4ZMNA

Crystal structure of human p-cadherin (ss-dimer long)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
213
Chain Sequence
DWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Cadherin-3
total genus 48
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmnA01
3Q2VA 2OMXB 5CO1A 3K5RA 4XXWC 1Q1PA 4ZMQA 2EE0A 2O72A 4ZTEA 3PPEA 4NUPA 4APXB 3Q2NA 4ZMWA 5CZRA 1NCJA 3QRBA 1SUHA 1ZVNA 3K6FA 4ZMZA 3K6DA 4NUMA 3Q2LA 2WCPA 4APXA 4ZI8A 3LNHA 2OMUB 4XXWA 2OMZB 4ZMOA 4AQEB 4ZMVA 3K6IA 1OP4A 4QD2E 3LNFA 3LNGA 4AXWA 2WHVA 2V37A 3FF8A 5KJ4A 4AQAA 2X2UA 3LNIA 1WUZA 2OMTB 3FF7A 2A4EA 2OMYB 1O6SB 2A4CA 2WBXA 4ZMXA 3LNDA 2YQGA 1NCIA 4AQ8A 4ZMTA 2OMVB 1NCGA 4ZMLA 2QVIA 4ZMPA 1EDHA 5DZVA 2WD0A 4AQ8C 4AQEA 4ZMNA 4NQQA 2QVFB 4AK1A 4ZT1A 3LNEA 1L3WA 4ZMYA 3Q2WA 1ZXKA 4OY9A 4AQAB 1NCHA 3UBHA 4NUQA 3MVSA 3K5SA 3UBFA 4AXWB 5JYLA 2OMWB 3UBGA 5JYMA 1FF5A 2YSTA 1WYJA
chains in the Genus database with same CATH superfamily
3AQYA 3BE1L 3CZFB 3PHSA 4ORZC 4GAGH 4M4RB 2A1WH 1RPUA 4P5TC 4HZLB 4ZMQA 1R0AL 4MRBA 4LAQH 2YPVA 4LIQE 1RZJL 2EDKA 2HX9A 2W9DH 7PAZA 3Q3GA 2APTA 3WKPA 3B6SA 5B39A 1HIMH 3TN0C 3G6DH 2VLME 2N0MA 5C7XH 1S7TB 1FHNA 4UIKH 4EN2A 3BVVA 1CDGA 1VENA 3BO8A 5AB1A 5E6IC 4N2BA 4X6DE 4LPCA 3LRMA 1MDAA 1U8JB 2O5NA 2WUBH 3U0WH 1MRFH 4P57B 2OTUB 3QP3A 3S36X 2DIBA 3GSXA 5IFHL 4ELKA 4TQIA 3IJ9A 3KPQA 3HMWH 4FJZA 1MWAL 3GIZH 5GZND 2EYRB 3P9MA 5EN2B 1B0RB 3R1GH 2FATL 4R5XA 4KJQC 4P23B 5DFWH 2NR6C 1MAKA 4NQDA 1SBBA 5DJ0A 4LVOC 4DETA 1J87A 3H7BA 3MLUH 3FN9A 3IRCA 1BVLA 1KTJA 1IGTA 1N0LB 3NAAH 4L3EB 5LCVL 4QHKJ 3HC3L 3WS3B 4E68A 3O41B 5F89B 5GSRA 5JOEA 3IK2A 3TO4C 5HYJB 3STLB 2FK9A 1G6VK 3TYFA 4NJ9H 3VYOA 3J7HA 2JJUA 1V7MH 3QORA 1OT2A 2G3XA 1AQDA 3ZDZB 3PWVA 5E8OA 5DWUL 2YPLD 3KDMA 2GIMA 4U2YA 3UXFA 2PPCA 2ZXGA 1LEIA 2X4PA 3FU8A 5SWSB 5LCVH 1E27B 2ZYIA 3OJVC 5JXEC 5F96L 4L8BA 3FQWB 1T89C 1TLMA 3PWPE 3T3MF 3CSBA 4Y4HA 3WAKA 3MODL 1IEHA 5CINL 5F21B 3U9PL 4MDJB 4YHPB 1XCQA 1H8NA 4FZEL 2BXYA 1T2XA 1GCFA 2YARA 2WQ8A 1DVSA 2COQA 3GS7A 4Y5VA 1ORSA 2VDKH 4J3OH 1F45A 4QWWD 4XBGB 1O7VA 4HMDA 2H2PC 3SJVA 3WHXB 5EHFA 5BPPA 1CT8A 3ZE0E 2DYPD 4I7ZC 4JFOB 1UWFA 1UT1A 4S10A 1HHKA 2JQMA 2WYZA 4DVBA 3EH5B 4JANB 4IBQA 3G6DL 3RP1A 1P6AB 1OTUD 4UOW0 4V2BA 2EH7H 2J3SA 1I53A 1X7TA 1DDHB 3WTUA 2DQCL 2W9DL 1CU4L 3FCGA 3G6JB 1AMXA 4HIHB 1HH6A 2ED6A 3L9BA 4RGMC 2G2PA 3P11L 4NYLB 4KK6D 3CHSA 4IGBD 3VGFA 3BE1H 1HHKB 1O9WA 3OMZA 1K9TA 5I6NA 4J12A 2X6MA 2RQ8A 4AX3A 1XBRA 1MCIA 5MERA 1ZAGA 1DL7L 5E6RB 4PV8B 5IOKA 1EAPB 4R7NB 3QO0A 5GISH 4GQRA 1OAKH 3LCYA 4P06A 1LEKA 3MUHL 1A3RL 4OLYL 5AB9A 1R5IA 4PGCB 5E8DH 5CJXA 1I8LA 1O5PA 4G1MB 4L1TA 4KO9A 3GXDA 1MAMH 2AKRA 4FXKC 2C3GA 2MHAB 1X5IA 4Y4FC 5BRPA 4G9FB 2D3VA 3E1ZA 3T8MA 4BFNA 2X2UA 1U8CB 2WLJA 3PUUA 4ZUWB 5KW9L 3STBA 4MD5A 4CC4C 4IRJC 3U46B 2SEBA 5F7HA 5EBWA 4YHYC 3MFFA 2AXJA 3QISA 3WNLA 1CI5A 3QUZD 2R4RL 4PJ8A 1YPZE 4X4YB 2BIMA 2XC8A 1F11A 3QYNA 1BG9A 5JNYA 2CUIA 1QI4A 2W92A 4NRYA 2WWKO 3GMNB 3TYFB 4W68A 4M1DH 3QJRB 4BK4A 4N68A 5CJ5A 1OIOA 5I1CL 1ML0A 2F7OA 1CZ8L 1IGTB 4L3EA 1T83C 1BVLB 3BW9A 4BWWA 2O93L 3ZOAA 4JFYB 1G0XA 1WH0A 3K0WA 3H55A 4K9EC 3ZE1E 5GXBB 3MV8A 4J8RB 3VM7A 4Z77A 4NQDB 5DJ0B 5FKPB 1G84A 4TNWF 3GO1L 2D7MA 3D87B 3LKQB 3FOMB 2BFVL 4DEPB 1B0RA 1GSMA 3PP3H 5EN2A 3LXBA 2MRYA 2VW6A 2ZCZA 4WW2F 4E5XB 5KSBA 6TAAA 1S4IA 1HHIB 1U8HB 3N50A 5EV7A 3GJEA 2EDTA 3LEYH 1OWWA 2D2OA 4F80A 1U8JA 5BRZB 4NEHB 2A6JB 2KLSA 1MQKH 4LRIA 5FYKL 1A65A 1RZIA 2AFNA 2LU5A 3KZ8A 3HCVB 3QDMB 4ZTOH 4EUPB 4XMZA 5DRNB 1FFNB 1S7TA 1A7RL 3WFCH 5I1LA 3RL2B 1P84K 4M56A 4EQ3A 1RZFH 1VEPA 3L4UA 4FA6A 4WK0B 3HFMH 3Q3GB 2CR0A 2BP8A 5BZWA 2IFFH 4WFFE 2JKNA 3N0AA 4DKFH 4F7MB 1CCZA 1T2JA 1MIEH 1C5CH 1LK3L 3CZFA 3HA0A 3TH3T 1GGIH 4OZGE 1IKNA 1S5IL 1XGTA 3LN4A 4QNPF 5DD5L 4LSRL 3NABH 4ZTEA 1E5UI 3UZEA 2CXKA 3L9YA 2I60H 5GGUA 3O3UN 5HHQB 2QKIC 2MOQA 3RJQB 4PY7A 1X5HA 3EJJX 5HP5A 4TUOB 1WTGT 3EYSL 3OX8B 4BH7A 3K6DA 3VXRD 4Z76B 3IDUA 4Q6KA 3R18A 2J8OA 1XCTB 1JPSL 3RTQC 3LPWA 1WGVA 4L2YA 1BBJB 2HT3D 5I82A 3ZIMA 4LLWB 3EBGA 1BOYA 4YGAB 4E42B 2BPBA 4GG8A 5JHDA 3BPCB 3ESNA 2ZTBA 1GTFA 1K4CB 4JY5H 5IV2B 1N5YL 5IHUL 5CWSA 1V3JA 2VC2H 4I88A 1NICA 3DI2B 3S8FB 1BP3B 4Z7UB 3NSDA 1QBBA 4PRAA 4UANA 1MZZA 2Y23A 4QHUB 5KJ4A 4NNXB 4CJ0A 5F3BA 4JHWH 1DSFH 1NBVH 4K7FB 1X4YA 1CDUA 2MCPL 3ZUCA 2FH8A 4PJIB 2ZUVA 3ARDB 4FD0A 4QHMB 1YYML 4AUYA 1JE6A 2Y36L 4X4MA 1ASQA 3ARFA 2Z34A 1CF1A 1RJZB 3GUTA 4EIUA 1FNGA 3OD3A 2OCFD 5BVPL 2NW3A 3K71A 4HLEA 5F7EH 1INQA 3ZTNH 1HZHH 3M45A 5C09B 5EFIA 1NBQA 1SLVA 3PDDA 4O2FA 4QXGH 1CDJA 1TSHA 2DYSB 2VM3A 4QRUA 1UZ6F 2VXUL 4ZUVA 1DBBL 4IJ3B 2FEEI 3RUGE 2DD8H 1KFAL 2E56A 3P2BA 5EZJB 5MENA 3D85D 2H0EA 4GQ9H 5CXPA 3TA3D 1EZLA 3B56A 4Y9CA 1VGEH 2KT6A 4BUHA 2NTFA 2JMRA 2BC4A 4YOKA 1SN2A 4X6CA 4Z7UF 4FA8A 1OGAB 2GTWA 1DVUA 1CFTA 2Z4QA 5BZDA 5B8CB 5L9DL 1CE1H 2XA3A 3KCWA 1KWGA 1ED3B 2NUTA 1VACB 3QE5A 3VXUA 2Y69B 5J13C 3IDXL 2ZKYA 5CS7A 3ABMB 1M7XA 1DZ0A 2M83A 3DGGB 2VDNL 4QCIB 4LHJB 3MUY1 4N86A 2YSTA 1LP9E 4QRTA 1DSWA 4LCUA 1S9WB 3WIIH 2DBLH 2GKIA 3UOAB 4XXDA 4MJ5B 3UTSE 1E50A 2X1WL 3KPTA 2CO4A 2DWSA 2EDOA 3A4AA 4BXVA 2LFGA 4D7BA 2FO4A 2WIMA 2LU3A 3EYVB 3GJFH 3ULVC 1XSKA 3CN1A 3KYKH 4BHUI 4ZS7H 5IVXB 1UM6H 3MV8E 1OAUH 4WI7A 3X17A 4B6ZA 1B6DA 2QL1A 3PRZA 4P5KA 4AYSA 2C1PB 1JWUA 5HJGA 5A40E 5CBEB 2ICEC 1WAAE 2NY3B 5IREA 2WTRB 2E8YA 4Z5RB 1BG1A 4U7MA 5CZVH 2E9BA 1BW8A 1P69B 2CO6A 3VI4B 3FQ4A 4AJWA 1HINH 3GSVA 1R3JA 5DMYA 1FJ1B 1JXGA 1BLNA 1JGVL 4HFWB 3MACH 4GH7B 3RWGB 5CD5C 2QQKH 4HYTB 1P2CA 4C56D 1SDYA 4GRWH 2GK0B 2K6ZA 1G7PA 1YEIH 4JO3L 3OKEA 5I66A 3VH8A 4HWZB 1A9EA 4O00A 3LEVL 5FA4A 4U1HB 1B3JA 4FX5A 3V52L 5DA0B 5IW1A 1O6SB 1NCOA 2PXYD 1DBAH 4JM2F 5FO9A 2W60A 4B9FA 1MHCA 2WIIB 3UZVB 1XMEB 4JR9L 3RFZA 5CLZA 4KMQA 4LSDA 1GXEA 2OL3H 4QR7A 4WVRA 1XB8A 1CS6A 4HJJH 5EZLA 3S0PA 1P4LB 3VI4F 5INDB 3MREA 4Y4KA 1FN4B 2XG4B 4KZDH 1AR1C 1NC2B 5E70A 2B16A 2GBTA 3PL6A 3HVNA 5C0JA 3FO2A 5D9SA 3UTSB 1IGFH 2VW7A 2AANA 3QIWA 4PJDB 4PP2A 3O9WD 5C8JB 3H3PL 5JQ6L 3MA7A 4JHBA 4YDLC 3BIBX 4TULL 2B7DT 4N4YB 4MA3B 1PFOA 2CDEB 4ZMYA 2GSIA 3ALWA 3CAFA 4FN0A 2NNFA 3INUH 3X14A 2DS4A 4MNGE 1GGCH 2EDNA 5E08L 2VH5H 3OVUB 3EGXA 4JO1H 4EEEA 5E1IA 1U8IB 3H8NA 5I1EL 3SGEI 4AV5A 5JPNB 2CIKA 4N2LA 1SMOA 2AZUA 2M2DA 1IC4L 2XFXB 3GSOA 2E7LC 3NRQA 2VQ4A 4ODVL 5A2JH 2A0LC 1ZSHA 5G4MA 3FQRB 2X5PA 1Q9KA 2XWZA 3JV4B 5FHAL 5B1JA 1YY8B 4XPFL 2X4OB 1UJ3C 2DQUL 2YEQA 4G2AA 3LSOB 2UY7A 2XXGA 3WEAA 5F9DC 3VXUD 4KJWD 4OKDA 2VXVH 3KPRD 4PEEA 4HS6A 5IVZA 1SGKA 4DUXA 2MQ0A 5M95B 1CK0L 4JZNA 2FUQA 1NANH 3CUPA 5LLIC 3QIWC 4Y1AB 1SHXA 2K9FB 3CK0L 1N8OE 2AQ1A 2B5IC 4FKEA 2AP2A 1IM9A 3X13B 1FVCB 4I2XA 4Q74A 4GI9A 4OIIL 2CLVB 4IIZA 1S9KC 1XIWD 2BNRE 1OCWL 1RD6A 4G1EB 3G5VA 4D8OA 3MBEB 3CXDH 1FRGH 2YK1H 4QD2E 2R29L 1I1YB 1HHGA 2X89A 2E75C 2CR6A 4QT5B 3HI1A 4I3RL 3NJMA 4XNXH 4ZW7A 2CH8A 2ZWKA 4F37K 3DX8B 3RZCC 1A4JA 4HC1A 4HKZA 1YEIL 4JO3H 1J05B 3V4PH 4GG6B 1EMTL 1TITA 4W9HC 1G94A 2F58H 3DXAA 2I24N 3CN0A 4PRPE 3RVXC 5IBTL 2CU9A 2HXAA 4QKXB 3V8CA 2MKWA 4KMTH 3CDZA 3N2JA 5BRZE 2GJ6D 3FB8A 4RAUB 2L3BA 1XCWA 2DYRB 2WUCL 3CIAA 3PYCA 2QZQA 1SPDA 3CHOA 3MACL 3O2VH 3VD3A 1QPPA 3WY4A 5C0IA 3GBLA 4X4ME 1BZEA 2KC0A 2JJSA 3STZA 1FFQA 5K59E 2EIKB 3LKNB 1Y18B 1EERB 3RWFA 3L16A 3D39A 4EDXB 3HJ0A 1AD0B 2D73A 1A8ZA 5EZOL 1UXSB 1KCUH 2K0RA 3ZYZA 1P7BA 4FQHA 3UAFA 4PRIA 2VJ8A 4WK4B 3SKMB 3B7YA 3NRFA 4JZJC 1EFXD 2P5WD 1BAFH 3BP6B 1QBLL 5AVUB 3O2WL 3W0WB 1V55B 2GTZB 3ZGIA 1ZJBA 5FDWB 5FX3A 2PYEB 4ELDA 3Q8EA 4AQ8C 1WCBB 3EUDA 1MVYA 1ACCA 3IE4A 2BM3A 3EYQD 4GT0A 4IKIA 3WNPA 4P4KB 2AEIT 2BVYA 4WI3A 1F1GA 1ZANL 3NIGF 5IHHA 3Q44A 3S3DB 1S9XB 2DBLL 4EI0A 1OAYH 4WV1B 4AYEC 1PKQE 5ACLA 4IDJH 3BPLC 4I4WB 1G9MH 4LGPB 4MX7A 3MLSH 1AXIB 2YRPA 5IQNA 1F4YL 4OZIA 1TJHH 4FABL 1WLHA 3S5LA 1H9DA 3IFNL 1T03H 3IDXH 1VLXA 3GNML 5SX5H 3US9A 2XTJB 3FTWA 3FU9A 3LH9A 4G8GE 4M3HA 1RUPH 3HW7A 3RVVD 3FB6A 1RHHB 4Y2DC 1T1ZB 5IB4A 4XNYH 4F37F 2HRGA 5DHVA 5AZEH 1F4XH 1QOKA 2WWMC 2V9RA 1P6WA 3B83A 3R19A 2P7TA 1G4RA 1OGAE 4LAJH 4L8CA 5IB5B 3FUDA 3S8WA 4AG4L 1M9SA 3CFKA 3W9DA 2VNCA 2WWNA 3LB6D 1A1NA 4IS6A 5JXAH 3TA3A 2Z35B 3NIFE 4GQ9L 3WTSA 1G6RB 4KDTC 4KK9C 4P2OA 4U1LA 3BYTA 4GKSA 1GYCA 1SYSB 1NL0H 1DBBH 2JH2A 2JJVA 1QVOA 2VXUH 2X6CA 3H0TA 3NCWA 1AD9B 1OTSC 4JFPB 4PCSA 2QR0A 2Z8RA 1T22A 1A6ZB 3IN0A 3V6FB 5BXFB 5JOFA 2XNAA 4GIAA 3KPNA 2WQXA 5JDSB 3UO1H 1GOHA 1N8ZB 2VQ1B 1DQMH 2ZYHA 4NAJA 3HMXH 3IJEA 2IH9A 1Q1JL 4KVPA 4BSVB 2XTJE 4I3SH 2EC9T 5CJQL 4TMPA 1NIBA 3UG5A 5JQIB 3VE0A 4ZFOA 1FL5B 3PNWA 3QHFH 4FFYL 2J6EL 2DJSA 4UDTB 3MGTA 4NQVB 5DEFB 2ADIA 4JMXA 3CQPA 1ETZB 3OB0H 1SYVB 4HFUH 5I23A 1NBVL 3RAJH 1JDAA 3VD9A 3VFWB 2NR6A 3OMIB 2VERN 2ADJB 2QHRL 4W6YB 3D30A 4PJ8D 1PBYA 3OWEA 4XCCL 3AU1A 5DHYA 2ICWB 2XZQL 5TK4A 2DKUA 2JIXA 4FLQA 2NZ9C 1VRSA 1QSFB 2JB5H 1C1EH 2O30A 3HPJB 3QNFA 4KTEL 4E9TA 4WF7A 2ZSVA 3UTZB 2CXGA 4PS7A 3THML 5F93C 4NFCA 5DHXB 2LLNA 2MCAA 3VI3F 1V10A 5DLLA 1SJEB 5CP3A 3K1KC 3QI9B 4TSAL 3VCLB 2I07B 3WENA 1YUHB 3IFOB 4FXGA 3VAEA 1KCSL 5ANMB 1HEZB 2EXSA 2K9UA 5F7YC 3WL9B 3MA9L 4HOWA 2HFGH 1EZVX 2NY4B 4HXAH 4XMLL 1FG2B 3MU3A 1UEYA 3WI9A 3EZJB 4ZUTB 1FNEB 4DKAA 4X5XA 3AS2A 5A2BA 4G7VH 2FWSA 1IC1A 3Q2WA 1ET7A 4Y4HC 3V4PA 4ELMF 4B3EA 1JRHI 3SGJC 4K73A 1N5AB 1XT5A 5F9JB 4UNUA 3P2TA 4L9LA 3UC2A 3K6SB 1YECH 2DYPB 3QNYB 1IE4A 2X4NB 3GMPB 1T5XB 2XJKA 4NQED 5D7KE 5ACMA 3A6CH 3JV6A 3G04B 2A0LD 4L4TA 5HI3D 3KBHE 4WFHE 4TNFA 5GJSH 4L9LB 2YWZA 1T4KA 4N3UA 2P5ED 2WQUA 2NXZB 4NQXB 1HK6A 1D9KB 2EDLA 5DJXA 1NCJA 1N5AA 3AM8C 4RMQA 1JS4A 4DZ8B 5ERWB 1F4WL 5GGSA 3NZ8B 4M03A 5B38B 4XBEL 1KOAA 1B4TA 3C9NA 5ABAA 5DQDH 2F8OA 3ARDC 3WEXB 4N2KA 5AVZB 3BSGA 1CICC 5GQBA 5T1LD 3G5WA 3MBWB 5ITFB 1BZ9A 5FGCB 1JNLL 1TQCB 2GC4C 3P73A 1TJXA 2NY7H 5C09E 2EUVA 3N85L 4V2CB 2JCCF 2MNWA 4Z78B 1QMUA 1RUAH 4XWGH 1VF5C 3OKOB 3SPVB 2BZCA 1HWHB 3LN9A 4TVPE 5CIPA 1AGEB 1BXUA 2ZG2A 3K91A 5FUCC 4ZFOL 3ARBB 4DGVL 4GP4B 2WMPA 4H40A 3OSVA 4Z7OB 4WEEA 1NC4D 1EJOH 2R0WL 1C7SA 4IRJA 5I6MA 3AU1B 5LAXB 3BP7B 1RLBA 2NY6B 3P4MB 4NAQA 4ZFFB 2EO9A 4OB5L 1GGTA 5CEZL 1VFBA 5CNHA 3HE6D 4OZGA 5IHZB 1IX2A 5B3JE 3L3OB 5E4EB 2EINB 1NCGA 1TETL 2D7TL 3QNZA 3B9KB 2JXMB 3H3KA 1CF8L 1MFEH 5KVGE 4ALAL 3VJ6A 3QUHA 5IK3B 5CD5D 1T4WA 3LPOA 5BZZA 1OE2A 2IEPA 3P40A 1N59A 1UZ6E 3QB7C 5EO0A 3BYYA 1TTGA 3HMXA 4HCRA 3RGVB 3OXSB 5E6ZA 1C08B 1VFUA 3ZL4L 1MCDA 3PWLA 2GK2A 5ICZA 2YD7A 2WY3B 4I5BB 1U95B 2HFEB 2UX7A 1A7QL 4ZO9A 4F3FB 5SV3A 4GO8A 4IRSC 2N1TE 4IIQC 5KYXB 1A6ZA 4JRXE 1T22B 4LRNL 4P46C 4R96A 4F8PA 2Y7LA 4ICWA 4XB3A 4GI8A 5EUOA 1K2DA 3QXAB 1EHKB 2QKIA 4BFOA 5DURD 2H32A 1AOZA 5IWLC 1E4KA 1JK9B 2NY3C 2NNAB 1U2HA 3IGUA 1H3WM 2W80C 4WTWA 3U2SA 4AYFA 5B1KA 4X4XA 2L0DA 5DHVB 4K9EH 4LSVL 4N90E 3Q8BA 5JIHA 4WKZB 2YD1A 5JUEL 3L5IA 5HD8D 1CXLA 4QJ5B 2F8XC 3VXMD 3WE6B 3DHMA 3NSXA 4Z7NE 5CINH 5CZRA 3FCSB 5CU5A 4ZSOA 3MJ9H 4NFDA 2WWOA 3O0RH 4KK5D 1L7IL 2ZWYA 2A6IB 2BVTA 4R5TA 2CPCA 1JZ2A 4GSQA 5C0CA 3T4YA 5AB2A 5KVEE 4YBHA 2I9TA 2J56A 3ULVL 4EN3D 1CLVA 3QCUH 3IAPA 4MA8L 1QWHA 4WWKB 5EEUA 5HPMA 2JWYA 4HULB 4JN2A 2CRIA 1S5HA 4HU8A 2Y3NA 1FI8C 3GJFB 4ZODA 4HZ1A 4ZQKB 1JVOA 2C9UA 3AREC 1IBZA 1SBSL 4GMTH 4XO5A 5HGGS 1F3DJ 3EBAA 5I5JA 4A2HA 1AXSB 5AVSB 3ZTEA 2ZPKH 3KYMA 2A6KB 2DI9A 1HHHA 5IFAH 4OCRH 3N1MC 3I74A 4U3HA 4KQ4L 1ZK5A 5FCUH 5CBAB 5J89A 3DWTA 5I0ZA 3CFBA 1ASPA 1KFGA 2FNBA 1AGDB 4BH8A 2CHNA 3OGCA 3STZB 3SBWA 5HDRA 3LZFH 3GBMH 4PJDE 4TQPA 1MFVA 5F7KC 4OQ1A 3R8QA 2E3VA 3ZZ1A 1IFRA 5DT1L 1UOKA 5DJZB 3I2CH 4FQQB 4GRMB 5IESH 4FXLA 4R4FL 5L2JB 1G4MA 2PCPB 35C8L 1J05A 4GG6A 4HKZB 4LDCA 1JZ8A 1MCCA 5I6OA 3ILEA 1XGRB 3OKDB 4KI1A 4XVUC 4YSAA 5I2IA 4LLVA 4RA3A 4WNQA 2CMRH 1HKFA 1ND0A 2Q76B 4JY6B 4XRCA 1K6QH 2AQNA 1IGMH 2GUYA 2PN5A 3BSZA 4PRIE 4F92B 4HIEB 5LO7A 3MBEA 3OKLB 1ZLWH 1BVZA 4TM9A 5LVEA 4AC4A 2PETA 1EQWA 4X5RA 5F9OH 4ZFGH 1WZAA 2EYTB 5TK2A 1FVCA 5B3NA 3O3AA 5E95B 1IM9B 1VGKB 2VMFA 3B9AA 3L3DA 1NFIA 3CD4A 3RU8L 4Q89A 3X13A 1E6OH 4FFVD 5D2NC 2F19H 5KSAB 5E2TH 1JHLL 1XZ0B 3RWIB 1XTMA 4JZNB 3TGXA 5EPMA 4P5RA 5IGXL 4HS6B 4LVHC 1LMKA 1N3NA 4MNQD 4W6XB 5JW5A 1K5WA 2CKBL 2E0PA 2ROXA 2UY7B 5I6XB 5HXMA 3LSOA 5DA4A 1FF5A 2B5IB 1RAMA 2D7NA 3DIFB 4ONGL 4JG0L 4TV3A 2H8PA 3VI3B 4JPVH 4HETA 3IXAA 4ELME 5JZ7C 3SYCA 2IG2H 5EUOF 1U8PA 1SN5A 3R4DA 2VLJD 3L1FA 5DK3A 4N0YL 2E7CA 2WLIA 1OSEA 3OKMB 4MS8D 3ABZA 3ARYA 1U8IA 2CGZA 4ZXBD 4HJGB 3TNMB 1NPUA 4YXLL 3NJNA 3MJWA 3UG4A 3LX9A 1JPGA 1I75A 1OHQA 2B1OA 1CBJA 2AJZA 1E4XH 1HI6B 5HGAB 4Z3HA 4HHWA 3E2HC 5L6YL 2CRYA 1MFBL 5C8JA 2WLYA 3V0WH 4PJDA 4A7TA 4EDWH 4U1NA 3DOIA 5I8KL 1QABA 3OLGA 4GSRA 3S35H 3VFUB 2GT9A 1MI5B 3CSPA 1JDCA 2H47C 3MMEB 4PIBA 4PJ5E 2G3MA 2X9YA 5F8QC 1ZK9A 1KCRH 2VDQH 4HZAA 2VITB 2ESVD 3EG9B 3HBGA 5JXEA 1YO4A 1V7NL 2VZTA 1R3IH 4DP4X 4NT6A 2GSMB 3GGWB 2Z91B 4YDNA 4A6YH 3RFZB 2Y2WA 4M62H 5CN1A 3QXUA 3L7EB 2GJ6A 1V3LA 4P2OC 1JHKL 4Q0XL 4X6DF 1NINA 1AZRA 4RA0C 1HOEA 2CBTA 1BZOA 3BP4B 1E7VA 4L0YA 1A9EB 2IGTA 4OZHE 4B9IA 5IQ7H 3FULA 2Z6FA 3L5HA 3APNA 3PABB 1SMAA 3DBXA 4EMZA 5DK2B 2H0PA 4HSAC 4A6YL 1E28B 1WVZA 4PR5B 3RZCA 1OCZB 1ILUA 4M5ZH 4XMUA 4X0KB 5BCAA 1OF0A 1EAJA 1JGEB 1R3JB 4G8EA 4LVOB 2ZOKB 4U0RC 5FGRA 3O6MH 3U6XS 3QEUB 2TAAA 5FYLL 3GSNH 4WHDA 1MCOL 3T2NL 5HGDA 1XF3B 3ES6A 1RPQA 1S7SB 4MCZA 4NNPH 4XI5C 1JWUB 2XU9A 4QRPB 4ZOEA 1ECZA 4RISL 4P2RA 1Y0LA 2RR3A 2ZUXA 4HC1H 1QG3A 4FFWC 4JZJA 5EIQA 1JZFA 4P46A 1IMHC 1F3RB 4DKEL 4DP2X 3DK0A 5LCVA 4JVWA 4KRMB 3IRZA 4MJ5A 1DE4B 3GHBH 2AABH 3QUML 4GUPB 1KJMB 4H88L 5DUPL 3KWWB 1IKFL 3O4LD 3CXFA 3DXAE 1DFXA 2OTPA 4FG0A 4FKHA 1MCPL 4FQ1H 3QDGE 4HLZH 3ZDXB 4X7TB 3TO2A 4HAFA 4LLMB 4XHJC 4YVNA 1CFQB 3O8XB 1H6TA 5HGDB 4JFQB 5KS9F 1HH9A 1XGUB 1NCWH 1PY4A 5EF0A 2VWEE 3T09A 2F8IA 4J27A 1KBVA 1T20B 4MXWH 1A3QA 4XPHL 5LNDA 6FABH 5J11B 4MJ2A 1XZWA 2ZOKA 1FO0H 4I89A 4XMWA 1ZTXH 1UH4A 1ZHNA 2V33A 4MJHA 4RGOL 4H0GA 3HUJE 3NJFA 4K71C 1G87A 2GHZA 4XT1C 4LHUD 4IOFC 5AW9B 3U4BH 3LH2H 4UQEA 1K6QL 3F3HA 3DVGB 4N2HA 4MA1B 2OI9B 1CGWA 1I1FB 3GZOA 5EIIG 2A83A 4OQTH 5C09A 5IT2L 1DO5A 4Y1AE 5DTFB 1I7RB 3PWNB 1AFVH 5IHWA 1FNGB 3DJSA 4MKMA 2V17H 4U6VL 4UQ3B 4IBUA 4OLVL 3ZTJH 3SGDI 4N6QA 3EJYC 3LNDA 1FDLL 4F8OA 3H4HA 3L7EA 5CLTA 3ARDA 1IGYB 4A67A 2MQGA 1OQOA 2BVOB 1O7DE 4P99A 4N8UA 3FMGL 3LIUA 1O5DT 4NNXA 4PRAB 3DO7B 2VITA 4KQ4H 4UILL 4FHJA 4Y2OB 5F1OB 4UT6L 3NACL 1I1CA 4MB1A 3BMWA 1MI5A 3BH8B 5KYNA 3I84A 1P5UC 3EZ8A 5GS0C 5GZOC 3BCFA 4J1UA 3A67H 2Q6WB 3UPCA 1KEGH 4LFHG 2OMYA 3FOLB 1U3ZA 1UASA 2OA9A 5DVKA 3EDKA 1XXFC 3PE9A 3JTSB 1XCTA 1UKTA 4JBSA 4Z6AT 4CDHA 4HJIA 4IJTA 2VAJA 4QO1A 3NZHH 3V5HB 5C6TL 3COOA 2NXZC 5FXCH 1J1OH 1MHPL 3FTGA 4QRSA 3FC8A 4H1LH 5CJBA 1E3FA 4LIQH 1L7IH 3JWDC 4B9JA 1OV8A 2WXQA 5ABDE 1R17A 4XPTH 1AHWB 4LEOB 4Y5XB 1BWMA 4WFED 2H8PB 3T0ED 3BGAA 3NCXA 4F7MA 5C0NC 5JUEH 2JB6B 2ZE0A 1KXQE 3O3DA 1XQ4A 3BKYH 1OGSA 1KPRA 3DOSB 1CGSH 5JOPE 1ZOXA 3CSYA 3VXSE 4WEBL 3W9EA 2JKJA 3RHWF 3VXTA 1FVEB 1QHOA 3QJTB 3RPIB 4NHCL 4W9DC 3U4EB 4UT7L 1FFNA 3RWIA 5C2UB 1BA9A 4PJXE 2NZ1A 5CJ8A 2IQ9H 1FWXA 1RZIB 4APXA 3WHE1 1K3IA 4Z0BH 3FTXA 3O3AB 1USZA 1A14L 2EYTA 2V4LA 3CPUA 5EDXA 1RH8A 1U8HA 4XP9L 5EOCJ 4FYTA 4F7EA 1ZT4B 1F42A 4B0MB 4OV5A 4HIEA 1NFDF 4N8VG 3S3SA 1SLWA 4YXKH 4KKAD 3BPLB 3Q13A 2WKOF 3PIQA 2CLRB 3KXFE 4XMVA 3MV8B 4D9LH 1S7WB 2FLRT 5I17B 4DIXA 2HN7A 1CF8H 1MFEL 1Z9PA 1X5KA 3FCTA 1TETH 2D7TH 3D39E 4XO8A 1B0GA 1X9RA 4R2GD 4RMWA 3QHTC 2Q1EA 1LQSR 1YLBB 3ARFD 1QBMH 4LBAA 3BKCL 1JZ3A 2RJMA 4Y5YC 3KHOA 1LHZA 1IM3B 2ZXEB 2EEAA 1KB9J 3VTAA 3WGVB 1EZVY 5HHMD 3N91A 1K4DB 3W11C 1LXMA 3TBCA 4S1DD 4PJ8B 4ONFL 4X4YA 1EJOL 2R0WH 5HVGB 2BHUA 3I50H 1I9JH 3LKRA 3EHBC 1SJHA 2DLTA 3NCFB 1KJ2B 2YUZA 4XODA 2OMNA 3HUJA 3D4ZA 1BFVH 1VADB 2F54D 4G42A 5CHNA 5FF6A 3LYRA 1HCFX 1HHHB 4U3SA 1QBAA 3KYMB 3X1FA 3T0EA 2X3CA 5I6KA 1RERA 5AWNL 3UJTL 1B2WL 3L13A 1AE6H 3X1EA 2WVVA 2VXQA 3IBOA 4S1QH 5T1KA 1FG9C 4IRZL 5CAYB 1BJ1J 4QKTA 2NUPA 3GINA 5HHXH 3LS5L 3V6ZB 3S3JA 3CSTA 4X8JB 3P77A 4P4RA 4R7NA 5GJTH 4I0PD 4QXVA 3MLZH 5DRZA 5GS2D 3K72B 2F53A 5DQDL 1DJHA 3RFRA 4AGQA 2AI0L 2HT2C 2ZG1A 3K6NA 4WKXA 2UVEA 3ZKXC 4D0CB 2QZ5A 3R06A 4XBEH 1WCQA 2HCZX 3UBFA 4NUGH 3IJ8A 5BS0E 4K3DL 3QJUB 1KB9K 3WE6A 5ES4B 1HCVA 4BZ2H 2D0HA 3O6KH 1HH6B 1W72B 1AP2B 4NIKB 3QUYB 1GJIA 2VLRA 1NUGA 3DRQA 5IMMA 4FZ8H 1ADWA 3FYIB 5DUML 4AJ0A 1X5MA 4JANA 4XN9A 5AAPA 2IPUK 4J3WA 3SY6A 1ZMYA 5BMFH 5I71C 1BM3L 2VERA 3TEUA 4EIZC 2XXCB 3BDBA 3VXQB 1VESA 1KZYA 2BP0B 2E59A 1KEMH 1JVKA 2NXZD 2R59A 3MRNB 4B96A 2EDBA 2YO3A 1FNFA 2GCYB 4L5FH 1LNUB 3L3IB 1U8MA 3DSFH 1PZBA 5MEPA 2YOCA 3QEHA 4KNTA 1HJBC 4X9YA 4HS8L 1TNMA 2XRAH 5AVVB 4XN1A 5A7EA 5I9QB 3ILPB 5E99H 3AWFA 3MRIB 5KSUA 4Y4HB 3VMOA 2P4AB 4FQLL 3GSQA 2YAPA 4BE5A 1EUUA 3SJVD 1ZDSA 1P7HL 1LGVA 4L8BB 2EE2A 1HSBB 1KTRL 2Q7NA 4S11A 3W1ZA 4TSAH 2VZVA 2NY2D 2DAVA 4DK6A 5C9KA 3HHRB 3QDGD 4W9KC 5DU7A 4KH2A 4XCYA 1AQDB 3QVAA 2F53D 1CMOA 3D25A 4N26A 4B9ZA 1W8NA 1UOVA 2M26A 5HI4D 2R9HC 3WUWA 3IJSA 4V1DD 5JIDA 1C1EL 3D69B 4KXZI 3GKZA 4LSUL 3H7LA 1AI1H 4F7TB 1J9RA 3P9LB 3UACA 2ENPA 1UH3A 1QI3A 1QSEB 2VDLB 5GGRY 3C6EA 4HFUL 1RY7B 1M1SA 3DARA 4NRZA 2BXZA 1UADC 4F7CA 3MV9E 4EVNA 1IAII 3W37A 1B2YA 1T1YA 4Y16D 5ITFA 2GBAA 1E4WL 3H42H 3DVFA 3QQ9C 3IWVA 3QT2A 3WFBH 4NZFA 1XX9C 5B1JC 4EO5A 4ELKB 1KTDA 1A2YA 2GC7C 4R4BA 5M7QA 1TQCC 2VQTA 2X70A 1H3TA 2VDRB 3UBXG 3QPXH 3WN5A 4BCZA 3TA4D 2YMTA 2E76C 5AL8A 2CA3A 4O51A 3C9NB 4KY1H 3H6JA 4Z7WB 3GZKA 1D6EA 3QEGH 4JREB 3UAJD 4PP1D 3BD3A 4PB9H 3RIAF 1D9KA 5DJXB 1NL0L 1OGTB 2BVUA 3NCMA 3FB7A 4ANWA 3QQDB 4B9YA 5I8OL 3B6SB 5B39B 1JPST 1FL3B 1H15A 5LGKA 5LBVA 3G3LA 3P0YL 3Q48A 4D3CL 4PMEA 4FFZA 2I5YL 5CO1A 4CU6A 2QVMA 3KH3A 4KMLB 3V4VB 3WY1A 4QOKB 2G75B 4ODTL 1CR9H 3QFJB 4Q58C 4DO6A 4BDVA 4Q97A 1MQ8A 3F64A 3QRGH 3RE0A 2FUTA 4IDLA 3KS0J 4AW4A 4FNTA 1AR1B 2AC0A 4LLDB 4Q8BA 1N70A 4R7XA 3OKYA 4A63A 4GQZA 3FYEB 3NESA 3SBWC 3WDJA 1TJHL 3V4PB 1F4YH 3DIDA 4PRHD 5AOZA 2PWEA 1TJGH 2H6PA 3S37H 1NGQL 1EGJH 2Q5BA 4LKXA 4S2SB 3AUWB 4L48A 3DHUA 5D71L 1XH3B 1D5ZB 3IDIA 2H1XA 1M2OA 3CDCA 3DPBA 3IFPA 5DQ9B 3ZKMC 4L4VB 3VXPA 1INDH 4ZW5A 4Z7WF 4EI6A 3VRIA 2EE3A 3H9SA 1HEZA 4GRLA 4NKOB 4QXWA 4CN1A 8PAZA 3QI9A 3SGJA 4FRWA 2GIXA 1Y6KR 5E8PB 4MJIA 2WVUA 1QBLH 4PLJD 5A2LH 4JPIA 4BFIB 5JR1H 4GBXA 1K3ZA 2CLZA 5IJKA 1U2CA 1INEL 4CMHC 1ACXA 4IU2A 4GMSL 3UJIL 1NLBH 3KPMB 2YSSB 3MV9B 4GIOA 3RDTD 3DMMA 3KLKA 2I7SA 3RY5A 5EU3B 1TYEB 4PVLA 4QRRA 1OAJA 3OQ3B 3JBG7 1RK1A 2Y25A 3N04A 2YRZA 4U0RB 1CE6A 3TX4A 4P2QA 2AHIA 1KYOK 5D2NA 3X11A 4OGYH 4C8XA 4PS3A 2OMTA 4BKLB 2YQGA 4JPKL 4A38A 3PL6D 5D5MB 1QTPA 1OB1A 3MGTB 4NQVA 4UDTA 5DEFA 2V7HA 5I75C 2OMVA 4Y2DA 4H2AA 1BV8A 1FL5A 2ARJB 3BEWA 3V4PL 3GXIA 3EDJA 3WFHB 5J06A 5DS1A 2WKOA 5D6DC 4NKIL 4KRPC 4I3RH 4XNXL 5KEZA 1XF5A 3D5OF 5C0EB 3IJEB 4I0CC 2ENYA 2J5LC 2VGLM 1P5VB 4JL1A 4W9FC 4GG6E 3X1BA 3L3GA 5AW2B 3CXDL 3KPNB 3BWAA 2WZAA 3P9WB 2QR0B 3QHZH 1D5XA 4P5SA 1AIFB 1WISA 5JIIA 3BN9C 1FYTE 5HVHB 2IGFL 3MI6A 2HWZH 1OHZA 3CK0H 1G6RA 2JF1A 4JFED 2Z7ZA 5EWIL 4XVTH 4IS6B 3TXAA 3WFZA 4ZO6A 2F5BH 4HP5A 4WCYH 2PXYB 5EEWA 1T89A 3ZU8A 3G5XA 3QNXA 4XNZC 1AOHA 2DOCA 3HKZA 2VM9A 5CCGE 4YBLB 1IVLA 4JRYA 4W9EC 3AT0A 2YIHA 4LB8A 2K45A 4UU9B 4NLHA 5FHAH 3HAEG 1J5OH 3D3VD 4XCNB 5HYQA 2ITCA 3NEXA 3ZKSD 1BZ8A 4ODVH 3U2IA 2Z0UA 1BQHB 3TV3L 1A6VH 1S78C 1ZV9A 4DW2L 3BRGC 3X2QB 4JO1L 2GAZA 2ATKA 2BY3A 1FZMB 1LK2B 3VSTA 3Q6GH 3W5MA 3LOWA 2XHNA 4F2FA 5BS0B 2OZ4H 2IANB 3ECWA 4ZMOA 1DP0A 3DTXA 1HEHC 1PY9A 4JGMA 2FB4H 2Z7YA 1QP1A 4PYHA 3GMQB 1KDJA 3CLWA 5FDWA 1A7BA 2H26A 2V5YA 3HN5A 5ITBL 4M7ZB 5HHOE 1BFOA 3KYNB 3MRJB 4NHUB 4NO3B 5DJCB 4AM0A 4X6DA 3FH7A 3I9AA 3TV8A 4LOFA 2CSPA 4PRIB 3BLBA 4PJDF 3DMMD 3U82B 1NIEA 3BRFA 4QWWC 2ITFA 5KVGH 3CX5J 3V6OC 3B2UC 4N1HB 5PCYA 3B5GA 3OC5A 3NIFF 3SN6N 2OYKA 4CADA 1PIFA 1Q0YL 3SD5A 4M7JL 4N0FA 3UFIA 4HGKC 4C4BA 4NERA 5HYIA 3UABA 1NKOA 5F70A 5BOJA 5HGBA 4LEEA 1WZKA 3GSNB 5F3HB 4ODHH 1I1AB 2QMJA 1QAWA 1GL4B 3FB8B 4HCRL 1NCCL 5I24A 1ZPUA 1KENL 2IXQB 3CFCH 3ULUE 3QZPA 1EUTA 1I8KB 3LEVH 4PRNB 5AW1B 2FTAA 4O4YL 5HDOA 1SEQL 4HLZG 1ZVSB 3NIDB 1NJ9B 1KF9B 5IB3A 2A3TA 1QYGH 2FQFA 3IETB 2QQKL 3A21A 2B4CH 2OYMA 5GGQH 4L0ZA 2YAQA 1B9ZA 4XN5A 4JK0D 1MRCH 1E8WA 1JF1A 5FW8A 2DQJH 3FFCB 1YAZA 2DZEA 4E41A 4YX2H 1GSKA 3X3GL 4YPGA 5LGYA 1N2RA 5FLVA 3QEQE 4G5AA 4PJHE 1T21A 3AJ7A 4MJ6B 4PJ9B 4YGVB 1P4IH 2KQMA 4JM4H 5MENE 5I0XA 3I75B 3NZUA 2AQTA 2GJJA 4OSUL 3GSUB 2J55A 5F1SA 1XO8A 3EFOA 4DN4L 4YDLB 5LHDA 5E2VL 4AQAB 3SDCB 4X6FA 5C2BL 5JO5A 3NP3A 4JDVA 2JCWA 3GBNL 3IMSA 5DS8A 1HQRB 2PNDA 4OI9A 1J9TA 1GYUA 1N4XL 2WXRA 3UAJA 3GXFA 2H1PH 5T3ZE 2C3VB 3QJSB 3SDAB 2UXVA 2IQAA 4RFEB 4M1CC 5C0ND 25C8L 3CHRA 3D9AL 5J5EA 5JHDD 3GK8H 5CU9A 5ISZB 5J3HD 3UBXB 4W70A 1FFPA 4XHJD 1FIGH 1J0JA 3FONB 2TSBA 2XKUA 3WFDH 4Z3FA 4BFFA 2AJ3A 1MKFA 2NY3D 1UJ3B 4LPXA 3BT2L 2CCWA 3L5JA 4PGBA 4MD4A 1OSZB 1UWGL 2O6CA 4U6YA 1IVTA 1V8HA 4JFZH 4P3CH 3VD2A 5B39G 4ZI8A 4KTYA 1WUNT 4G8IA 2WVSA 3GBDA 4YFLF 5CSZA 1QSEE 2P28B 5D9SB 3UTSA 4XHQA 4YSPA 4Z0XB 5HJ3B 4GAYB 1KBBA 2WLKA 2B77A 1NC2A 4KUCF 5IIEB 3MBXH 1DN0A 1I7UA 2J2ZB 3WNMA 4HD5A 5GGTH 5C0CE 1P4LA 1MG2C 3LIZH 3VWJA 3PJSB 1OM9A 2FGWL 4ZPVA 4OD2B 4J4PA 4LU5L 5EULV 4GRLD 4N2GA 4WW2B 4LOUC 3PAZA 1YAIA 2Y07L 2EO1A 1ROWA 4RX4A 3KPSB 1WWWX 4QXGL 4MYPA 3KD4A 4XAWH 5B21A 4LE8A 5I19H 2CIIB 3D48R 1CQYA 2CK0H 1WZ1H 1TJIH 3HNVH 1HQ4B 3I85A 4LLYB 4M5SA 4BFBD 1D9KC 4J3XA 1EVUA 3TA3C 3HNTL 4Y16C 4X5WB 1HOCB 1LVEA 1Z9MA 4XBMA 4KI5C 4XOCA 3L95B 5DVNA 3LHPL 1DANU 1YYMH 2PF6A 3TFBA 4H25B 4P8QA 3RWGA 2UXGA 3X12A 2MMXA 3WJMB 4DTGH 1F13A 1QLFB 1IILE 3CIQA 1L7TL 3FZUD 3GSVB 3MV11 4WJ5A 3MLXL 5DQJB 5IG7A 3JZYA 4JY5L 1AO7A 4ZBJA 3PP3K 1D6VL 1PG7H 1PY0A 1WDAA 3VQ2C 1QQDB 2OCCB 3SDAC 3RRQA 4LEBA 4Z5RA 3NDYE 3JV5A 5I5MA 2GVYA 3MRCA 3WIHL 1FLRH 1IQWL 1GKEA 3ZT7A 3RURA 3EYSH 4HWBL 2VR8A 3DETD 3LQZA 2HYMA 3V6OE 3I6LD 1JBJA 4OD1L 2NX5E 3K4AA 3EYFB 2DBJA 3K81A 4KOCA 4WW1B 2DQEL 2X0WA 3L3OC 1GCYA 1R3KB 2XWRA 2N1KA 3B9KC 4OF3A 1C5CL 1LK3H 2ID5A 3HC2A 4PV1C 4QRTB 3JVGA 5ILTL 4YDVB 3NSYA 3J07A 1CLOL 2YFNA 4UWQB 4U7KA 1O9VA 3N42F 3X3FH 5KTEH 4FFWD 2Y1ZA 2ZXQA 1A9BA 2VJXA 4BFGA 1GIGL 1P6FA 3C60D 3LV3B 1XD0A 2GY5A 4KJPC 2XQBH 2EABA 4MDIB 4PP1C 2X88A 1KC5H 4OGAC 1CFTB 4ABUA 3CV5A 2OSLB 5I30H 4PJGA 1NIAA 3NPSC 4G9DA 2HH0L 4X6CB 1MQKL 1PG7W 2VXTH 3D0VB 3RVVC 2NTFB 3O45B 1SXZA 4PRHA 1DBKH 1OSYA 3JWDH 4Q6YA 1P7KB 3DHPA 4KX7A 5L2KA 3TEWA 3B7TA 3MNMA 3ARGC 1N0XL 2BNRA 3P0GB 5E5RB 1RKRA 2NLJB 1OK8A 1YEHL 2CNZA 3DRTA 3T04D 4AH2B 1BFSA 2V3EA 5EFIB 5C0FB 3VTMA 2KZBA 2WTOA 3L48A 3QQ4A 4NQEB 4M6MH 5EO9B 1E9QA 3L7FB 5HSFA 5EU7C 1TVHB 2YEVB 3LRGA 4Y5XC 5KVEH 3PWUA 1DVXA 2XI9A 5FUCE 4OKVA 4J6RH 4BZ2A 2Q87A 3ARFB 5I1AA 5C3IA 4XZUB 1D9KD 2E6PA 3VB9A 4P2OD 1YEGH 1MI5E 3UPRB 4XVUD 3KL3A 3QARA 1P9MC 1NBYB 5GRXG 2QQQA 3K80A 4Z3EA 1JPEA 3PJNA 5D7SH 2WXKA 4LSTH 4I9WD 5AW7B 3L2LA 2PYED 3GI9L 4KWUA 4F8NA 4IEFB 4PGEB 4U3XA 4S1DC 3LD8B 2DWYA 2RMNA 2VWEC 2VIRB 4XN4A 3E8UH 4POUB 2EDJA 1BQSA 4X9HA 1BBDL 4PJ5D 4E42A 2AJVL 1LDPH 1M7DB 1NOLA 3GTTA 4UTBA 5E8DL 3AGVA 1UEMA 4WFFD 4IRJD 2XPZA 2UWEF 3P30L 3WLWD 5DZLA 2ZKHH 4J2XA 2YD8A 3OXRA 1WWBX 5CJOL 1HSAA 4Z76A 5JW3L 2EKSB 3OX8A 5B1BB 3G6JF 2XV2A 4JM2C 3ZSTA 1U41A 2ICEA 2XQ0A 1I8LC 4PY7B 4G70B 2WCSA 4LCWB 2CGYA 4R0LC 1MXDA 3WV0A 1NZRA 4YAQA 3GDBA 4NQTA 5I16A 4ZXBC 1M05B 1FPTL 4HIQA 2XWTB 3CX5K 1XGTB 3OF6A 2YUXA 4JDZA 4NX0A 1DJSA 1EPFA 2EDXA 2X53A 4ODBD 4WJKB 5EB9A 3KGUA 4MB4A 4P49A 3Q01A 5DCCA 3BVNA 3BUDA 5CR1A 4F2ME 3UYRH 3K4DA 5DFAA 3W2DH 4XH2A 5E2JA 5DRNA 4YK4B 3HLAB 1YEEL 1NDGA 1GPOH 3ABLB 4GJTB 2OBGA 4RGNE 4KK6C 5D7LA 5ESVA 2X05A 3UZQA 2X9XA 4ECNA 3T0EC 1QSVA 5IUSA 2FX9L 3AXHA 4F58L 2R1YA 2G5UA 3MKGA 1JNHA 4AJYV 2MNJB 2J72A 3TJHD 1XH2A 3D34A 5DJDA 3VFNA 1P7QB 3HZVB 2N3JA 4ZMVA 4E5XA 3JTTA 5IQMA 4FZEH 1WSST 5KSBB 3HPLA 4WUUA 1KJ2H 1QKZH 4L0PB 4LMQI 3LKQA 2YUWA 5LGHL 2UZYA 5EZIL 4N2IA 4YNYA 1WICA 3ULUD 4RGND 3CCHB 3QO1B 2IALA 1FHGA 3GB7B 3V4VH 2VDNB 2QTEA 3AT8A 4IRSD 4PW9A 3SKOB 5E5MB 3L6FA 2HX8A 2UVFA 4RWYL 1IC7L 5AL0A 3WN5C 4YDIL 5A3ID 2BNQB 1SY6A 5E7FA 1NEUA 3QS3A 5JNYB 5E1QA 2AXGA 4FDWA 3CH1A 3RVTC 3RKDD 4YQXL 3TT1L 4NJ9L 4KVNL 4DFHA 5K5YA 1OF2A 2OL3A 4KHXH 3AXLB 3KL5A 3U46A 4NM4H 2IDSA 4ZUWA 5CCHE 1U8CA 2EEDA 3HC3H 3DJRA 4M9PA 4PY8J 3P4OB 5C9JB 2EUZA 3MLRL 4JAMA 1S7RB 4WWKD 4KHTH 4GW4B 1IB5A 4N8VA 5I9QC 1L5GA 2PXYC 2F74A 4XC3H 2UUDK 2FATH 1YQ2A 1ZSDB 3C5SB 4M5YL 1I8AA 5H37H 1LEKB 4H20H 4AVIA 1WITA 2BJML 1MFDL 4TRPL 2ZOTA 2A38A 4X83A 2G4GA 3U0WL 4YDJA 1CJYA 2A74C 1GYWA 1YG9A 4NDMA 2NR6D 1UUSA 3FUHA 1N68A 1TTCA 5IQOA 4XGZB 4P2RD 4J39A 2VSKB 3K46A 4YWGL 4LFHD 4A39A 5C7XL 1RIVL 4J2QA 5JPMC 2VZUA 3NJGA 2GUOB 2NOYA 1KGWA 3QULA 3ARDD 4PGJA 2XIDA 2MOVA 1UB5B 3KL0A 4GXUM 4JCWA 1F5WA 4OT1L 4NJAL 2A1WL 1YMMB 4DVBB 4KJPD 1SNRA 4AMKL 1ORQA 2VT0A 4ATTA 2J88H 1NDMB 3F7PC 2HFFA 2D03H 1I8MB 1LJMA 1KNOA 4LASL 4YUEH 4CU7A 4J3OD 2ZSWA 5C09D 5IM7B 3GTNA 3IFLH 4PD4K 3C8HA 4LLQB 1YEFH 1AHMA 4Y5VB 3PG2A 4IBZA 4GLRH 2ZIDA 5CEXA 4K3JH 1OTTC 4YHPA 1J88A 1NGPH 2ZICA 4ODXA 2ARWA 3O9WC 2Y5EA 1T5WB 3L3HB 5IJVA 4OLXH 1HE8A 2DTML 2FX7H 2X2JA 5D70L 5DRWA 3MO1A 1OWRM 1UB6B 2EEFA 2ED8A 3ZKQD 5KAQG 3ETBF 3P54A 3FRUB 2ZX9A 2C5DC 4LCVA 1OOAA 2QSCL 1FZJB 4G80A 4HD9A 5SWSA 2P5EE 1LEIB 4HEPG 5E00B 4MKTA 5HHNB 3ZTDC 4YR6A 5KYYB 5IOPA 3KDMB 3WCYA 1FE8L 1YEKH 4TSBL 4TUUA 3VWJD 5GIRA 1AIZA 4KPHL 2X28A 3Q1SL 3TBTA 3MV9D 3RDTB 3UIZA 1S7XA 4TNVF 5J6GB 2A4CA 2Y22A 5HDWA 3ARGA 3SDXB 4BQBA 4G7YH 3STLA 4A2FA 5HYJA 5KN5B 4I48A 3TN0A 2AK1H 1E6JL 1RJLA 3WS3A 4CVZA 4ZK8A 5EU6E 2A9NL 1NCAL 3RVWC 5EH1A 5CZXD 3VFPB 4FTVB 3O4LA 4TQEH 2FZ3A 3RX7A 1B9KA 4MNGA 1E8YA 2IBGA 3NVQA 3KXFA 4AMXA 1G0YR 3GPEA 2C4FT 1J10A 1VPOL 3RGVD 3WXVL 4XC1L 4PU2A 3QORC 1Q9LA 4I48B 3TN0B 1HXYA 1Z7JA 4B53A 3GXUB 2EYRA 2XA8H 3P9MB 4JFDB 2EKJA 4UNVA 5DK0B 3MGOA 4ZXBA 5MP6H 2YGOA 1MI5D 2HZHA 4Q9QL 5KYWB 4QRRE 1WHPA 4E2OA 2OTUA 2WQAA 4ZSOE 2QT6A 5GPRA 4WI0A 1M56B 5JPMB 1LO4H 4HEME 4DSYA 1NMBH 5IOPB 4F7KA 2X40A 3IU4H 4P0DA 5ALCH 3SY0A 2E86A 1VCAA 2B3RA 5I1DB 2UXFA 1BGXH 3DXAD 2FX8H 5E1AB 4FERA 5ID1A 2GSGB 4JM0A 3MRKA 4K8RL 3QIBD 2EVIA 4WWNA 2OR7A 5L2KE 1DYZA 1JGUH 1Z3GL 3MO1B 5FDYA 5LXGL 4LSQL 5HI3C 1GY2A 2X7LA 2AV1A 2GEEA 5EA0L 2MCG1 4MCYB 4XMPL 2LVCA 4JG9A 2I69A 5CEXB 3UAEA 4ZZFA 3DSNB 2VM4A 5H37G 2JCCB 1P9MA 1KIRB 4GXUN 5E6IA 2XX1A 1CYGA 2EUXA 2VUOA 1M2VA 2X4QA 4PTUA 3EYUL 3K7UA 3NJHA 4QY8B 2ZSWB 3WBDA 5KVFE 4EKJA 2BS71 4IOIA 3TBBA 1R3HB 1PCXA 4RESB 2B59A 3L5XH 5B4MD 1CBVL 2BVPB 1MVUB 2P8PB 3D2UB 3TNNA 4UTAA 5FIEA 1D2PA 3KPLA 4H4NA 5I1IH 3GMOA 3OTTA 1OPOA 1JGUL 1Z3GH 5LXGH 1ZEAL 4FA7B 2Z8SA 5DLMH 4K2UH 4U1IB 4KNUA 1UCBH 2X3BA 5GS1B 1R24B 5JHAA 3ZKNC 4UNTA 3V0FA 1CFVL 4NO0A 4MNQE 1F58L 3SYAA 3IU4L 5J12C 3BGMA 1I9IL 2IF7A 3GHEH 4PRHE 3RBGA 5DD0H 3TT3H 1YUKB 3M17B 4FFVC 4F9PC 3LRSA 3LXUX 5HVWA 2EIDA 1M7IB 1SLUA 4XVOA 4QGTA 1LD9A 1KLUB 4JFDE 2EUWA 2K1MA 1AVAA 3ISYA 1BD2A 2FCBA 4MQTB 1AGBA 4CGTA 1UWEH 4O9HH 1AANA 2XY1A 1H0DB 2G60L 2KQNA 1LE5B 5AUMA 3ZJAA 1NBZA 1RUKH 2F9BT 4XWOC 1R5WA 5AYUL 5T3XD 3AY4A 5B3JF 3WIFA 1BIIB 2ZX8A 1YEDA 4ZTPL 2VAAA 4JKPL 4YSCA 4U0QB 1S7RA 3VXSA 2CDFB 6PAZA 2GB2A 1QFWH 4WLCA 4HKBB 5C9JA 3C5JB 2HJKA 4M7LH 1ZLVK 1PLCA 3KPRB 2HKFH 3AVEA 2VB5A 2BSDA 4PYGA 1AJ7H 3Q5OA 2OL3B 1OP3K 2UYLA 1WA1X 4WI6A 5IR1B 3ZRCC 5K9OA 3MRHB 4PB0L 2ZCHL 2XV0A 2BNQA 3M07A 4CL7A 3KLSA 1ETA1 1DR9A 1H3XA 1ZHKA 4M7ZC 4R2GC 3QDJB 1KYUA 5DR5L 1OTTD 4JCMA 4GRWB 4OF0A 3RTQD 4JRYD 4WNSA 3T3ME 4KROC 5FECA 4G6ML 1UXLA 2AJYH 2VDKB 3UMNA 4LEXL 1ADQA 4ZYKB 1MG3C 4PW4A 1T66C 3QG7L 1II4E 3CCHA 3I6SA 3D12B 5D6CB 4DKTA 4I1PA 4O02B 3RI5F 2I85A 3ZL2A 1FFTB 1G0DA 2APBA 4N2FA 4XXCA 5DJAB 1XGPB 4FAAB 2V2TA 1A6WH 2NDFA 4WTZA 2XN9B 1MNUH 5DJ8A 3VFNB 3SKJH 1H3VA 1TTFA 2FJFB 1MFAL 3CPLA 1NSNL 4DO5A 5AYQA 1BPLB 3IGAB 3CLEH 2O72A 1R34A 2ZOOA 5D1XA 1PNCA 4DGWC 3D2TA 3VFMB 3NRPA 4NUPA 1E4HA 1Q94A 4OVVA 5GS0L 5TE7L 3AS0A 5BOPA 1RURH 5TDOA 4AMKH 4UAHA 2WVTA 1GYAA 3FNKA 3K3QA 1MLCB 1KB5L 4L3EE 3FHAA 5E8NB 4BELD 2HX7A 2K4WA 2P24B 2YAOA 3HZ3A 1XGYL 4PTTB 5T5NF 4C83A 3VA6A 4ODUB 1HDMA 1NCBH 3QQ3B 3NCEB 2D7QA 4YHLL 4UOQA 1BMZA 2CZNA 1G1KA 2XPGB 1XAKA 2VDRH 2JNZA 3BC9A 4P23D 1FH5L 4AGPA 3E8VA 2E5EA 3IB4A 3MCG1 3OG4B 4WEUD 5GRYA 1FV1A 3IJHB 3IDNA 3CFTA 4QJ3B 1TU2B 1CN4A 4PJCB 2DQFA 4Y8DC 3NJJA 3CFIC 4WWOA 5MEQB 1PZ2A 4TRPH 3B2VH 4OFYD 5AQ0A 1MN4A 3IYLW 3FSZA 4LLUA 2X3AA 3QEQB 4NKMA 1PX3A 5HHME 5C07E 5KBNC 4PJBB 3NEOA 3G5ZB 5AKSA 5D7EA 5C92A 1UVQA 4YO0A 1L0PA 7FABL 2KLTA 5B7FA 5EDSA 1F3JB 1UZ8A 5I71B 5F6IC 3VDAA 5FB8B 4G3YH 1U8LB 2YPLB 4PWHA 4A2LA 5C0GB 2A73A 5D7IA 5FKAB 1DQTA 1UM4H 2CGRH 1VFAA 2YN5A 5FGCE 4XMTA 4IIQA 4LSPL 1Q0XH 4XMKL 3T3PB 1MAJA 2HMIC 1IEBA 4G6JL 1DLHA 3ROLA 4IHOA 3QXDA 1FORH 4FLOA 2OR9L 4KVNH 3DROB 4C58B 4UTAH 3HAEB 1DJWA 3BKMH 4O58H 4BCYA 4G6AC 5DMGD 3SKNB 2WLLB 5K1VA 4NGHH 5T3ZL 5TH2A 2EXYD 1QZNA 2YD5A 3ZE1F 1N26A 4YEEA 5FLUA 4XPGH 5C07B 4PJ7F 2OK0L 1WFTA 1BD2E 1VZGA 1A21A 4D0BA 1AG0A 3VFRA 4FQCL 2DWXA 1H3PL 3PDOB 2UZXA 4TVPD 3VGAC 1MH5B 5JW4Q 5D72H 3ATBA 1TTUA 2H32H 4PG9A 1PSKH 2Q7YB 1P5UA 2YEZB 3T2PA 3K4ZA 1QKZL 1LMIA 1OKEA 2H7WA 3T1WA 4HBCH 1S78D 4AGLA 2RCSL 1KTCA 4ES8A 4KJWC 1A1MA 1ACZA 3VXOB 1RFDL 1PVHA 1MJJA 1XH0A 3QUZA 5ETUA 4HPYL 1HC1A 3QWOB 4MB3A 4B5EA 4OZIE 1KXVA 3EAKA 3RIAK 2ICCA 3D0VA 4PIRF 1QRNE 1E65A 3NCJL 1QNZH 2EE9A 5A2CA 4PJGB 5A6LA 3FPXA 3M8OH 5EBMB 4N1EA 2MOGA 1QSFD 3PP4H 1A3LL 1C5BL 1YNLL 2BSRB 2DDQL 3T1FB 4OZ4B 4YH6A 2M8XA 2YMOA 1RZ8B 1ZDQA 4FQXD 1T66D 4K7PX 2DF3A 1N6QH 4CGUB 4AKOA 1PZUB 4FEIA 2R7EB 2YC1B 3TPUA 3C2AH 1IGJB 1X7SA 1L0QA 4HUKB 1DQJB 2E7LA 5L0QC 4K07A 4GSUA 1QSZA 1IBDA 2PO6B 1DQKA 3OR7B 4MJ4A 4FTDA 1OLZA 3M1CA 3QWRA 5FR3A 1IAIL 1BYNA 2DV6A 2X44D 1DCLA 5CJOH 4FP8L 1D7BA 3GRWA 1I3RB 2W8CA 3VFOA 3NMEA 4N0UA 2F68X 3PFQA 3FRPB 3ENEA 3GMRB 1KIQA 4HEMA 4U1KB 2AJVH 2BOLA 1AXTH 4WHTB 4DCQB 5B8CC 2NSMA 1GGBL 1OP9A 5IG7B 4WJ5B 3AY2A 3PGCA 3RPBA 1C8PA 3CVIH 4H8VA 4ORGA 4LSTL 4UV4L 2XWEA 2Y1VA 1WS8A 1PJ9A 4CVUA 5AW8B 1EZUA 3ZE2B 4WWPA 1ZLDA 1J1PL 4F2MA 2DQIL 4W6WB 1GYVA 4X98B 2FVNA 4G7SB 5AALA 5I0DA 4AJVA 1XGZA 1QZ1A 5DJ6A 4FS0A 2K6YA 1LLAA 2D0GA 2ZUQB 4ORGB 1NLDH 3GLDA 1CTNA 1HOCA 4WQOA 1CD9B 3D33A 1U36A 3SGKA 3VW3L 4JRLA 3BISA 3E3QC 1WD8A 1YJDH 3OAYH 1XR8B 4LLYA 1QUPA 2IPUG 4P07A 3SE3A 3LNEA 1PKQA 4BFEA 1ITCA 2IADA 3JZ7A 4N0UB 1I8UA 2O5YL 5LQBH 5IKCA 1JWMB 5JHLH 3ARPA 5F1NB 3HG3A 1VFOA 2H0JA 3VWKD 2I27N 1DVYA 4RMVA 4GKNA 2J2ZA 2H6OA 4HIIA 5IB2B 1F2QA 1NC4A 5IMLA 4DEUA 4CUCA 4GAYA 1X4XA 3OF6D 2X0VA 2ZNWA 4E9YA 4QMEA 3F04A 2AJXH 2W0LA 1BMWA 1DQJA 3RI5K 5I30L 3ULVF 3CVDA 2VR5A 3KBEA 3TYGL 3GD1C 3C87A 2YQ2A 4P3WA 4Y1SA 4I18B 3SHSA 3M86A 3ABGA 4ZUSA 1XVSA 1M71B 2Y5QA 4MD4B 3X3FL 1X5GA 3BWSA 4ODSH 2EYSB 1OD7A 2JQZA 4LOEA 3B5HA 5T3XH 4BXSV 2YGPA 4LQFH 2PO6C 3M7OA 1L6ZA 3VX0A 4YSUA 4WU7B 3QAQA 5D1XC 1EXGA 2I32A 4QYOA 3AAZB 1UD6A 4RBPH 3UBXA 5I1GH 3TF7C 3B5TA 2YA1A 4GSDL 3T0VA 3BIKA 1DBML 3GEFA 1OAXH 4MAYB 5HI5C 5HVHC 4QXTB 2IQAB 4HT1H 1KN4L 1RZ7H 4IKKA 4KAQH 4WO4A 3U36B 2F2HA 4M93B 3SDAA 3VXOA 4HG4J 2X6VA 3FKUS 1J8SA 3EOTL 2Q10A 3W56A 1GZHA 5KSVB 1EGJA 4X80L 1W16A 1QRNA 1WBXB 1GHFH 3ET9F 4L1DA 3HI5L 3RWHB 4G43B 3K8MA 5IEHB 1TOXA 1UOWA 2V9QA 1YJDC 3EFOB 4HJSA 4K23L 3RL1A 2FBJL 4ZPTA 1PG7L 1D6VH 1RULL 3I75A 5T5NG 5LB1A 5HGHA 4AK2A 3MLXH 5EUKB 3NDZE 2IIJA 5C07A 4OR1A 1ES0A 4IRSB 5EU7E 2YMXL 4R8WL 1WK0A 4EXPX 1A22B 3C5ZD 3NZSA 3U0TA 3FT3B 3CFJA 4GO9A 4IBWA 1JWSA 2F54B 1S46A 5H2BB 3S4SB 2R0KH 4NKDA 5IB3B 4GW1B 1A6TA 3BZ4B 3VXMB 3MSPA 1DQIA 3QCTH 5HHOB 4OJYA 4CKQA 3FHQA 1MIMH 1MCJA 3IKCA 4OZHA 1TJIL 3HNVL 3AG2B 1WBZB 1U33A 1PGRB 3T0AA 5AFAA 4QPEA 3IBEA 3JWOL 5DD3H 1F3JA 1UZ8B 2WANA 4NUJA 3RILA 1NPNA 1CL7I 1GAFL 4HXBL 3LS4L 4HUUA 3MRBB 2R2BB 5KAQF 4XAKD 2GI7A 3PGFL 4AIZA 1RZKL 4LLUB 4WEMB 1BIHA 3LN5B 1IC0A 4BV1A 2Z31B 3KPOB 1A02N 4L1SA 2IANE 4EJ1C 3MBEC 2W5PA 1CLZL 3U6RB 1EFXA 2P5WA 4QHNB 1CD1A 5GRVK 1SVZA 5I18H 1JYNA 2CBQA 4X6CF 2DQFB 2ROYA 1TEGA 5INCA 3IJHA 4WFEE 3T0EE 1HL8A 2EVGA 4O02H 4OLWH 2IV8A 3TWCH 1JCKA 5BUPA 1MJ7L 4NO0D 3GMQA 3BAJA 1CPUA 4M7LT 3HZKA 4K94L 5J6SA 2DM4A 4TTGA 4ZOCA 2XTSA 5FYKD 2IANA 4JFZL 4P3CL 1TZHA 1VZIA 3ERXA 4GO6B 3KWUA 1LO2H 1BQLL 4N8CL 2N59A 1NAMB 1T1WB 1A25A 3BP5B 4P2RE 1KXVC 3MRLA 1Z6JT 3BN3B 3HRZB 4D9QE 5CCKL 4LSSL 3D39D 4O2EB 1FIGL 2F0CA 4UM9D 3FH5A 4K8RC 3QZMA 4UF7C 5TDOB 5KOVC 1S7VA 2VSCA 4FG6D 4ZZKA 3GK8L 1FGNH 3ESUF 3SZKC 5LUMA 5HD8C 1X3DA 1H5BC 3U1SL 2I25N 4B5ZA 1DJYA 4C4KT 1M3JA 2V8MA 3CPLB 4N6RB 2DWTA 1M53A 1L3NA 3IM1A 4NO2B 3BZFA 1E90A 5E1GA 2XACC 3OLEA 2CRMA 4MNHB 3H4FA 1X9LA 1XIWA 3D8MA 2AJSL 3DGDA 2P80A 3TBVA 4F20A 1O6TA 5CSBA 1S3KH 4TVPH 4OGXH 3NN8B 3MLPA 4R7DA 3FT9A 4UTBL 3A6OA 5D8JL 1EEZB 5FECB 2KL6A 5I76B 1F90L 3FF7A 2V2WA 5F88A 4MD0B 3NIDF 5A2KH 4HWEH 1A4KB 1T0PB 1QYGL 5IR1A 5TDNA 3U7YL 2UWEB 4UCFA 1A7NL 5JXED 2BSEA 2G2RB 4Q9BA 2VOTA 3WFHA 3KPRA 2OMVB 4Y2DB 3IMWA 5F7AA 5C86A 4HHAB 1L9QA 5ICXA 5D5MA 5HTSA 3CSFA 3CZKA 5HHVL 5FO8B 3L1EA 2R2EB 4ZOBA 4E5XG 3O9WB 1N19A 3UJJL 3Q06A 1NGXB 1VEMA 3WJLA 2YHGA 1QFUH 1Q0YH 4ZD3L 2VDOB 1MFCH 3KPSE 5BQ7A 4UT6A 4NCC1 2ZUUA 2F5AH 4P2AA 4P5MA 5EU3A 3N1QC 3CDFA 4Z3IA 5CUSL 3KPMA 1NGZA 1LO0H 1NOFA 3MUGB 1I1RA 3CTTA 5CGMA 2CQVA 2VLKE 5KVMC 3O4LE 3NJKA 4AXWB 5IQLA 3ZDYE 2PYFB 3FFDA 3UBGA 2E6QA 5C0BB 3SCMD 4MB5A 4KO7A 1AH1A 2IOOA 3NH7L 3ZHFA 5D8JH 4W9CC 4MNQA 4Y4KD 2KZ1B 4RNRA 4OGXL 2A99A 4FMVA 3IMUA 4HJEA 1G1YA 5DYOA 3ULUF 4JCLA 1KIPB 4LKXB 4S2SA 2WO3B 2H6PB 3F84A 4FEMA 4Y1AD 2Z92A 1YEJH 2KPNA 3LZNA 1DBJH 2X89D 4OFIA 1I3GH 4QY8A 3WNNA 4PTUB 2X4QB 4C54A 3OZ9L 4JM2D 3MCKB 4L4VD 4M6NL 4JFEE 1Y7VA 2G9KA 1WAAF 3D51A 2DQDL 2HVJA 2G75A 1IBHA 4EI5B 5T3XE 4RGMB 3FTZA 4N2OA 2F5BL 5L8LB 3VACA 3DVIA 1FNAA 5FS5A 3RNKB 3U0PA 1XF2B 3QSKB 5EU5A 2GJZB 4R4NC 4UUJB 1WWAX 5CP7A 1KJ3L 1IFHL 3BAEH 2HJFB 2XQYG 4N0CC 4G5ZH 2K70A 4XP5L 2BW5A 2CCLA 1X9QA 1QACA 2YQ3A 4YPJA 4KKCD 2LV4A 1T0OA 2A9MH 4NBZB 1WA0X 4I77H 4Z7WA 2Q86B 3EF7A 1MCEA 2IH3B 3J2PA 4NZUL 3O6LH 4K5LA 1ZHBB 2AVFA 5E9DE 4HWBA 2YJLA 3F2LA 1P1ZA 1A2YB 2JELL 2BWQA 4DVRL 3UIYA 2VLKB 2X09A 4JKNA 1T1YB 4RAHA 4AEHL 3U9UB 2NY6C 1WTLA 1Z2KA 1BHGA 4PJAF 1T1XB 4LL1A 3QGVA 5TE4H 1XL4A 2HFTA 1RZKH 4NRZB 5LG1A 2ISDA 3KXFB 3PGFH 3EJQA 2PCFA 4H1LG 1SXNA 1EEQA 3O4LB 4HXBH 1GAFH 2WGNB 5E9NA 4QRQB 4PLJC 3TWYA 3JWOH 5DD3L 5DJ2A 1FZKB 5ESQB 2FJHB 3QH3B 4F7TA 5DVMA 4FQJL 4IOFD 3CHPA 1RVFL 2K7QA 2W81C 1J8KA 3KGSA 4WHCA 3IJSB 3ARGB 5KVDL 2GTQA 3SDXA 5J8OA 1PLGH 3NCYS 1EZSA 3BGFC 2J1KA 3MOBL 3BPOC 1UQSB 3VXNB 4U7SA 1NLBL 5DSCB 5TTRA 4E0RB 3C6SA 5J12B 2VXQL 4YXHH 2P26A 2H9GB 3MR9B 3MOAH 4UIMB 5KYYA 2R0KL 1E30A 4TNVK 3BH4A 3RTQB 4F24A 2HRPL 4PW3A 4G80B 2HJLB 2K7PA 2XTJD 1U9KA 3GKWL 2HLAB 3EBHA 2VN4A 3C5ZA 4R8WH 4XPBH 1Z0MA 4KKBD 3T08A 1WIOA 2X4TA 3MRIA 5DRWB 5KSUB 3WELA 4UBDC 1Q9WB 5DHVH 3WSQL 2DH3A 1UD2A 1RULH 4BEIA 1IL1B 3MROA 3QEHB 4J6IA 1VB9A 5SX4H 3FQUA 3RYMA 1DQDL 1LNUA 3L3IA 1KACB 4EE2A 4ONOA 4X80H 3KNBA 4GI6A 3MNDA 1SUHA 2VXSH 4FNQA 5D1ZI 5D7LD 3QRGL 3C6LA 2OX5B 1E9OB 2JE8A 4EBQH 4DH2A 4BZ1L 3BWUC 1KULA 1UB5A 2EIMB 5I1GL 3E1F1 1QLEL 4PRDB 3JQOB 4RAVA 5DS2A 3T77B 3F65A 4KROB 5CILH 4NC2B 3WXWH 5K9KB 1DSYA 3VFVA 1M9WA 1NWOA 2WN2A 4K15A 2Y24A 1Z5HA 4Y9FA 4PJGF 3RGVC 5TPWH 4G59C 3EGDA 3VTTA 1BSIA 4FNPA 3UC0L 3LXAA 2QPUA 4YDJB 4YE4L 3QPXL 1XGQA 4OI8A 3P2DA 3ORJA 1AZCA 2F6AA 3QPQD 5DD6A 4JPSA 4P4RB 3P77B 5AVRB 4C47A 3IEAA 1A6AB 3FUEA 8FABB 1A64A 1XR9A 1QR4A 4OCSH 1MREH 3KWVA 3MRDB 3QEQD 4KTDL 4YHKH 4BWTA 1G7IA 2JJSC 1KGJA 2FGZA 2ZCKL 4CNIB 4AL8C 4Z7QE 5HY9B 4D0DB 1L5GB 4PWKA 4N8VB 3OKKA 3DV4B 2OJEA 3QUXA 3VD4A 2BIIA 2J1ZA 2VC2B 4W9JC 3T0EB 4JAMB 4YHIA 3L2NA 5BW7C 1CD0A 1AY1H 5FF6B 4G42B 5DEGA 4WJG3 1OO2A 4OLUH 1YCSA 4OI7A 3MNZB 3SDDC 1AI1L 5C0CD 5LBSH 2YOAA 1UJTA 1YJDL 1W0YT 2BHYA 3U1PA 4UDUA 4ZS6D 2VL5A 1F02I 1OF2B 2VLJE 1X5JA 3EGSB 5PAZA 2IH8A 2RAMA 1JZ7A 3HS0A 1J1PH 4QYAA 4GKOA 2XN0A 1T0MB 1KYAA 3ZZQA 1U92B 1XF4B 3FN0L 5KJRL 1OW0A 3L1OH 5AD0A 3V0VB 3BVUA 4OZHF 2C9PA 2QPSA 2LABA 4OLZH 3VMPA 1T3FB 2QSTA 1CXIA 4WO4D 1ODAA 1OPGH 3QXTA 4HJUA 2X1PA 4UM9A 4Y1TA 1BPVA 3FW6A 2BNRD 4N9GA 2OSWA 2XRAL 4JFSA 2CE6A 4NN7B 3PWPA 3QRFM 1C12A 3KR3H 2YLKA 2N7BA 1JNHB 4XBPA 2NY4C 1LO3L 2ZUTA 2O6FA 1EHNA 4J3BA 2V3DA 4MMXC 1BM3H 2VDLH 1NUFA 2IMNA 5BMFL 2JK5A 2B8OT 3G6AA 5I1KH 4QXUL 3RPIA 5K9QI 3GEWB 1F41A 4X9GA 1RP8A 2JB6A 3O3DB 3D3VE 5HHPA 2XZAL 4TQ8A 3BAXA 1MRDH 4LEOA 2P47B 4Y5XA 4FXKB 3W39A 1UYWH 3S96B 4L37A 1FNSL 5EBLA 4AQEB 4PSRA 3VFSB 4NUGL 3NFPA 2BSTA 2AEQH 4JB9L 4I2XE 2O5XH 15C8L 2DQTH 5BVJB 1M05A 3FAXA 2HUEA 3DYPA 3IPEA 2V5TA 4PJ5A 4AEIL 1Q8MA 1CGVA 1EO7A 3FF8A 1CTOA 2AXHA 4XNQB 4YAQB 2E74C 1UA6L 2QLVB 3PV6A 4YSDA 3ARBD 4HU2A 1KYDA 5L4JA 4I0PB 4WY7H 3SIKA 4G83A 2WBJD 3OXRB 3QIUA 2MPAL 2EACA 3N9GH 4Q4IA 1UHVA 3VD1A 1RFDH 2A4EA 2ZXCA 4IRZH 1WC7A 4JX0A 3MDJA 3V5DB 3V7AG 1G7JB 4FQ2H 2RCSH 2Y7OA 5DEZA 2EDMA 3DECA 1ZVYA 4OCYL 3TJEL 2HLFD 4G7RB 4ZMXA 5KS9E 2BY1A 1F6LL 4M4PA 3BAWA 4IEFA 4JY4B 4PGEA 3ZKXB 1AR2A 3PWPD 3MJGX 2VR6A 5BO0D 2QKSA 2WQWA 3P3TA 2P43B 2A9BA 1Q9OB 1L4IA 3RQ3A 2OK0H 3HE6C 1EFQA 1ADQL 1QLRA 5AW0B 1TQTA 3AS1A 1BVOA 3SQOH 3KBPA 3UPRA 4KO5A 3F58H 2CAKA 5L0QB 4QNPE 2WGXA 1R3LB 2R0LL 3MKKA 2ZJSH 1JPFB 4UTAL 3ATEA 3LD8C 5MEOB 1RK0B 3PWUB 3HHSB 3TJHC 1SXBA 4KITB 1TVHA 1FFOA 5TE6H 2YXFA 4D9RE 4JG1H 2P5WE 4M43H 2QQNL 4XB7A 4Y0GA 3DVGA 3VXUE 1RMFH 2EDYA 2O5ZH 3NGBB 2PW2A 2W9EL 3C60A 4JHUA 2WKGA 5JYMA 4YHMH 2L7QA 3L8QA 4OD3L 2TRHA 3S96A 3ECQA 3ZHKA 5D4IA 4Z0BL 2F7RA 2WNGA 1NAKL 2CKBA 4UINL 2UXTA 3SO5A 5DVLA 5CKGA 1MCQA 4JFQA 3ZSSA 2WYTA 1BZDA 5BZXA 3BVXA 4TLKA 3B7RL 4PJ6A 4APQD 1J8HE 2ZX7A 4GOSA 2ODIA 4X7TA 3LMJL 4NAMA 2RB8A 2PR4L 3KCPB 3MV7B 2WP3O 2VUKA 5JPNC 3RDJA 1TLKA 3D09A 2BDNH 3KWWA 3T71A 4POZD 3LEXA 4KXDA 4OD3H 1XGYH 2NX5D 1THCA 4TUKH 1J8HA 3B43A 2LOEA 2ZX6A 4WW1A 2OMBA 3EOBB 3MNWB 2HTKC 2ZF9A 4JZJB 3P3RA 1NGYB 1TQWA 5AZ2L 4GAJH 4GQPH 5TE7H 3NZHL 5C6TH 1TO4A 4P2RB 4M43L 3BUIA 3U79A 4N3TA 3UCQA 3PFUA 4P9MH 2DRUA 1TPXC 4I9XA 1KXTA 3B4NA 4K7PY 2P44B 1ZA3A 1NSNH 4M29A 4YIQB 4MBOA 3RVUC 2GITB 3T8VA 5LXVA 5E6SB 1MZYA 1T0MA 1UWYA 2VLLB 1EO8L 1KY7A 1JZIA 3HS0B 4JRXD 1UFUA 5IF0B 1JZJA 1AGFB 2VYRE 2R27A 1TMCB 5DQJA 3ETSA 4OGQC 1OL0A 5J0BA 4WWKC 5FHBL 3Q5TA 3QG7H 4XPAL 2XN2A 1BCIA 2VL5B 1ID5I 2V7NA 4UT9L 1AZNA 3WJMA 3BWUF 4G6MH 3RZCB 5DZOA 4DN3H 1AO7E 3MNZA 4HQQH 4KK8D 5CFHA 2CM6A 3TIEB 3RG1C 4C59B 2H5UA 3TJPA 3CSGA 2BZDA 4JGJA 4J4PD 4OCYH 1J0IA 4J3VA 5D96C 5ECJE 4RVBA 3CMGA 1R5VB 3P4NB 2EO7A 2CKNA 4HUXA 5DFVC 4TSCL 5GZNC 2QLYA 3EJTA 3N9GL 1FL6A 5C08E 1GZQB 3UROR 4M7LL 4ZT1A 1ZE3H 5J13B 1A6AA 3GSRB 8FABA 4KV5E 1RUML 1R4XA 4POZC 4UQ9A 43CAB 4DP6X 5FWRA 4Q7DA 4ZX3A 3GIVB 5KS9A 4WW2A 2F7PA 5J11C 1I3UA 2ADFL 3FT2B 4AL8H 3VWJB 4OJFH 3BUYA 1IJ9A 1T6WA 3H2PA 4RGOH 4PJBF 4IRZA 2LT9A 2VLJB 1JNNL 3WD5H 5ICYB 3DX6A 2XZAH 4BSWA 2Q3XA 3I9GH 3MFGB 2P49B 5CSZB 2V9UA 2WXNA 2QQLH 2Z93B 2ADGA 2AGJL 2OQJA 2FSEA 3P0VL 3MGAA 2ZP9A 3FAWA 4ZQTA 5FYJL 2RACA 4PJHB 4LT7A 5GGVY 1RUQL 2IBZY 2JIXD 1I9IH 1TMQA 4KXCA 4F33B 1HI6A 4FQ1L 3VQ1C 1NANI 1E9OA 5C0AE 2ORBH 2OX5A 3C6LB 3GI8L 2W9LA 4IU3B 4NQDD 4UMSA 4CU8A 2H2SD 3UADA 5I15H 5C08B 2PWFA 4AENB 4F2EA 2FL5B 3KVDD 5ID0A 1HYSD 1RP9A 4XI5D 4NNYA 1Q4NX 3PHQA 4MFHA 3FQUB 3KR3L 2WLIB 4W4OC 1PG7X 5ALBL 4JE4B 3SODB 4HG4K 5GRUH 3JYCA 3QXVA 1KTLA 4HWUA 4GG6F 1KPVA 5I8EA 1OPGL 4GKZB 3OJMB 3HAEH 4X5QA 2BLFA 3QI9C 2LTQC 4P9HH 1XF1A 3CQFA 1M6OB 2VZSA 5JO5B 1NMCC 4JQIL 3ZYOA 2H1LM 5KJRH 3FN0H 4PV9B 3RTQA 1D5MB 3GSNL 1LM8V 4UIMA 4ACTA 3FO1B 1IAKB 5EA0H 3OBAA 4JFEB 4A6YA 4F7PA 1A5FL 5E5LA 1T21B 3ZPDA 4NRXB 5BW7A 4KI5D 1DVFB 1KGYE 3II3A 3QIBA 4E41B 4N2AA 3NK3A 3QUXC 2LW3A 2BFGA 3AITA 5E9DD 2A9CA 4PJCF 4PJ8C 4OLUL 4YC2C 1C16A 4JY6A 4KZCA 5H94B 3IETA 3SOBH 4MMZA 4WNQB 4A68A 3NEEA 1LO4L 1NJ9A 3BH9B 3D2UD 3PQYE 4KX9A 1VDGA 2PCPA 5FW7A 1PLBA 1E9PA 1BEXA 1OXYA 1T1XA 1E2VA 2B20A 1H6FA 2A9DA 3T2QA 3T6VA 2COVD 4L9LC 3AREA 4JQXC 1J1XH 2PTTA 2Z0BA 3GSNA 3R4RA 5L8JB 5HGBB 3HR6A 1F4AA 2D4DA 2GYSA 4Q6IA 1IBBA 4JDEA 3RVXD 4BH8B 1BDYA 1U30A 4TLUA 3UC0H 1DFBH 5CBAA 3O6FB 4C57C 2E27H 2VISB 2Q86A 5GGVL 1NMAH 4KGLA 4M00A 2XWJA 1PNDA 3RY6C 2ZZUT 4LCYB 3ZKND 4X6DB 3A3YB 1NEZG 3B1UA 4H8PA 1UCTA 4EDWL 4KPHH 3MQIA 1QLEH 1OE3A 4OM1H 4NSKB 2C3WA 1AQMA 2XWBB 1FE8H 1CLCA 5J3HC 5I1JL 3ZDXF 3EF4A 1E4XL 3ZTJG 5D1XD 4EQ2A 5C0BD 1ET8A 2WXGA 3LVEA 3SCMB 3UP6A 3QIWD 1HWWA 5BS0A 2QSCH 3SE3C 2VXSL 3PLYA 1M57B 2KUTA 2ATKB 1SJMA 4YMPA 2WSPA 1WBYB 3MRQB 2AEPL 5F44A 1RV6X 4XN8A 1E2ZA 2WXLA 4ZMZA 1KIPA 5BV7C 2X9ZA 5T5FA 3EHBB 2ITCB 4XCNA 4PJEE 1OVZA 4KH9A 1JZDC 2VMJA 3FQNB 3TCXA 4HS3B 2YFOA 1GS6X 1J0YA