 3X3GH 5JHLL 1ZS8B 1BZQK 3JTBA 1T2QL 1N68A 3C5SA 5D71L 5AW5B 1FFOB 3MRRA 4RFNB 1I8MB 2ZT9C 1LK3L 2P5EE 4DKEL 2O30A 1TNMA 4QOKB 1RIVH 3MV8D 4G7YL 3B8YA 4M1DL 2CRIA 3QYMA 1I53A 2H6UA 4BSWA 3T3PF 5KVFH 1CB4A 3Q2VA 2IADA 1EJFA 1QFOA 2VL5A 1W0VB 4NS0A 4DGVH 5IHZB 4U1JB 5C0FB 4U3SA 2E7LA 4HOXA 2HT2C 2QTVA 4AYID 5T8IA 2H47C 3L7EA 2FAUA 2RAMA 3M88A 3GXUB 2BSSB 1NZRA 1JWMA 1LEKB 5D6DA 3AUVA 3TZVA 3H9SA 5BV7H 4WWKC 3EOAB 1BVZA 1YMME 4LCWA 4FEIA 4NQCB 3HE6B 1G7LB 1BYNA 2KS0A 1INEH 1AD0B 3CFUA 4K3JH 4TXVB 3TEYA 3WKPA 4YDJA 3DGCR 4ZUVB 1T1ZB 4E5XG 3UGUA 3ECUA 4U1MA 1QRND 4JN1L 1G94A 2Z7YA 3B9DA 5J06A 1JNHA 2CXKA 2XWTB 2BSCA 4M4PA 1Q0YH 4F7EA 1A25A 5GS1A 3SOBH 4HLZH 4P46D 3V95A 1AKPA 1ZPLA 3FB8A 1N3NB 1WCBA 3ZE2F 3D18B 1HKLL 4PY7A 4JO1L 1UKQA 3VH8G 4K7FA 1Y1DA 3VG0H 4ZPVA 2JB5L 3AM8C 4Z7OB 3OZKA 4H1LH 1ZEAH 1UB6B 3FKUS 4C4UA 4X7CC 2MCG1 5H8DA 3QNYB 4XBEH 5ITFA 5KBLA 3HB3D 3EHBC 3VXMD 3BGFB 2BNRA 2CO4A 2EICA 2Y2WA 1X5HA 5HDQH 2D2OA 4LMQI 4FJZA 3JZYA 3QXAA 4H0IA 3BDYH 5AFAA 5J11B 4PPTA 2Y3AA 1D5BB 1S7SA 2OFQA 5DEJA 1GRWA 1O6SB 1FPTL 3FUEA 4X8JA 5DURD 5GRVK 1HHJA 1VEOA 4PJ8C 3TVMA 2BCMA 4F91B 3GSQA 1BD2B 1RZGB 1IBYA 5C3IA 5J4MA 1SUHA 1UXSA 4ODHL 1QFHA 4FCAA 1AHWC 3JWNG 3LPPA 2EVJA 1LNUB 2BSTB 2EDTA 1NCHA 1QR1B 1EHXA 1RP8A 2WBJA 3EYFA 2BIHA 1T1ZA 4J27A 4P23D 3AY4C 3BPCB 4YWGH 3LKRA 1PLGL 2Z31C 2BHZA 3T6XA 1TNNA 3RDTC 4ODVH 4FI6A 5LN8A 4O00A 2WLLA 4QYOB 4DFIA 3MJ8A 1MCLA 3KPOA 3SJVD 5JIKA 5SX5H 2G2PA 2EE3A 3LNGA 5IQ7H 3ZTNL 3IGAB 4JB9H 4JGUA 3IFPA 5F1NB 5C2BL 2C7FA 5BS0B 2CJSA 2DQMA 5AD0B 3GTNA 1VFBB 3BEWA 5GGVH 2NY7L 5DC2A 1VADA 4JM2C 5LG6A 4PS3A 3LZFL 1BLNB 2CLRB 4JLRA 5D1XC 3B56A 3QISA 4F7MA 2AABH 4PYHA 4GKSA 2EXWD 5DJAB 1WAPA 1N9PA 4H1LG 2DYRB 2GBVA 2CBTA 4ONHB 5DVPA 1U41A 1WHOA 5KANG 1G5AA 5EIIB 2CWRA 1JD7A 2OR7A 5GSRB 2OMUA 3PDDA 3ELQA 1DBBL 2ZE0A 3WKMH 4C59B 4X0KB 1E5BA 4LASH 5JPNC 3C6EA 3F83A 2JXMA 4IOIB 1NMAH 3LEYL 2RGSA 3CZJA 4JGJA 2F9BT 5GSVB 4R4FL 3DHPA 3WEXB 5JA9A 3UTSA 1P84J 4FKKA 3C08L 1L9TA 4PJHF 1AH1A 3AWEA 3O4LD 3NEEA 4LCIL 3JV5A 4UQ9A 3W57A 5JIQA 4IS6A 4XMXA 3K6DA 3UPAA 2MRYA 1VFAA 4JW3A 3S3SA 2EE9A 3KLAA 4OLVH 4FTVA 4HEPA 1FO0L 3GJFA 3RAJH 2P4AB 2ZNWA 5FF6B 2Q8AL 1GYAA 3JT2A 5AG8A 1R3LA 5K9JH 3NRPA 4HJJL 3SGKA 1J1PH 2X4RA 3DRQB 1ID5I 3RNKA 1NCCL 5HGDB 3UC0L 4L4TB 1XF5B 3G08A 1TYJA 1KUMA 4WY7H 1OT2A 1SXCA 1W8OA 2Q20A 2X4OA 2HYMA 4OQTL 4KK5D 2BJMH 3VA2C 2QGBA 1TEYA 2F68X 4AW7A 1E2VA 1ZV9A 3E8UH 3NH7H 5D93B 4RX4D 4P48A 4OY9A 1EMTH 5GS0H 2C3VB 5FV1L 2X0UA 1HINL 4F8NA 3BGMA 1QBLH 3CHRA 3KYAA 4ZX3A 2QGEA 3V6OA 4ODXB 3G6AB 4IBSA 4DP5X 1W91A 2DQHL 5FA4B 3SKJL 2ZCKH 2J4WH 3V52H 3BAXA 2Y5TA 4K9JA 5FR3A 4MB4A 4Q9RH 1P6WA 2XV6B 4MD4A 2P8PB 5C0CB 3ABGA 3EFOA 1RUPH 1DVSA 1HINH 1I8KA 2QVKA 1GKEA 1OPGL 4G70B 3VB9A 3BX7C 3FONB 3T1WA 1AGBA 3QCTH 2ZAIA 1JTTA 5M94B 2CALA 3C60C 2XA3A 1QQDB 3G5XA 1NJ9B 5F8RC 1FNSL 4BFFA 1JMXA 2WQWA 3TTSA 4RRPG 5CUSH 1YEFH 4MA7H 3QZWA 1PDKA 5BXFA 3MRNB 5I6XB 3D4ZA 2YJQA 4URKA 2GTZA 2QKSA 2X38A 4WO4A 4FMKA 3DIDA 3QEUA 2FIKB 4BWUA 4NYLA 1SXSA 1LDPH 4Z18A 3EOTL 5J9PA 2GSMB 3MV9E 4KHTH 1FO0H 4LPYA 2Z35B 2IDSA 4ZZFA 4JFPB 1J8KA 4N1HB 4ZTPH 4DERA 4M9OA 3NJXA 1BSIA 4M29A 1WGOA 4FS0A 4OI8A 4WTXA 4S1RL 4J4PA 4X4ZA 3ZK0A 4HIHA 4HSCX 3W11D 3JWOC 2ZIDA 4C47A 4R0LA 3PJNA 3MBEC 1YRKA 1URIA 2W65B 1NQBA 1CLCA 1MRFL 3B2VL 3HN8A 5J12B 5DHVB 2YUWA 1NKGA 3EO0B 3DIFB 2P8MA 3AMLA 4ZNCD 3IKCA 1TTFA 3IPBA 5KUMA 4H5SA 1IC5L 4PJCE 4TUJB 1H3XA 1UT1A 1SXNA 2F8VA 2IG2L 3INUH 2WD0A 3VGGA 1DBKL 1YNTB 1D5BA 1MVUA 3GS0A 2XTJC 3DOSB 2A1WL 3MJ7A 5MI0B 4BK4A 5EUOE 5BOJA 2DH3A 3WIHH 3PIQB 1NJ9A 1EQWA 1IGTB 2DQUH 2X4TB 5HYJE 5BZXA 2JKTM 3HG2A 1RPKA 4ZUUA 5KSBA 2EDDA 1HCVA 3QDAA 3QUML 1I7ZB 2F2HA 5EF0A 3HB3C 2FIKA 2IPUK 4GBXA 4GEIA 3WHE0 4XWGH 4GRWE 3I75A 1SEBB 4NHUB 3AITA 2NY3D 4PG9A 3RY6C 5MENA 5DMKB 1T3FB 5F9JA 4PRHD 2VMFA 3SE6A 4FRWA 4OZHB 4KJPD 2K9UA 2D31A 2XC8A 3UBFA 2NNRA 4ZTPL 1G87A 2EIMB 4ZRGA 2YSSA 1PLCA 4UTAA 4DZBB 3BO8A 4ZW8A 1JERA 4Y2LA 5I5MA 3MJ7B 4HAGA 1ORQA 4JBSA 2NY3B 2BSSA 4BXVA 5FF6A 5F2FA 2JCCB 3APMA 3FSVA 1BX2B 2XN0A 5EZJB 1H9DA 1EX0A 4N0UE 2VXSH 5H35B 1S8DB 3LPOA 2VITB 2OYPA 1BEYH 5TPWL 4EI5B 1MSPA 3K5RA 1PYWB 4AL8H 4POZC 1NUGA 2VUYA 5ESQA 5LUMA 4WWPA 3FO2B 4KJWC 5E5RB 5K5YA 4IEFA 1URZA 2EDBA 3FT3B 3RKDC 3U30C 4OIIL 1OCZB 3BWZA 3L2LA 5CJXC 4J1UA 3FFDB 5KTEL 3IN0A 3MU3A 3FW6A 2NMSA 5LAPA 3ZTDC 4N0YH 2M8XA 4LP5A 4MD5A 3T3MB 1PL3A 1ZEAL 1RZJH 4DCQA 3GKZA 1K4DB 5TE6L 3IVKA 5TQ2L 1IGCH 2QSVA 1JHTA 5CSZA 5EN2A 1UJ3C 4OQTH 3TCLB 3TBWA 2V8MA 3EFFB 4GRWH 2ADGA 4PJ5E 1QFWL 4RZKA 4E9TA 4FYQA 2E9IA 1MW1A 1RMFL 3UIZA 4C58B 2H4EA 1DQQB 3FTUA 5TF1L 5GGRY 4OCMC 3U83A 3JWDL 5K9JL 4GAJH 2AQNA 4MZRA 4ZQTA 2Q8AH 1JZ6A 2H32B 4LHUA 3WFDL 4G7VH 4QHKJ 3AADB 3LB6C 3Q0HA 1JL8A 4WIQA 3MXWL 5FFLA 2LLNA 4DAGL 3IXTA 4LVEA 4NQDB 3IMBA 1AHMA 4I87A 3HS0C 2XPZA 3QQ4B 2F74B 5GS3A 3ZLQC 5CJOH 1D5ZA 3DHUA 1NKRA 1U8JB 1KIPB 5DVOA 3HG3A 4N2LA 3OPZH 2ZOWA 3P11L 4A66A 3RWCB 3WJJC 3LPGA 1O7DC 4N0UB 2HX9A 3BUQA 4R4FH 1QYGH 4Z1PA 1WHPA 4MD5B 1VLXA 3V4UH 1QBBA 4F33A 2H32H 1JXJA 5TGBB 2WINB 3QUZA 4N0YL 1QEWA 4NHCL 3ZHNA 1IEBB 4NNYB 4BWWA 1GJWA 4I48B 5EZLB 3ROLA 4H25A 2ZUWA 1LK3H 2CA3A 1QSEA 3EYVA 2CD0A 2OP4L 3NCJL 3PNWB 4Q4IA 1OLZA 4ZBJA 4ZTOL 2FECI 5EEXA 2YIHA 4Q7DA 1EJ6A 4UT6L 4Y8DC 3O2WL 4WO0A 1KTLB 4KBPA 5F1KC 5B38A 1AC0A 5DJ6A 1IGIL 3CN3A 2XFXB 1D5XB 3QXDA 4GBXC 1BEYL 2WUBL 5B1BB 1HCFX 3VXOA 4NUJB 1QLRB 3MRGA 4XXDA 4Y2OB 3LXUX 2C1PA 5F7MC 1WVZA 3ZYIA 2Y72A 4DT2A 2HA1A 4K4KA 2FH8A 5KVDE 5BMFL 1HKFA 5EIVA 3RHWK 2D7QA 3A6CL 4S1DD 1BBDL 4IBZA 3WEXA 5I1KH 1EFXB 1WZLA 2VSDA 3ALWA 5MP6H 3DO7B 4O58L 5CF3A 4MNHA 4FMVA 2W80C 4YIQB 1TZIA 3X12B 4NIKB 3CZLA 4Q6IC 4WWID 4YQXL 4QDGA 2X40A 4FZEL 5DMKA 5HHOD 1PSKL 4LPUA 4ES9A 1HJCA 1R34A 2FT7A 4AWJC 2FL5A 5FM5M 5JUEH 1AE6L 5L7XL 2IV9A 4LAQL 3IFOB 1N4XH 3GSWA 4U0RB 3GSNA 1ZLDA 3CHXA 2Q8BL 1J9TA 4PW9A 4XNZC 3RTQB 2ZG2A 5HY9B 4GT7A 3FAXA 2EH8L 3ULVH 2Y07L 1HWHB 3I6GA 5IUSA 4XOAA 3FT0A 3VSQA 1BAGA 3WNLA 4FQIH 4UCFA 1J48A 1ZVSB 2CIIB 1H3UA 4WHDA 1UYWL 5EV7A 4IOFD 1W0WB 1AACA 1GGIH 4KVNH 4RCAA 5EBWB 1KLFB 4KROC 5AOZA 3INUL 5I5JA 1SGKA 5KOMC 5CEXA 2WLJA 3LKRB 1HHHB 4X6BB 3WJJA 5I30H 3MRBB 4ISVA 2X4OB 5HI5C 4F15B 4CW1B 4EN3D 2Q10A 4L1TA 3D05A 1NFAA 5DHEA 1JZ4A 3NFPB 3VYOA 4FD0A 3HC0B 4G9FE 2IAMB 3CUPB 4XMWA 2ICEA 1XF2A 2HX7A 1E2WA 3QZMA 4LQ1A 1CPUA 1ANUA 2VLJA 4YHOH 5BOPA 2BY1A 2A74B 2UX7A 1J8HE 5LBGA 3QT2A 2BVTA 2IPUG 5IFAL 1VCBC 4XBMA 3MZGB 2VLKD 1S3KL 3KH3A 3SDDD 1CI3M 3CD4A 1EV2E 4G7VL 4KC3B 5KYUA 1G0DA 1Z3GL 4M61A 4NRXB 3P2TA 4HIJB 1U8IA 1L9PA 2NXYC 5IHHA 1MCPL 3WFBH 4N90D 2L7JA 5EU6D 4PJIF 1R3HB 1IE4A 2H26B 5DUBB 4HKZA 3HAEA 1J0YA 5CCJA 3KDMA 4ZUSB 5BCAA 2I32A 4OCNC 5E8PB 1L9MA 1S7XB 2XWRA 2YARA 3GXIA 3IMTA 2R2HB 4AENA 1NUDA 1X5ZA 2WZ0A 1S5IH 3L5JA 3ZHFA 2VAJA 1YNTA 4Z7OF 2BVOA 4LOUC 3HG1A 3KVPA 1U21A 3EDEA 4RMWA 2ZWLT 5HBBA 1EO8L 5TE7H 2GHWB 5CINH 3WELA 1AOZA 1XEUA 3NCBB 4XMKH 5INDB 3IGKA 4BKTC 5DHVA 2AJUH 2XKUA 4OJDH 4FFZA 1NUFA 5IFJB 1DJWA 3WV0A 3U25A 3H9SB 2VJ8A 5HJGA 3D50A 3EOYG 1WH0A 1NINA 3L81A 1IEAB 4G7SB 3BPLB 4G5ZH 3BAJA 5AYUL 5ACMA 2FUTA 1JFHA 3CFEB 3UTZA 1OSEA 1ZHBB 3P3TA 5DD3H 1RUAH 3T71A 5B39B 2GSIA 4H20H 4UBDC 3HJEA 3FB6B 4MNHB 5IQNA 3OAZH 4MMXA 2X4UA 2N1TE 1IQDA 3RL2B 4BZ2L 5EBMA 1EK3A 1TG8A 2Y1YA 1BZDA 3KCPB 2BWQA 5F1OB 4K71C 3O9WA 4MQ7A 3EJPA 1FYTD 4U0RC 3IGLA 4MJIB 4UILH 5JMOC 1QTSA 5EIQA 1MRDL 4YE0A 3IU3A 2BOLA 1K5NB 2LFGA 4OBSA 1D6EA 2R23A 5SV4A 2FCBA 2J12B 3O3UN 4WI8A 5I6LA 2X1OA 3QUMH 3ZKNC 1PZDA 1RHHB 3RUGF 4OIFA 4PRAA 3NIFE 3SDAA 3ALXA 3GEWB 1U30A 2IFFH 3ZVVA 2NY5H 4HJGB 1QMUA 2ORBH 4G9FA 4YHZL 1IBDA 3LEXA 2QT6A 4P4KC 5JTWA 4L9LC 4Y9EA 1OM9A 2B7DT 4KX9A 3VFMA 5E6ZA 3RIFF 1BXVA 4QRPB 4JJHA 3RVWC 4ZMWA 4EI0A 1ZHNB 2ED6A 1XGPA 4NI6A 5A16B 2A1WH 4Y2OA 3TONA 5EEYA 2RALA 5D70H 1Y7VA 1CE1H 4S11A 1AIFA 1CU4L 3T5WA 4KK9C 4DN4L 2W0FA 3U7YL 4YBLB 5GRUH 2HG5B 1BFVH 4AUUA 4WI4A 1AO7E 3SE8H 5C0AB 4P8QA 2DIAA 4P9HC 1CGXA 2CGRH 1LE9A 5CGBA 1Z2KA 2LAGB 5BVJA 5ICZB 1CGSL 3BWAA 4P46B 2EYRA 3MLSL 4M93B 3VXSD 1KCUH 1JYXA 3S4SA 4H88L 1FNEA 3HE7D 2K6YA 4MCNA 1KCWA 1ZVHA 3WJMB 1QRNB 4KMTH 2QTEA 3CMOH 1O9VA 5I2IA 5D7KD 3THMH 1T7XA 4JQXC 2XKNA 1F3JA 4LSPH 3CPUA 1AGDB 5FHAH 1VAHA 3AU1A 4NNXB 1HQRA 4X7SH 5D2LE 1HAUA 4PIRF 3EOAA 5T3XE 4DK3A 2X6VA 2VMDA 1V7NH 4DH2A 2R15A 1NFDB 1H3PH 5CLXA 1AZCA 4IRSC 3WKYA 4OD1L 3SPVB 3P9MA 2C3GA 1M1XB 5CSZB 5AL0A 4ZMYA 1RULL 2ZSVA 3QORA 1WZ1H 4PRAB 2ZSWB 5FKPB 3OB0H 1EDHA 1GZQA 2FIRT 4YXLL 2DQGL 2DQ6A 4DP2X 2ZX7A 4N5EC 5GS0C 1C8PA 2G60L 2VZVA 1GH7A 3R8QA 2PPAA 1F18A 4AZUA 5JA8B 1R3HA 1JXKA 2C4XA 2NPLX 3CK0H 3C5SB 4L4JA 3DHMA 2G2RB 3VWKB 2F7PA 3L1EA 2DQDH 1Q94A 4GP8B 4PU2A 2L4OA 4JFDB 2UWEA 1FZOB 3S5LA 5CKGA 1E3ZA 4PJAB 4XGZA 5D7JA 2Q3ZA 5EMYA 2P48B 3F6JA 2QQKL 1XO8A 2X53A 4XBEL 5IM7A 1HH6B 3LZPA 4QR7A 2A4ZA 2EAEA 5I2IB 2Y7LA 4ZK8A 2O5ZH 2OMXB 1AY1H 3EH2A 5T1LA 5A2IH 2YN3A 1S2EA 3GSXA 4LQFH 2IANE 3DVNA 1BJ1J 1VEPA 3SE3A 3IDIB 4J7RA 4QRPD 5F88A 1IEBA 4APQD 3PP4L 4HUXB 4X4KA 1FVCA 5IFJA 3EBGA 4UM8A 5J1TC 3CJJA 4KVCH 5KW9H 1U92A 3NGBC 2VERA 4OJCA 2NYYC 3VXSE 4WJG3 4WFFE 1M7DB 3MMEB 1MJUH 4D9RD 3QRGL 3EIFA 2ITFA 3KLSA 4YBQC 5MERB 1NFDE 4RMSA 2IBGA 4YHNB 1QI5A 1RZQA 2GB2A 2R1WB 4UV7H 3EO1A 1FFPA 1CICA 3FQXB 1CGUA 2ZP8A 3MR9A 1J5OL 4HX1B 4JFWA 4OCYH 1AS7A 5IV2B 3I02B 4P4RA 5IHWA 1N2RB 3QG6B 4Y2DD 1P4LB 1EBPA 2EYTB 3FS9A 4DGVL 4XODA 5EEZA 5EF1A 4ONGH 3RJQB 4U1SB 1TIUA 3ARGB 3LKNA 5KJ7E 1RIVL 5A43C 3ZTJH 3LV3B 3TBWB 3WKML 1SBSH 1F4WH 3GXPA 3OSVA 5FLVA 2DJUA 5IG7B 3IJYB 3FTGB 5C0AD 1Q0EA 1XH3A 4FXGA 1RSFA 4WAFA 5B7FA 5HI5D 4XMLL 4LCUA 4AYFB 5K9OB 1NIDA 3QJUB 5IFHH 4TVPD 4HK0A 3GS7A 2YAQA 1QSZA 1Z9PA 2I07B 4WWNA 5E8EB 5IGXL 1F8TL 4WU7A 4KZEL 5F7HA 1A7NH 3Q2NA 5AAWC 4K8RH 3OKMB 2HT4D 4NKMA 1NGQH 1ZWIB 2W65A 3UGXA 3FRUA 3O11A 4GNKB 1QSFE 5IVOA 3BD4A 3NIDF 3ZTNH 4A37A 5MI0C 3UTTE 4BZYA 3OMNB 4TNWF 5IW6A 3BW9B 3WLWC 2A38A 1IGFH 1T1YA 4DPRA 4YFDB 5CZXC 2X70B 2QPSA 4OM0L 4AIOA 5A2CA 1ZA3A 2G60H 2ZX6A 4R83A 2A74C 3FMGL 4KH2A 4L4TD 3VM5A 4PJIE 4MA8H 5DZNA 5DYOB 4H25B 2H2SC 4GRLC 4OFKA 2H1XA 5DFVC 5I1DB 1IGYA 5KYNA 1OHQA 4ZOAA 4ECNA 1E28A 2QPUA 3ILQD 4U1NB 5CZXD 1RD6A 2CGZA 4MNGB 1QSFA 5JIHA 2YGNA 1TETH 5FECB 1QLEL 1U8OA 1D2OA 2YBRB 4PLOB 1I8MA 1YY8A 4LSPL 4P2RA 3DUSB 5A6MA 1J1XH 5HVHB 3NZHL 2R1XB 1E4WL 3OAWA 2I9TA 1I3VA 2Q7YA 3DXAB 3P4OA 1CLOH 3GMRA 2WXFA 3HLAA 4ORGB 1LO5B 2PPEA 2YPLD 3BZDA 5I5RA 1DQMH 5JHDA 3LYRA 5C92A 1YNKL 1JVOA 2DQIH 4B9JA 3UCRA 2L7UA 1TZIB 3X12A 4JY4A 1ECZA 1J0HA 2YPLE 4Y9FA 3FQUB 1ETJA 2H26A 5DUBA 4LRIA 3FN3A 4HZ1A 4DN4H 3UX9B 3PHOB 1NGYA 4CC0A 3FRPB 1FGVL 2KQMA 1ZK5A 2LFEA 2NSXA 1ZLSL 3ABMB 1I9JH 3O6FB 5D6CB 1FH2A 3PNWA 1QA9A 4M4RA 3RIKA 4YHZH 1GYUA 3IJHB 1PX8A 3LN5A 3ZDZF 1VESA 3DOIA 4BGLA 5ID0B 3NCCB 4BSVB 5ENWA 1KGCE 1VHPA 3C8KA 4PD4K 5C97A 3SPVA 4X7DC 4QEGA 4Z7UB 3ILDA 4ZODA 3WEBA 1KTBA 3UO1H 3ZMNA 2Z7UA 4NQCE 2X89D 1XH0A 5LBSH 2OMNA 3ZTCC 1U3NA 4LKXA 3Q8BA 4B6ZA 1WRFA 1NMBH 5C0IA 5IIEA 3L3IA 3O4LB 1L6PA 4GAGL 3ZE2E 5JMRA 1RPUA 3J27A 3EJRA 3KXFD 5BRPA 5CJ5A 2HJLB 4XNBA 4H20L 4DUXA 2VDLB 2PTUA 3A0OA 2FR4B 5I8OL 4NPKA 2CBOA 3AWGA 1KTDA 4XC3H 4U6YB 5J6HB 4PR5B 3NP4A 4LLMB 4Z9KB 4YHKL 4YSUA 1T0MA 5TQ0L 1Q4NX 3Q13A 4U1SA 4ZT1A 2I60L 3N41B 3N9GL 2CDFB 5H37A 2UWEE 2YPKA 3HN3A 4XNMB 1YEIH 4YR6B 1E67A 1I1AB 1XH1A 3MOBL 3MV7A 2AJUL 2R7EB 3PHQA 5D7SL 5AOMA 2H6PB 2DM2A 4HCRH 4IIQC 1BF5A 4QIRA 1U93B 1S9VA 2O4EA 3EFFA 3A67H 3MLVH 2I60H 3BVWA 4G8EB 1NTDA 3UJIL 3RWGB 3WSQL 2XJLA 3ARVA 2J5LB 4UAHA 4E9WA 2H0PA 3RZWA 1G84A 5IIEB 2W0LA 3LCYA 3OL2A 4HWEH 4AIZB 1AZZC 2ZUQB 5B22A 4HS6A 2AK4D 3DLQR 4WUUE 1X9LA 2FVNA 1KLGA 5HHME 5FV2A 1E42A 3BAEH 1GMEA 3ARDC 1KCLA 3U1QA 5C09E 3V5HB 4MCMA 2OMTB 2PWEA 5IQOA 1N6QL 4LRIC 1NBYA 4ZX5A 4KO6A 4W93A 4LP4A 4E41B 4WW2F 3DKHA 4Y19B 1NMBL 3IMWA 4XB3A 5D72L 1B2WL 3FJTA 4FTVB 2VABB 3GMPB 2VW7A 5D1XA 5FYKD 3T4YA 1MREH 4LNRA 4TUJA 1NAKH 3MUHL 3ESOA 4BFRA 1INDL 4PV9A 5CGYC 1QO3A 1HTYA 1UD2A 5IESL 1HHIA 1CK0H 2V9UA 2F54E 2UY6B 4HUUB 2BVUA 3GNML 3BVDB 1DLFL 4GW4A 3MGAA 3VGDA 3F05A 3QIWB 2BS8A 4XVUD 5JORB 5CSGA 1M7XA 2XQ0A 3F3HA 3MA7B 2LLLA 5TDNB 3U30B 4XAKD 3DIVA 3QULB 3WJLC 1TENA 1J05A 3UAJC 3E6FA 1WUZA 4FYRA 5B3SB 5C0EB 3PL6A 1L6ZA 2ZOKA 2WBWB 1YDPB 3VRIB 3IDMB 3HAEG 1QBMH 3M07A 5JHDB 3L2MA 1O7DE 3D51A 3FT2A 3LQZA 1JZ8A 4M93C 1DLHB 5E8PA 1HZLA 3JWNC 4GO6B 5T1KA 2NT0A 5KVGH 3DJ9A 3GBML 4Z3TA 1Y6MR 4MA1C 2BNRD 3KDPB 3HHMA 2BY2A 5E9NA 5EBLB 1UHVA 5JHAA 3NZHH 1MJ8L 3ULUD 4RESB 3BGFC 1OTSC 4X6FB 5HI3C 3E2HC 1G1KA 3O41B 5BRZA 2Y07H 4XHJC 3EBIA 1FFTB 1YAIA 4P23A 1M56B 2C3WA 3EOBB 1CURA 1DJSA 5D7IA 1J8RA 3LNEA 5C09D 3TWCH 3OC5A 1T4KB 4X9IA 1ODUA 4CC1A 3QXWA 3FTZA 1L9OA 3IF1B 3KYNA 1AE6H 4MAUL 2KYIA 5BVPH 3K6SA 5F89B 4U1MB 2VDKL 1PYWA 1SEQL 3EJCA 4FQCL 5D1QA 3UOAB 4AH2B 3D5OF 3GSUB 1TTAA 3TNNA 3BZ4A 3H53A 1PZ3A 5FA3A 2JCCF 4JAMA 4M6ML 4NJAH 2FGWL 2WP3O 1SY6A 1YECH 2IC2A 1J9RA 3QDJD 3TYGL 4LF3B 3ZIMA 4EXKA 4Y1AA 3V4PB 4B9FA 4TOYL 5DJDA 1YA5A 1PZ5B 3NJVA 4KTDH 3HG1E 1J8HA 1F4AA 2OSLB 1E30A 3RKDD 4OR1A 2WUBH 3LDBC 4FXGB 4XE5B 4RZCA 3WXVH 3FCUB 5HDBF 5BS0D 4Y1AE 1RIHL 4MAYD 3IDXL 1IGIH 4AEHL 3UBHA 5D7IB 2NNAB 1DN0B 4LDEB 1DQQA 4A1RA 3LKNB 1GY1A 2H6PA 3MACL 2OP4H 3NCJH 2B4CH 4M7ZB 2ADYA 4HF5H 5MEQA 1PPIA 5EOTA 5C0RL 3IPFA 1MHCA 1FIGL 3UPRB 4BFJA 4N6QA 4TMPA 4BFOA 4NHCH 2APBA 1CYWA 1NC2A 4G1EB 4DVBA 3QUHA 1D5MB 2AJYH 3K4DA 4OZGE 3R4DA 3HI5H 5I1CL 3MV8E 3ULUE 4F1SA 1Q9OA 3GBNL 4S1SH 3BRGC 4YZWA 3D4CA 5CNHA 1Z6JT 4YZFF 1KEGL 1CXEA 3ABKB 5ECGA 4LSSH 3UGEA 2XG5A 5INDA 1YLBB 3B7RL 5E2WH 5EB9A 1BIHA 1TQWA 3WFDH 3MJ9H 4XP1L 1DBJH 1PY0A 4XPHL 4DO4A 4Y4KA 3V4PL 4FFYL 1B9KA 4ZAKB 3A24A 5SWZB 2R59A 5KBDA 3P4NB 1HHIB 2XU9A 1QFWH 1QTYT 3AS1A 3AJ7A 3C8DA 3D8MA 3Q8AA 5CP3A 2OQJA 1EUTA 3C8HA 4BKLA 3VDCA 4IKIA 5AAMA 2WBJC 25C8L 2VDNL 4DEWA 2AXHA 5TE6H 5HP5A 4LOFA 5I0VA 2A73B 4Y16C 4QNPE 3UYPA 1AC6A 4GEJA 1HNFA 3I9GH 1I7TB 5KJ4A 3BFWA 2XXGA 1DQDL 1CFQA 1XTLA 3B5GA 4OGQC 1PD1A 1EHAA 3D39B 4Y9BA 3VH8B 5MEPB 3VGFA 2DLGA 3Q1SL 4HIEA 4B96A 4OIIH 5EC1A 4WRLA 3T0XA 3CDZB 4P5MB 4YXHH 2NY1B 2ICCA 3FDWA 4JFPA 1A64A 2YXVA 1A8ZA 2PXYB 4M7JH 3NJHA 2B0SL 4AL8L 3QDME 4Y5VC 2P52A 5MEOA 1P9MC 4MJHA 1I82A 3W0WD 4M62H 4ZS7H 1X5JA 4MDIA 4DTGH 2VE6B 4JY5H 1RULH 1T04B 2DI7A 2IPKA 2LT9A 4MSWB 4OJFH 4G9FD 3H2PA 1MW0A 5DD0L 3FK3A 2VQ1B 2O26U 4JLRB 4J3UA 2GBAA 4UT7L 3KL5A 5EO9B 2H2PC 1BQHA 4GXUN 5E4IA 5A1AA 1G1OA