4ZMRA

Structural characterization of the full-length response regulator spr1814 in complex with a phosphate analogue reveals a novel conformational plasticity of the linker region
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
207
Chain Sequence
GLVPRGSHMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the full-length response regulator spr1814 in complex with a phosphate analogue reveals a novel conformational plasticity of the linker region
pubmed doi rcsb
source organism Streptococcus pneumoniae (strain atcc baa-255 / r6)
molecule tags Dna binding protein
molecule keywords Response regulator
total genus 77
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zmrA01
3QELB 1ZH2A 3JY6A 3FFWA 3UUGA 2HPHA 3T8YA 4LDZA 3S99A 1USKA 3GRCA 1FFSA 3EQZA 4MS3A 1JBEA 2FEKA 2HJ9A 2IPMA 2VUHB 4ETIA 3H5LA 1ZGGA 4N0QA 3K4HA 3I5AA 2P4UA 4MQEB 2IDMA 1QKKA 5IEBA 4OLBA 1TLFA 4G0ZA 3OMWA 5JS2A 2PUEA 3BBLA 1SRRA 3KTOA 4RY8A 2FVYA 1E2BA 3D02A 5IX8A 4W5TA 3O2QB 3QEMA 4KQ9A 4RKRA 2LP4Y 3N0XA 1GLGA 3MYYA 4EYKA 2WRZA 4XARA 2R4QA 4LE1A 3HCWA 1LJLA 2PUCA 3A0RB 1Z13A 3MIZA 3O1HB 1H9CA 2WJAA 4TLLB 1QP7A 3EULA 1USIA 1VKRA 3T6KA 3FMVA 3DGFC 1LJUA 3QLTA 1Z26A 5C5CA 2FLWA 4G0PA 4YR7A 4HNSA 3IPAA 3KJXA 4L4UA 1BDJA 1PEYA 4B09A 1Y1LA 3MM4A 3OLXA 4FE7A 4KQCA 3G85A 4EYQA 1JX6A 1DC7A 2PUFA 4OBBA 2HQBA 4XXHA 5T3YA 3N6VA 4PZ0A 3DGEC 4MR9B 5KQMA 1YK0A 2MYPA 1U2PA 1M2EA 3ROFA 1ZVVA 4LE0A 4M88A 2ZWMA 2P9HA 4N03A 3OQMA 3GV0A 4FB4A 2GX6A 2QV0A 2FXIA 3HO1A 3QELA 1NXPA 1URPA 2NZVG 3C3MA 5HKOA 3SG0A 3H6HA 1DCMA 4RK1A 1Z25A 2JCGA 1ZAYA 2MYTA 3CG4A 5F64A 2QXYA 5FBKA 4RK0A 4MQEA 1EFAA 1ZDMA 5FWXA 5DLEA 1W25A 2IKSA 3JPYA 3LUGA 3OLZA 5TPZA 5TQ2A 1YK1A 1L5YA 1M2FA 4KPYA 3GA5A 3H5TA 1APBA 1JH9A 4MRMA 4WXEA 3GWGA 2JBAA 5KQPA 4O1IA 1C0EA 3JTEA 3N8IA 1YMUA 4MQFB 5BRAA 4RK7A 5TQJA 3LTEA 2M1ZA 3KSMA 4WT7A 4Z4IA 3I45A 4MRMB 2R48A 1B00A 3KS9A 3H6GA 3A3KA 3HZHA 2A9PA 3MA0A 1EWKA 1JF8A 2QU7A 3LUAA 4MQFA 5HM6A 3NNSA 1JL3A 4MR7B 4OATA 4PICA 5EWMB 2W42A 1DZ3A 3GT7A 3QLUC 4MR9A 3RVJA 2F8TA 4JAVC 5B3JA 4EVRA 4RXMA 4RK5A 3GBPA 3OO0A 3H5VA 4XASA 5TE9A 4H3HB 3ROTA 5DTEA 4QICA 1FSPA 2PUGA 1M5TA 2DRIA 3CHYA 4KV7A 4KK3A 2FKAA 3H5WA 2L17A 3HK2A 4KVFA 3TB6A 4MS4A 3BILA 2L2QA 4IMJB 3TX6A 5TPWA 3DZDA 4JB0A 5CNIA 2AYXA 3TO5A 4LZLA 4RU1A 4JASB 4MS1B 2FQYA 2RDMA 4FE4A 4E7PA 3LMKA 1YS6A 1Z17A 2VUIB 4MS4B 1KRXA 2WJWA 4IRXA 4W5NA 1BDIA 3N0RA 4ZJPA 4ZMRA 5BQ3A 4IMIB 3IPCA 5JNUA 1U8TA 3E3MA 5TPZD 4RV5A 5KWSA 1MAVA 1RZRD 3GBVA 2F8SA 1DCKA 1IIBA 4Q6BA 2VK2A 2E4WA 1SXIA 3OLVA 2IYNA 3FGZA 3A0UA 3N0WA 4LE2A 3D8UA 4F8JA 6ABPA 3G1WA 3LUJA 1QPZA 2CD7A 3JVIA 3T95A 3QLVA 1A0OA 1QQBA 4G86A 1T34A 4CBVA 1QP4A 4O1HA 4WUTA 3E61A 1OXBB 3EGCA 3DBIA 1EWTA 1DP4A 3MF4A 2L18A 2TMYA 2QVGA 2JB9A 1ABFA 4RY0A 4G0QA 2L19A 5C5EA 2QVCA 3RVRA 1JDPA 4PEVA 4HYEA 1ZHHA 1TJYA 1PEAA 1J56A 3KCNA 1RXIA 4G0MA 3LUKA 4IGAA 5IULC 2CHEA 1PHRA 1JDNA 2WWVD 4TMYA 3Q7TA 3M9WA 4O5AA 1DG9A 2FLKA 2I6FA 1JFTA 1QP0A 5KC9A 3BRQA 1U0SY 3LKVA 3SAJA 3OM1A 3QLUA 3N53A 1D4ZA 2XDYA 2NUBA 5BR1A 1U2QA 3LUCA 1JWLA 1ZGZA 4RXUA 3H1FA 3HSYA 4Z99A 4OLAA 5JNWA 1Z2EA 5CHYA 3EQ2A 2E4YA 4QPJC 1PNRA 5CNMA 5BRJA 3C6QA 3IP6A 3BREA 4MAAA 1QMPA 1CYEA 2GI4A 4GNRA 2JK1A 3QX9A 5IBQA 1KGSA 3N75A 3EDCA 5FWYA 4ETMA 5T7BA 3QEMB 1QQAA 4DN6A 3HXMA 5CNJA 5JNTA 3FFXA 4MS1A 1LBHA 2JVIA 1BAPA 3HEBA 4MR8A 4F12A 5TQ0B 2E4ZA 5D2CA 4EVSA 4F11A 3M6MD 2MSWA 4WZZA 4ZYLA 3TMYA 4LDAA 5ED4A 1KMIY 4DQDA 2NZUG 4YWHA 3O1JC 5HSGA 2PMCA 4ETNA 2RGYA 2OQRA 4LX8A 2LIVA 4Z4CA 1PUXA 4Z0NA 2KYRA 4G0YA 1XHFA 4YO7A 5GQSA 5JNVA 2WMYA 2M98A 1YVUA 4NCBA 1AB6A 1M5UA 4YGXB 1DRKA 3NHZA 5DGCA 1ISSA 4MR7A 4D6YA 2FN9A 4D74A 4KRFA 4QYMA 1QO0D 1F4VA 3R0JA 3SQNA 2IPLA 3A10A 5IEJA 1LBIA 1ZY2A 3C97A 4NQRA 4P1ZA 3EODA 1VLZA 3OLYA 3LKBA 1NXXA 3VNAA 3H5IA 5KI6A 5JNRA 1GUDA 2ZAYA 1P8AA 5TQ0A 4G97A 3CRNA 2PUBA 4MPTA 4RK4A 2J48A 1A04A 4NV3A 2GWRA 2V0NA 3IP7A 5CNKA 2FQXA 4Z4HA 1NXOA 3MMNA 4S05A 3SY8A 1SXHA 4XLTA 1OXKB 1C4WA 3KKEA 2IPNA 1CEYA 3OO1A 2GKGA 2ID9A 1FFWA 1Z16A 2FEWB 4KMRA 4RDCA 3CU5A 5EWJB 4Z4EA 3URMA 1EHCA 4WXMA 1DBPA 4N47A 4YV7A 3HS3A 1ZESA 3HJFA 1BDHA 1PNTA 2YHBA 1Z2DA 4RK6A 3DLBA 4RY9A 1RNLA 4JB2A 1TM2A 3QLVC 2ID7A 3GL9A 2A9OA 2H3HA 2X7XA 5PNTA 4EY3A 4YRZA 3UK0A 3EAFA 2JVJA 4D6XA 4H60A 4RSMA 5HQJA 4Z4FA 1YTUA 1Z12A 3F6CA 3IP5A 1Z18A 3JPWA 3MQ4A 3T38A 2CWDA 4JA2A 5DKFA 4NICA 1K68A 4N41A 1JHZA 5DCLA 2FMKA 6CHYA 2PKXA 4YP9A 3O74A 2CHFA 3RVPA 1E6MA 1YMVA 4DADA 3CNBA 3SNKA 1P6UA 3SM9A 3OLWA 2FMIA 3RVNA 3HM9A 2QSJA 2AYZA 4EVQA 3RVLA 1D5WA 1FFGA 2B1JA 4YS6A 5I4CA 5JS1A 3EJWA 3NNNA 4Z4GA 1XHEA 4ML3A 3P9YA 2E4VA 3DLHA 7ABPA 4XAQA 3OM0A 2MYNA 3O1IC 1CHNA 3TD9A 5TQ2B 4W5OA 3CTPA 2A9RA 2MSLA 3CKMA 3I42A 3OQNA 3KYIB 2MSKA 2FW0A 3L6UA 1Z15A 4QYWA 1QO0A 3IP9A 1GCGA 4OTZA 4RXTA 1QNLA 5B3JC 2PL1A 3RH0A 1SD5A 3H75A 2FTKE 4E7OA 2IPAB 1YIOA 3CLKA 1DBWA 1NATA 3ILYA 1DC8A 2LBPA 3K9CA 1GCAA 3GYBA 1A2OA 3NHMA 2FN8A 2JRLA 3CZCA 3HDGA 4W5QA 1AB5A 3RQIA 2NT4A 4G0OA 3Q9SA 4OG2A 1JFSA 1JYFA 2LPMA 3F6PA 3W9SA 1KRWA 3UKJA 2H0AA 1EAYA 3KYJB 3OQOA 1DBQA 2MYUA 2O20A 4KREA 4L85A 1U04A 3OMXA 5KQGA 3O2SB 3HDVA 3O2JA 4F3TA 4MR8B 4KZKA 1D2AA 4MYRA 3CFYA 3Q15C 3HV2A 4PE5B 4KFCA 4YCSA 1ABEA 5FWXB 4TLMB 2IOYA 2BGGA 3FDFA 1JYEA 1VRVA 4HNQA 4Q7EA 1E6LA 1MB0A 3KLOA 1S8NA 1ZH4A 3HUTA 1GUBA 3F7NA 4XFKA 2A9QA 3M9XA 4G0XA 5FWYB 1L5ZA 4JP1A 2PE5A 1K66A 5EWLB 4ZMSA 1XWWA 5IUJC 5JNSA 1BVHA 2FMFA 2PL9A 4HNRA 4LRQA 5ABPA 3LFTA 1P2FA 3HVRA 2WB4A 3H1EA 3CS3A 3HUUA 3LUFA 2N9UA 1USGA 1NXVA 2HSGA 3NNDA 5IUKC 3CG0A 4PYRA 4UHKA 8ABPA 1SXGA 3H5OA 1DCFA 3VNBA 2GBPA 3QEKA 2JBAB 4RZSA 3RVOA 2B4AA 4KK4A 4MS3B 3JS5A 1DRJA 4MGEA 4TN5A 3RVMA 4EYGA 4KNYA 1P6QA 3BRSA 1MVOA 1YS7A 1HEYA 1LK0A 2R47A 2YHAA 3O75A 3Q7RA 1D1PA 2PLNA 4P98A 2Q5CA 1WETA 1ISRA 2PUAA 2NT3A 3RVQA 2WY2D 3IDOA 1JLKA 2PAFA 1JFVA 3H1GA 2RJOA 4MLCA 1F51E 3L49A 3ILHA 3KHTA 3NBMA 5KC8A 3RVKA 3Q41A 5EWLA 2PUDA 4N0PA 4F06A 2RJNA 5EWJA 2FQWA 1R8JA 3C3KA 2FSPA 3O21A 4Z9AA 3CZ5A 4N76A 1W9HA 5TPWB 4YLEA 5E3JA 3LOPA 4Q6WA 1NY5A 1E6KA 5IUNC 3FFTA 1RXEA 4JOQA 3B2NA 4H3KB 1TMYA 2R25B 1MIHA 5GOTA 4MLDA 4IF4A 2E4XA 2QR3A 1EWVA 1BA2A 2VYCA 4IILA 1I3CA 3C3WA 4RWEA 1DJMA 2JVKA 4EUKA 4UHJA 4RKQA 1D1QA 2E4UA 4GPAA 4Z9BA 1MB3A 1NTRA 3JVDA 1TVMA 5EWMA 4EYOA 3I09A 2FMHA 1NXTA 2HQOA 3Q7SA 2FEPA 1UDRA 2LUOA 1RPJA 3RVSA 3F73A 5KQLA 3QX8A 2PJUA 4S04A 1FQWA 1RZRA 1NXSA 4Y9TA 4W5RA 3LUHA 1VPWA 3QK7A 1ZN2A 4RS3A 5FBHA 5IC5A 4ZPJA 2OENG 3LUDA 4NCAA 9ABPA 2HQRA 3KLNA 4WWHA 2QZJA 1ZITA 3KG2A 4EGSA 1NXWA 2QW1A
chains in the Genus database with same CATH superfamily
4LXHA 4OL0A 2Q4EA 2P9GA 4GC5A 4R3NA 3LV8A 1COZA 1E9SA 2OZEA 2YMPA 2HPHA 1HH4A 3FFWA 2ECPA 5CHEA 5EPEA 3WNZA 2B34A 5BV0A 4ECEA 2WSBA 1MH9A 2VUHB 2D2EA 1PQUA 2INGX 1JHVA 4B31A 3U44A 3DFMA 1EFVA 2XUGA 3F0TA 3EFEA 4FCTA 4QJ4A 1YJAA 1U31A 2BZGA 3OD5A 5B7GA 4QG3A 3F4KA 3KZNA 4J76A 3WC4A 2H4XA 3OU7A 5DN6D 4F4DA 4F21A 2QV7A 4UTPA 4U63A 5LN1A 2R8XA 4HWTA 4PZLA 5FDFA 3U81A 4RKRA 5DB4A 2O6HA 1EX1A 3B6JA 2B7CA 2D5CA 3IO3A 2NUTA 1GAXA 3KQQA 3FSJX 5EXSA 5FNVF 4K9QA 4J43A 5CU7A 4RY2A 1NUQA 2AQKA 5B1YA 1VL8A 1OH8A 4MSUA 4TVOA 3RI3A 3KPJA 2E48A 4M49A 1LSJA 2EC5A 3EGVA 2G8NA 1Y3BE 2G88A 3GDGA 3KOYA 4S1OA 3S1LA 1DKOA 3OBIA 3SU8A 2R0QC 1WABA 1WSBA 2CC2A 2F4NA 2IIPA 3BL8A 2NADA 1WRBA 3NT2A 4KFRA 5AYVA 1PFWA 2B61A 2NQTA 3MM4A 3TRKA 3U0VA 3UOWA 3WB0A 1TCCA 1VLMA 1JDVA 4KNVA 1T1JA 3ZX4A 4F5ZA 3QTLA 1XALA 1XZFA 4UAJA 2QE7D 2HIHA 2ZU6A 4UUQA 1G42A 3BSWA 4M1MA 4CQMD 2CV2A 3GH3A 3NKFA 3U4IA 3RYHB 5CX1B 1NUPA 3WLNA 4QYSA 1YK0A 2HRQA 2PUHA 3FCAA 4KSCA 1MVNA 5ALQA 4M89A 2J0EA 4MV4A 3DZFA 4OHKA 2QNRA 3QMMA 2W2MA 4M6WB 1N6OA 3OU6A 4YJ3F 1QHYA 4UOQA 1N5LA 1KQNA 4NEHB 4QAJA 2AEFA 1VJCA 2FH5B 2ZXFA 3B8HA 1BX0A 3AHEA 3QELA 1ZZEA 4ZPXA 5A6SB 5M5BA 1A9XB 1D7AA 4MRVA 4TQGA 5JSYA 1Z6GA 2ZDGA 3V8PA 4G85A 2V9CA 5HEKA 4N5NA 4J75A 5ERYA 4PSKA 5LZ7A 3RSFA 1TC2A 4J0HA 1I4OA 4RFVA 1A7UA 4CQMA 5HCUA 2XUZA 3CYFA 3NBUA 3Q3IA 5FBKA 2VZ8A 3OZFA 3W06A 1F2UA 3UT0A 3MERA 5CVEA 2ZIFA 5BUCA 1ZDMA 2FEXA 5DLEA 3S2YA 4XWGA 4XB1A 1F0PA 3EA5A 3R7BA 4HFMA 2XE6A 1C9JA 3BK1A 3HE3A 1PAUA 5AW8A 2VXYA 3EMDA 2H2AA 3W4KA 3NWEA 5IVPA 3L0ZA 3JZMA 4D0SA 1ISPA 1JSXA 1BWRA 2I0FA 4ZGWA 1A2QA 3DAPA 1I9CA 2ZRGA 4KDRA 4RELA 4X0EA 5FTLA 3BT7A 3AQIA 3SYKA 2JATA 1D6JA 2FWPA 3OC0A 3S44A 5TRTA 2GD1O 2M1ZA 4NKRA 4J94A 3ZDBA 3IJ5A 4Z4IA 3I45A 4V0SA 4FDTA 1F3OA 1B00A 3KT0A 4NK4A 1H0RA 1V1JA 4C78A 1T5DX 2A9PA 3VTKA 2VUSA 1MEEA 4OH7A 3K0SA 1N6NA 3ZG6A 4U7GA 4HCJA 4HTFB 1YS4A 3NRCA 3T12A 4HDRA 1GYRA 2WJYA 3EA4A 2VHXA 5TE9A 2XCRB 3DPIA 1R16A 4GYYA 1AQIA 1DEOA 1QYVA 1CF4A 3ONFA 1TKCA 3K8QA 1KYVA 3BDIA 4JLNA 1IDN1 4KQ2A 5ITSA 5BVGB 2VAVA 5H9VA 2Q7OE 5I7SA 3DZDA 1EG7A 2H06A 3KSDO 3DAOA 3JRNA 3R44A 5CNIA 1P44A 1HK7A 3PZBA 2R3SA 3PUYA 3SHQA 4J1SA 1RPNA 3IT2A 1BG6A 1FMCA 3GA7A 1YF3A 2YX1A 4HNAB 3WSTA 2DXIA 1XRSB 1UCFA 2C7GA 3K9BA 3QPDA 3AVVA 1ILEA 1F0YA 3HDHA 3DV2A 3DMRA 5BUQA 2AZ4A 2QZ4A 3E3AA 2W93A 3LS2A 3NP9A 3PSHA 4H1VA 1HYEA 4TTQA 4AU1A 1V96A 4W5NA 1LF0A 2MOKA 5HF6A 3L6RA 5IZCC 1MX9A 4E5NA 3LYHA 5J2UB 3P2MA 2EGUA 3ZZ0A 3MTQA 2NXEA 1KO7A 1MAVA 1RZRD 4KWCA 1A97A 3F6RA 2H31A 2P9ZA 3ZE9A 1DCKA 2PGIA 3N3AC 2CUZA 3H16A 3IEPA 5BQ5A 1JQDA 5LDHA 1WV1A 2YJ6A 3WHPA 2ACEA 3JVIA 1OU0A 2VNAA 4EG4A 1I2BA 2O57A 1QQBA 5IT5A 3AR9A 4B4OA 3K0CC 3E5NA 3O73A 1VMIA 1OC2A 4IO0A 4JI0B 3E6AA 3EEIA 5D1NA 4M55A 2QGNA 2L18A 4U6NA 3TXXA 5J4LA 2HCBA 2XXAB 3FDZB 4DMCA 1UDCA 2OV1A 3MMZA 2PLAA 2VOJA 2I1LA 2I6QA 4URWR 3FYTA 4U5QA 1DDIA 1FP7A 1X7DA 1LY1A 1ZM9A 4GR5A 4Q9HA 4B2IA 4LWOA 4DNQA 1PHRA 4YWJA 5SZKB 5IULC 3RADC 1HYGA 1MF7A 4D45A 2Q5EA 3EPPA 2W90A 2CK3D 4WACA 3OZGA 5L3RA 4YUZA 3RYCA 1RYEA 3LKVA 3WWZA 3ZKAA 2FN3A 1KARA 1GKUB 5EXDA 3ZQ6A 3QLUA 4BZWA 3QUCA 3LVFO 2XDYA 1SVNA 3PF8A 1BSVA 4RVSA 1C81A 5BR1A 4O2BB 1QF7A 2WAMA 2YZ2A 3DOCA 1XZAA 4I9HA 3NG1A 4NYMQ 2WU1A 4ZCTA 1NNUA 1KI2A 2OV3A 3UAVA 1T2UA 3UENA 2JH8A 2FGKA 3V2UA 3ZWVA 2ADOA 2Q5QA 4ESEA 1KU0A 1TXGA 5DHRA 2O52A 3PJGA 4HHEA 2YW9A 2FPPB 1UADA 4WGFA 1CYEA 5C8XA 1YWGO 1WXHA 1Y3AA 3CW8X 4YP0A 3DJYA 1Y4AE 4AG3A 3Q98A 5A4AA 1NAHA 1DOAA 1QQAA 2PZFA 4C08A 3HXMA 1E5XA 1ZJJA 1KZGB 2B4KA 3FFXA 3OWHA 3X1WA 5EXPA 1FDIA 1LBHA 4K6KA 4AO8A 3B3FA 4ER3A 2AOWA 2JRCA 2GSWA 3NCHA 5LKRA 3FKSD 4KXQA 5CDUA 2QUKA 2JLWA 3C24A 1ZO8A 1IM8A 1RBQA 4BP3A 2W2PA 4G41A 2WSYB 4ZU3A 3VKWA 2NMVA 1YTLA 4WLVA 4WW0A 3A6LA 3MT7A 4X8MA 1G60A 2PKRA 4YO7A 4RM2A 1IN4A 3IMEA 1UPAA 2FFQA 2QN2A 3GG2A 2JI9A 2OAQ1 1SUWA 3V4OA 2XZDA 5HXAA 1FUIA 1LW6E 2VATA 1LRLA 1ZG3A 2RAVA 3IXLA 5DWDA 3MCTA 3F98A 3TOCA 3CF4G 3NC1C 2VJYA 4PGFA 5KNCA 3V7FA 4D9CA 2ASEA 2DBYA 1P7WA 2AB0A 1NQ5A 4GMGA 4J0CA 4QDUA 1UBKS 4QXPA 2BONA 4BAUA 4BXOB 2IYZA 2QTLA 1YR2A 3ESRA 1EQ2A 4NS4A 3TSZA 3BK7A 3GP5A 4X6LA 5JNRA 3IVMA 5TQ0A 4PFJA 3CRNA 1C9EA 2YXDA 4FWIB 4EW3A 1Y0BA 2QYTA 1B93A 2DWQA 2HWYA 3WK6A 4PLPA 4LWZA 3V8NA 2J9GA 3GFPA 4B3GA 3IDFA 2Z4RA 3I1IA 3D6FA 4OP1A 4IW3B 1SXHA 5FBZA 4IV8A 4KVAA 5ECGC 4JVLA 4TYWA 3W2FA 3WGKA 2ID9A 4QDKA 1M2VA 5CFZA 2VT7A 5CAEB 2OZPA 1QM5A 2AUTA 2IPOA 3PB3A 3ZU5A 1PJQA 3DV9A 3HCBA 4H1HA 1JMKC 3CLUC 4KMRA 4KOAA 4CLOA 1E63A 5EIEA 1BKSB 3HEMA 4TXLA 4YRFA 4WBNA 5LP1A 1EHCA 8MHTA 3UJNA 4DPMA 4Z9FA 4KPGA 3HS3A 3KJQA 3OTWA 5BSHA 4DIKA 1R00A 2YS7A 1Q12A 1XEWY 1YQUA 4UUNA 3SHFA 1T2FA 1Z2DA 1TO6A 5U4QA 1UMDA 3A9WA 1R5BA 1RNLA 3AOEA 5KJ6A 4X65B 1Y6RA 5JZOA 1TU4A 2X7XA 4AG6A 4HMQA 1QE5A 4V03A 4NIMA 1YI1A 1CDEA 2VTVA 5IBRA 3OH8A 3AL3A 1PCXA 4FFMA 1FTGA 1XZIA 4U9HS 4US2R 3OMLA 1Q84A 1AS0A 5F12A 3WHIA 2VA8A 2B8JA 2JS7A 4IYRA 1J24A 1V48A 3ZXYA 2LWIA 4L50A 2HDWA 3PEUA 3M33A 3O4HA 3CZ9A 3O74A 5AVWA 1SVLA 4JBWA 4MZXA 3A2LA 3ZD6A 2BAGA 1Z4IA 4Y1RA 3PDIA 4IIJF 5FUXA 3N2NA 2WIFA 1EXMA 2ZWAA 3RR2A 2X7HA 3C8DA 4BFLA 3OLWA 4J4TA 5EMHA 3CR7A 3EVDA 4PFSA 5LVAA 1N77A 4FNOA 1GCOA 1W93A 3OQIA 5KSWB 4L5YA 3BF8A 4FYKA 4R7ZA 4CHGA 2XWJI 4IR7A 1ZK2A 1BXRB 3VZPA 4C14A 4K9KA 4UVHA 3W9UA 2Q6VA 1QRTA 1EUDB 5B1IA 5TQ2B 1WSAA 1JIKA 4Q34A 4W5OA 2R8ZA 2WVHA 1E1YA 3FBTA 3VPAA 4PRLA 2A6PA 3MWYW 4U2KA 3KR2A 3V4RA 4XUEA 4QXQA 4DMUB 1Z15A 1QO0A 2G9UA 3PFCA 1D0SA 2BFBB 4R5MA 3HABA 3BTVA 1L7VC 1JQJC 1KE2A 2BISA 4HQOA 2GETA 1Q77A 4JP8A 1GSIA 1ORDA 4TLAA 3ONWA 4LVUA 1MOQA 4CEJB 1P0PA 2YHIB 1H4SA 3ASYA 4MA0A 2XRYA 3TLGA 2KBEA 3RYFA 3GPIA 1EX9A 1GCAA 1DWPA 5L6MB 3ZWWA 4MUEA 2A30A 4PHGA 1KNQA 1PR0A 1XJ5A 2PY6A 3IL2A 3R6TA 2J4DA 2ZPUA 1GKIA 2J3HA 4W5QA 3Q10A 1N3LA 4CTMA 2DFVA 3ZCVA 2GYVA 2JAQA 1JFSA 4BX9A 5BWLA 1RYBA 4RGVA 4YRDA 5DNEA 5DM1A 3F3SA 4CIAA 1MRSA 1G5IA 2NGRA 3KYJB 2LCFA 4URXR 1QUEA 2MU1A 1OILA 3L8MA 3L0PA 2YQZA 5HKKA 5IT9A 1TMKA 5E1OA 2C7VA 4L85A 3GFSA 3RGGA 3DR3A 2BDTA 3MMXA 4GC9A 4IDEA 4POOA 1P80A 2QJTA 4B7UA 3HJGA 2KPOA 5F9MA 4MWCA 2I34A 1P5ZB 1TUGA 4MYRA 1CTQA 2XXBA 4BX0A 2V54A 3RM3A 2G0TA 5FTWA 3U09A 1W87A 3FDFA 2IHKA 4KQ6A 4FS8A 1TQHA 5J43A 4XM2A 2DBRA 1MAUA 3MWKA 2W6PA 3O0DA 1JHXA 5ALGA 4Q01A 1JDJA 1RW4A 3UOGA 1SCBA 3VNUA 1J06A 1CUEA 3CLUD 4MKGA 3TZKA 1ZIXA 3DBHA 3ZU4A 3HHPA 3CRVA 4Y0NA 4ZOBA 4LC0A 5FLXA 2WWRA 1BCSB 1ENOA 2XH8A 1C9DB 3UWOA 5IXJA 2H1CA 1E1RA 2NTVA 4I5FA 4W6ZA 1ULHA 2NZWA 1VCMA 4PLCA 1LRKA 1MO3A 1NVVR 3CZRA 5H3HA 1QGDA 3RVMA 5KAPA 4IQFA 1KKMA 2OO5A 2H4FA 5AW5A 1S4QA 3AERB 2CMKA 2UYHA 4KH1A 3G0CA 4P0PB 4M60A 2BFDB 4X24A 3ZHSA 3ICEA 1RYFA 1QYCA 5BURA 1O97D 2W6JD 3X44A 2BF7A 2PAFA 2G71A 3NP7A 1B3BA 1S4MA 3RD5A 4J0DA 1I6MA 1IBCA 1SQSA 3NBMA 5DHUA 2ZRPA 3I6QA 3CWCA 4R71A 1GTVA 2ST1A 4XRRA 1R8JA 2KX7A 3KKOA 1FDUA 3NEYA 4WOBA 1NMQA 4LJ7A 1NV8A 4PF1A 1PN3A 1VMKA 1ULZA 4J49A 3LIPA 2PVSA 3CKYA 3ZTTA 4B2YA 3WIUA 2A9JA 3W6PA 3OZVA 4X71A 1ZD8A 1ZD4A 3BG5A 3GEGA 4G5FA 3EVNA 3O82A 4DHEA 4ZI7F 5BXYA 4ZAFA 3L0DA 4UBKA 1J97A 4DV1B 1TVCA 1KJIA 1PR5A 3GZTB 2CD9A 2DE0X 3K09C 3O4IA 2QMQA 3TLMA 3WQHA 4AJ2A 5C1DA 2AQIA 5JWHA 3ZCSA 1H9BA 3SR0A 5IWCA 1D03A 3IA7A 3WYBA 4KUGA 1Z0IA 1R0SA 5IJAA 2ZKIA 1XBTA 4TSRA 1J0AA 3MOIA 5TXGA 3DBVO 1KO4A 4PN7A 4GEGA 4OK6A 1U0EA 3GCZA 2QTRA 5TF4A 4BWFB 3IUJA 2CFSA 3TIFA 1AV6A 3Q7IA 5AI5A 1STOA 3C4JA 2CT8A 3PJFA 3VHXA 4ZPJA 1OVMA 1X0VA 3GRFA 3C48A 5LM3A 1C1HA 2W22A 3HQ4O 2ZRAA 3KKNA 3RDPA 4ED9A 4FILA 1VLJA 3JY6A 4I46A 3HTXA 2BVNA 2BHLA 3WLFA 5TARA 4ENRA 4ZHSA 5IDQA 2O8FA 1U0RA 2FSIA 3ZY3A 4C21A 2GPTA 1JKXA 3PHGA 4OEHA 1PJBA 4XQ9A 1PJLA 2C2YA 3OF2A 2F17A 4F46A 2VQSA 1EDZA 5DN9A 3FCUB 6REQB 2XBLA 4O4LF 4ALNA 3GNTA 1I6WA 3UCEA 1HOXA 3A06A 3AJEA 4ZXFA 2XKKA 3M8KA 3ZY4A 3H5RA 1Z22A 3KTOA 3LQQA 4O4IB 2JAPA 2JI6A 1L6RA 5D6OA 3V8MA 4EJSA 5HRUA 1TM7E 1E0SA 1EE9A 4W5TA 1KF0A 4X91A 3P9ZA 1GZVA 3WZLA 1D1SA 2FUNB 4KQ9A 2FV8A 4D79A 1YRWA 4YQEA 5CYGA 3ADDA 4PIPA 4WPGA 4LI3X 2QTVB 1JI3A 2B99A 5B7NA 1ES9A 1TTQB 5KWEA 3D43A 1R0KA 1N2IA 4C0WA 3FLEA 3ZWQA 3KE8A 1R9GA 3O1HB 5D6NA 3U48A 1O8CA 2WJAA 3AJ8A 3BJZA 4XIGS 5FLYA 3ZXXA 2WOOA 1NJSA 5K8LA 4B3MB 5FOWA 1JJVA 1YGPA 2OG2A 1ZOOA 2Z2KA 5HKBA 2BMEA 3MCUA 4XDGA 2PLWA 5F4BA 3P9IA 1Z5UA 4HNSA 5K3SA 4PZEA 3GRAA 3NASA 3U44B 3GXOA 2R00A 1GXSA 3N5KA 2L42A 4CLXA 2R4TA 4L16A 4O0LA 4LJSA 3L4JA 3ETNA 1X15A 1S02A 1C1XB 2Z5GA 3ADPA 2YN4A 4GRIA 5KKAA 3AKZA 1DIHA 2XZPA 3D7RA 4L0DA 2UU9B 1SCAA 3CVYA 4KG7A 1F60A 1M2EA 4WKGA 4JEUA 3MUFA 5A3SA 5CR9A 4LE0A 3LWZA 2ZJ8A 3NJ4A 3H05A 2DQYA 1OTXA 4NZMA 4X20B 2P79A 3HBLA 5DK4A 4XJTA 3HY3A 4PX3A 5AMXA 5EA2A 1LTKA 2PKCA 2BBWA 3C3MA 2FR0A 4EJ2A 1C1YA 3F78A 4FNAA 1M6WA 2VEOA 1UDXA 3IB3A 3NORA 4PQEA 3X1DA 2Q1XA 2XV1A 2DGDA 2QPTA 3QIVA 5KS2A 3RF6A 1THTA 2QT0A 4ARAA 3K53A 1B6RA 5ALXA 1NBMD 4BUJA 1X7XA 2M6RA 1UBEA 2XUDA 2C04A 3NIWA 4RKEA 3E9RA 4M9UA 2XA1A 4PN3A 4DA0A 1XJ0A 2V96A 2E1RA 5ARDA 5IWAB 2H9IA 1D2RA 3FKQA 2ZSHA 1RDFA 3UMSA 1TA0A 3PXDA 2W71A 3UJHA 4ZI3A 4ZV4A 3INNA 4TLEA 4FJ1A 1BCRA 1GQSA 2I6UA 1R12A 4P8RA 4RSRA 4PC7A 1DEHA 1A4XA 1VMAA 3PGKA 1OBHA 4JU8A 1QCCA 5E1BA 3ZQKA 5BPHA 3CNEA 3GK3A 3LF1A 1N92A 1I4DD 1JBKA 4P4GA 2HMAA 4UVEA 4YRSA 1H23A 1T43A 4BE4A 5A03A 1GQYA 4H9GA 2F3QA 3I61A 1PG2A 2XYQA 3T5CA 2ODAA 4XA8A 3B13B 4XUGB 3AIKA 5LWQA 3V97A 3R5HA 3PHHA 4HPXB 1F5SA 1XK6A 1M1YA 1BEEA 4I5IA 3NOVA 2GRJA 3PD1A 3QI2A 4I1SA 2XT9A 4BNDB 1NJ2A 1BD3A 1II8B 1T36A 1J8FA 1AGRA 4IMJB 3G2NA 3NEJA 3TX6A 1L2TA 3O8QA 2H63A 2PD3A 1H69A 4DLWA 3SEZA 3DKVA 4PHCA 4QX6A 4C43A 2NYRA 2AL7A 5G0WA 1QFXA 5I5GA 4W9NC 5C7IO 4TMZA 2QR2A 4CKCB 2P9EA 4FGUA 2QM0A 3K1ZA 1NYLA 2BZ0A 2JJQA 1L5VA 4UNRA 3HYLA 3JQ9A 3QXCA 3NYIA 4ENWA 5IDWA 4EMUA 1TZKA 3NO4A 3D4LA 7MHTA 5AVOA 2H4WA 2CL5A 4PRKA 1WZCA 3AM3A 2XPCA 3V1YA 3T5PA 4UUBA 3EOBI 3RJ5A 4FX2A 3PCXA 2DG2A 5LYJB 2G6TA 2G80A 2HO4A 2IEGA 2ZI9A 4G37A 4C0JA 1CUWA 3HWX1 2BKUA 4QOIA 2JAOA 4FLMA 4LTMA 4CEIB 3OCYA 2FVXA 1EFKA 1JNYA 3UJ6A 2JLXA 1ESZA 2R1ZA 4HNHA 2IBMA 2EFCB 4CBVA 4V39A 3HRIA 3T5TA 2FW9A 4HDSB 5CDYA 2GCPA 3LSTA 3D1JA 2GBLC 1SKAA 2KHZA 2WFLA 1WXWA 3MG9A 2Q4RA 2FFHA 2G76A 3UFXB 1U81A 3GIDA 2X5NA 1M75A 3OTGA 2Q5FA 5DLPA 4CKYA 3C8UA 4JXJA 4MW4A 2A2ZA 2REXB 4KIWA 3LNCA 4V0ME 3DDHA 1UKEA 3TCXB 4LNHA 3GJ8A 2H11A 1M2VB 3K09A 1Y4ZA 1E2GA 1N2GA 4B6QA 1ZH8A 1M8GA 2FLKA 3M6FA 4I19A 3HL0A 3F67A 1QP0A 2YZGA 1F8YA 4HDNA 1FUKA 1MZVA 4KRYA 4HAVA 5EJIA 2DU8A 1GYPA 1FDTA 4A8HA 4BVLA 1YA8A 2HU5A 4PX9A 5JQGF 2O5RA 1F3LA 4NFSA 2ZYVX 4WZBB 4QUAA 1Z2EA 2G1KA 1NT2A 1MA0A 4LQCA 2HUNA 4PXYA 4GOOD 4X1YB 5DLYA 4G1UC 4OOEA 3W7BA 1N2HA 2PGLA 4CM3A 5H4HA 3BXFA 3K72B 2JLZA 3CUVA 3KDSE 3BDAA 3QHQA 5AOBA 4P7BA 2VZEA 4CODB 2O8DA 2AFRA 4MOWA 4EYSA 1GRRA 1Y4SA 3OP1A 2C9ZA 2HHLA 1PEDA 2FSVC 4R98A 1BVYF 5DF1A 4C7JA 2HW8A 1MIOA 3L46A 1OV6A 1RQNA 1EK6A 2C83A 1E18A 2PN1A 2VQ6A 4ZTBA 1V6SA 1XF1A 1BAPA 3S0JA 1NW8A 1W4CA 3STYA 4JUCA 4F2DA 5HP4A 2XMSA 3GNSA 2HNAA 2BFFA 5K3FA 4JJAA 4EPWA 1KMIY 3OZEA 2A5JA 4E4YA 2CVFA 1PSWA 3T0FA 1M67A 221PA 3GGGA 1RHMA 2FUG6 2QF7A 1TF2A 2VK1A 5HSGA 3N74A 3ORFA 1E0KA 4KAAA 4YAFA 1Z06A 5AJTA 3IMCA 1GFWA 4HAIA 4FNMA 1SVOA 4ZKEA 2GD0A 4I1YA 1ZEMA 5G02A 3T3DA 2PZ8A 4Y8VA 4J8PA 4YGXB 3EXHC 2QTMA 5BV1A 2CMGA 4DARA 2BKXA 4MR7A 4QBGB 1DQYA 1Z4PX 3AEYA 2W6QA 4YRRA 3K0CA 3UWDA 2Y1EA 4QYMA 4YNBA 5EMNA 2OBYA 1QJCA 2P35A 1RM4A 1RR6A 3ELUA 1IOZA 3IUQA 4L8VA 4F3YA 2WLTA 4QEDA 2QRUA 2PSDA 4P7KA 4DE5A 2PD6A 1RWWA 3WKDA 1YD7A 2XQKA 3OPQA 4LF6B 5FNVA 4LZJA 4AF7A 1NI4B 3MSCA 4GSLA 4Q4AA 3T3OA 3GNQA 2BRUC 1IHDA 1YRBA 2JEYA 3GQBB 4G97A 4K9SA 2IU0A 3TQSA 3UT5B 3IP3A 1QFZA 4C9BA 4F38A 2V0NA 3IP7A 3EQ9A 2B1QA 4DILA 4EL5A 1G64A 3P2JA 3TDKA 4Z4HA 2E1PA 4S05A 1MJHA 2Y77A 1GLNA 1C4WA 1JP7A 4ZA2A 1JPNA 1T4CA 3C0KA 1X7ZB 5ER9A 1GGJA 1O6CA 1SIUA 1FP1D 5BO5A 4EG5A 1MTOA 1RJDA 2IEZA 4FZ5A 1P7ZA 1G7SA 1I3MA 1QG2A 2BH9A 2ZIGA 3IESA 3L01A 2B8WA 5AKLA 2IEBA 1KQGA 4YV7A 1XDGA 2CK3A 1U3CA 2OHVA 2BEVB 3VPHA 4WCVA 1PNTA 4AMYA 5EJ6A 2TMGA 2V7EA 3R6DA 2O3JA 3DZKA 1DX6A 3QYAA 3NAZA 2D1SA 4JI6B 4R2WA 1IHXA 2FJUA 1A77A 1GADO 2OKGA 3FBWA 3DL7A 3OQ1A 4LBZA 3ZEAA 5INTA 2R1TB 1HX7A 3UK0A 1SO8A 3GGPA 3KOZA 3VPCA 3CN7A 5KSOA 2GFHA 2C4KA 2ZAMA 4PTYA 3V7WA 4E5VA 2C5SA 1RAIA 5BYKA 2EIHA 3AGQA 3GZJA 5ILGA 3VH3A 3IE0A 2ZVPX 1DZIA 4OY3A 4TTAA 1P31A 1I0IA 5FA6A 2BFFB 4ACAA 2NWQA 2Q2WA 2QE7A 3OPYA 1ESNA 1RYZA 3E58A 4OREX 4ZJUA 1GGMA 1QHSA 3PQ6A 5MGBA 1LRJA 6CHYA 4AUKA 1OFTA 4K9PA 2RJ3A 2HZBA 2XB9A 3MWEB 3OJLA 5IM4A 3SNKA 4WNIA 4I1PA 3HCEA 3WDMA 3M1IA 4DPLA 5KOHB 3G2MA 3RVDA 2WTUA 4EVQA 3PNLA 3OEHA 2RONA 3AFOA 5KYYA 3H1BA 3M1AA 5D7BA 1M73E 3BE4A 4X6UA 3ZHCA 4D42A 3HRKA 3V8BA 1G6HA 1Z6PA 5AK0A 3TB4A 3KALA 1GG9A 2AD1A 1KC3A 4NC9A 1MQSA 4GGMX 4CUJA 2UUAB 1E7MA 2DEUA 1Q3KA 3JAKB 4QBKA 1O96A 2EP8A 3I32A 3R8CA 2V8BA 1TRHA 1C0LA 1EFDN 3S1SA 5C18A 4LSZA 1SXJE 2HA0A 5IP5A 2O2SA 2HU7A 1GPH1 1KZ9A 1Y8QA 2PL1A 2C9OA 1IVNA 1YZYA 3Q5GA 2TRSB 1OXMA 1YB1A 3OX1A 2CXSA 3KQWA 4B17A 3NC4A 3TIGA 5IJZA 4GXTA 4F93B 1UWKA 4JDPA 2PTGA 2Y1KA 5B2FA 1SXJC 1QGZA 1G1AA 1HG1A 2OGSA 2QT9A 3K2BA 3OCZA 4LJ9A 4ZODA 3VR2A 1ZR4A 4LXUA 5AM0A 1AS3A 1CUVA 1YS2X 4YH1A 4ARBA 3AWIA 3M5WA 4KACA 5AM1A 4DLPA 5F23A 3IV6A 3SP1A 1W2GA 3WGIA 4B3TB 4XQEA 3ANXA 3QE9Y 4X93A 3ZDRA 3QZUA 4QYIA 2X58A 2LPMA 4IDFA 3FF1A 4L8FA 4LI0A 1F6BA 3B82A 3IQIX 2PU7A 4RTJA 5DZSA 2J9YB 4FHCA 2QTCA 1I7SB 3PTZA 9LDTA 3LC7O 3L1KA 1TM4E 3SSMA 1IQPA 1A2BA 1QGAA 5DYGA 4HVTA 1R88A 5TJHA 1KMQA 2FW6A 3A6HA 1FSFA 1XCJA 5KO2A 4EHBA 5A62A 1VMEA 3RC1A 1X7YB 2O2EA 4A6EA 3BXEA 1E6LA 1ZNQO 4GOND 3R9IA 3HUTA 3G17A 3JQ9C 4NP6A 3UGKA 1AQNA 3OT1A 4G4SO 4IDNA 1VLQA 1Y33E 2QENA 1VRCA 3IIEA 4CT5A 4N3AA 5IUJC 1YR3A 1NC1A 4IWYA 4P31A 5EZYB 3GD7A 3FUTA 4LHYA 1BWPA 2CFCA 1E2LA 1UQUA 3ZD9A 3PEYA 4RZIA 3GLQA 5NULA 3CX8A 3G2LA 4AICA 2BI8A 3LUFA 5EQTA 5J59A 1KJJA 1O4WA 1PGOA 2OM6A 4Q3LA 4UHKA 2G5PA 2OB2A 2VJNA 3OZBA 5JU6A 5F9HA 5E6RB 3IAXA 2Q8QA 1AXGA 4PNZA 3P52A 1M1XB 1LBSA 1Z82A 4M8LA 4XYBA 4N76A 3Q3EA 4CKBB 4EA6A 2AOTB 2QZ9A 1P6QA 1L5SA 2DC1A 3FOWA 3WVNA 5JXGA 2R68A 5AKEA 1RRVA 2JI7A 4BNIA 1D1PA 2PLNA 3I1YA 1RLUA 4TUYA 1ISRA 4DC0A 1Y6GA 3OKAA 1GNSA 2AVDA 2CXNA 1XVAA 2P9BA 3P0JA 4ZCSA 2DCMA 1Y34E 2B25A 2CEKA 4MLCA 4XVUA 3RFXA 3IV9A 4ARZB 3C4QA 3GJTA 4COKA 3OUZA 3IIKA 2FSPA 3N07A 4TYMA 5LQAA 3U5ZB 4AIRA 2QI9C 1ZRSA 2Q99A 2B5OA 5J9FA 5B64A 1XCOA 4TMTA 2K5UA 2IIVA 2ZYRA 4EAQA 5AUNB 1YZKA 4RD3A 3LA8A 3OM9A 2YZNA 2PMEA 2WA2A 4PTLA 1BCRB 2AJTA 1JHYA 4YDSA 2GNPA 2VP0A 4R51A 3RODA 1XZHA 3M34A 4HC4A 3GEIA 1DBIA 4HB4A 4PS0A 3MXOA 3A6KA 1EJ0A 3H8VA 1IFXA 4L28A 5I8ZA 1V37A 3GDWA 3FZNA 4CKEB 2DQKA 3ZLTA 3GLSA 3KOMA 1KEEA 1T9GR 5CRIA 4JGGA 1DAFA 1Q57A 3QX8A 3UPUA 1TK2A 4U8HA 2V8OA 3C7KA 4CUZA 3L06A 3GDFA 5JOQA 5EZYA 4N0DA 1IE3A 1X1QA 2PX4A 4QOHA 2R85A 1UOOA 3RBXA 1F9AA 1YB2A 1B0PA 1SA0B 4FOSA 2DFLA 3IBTA 2V58A 4MMYB 4R54A 4YMGA 1OA1A 2GTPA 3NETA 4EGSA 5HPYB 1LLQA 3VXKA 4BN5A 2V6JA 4CMIB 5K5EA 2OD7A 2QW1A 2FMUA 5JFOA 5JAOA 3LSYA 1TF7A 4IQ8A 1XJCA 2BTOA 2Y4OA 5EZQA 3FPLA 5CXUA 4GI3A 4OHRA 1RMQA 3OQ6A 1L4FA 1TEXA 2LZ0A 2WR8A 1SVSA 3AVOA 3BA1A 1SHZA 3EQZA 3GN1A 3BGIA 4JJKA 5D8DA 4KN6A 1KR2A 3AF6A 1HF3A 4H0NA 5DYTA 3G9QA 4DIFA 4DA4A 1XEWX 3H9EO 4BVJA 4DDTA 3U19A 2CLCX 2IDMA 1TO1E 3HKDB 4B7CA 2FOIA 2CXPA 1A5AB 5JS2A 3MJSA 1SRRA 3B6ZA 4MUFA 2QL6A 4RPGA 2ZI3A 5AP9A 3VBEA 3WL7A 4Q9IA 4DCPA 1P5HA 2A7XA 4OM7A 2ZRFA 1JEQA 1CY7A 4F04A 1FMFA 3DHVA 5CLFA 1P0FA 3EXFB 1SCIA 1X87A 2JIRA 4HDSA 1I32A 4YMVA 3H11B 3QHPA 5E8RA 5B12A 3RTCA 4GYJA 5IN4A 3UMVA 2OWEA 3IHWA 4M4SA 1AF4A 5AW2A 4R1TA 1XLWA 1Z4LA 1QH0A 5I47A 3M4NA 1WKCA 2VUTA 4LZWA 2QQEA 2EEZA 1XZPA 3O3NB 1MC1A 1KIFA 2OCAA 3CNLA 4KQ1A 4JCOA 1WW2A 2CL7X 1JVSA 4QTYA 2XCTB 1NT4A 2HI0A 3ZQJA 3TYXA 2BMJA 1PDOA 4UEQA 2BWJA 1IN6A 1C1DB 2WDPA 3CURA 1Q1AA 1G4UR 3T7KA 4BGVA 2AC2A 3K1TA 4UMDA 4BIMA 1US8B 1I2MA 2QG9A 2GF0A 3OHPA 4KVZA 2GGSA 2CFTA 5CJ2A 1GDDA 4G67A 4EGQA 5C80A 1U2PA 4ZOLF 4CKCA 3GI1A 4ZDWA 5JARA 1NRJB 4KIGA 2QVXX 1J7JA 3ENNA 1OV4A 3ZQUA 3ZWYA 4GR4A 2WWYA 5FJIA 2R6JA 1PZEA 1XPOA 1QF6A 1LLUA 4JBXA 2ZE5A 4GAEA 4TKVB 1U28C 3MWEA 3HZZA 3WX0A 5LPNA 3R9XB 4TXMA 2ONJA 4PLYA 1R7RA 2ONZA 4C6TB 2H2IA 1C7JA 3CE9A 4FM9A 4FMBB 4ISBA 2FPXA 3V32A 3CSDA 4UU8A 4LNUA 3L6BA 5TQ0B 2GZ3A 1SKMA 5KX5B 1WMAA 1TYBE 1R4MA 3GA5A 1P75A 2CXHA 3RAFC 2O1WA 4IJKA 1UC4B 4XH9B 1WTAA 3TEMA 2QUJA 2ZG6A 3MJHA 3PDJA 5JJ5A 2EKQA 2FUCA 3ETHA 2OYRA 3BQMB 2BCGY 3JTEA 1ZHOA 4UPVA 5AK3A 4LYAA 4TTSA 1TAUA 1KY2A 3LQ2A 3NHRA 1YI0A 3LDGA 3TQHA 3H9BA 3P45A 3W04A 2X1VA 5CG1A 5FWDA 3JQDA 2PSFA 2TSYB 4E5YA 4E5SA 1LTHR 1WTCA 4G8DA 4ROTA 4B6FA 3D6UA 3P2OA 4KYUA 1EXWA 1T1IA 3H6GA 1XTPA 4ZAGA 3TRFA 1S2DA 5DLQC 3U80A 3WGLA 2O8BA 4EHAA 2QSYA 2F7SA 3P2IA 4FBLA 4MR9A 1TAQA 4XGKA 5JY6A 3C16C 4D98A 2EX4A 2R1VA 3GBPA 4CM5A 3QYJA 1B14A 4F72A 3EIEA 5EESA 1HE8B 1F2TA 3WYFA 1VA5A 1BZYA 3HG7A 2OHIA 1B4DA 2D06A 2XWSA 3PCTA 1DPFA 5I9IA 7AT1A 3WKEA 5CT9A 5E4TA 3U3DA 2NXWA 5A05A 4F56A 3J81A 2ISQA 4NMLA 1ZRHA 4BQOA 2X9QA 5FI0B 2VBGA 7GPBA 3RG8A 3FPEA 1SU8A 2HBRA 3QSYA 3RO7A 3LX5A 4FDAA 4C0KA 3K9LA 4GSYA 4YVFA 2OGUA 1U9YA 5BNIA 2AUMA 2X77A 1KSGA 1EESA 2RAUA 1XA4A 2GO1A 3IAUA 2FP3A 4WZBE 4DIDA 1NNEA 1P1BA 4DLAA 2J31A 3UJ9A 4BBZA 2QX9A 1C3EA 2V7PA 3ECCA 4JKYA 1B0AA 4EA7A 1CDZA 3OF5A 1NHWA 4GRAA 4NULA 2WNHA 3JWEA 3UJAA 2F8SA 2P1ZA 2R1VB 4DDVA 5LMZA 4P86A 3GAAA 5HMLA 2J7PA 4GSKA 4NCXA 3QOYA 5EINA 3OSUA 4J16C 5JYBA 2OO3A 4MPPA 4KQKA 4WFIA 4YT4A 3HR8A 3A25A 2AFHA 3PC3A 5E0KB 1YAJA 3GMSA 3H65A 4D7AA 2J0VA 4BO1A 1QP4A 1AGXA 2FPOA 3BMCB 1JFRA 4K1XA 1RI1A 1QG4A 4WFKA 5GZ6A 3RSSA 3P1JA 2QRGA 3OE5A 2W9XA 4ACBA 1I80A 1N2BA 3P2EA 4B6EA 2QVGA 2XF2A 2X9LA 4HEHA 4DSNA 2EIXA 3H0CA 2X0DA 1PQPA 2ZBRA 1XZBA 2EDCA 3D8RA 2ARKA 4GPEA 3MS2A 1I4WA 4MQUA 1DJQA 2YNMD 3D6AA 4H7DA 4TT3D 5JTUA 1RXCA 2XGJA 3UJ7A 4CMAA 1P19A 3UMBA 4BFSA 4ZEMA 2WWVD 2GESA 3BRQA 4ZQEA 3SAJA 1Q3TA 1HZZC 4MVXA 2F3SA 5JSHA 4KGVA 4OFZA 5JC1A 5EZ5A 2BSQA 3VH4A 2ODPA 4Q4JA 4LXYA 1SBHA 3PEVA 4D99A 3N2GA 2QS9A 1JWLA 1IH8A 3ROXA 1NYRA 2FX3A 3CMMA 4O4IF 4WZAB 5EP2A 3T06B 1JHAA 3TNYA 3P9NA 1CF9A 3C6QA 2PX6A 4OSPA 1BXZA 2FZGA 5M3BA 3KZMA 4ZVSA 3BORA 5I7OA 1VLHA 1WW8A 2IYYA 3I5XA 3MJEA 1Y9ZA 4BVGA 1MVLA 3CGGA 3KSZO 3KR9A 4DJEC 2A0YA 4X1YA 1E6WA 1Z4NA 2Q4TA 4EHHA 1JLLA 1FMJA 1N9GB 3L18A 4N9QA 3ZWDA 3L2OB 1C7EA 3RROA 1BVRA 3HEBA 1ODTC 3GJ5A 1MX5A 1ZUHA 1NQUA 4OQPA 1N2CE 4YDRA 2X2PA 3ESQA 4LRSB 4ZVRA 3K9WA 5CEEA 3GLRA 3MJ4A 3TPZA 4PO8A 4FNGA 2ZBQA 3R6WA 3L0CA 1PT5A 2JHAA 2BMWA 1N0UA 5T4EA 2B7BA 2HCFA 2GN2A 1IN5A 4G0YA 2ORVA 4GW3A 4HDRB 5K0NA 5AUOB 2W6ID 2Z2ZA 4A36A 3BCSA 3CUKA 2CL0X 2GEFA 3NHZA 4HBGA 1MAWA 3UIEA 4UHBA 1IQUA 4DXDA 4LEIA 4F91B 5F5NA 2GZDA 2XUKA 3FBGA 4KQGA 1XDUA 2IPLA 3CUWA 1JIJA 4CDNA 3NWBA 1XMSA 1AF7A 2XMQA 4RTPA 4D9IA 1HORA 3EODA 3K35A 3RIMA 4XPIA 1MO2A 1Z6XA 1NXXA 5CPFA 1DUIA 3H5IA 1JSCA 3QVSA 4BLWA 1L1EA 1P8AA 3NKVA 1S01A 4L8WB 4X1OA 3SHVA 4Y6GB 3HDTA 2GXSA 4MTCA 2MCFA 3M3DA 2CEAA 2R84A 2C00A 1TVEA 1KOLA 3CO0S 2CYCA 1O96B 2IE8A 3KM0A 5K3BA 4M1YA 3ZCTA 4C05A 3N6RA 3GEBA 3FYDA 3EYAA 1TECE 4TL6A 1UZAA 3TNJA 5ICEA 1QH1A 2PZGA 1R9JA 1ZN9A 3JWJA 3ONNA 4X61A 1B76A 1M7BA 3EFOB 3MCVA 3E70C 2HSDA 3NIDB 3QMPA 4M87A 4WJLA 3MWGA 5BNZA 1FBTA 3GIWA 3FMIA 3ZYZA 4N47A 3L8CA 3IELA 1VKZA 1BDHA 4Z8YA 3R23A 3PK0A 4JWTA 1X0XA 2IF2A 3GJ4A 4R31A 2WTNA 3LYLA 2HA7A 4IFIA 2CMFA 3WR5A 1D2EA 5H0IA 3B52X 4NATA 4JT8A 1TM2A 4MW1A 4PV7A 2O7NA 3MMPA 3AR6A 1RIFA 1ZNXA 3I64A 4YJ2F 5PNTA 1YCFA 3U6BA 2GK3A 3P97A 2JVJA 2X13A 4AY5A 5HQJA 4Z53A 3D4OA 2R8RA 3MOGA 3N70A 1WF3A 1T36B 1MHTA 4L7QA 2WC1A 1XRPA 2AN1A 3PITA 4AJNA 3VOBA 4RWZA 3ZI4A 5K05A 4CV2A 1K4YA 1O54A 1IBMB 4E4TA 1NWHA 4YJ2A 3O8OB 1VE6A 1OYWA 1Z5VA 4TVSA 3CW2A 1YKSA 3WV5A 1RC1A 1BHJA 1CUYA 4B0PA 2VTBB 4UCXA 1TFUA 4RA9A 4BC0A 3KDAA 3ZDCA 3NGLA 1ZMTA 3D5TA 2DB3A 4KN5A 1ETUA 3BJRA 5EYPA 3UB3A 1RAEA 1P9WA 2RMKA 4YMSA 4B32A 4ZYWA 3IILA 1UUFA 2UXCB 2XCOA 3AL2A 5JAMA 4RE5A 4WNAA 4BAZA 2Y0CA 2ABWA 5KIAA 2Y1DA 2ZYHA 3SC2B 1VP3A 1P7YA 3ZW9A 2GT1A 4Y2HA 1QFSA 1DTEA 4YHBA 2XB8A 2FEOA 3GDOA 4BMXA 1O2DA 3IDSA 5EN4A 4BQIA 1OZ0A 4EJSC 1Z8DA 2MWMA 2XUAA 3ITNA 3SDBA 1LNZA 3JZAA 1YFKA 3K70B 1ZICA 4F4UA 2JIZA 1GGFA 1XAIA 3DVRX 3ROGA 3VR4D 1FQJA 2EKBA 3BE5A 4HDCA 3WE7A 4YCMA 2X2FA 3LZDA 4N65A 4ETWA 1LK5A 2REQA 2V5AA 3DVAA 3KP1A 4WI1A 1PUJA 5FB3A 2QRVB 3CLKA 3QY0A 1Q14A 3KZOA 5IAJA 4XSHA 4FFDA 4S1PA 4DAOA 1A95A 1CUSA 1L4YA 5EYPB 4BB6A 1B16A 3MIIA 1OFUX 3HDGA 4OJNA 5K8UA 2A9KA 3RV4A 3GVCA 4ENQA 1XEXA 3G8CA 1N25A 4OQEA 2E37A 4DKXA 3T1OA 1F20A 4X20A 3I9LA 1E4VA 2UVPB 4HFJA 4HN2A 3JQ8B 3LA6A 3O8OA 4AYXA 4Z1OA 1AS2A 5ADUS 3WYNA 5BYBA 3DQPA 4NE7A 4NABA 4DNOA 4M7RA 4Z51A 5M7EA 2I7DA 3IKTA 3KQPA 1RAGA 1L7NA 2H0QA 2XADA 3TLKA 1HETA 1XRQA 3AB7A 1K97A 3IURA 4UAGA 3MRSA 3E9MA 1K0FA 4RQUA 3SC6A 2P9QA 4AMVA 4KZKA 3NM6B 5I4IA 2ZR8A 4UFOA 2ZPAA 4J07A 4REQB 2WZDA 2BGGA 1FTSA 4Q7EA 1PR1A 1KI4A 2QY6A 3MNFA 4AYWA 1R6AA 1EQAA 5HM8A 5HX7A 1J00A 4CR8A 1YS1X 1J8DA 2O8DB 1P2FA 4K2HA 2HF2A 3NPAA 3UGJA 4M7OA 2LKCA 2BGUA 2I4IA 3KQHA 3CJQA 4RHXA 3PFNA 1OU4A 1NMSA 5ALLA 3W3AH 4AX8A 4HNVA 1V5EA 1L5HB 1YFJA 5L40A 4YJFB 2OD2A 3KEOA 2GHTA 4C7KA 1IG0A 1IEQA 3H5OA 3R3SA 4N82A 5EZ6B 1JQKA 1DINA 1W581 3FFAA 4ZOCA 1J39A 4WH0A 2CLFB 1AVTA 3UJCA 1H2YA 1PYGA 1H2RS 3NRBA 1AURA 1C2YA 1H22A 1TPYA 2PZLA 4I8DA 2YHAA 4OHBA 3IRVA 2GARA 3H3JA 4MV6A 2PIDA 4RULA 1G20B 1OBCA 4QU8A 3C15C 1W6RA 3KEMA 1SQ0A 4LNUB 4IJMA 3AUUA 2X4LA 3I6IA 1D6MA 2JCBA 1VYTA 1PG5A 1JBQA 4RQBA 1XMOB 3K4QA 4YJ3A 3QYPA 5BUZA 5IDVA 1WWKA 4QEZA 5EWJA 4HWPA 3O21A 3GCXA 4LRWA 4O63O 4C6TA 4PX5A 4CGYA 2HA2A 2R5WA 3QXJA 4MRSA 1PFQA 2DY0A 4JNKA 1KYYA 3QF4B 1J49A 5FWAA 2QSZA 1VECA 4C3VA 4TKVA 4EOGA 1RYDA 5C5IA 4QD3A 1XAJA 1RXEA 2NW6A 3EUFA 4J0GA 4MMZB 4Q21A 1U65A 1HTWA 3FN4A 2IXAA 3R7AA 1UT8A 1UXKA 3WO0A 2GAAA 2O7VA 2AUNA 3C1TA 1YZ3A 3G5AA 3WXMA 3ZOZA 5LJIA 1SWVA 1QHNA 5J2TB 1XPRA 4UHJA 4M54A 2ATXA 4HXYA 1L5NA 4J0IA 3VFDA 4MWTA 4CEHB 2WBLC 4GPAA 2E4UA 3C7AA 3HYRA 4HV4A 3JCZA 3V4VB 4BNWA 1O97C 3I73A 5DMHA 3N9IA 3CB2A 3C6BA 1YT5A 2JIDA 2RHJA 1UMCB 4F6CA 4G25A 1V47A 1KYZA 2FDRA 4G9BA 3IEIA 4L51A 1OBOA 1MTZA 3PPYA 1UBFA 1P2VA 1ZLXA 2FWBA 3BMQA 3EASA 4MUHA 1N5JA 3QJGA 1E64A 1B26A 1PT7A 3PYLA 4JJIA 3WICA 4YPOA 9ABPA 3KLNA 4LZOA 4NYMR 1V8BA 2PWBA 2Q3FA 4RCZA 2P75A 2D0IA 1IN7A 4JOSA 4OUDB 4BB9A 1CU1A 3AR5A 5DLDA 4YP6A 2V45A 1D9ZA 2B21A 3BJIC 3G9UA 3GW8A 2QTAA 2M9MA 3WXBA 4QVGA 1J8VA 2CNDA 3GRCA 4X1KB 2VJCA 5BQXA 1P8JA 1YQTA 2HJ9A 3ONVA 2P2ZA 2W5UA 5EAIA 1NI4A 3ECAA 3QG1A 5CA1F 1JFLA 3AP2A 4LISA 2Z9DA 2VP6A 4A5SA 2LV8A 3QI7A 5BV2P 2VWQA 1KK3A 4HS4A 4MB2A 3VYSB 4D97A 2VPXA 2Z95A 1C2TA 3UC9A 4INJA 4C4OA 1Q1NA 1T8PA 2XIJA 3LW8A 1LTQA 1FX0B 2N1BA 4JI2B 3GOQA 4WBSA 2G4CA 5KYYB 2P1DA 2BFAA 3KSAC 3I9NA 4XD7D 3V34A 1ZOIA 3IP1A 2PZEA 3B53X 3MYYA 3VAAA 4CKWA 4P5EA 5K0EA 1DE0A 1E9EA 1KIAA 5EZSA 4FPXA 5FPKA 1JW9B 3COJA 3ILXA 1AT1A 3WWEA 5FO0A 2EHDA 3VU0A 1GPKA 1E6CA 1ISMA 2YWXA 1VG8A 4CPDA 1QP7A 3QU9A 4F7DA 2OOSA 3MGCA 4TTIA 3O90A 4PG8A 3GG9A 3OPYB 2AMVA 1IULA 1P0MA 1Z5OA 4Q93A 4S12A 3HH8A 1W85A 2BE9A 4I1IA 2ZAIA 3GC6A 1ZJ5A 5KCMA 4KI0A 5AIAA 4QVIA 1XROA 3B9PA 1L7AA 3DT9A 4OLJA 4UDOA 5D5HA 9LDBA 3IBYA 2J6CA 5BPFA 2R1TA 2YXLA 1JX6A 1J0CA 4ARUA 2FPLA 2QUIA 2DHDA 2X1MA 1E9BA 4IIFA 1JR3D 1NURA 4FYWA 2DBZA 2YWFA 1DOHA 3ESYA 3WZMA 1XN4A 4DL9A 5GIPE 1YOVA 2RGUA 2C77A 1OYVA 3C5EA 1ACMA 4CV3A 3OQMA 3GMDA 3SC3A 3VHXB 2IJGX 3V2HA 2VS1A 4NOMA 4CM8A 1BHQ1 5JZVA 1SK8A 3RC7A 4RZQA 3TOXA 4BFXA 3UM9A 3UMYA 3QQ5A 2Y68A 4I14A 4Q48A 4DC9A 4DQVA 2XB6A 3K73O 4GLJA 3CG4A 4QDOA 3V48A 1CZRA 1CR0A 1KMHB 1U2RA 3ELYA 4PR0A 5CP8A 1FXUA 4JELA 4AKEA 4TSFD 1DPGA 2AHOA 1L4UA 2VG8A 4ENTA 1GG5A 1LSUA 3DTNA 4L95C 4DB4A 2WWWA 3C3XA 3PT5A 4KYVA 4ZO7A 2XMBA 3S55A 2GN1A 2QAIA 4DQUA 5THXA 4B75A 4D8VA 5CFMA 2JLUA 3U5TA 4G1EB 3NHYA 5CDHA 5IU6A 2GCOB 4CMBA 5KB3A 3UXMA 1NQXA 3FDJA 3A14A 3AUFA 3PXGA 5DX0A 2IYLD 3SPXA 4DQLA 1QBGA 3IQZA 3OKCA 1U7PA 3U4AA 4BZXA 3AHCA 4D9EA 2RGEA 2VT6A 3NDPA 3OT5A 2IY8A 4NHOA 1T6YA 2J6IA 3RTBA 4ATNA 3R0XA 2J3KA 3WRXC 1JF8A 3DHYA 5SYAA 4JQZA 2I4TA 2QVYX 1A2KC 2W0MA 2QM8A 3C7TA 4XB6B 3E81A 3UC5A 1KK0A 4C4XA 1CJVC 3COWA 5LB4A 5K1ZA 5JS8A 1MMFB 3CX7A 4HTAA 4ZVOA 2RCNA 4UM5A 1XOIA 2ZTVA 4MWOA 1YC5A 3FROA 2IYWA 4P3YA 1OLOA 1IMOA 4B4VA 4DRYA 2FK8A 2A57A 2WD8A 3AUAA 4I2VA 1H0HA 3NT5A 2FDXA 1C9MA 3OESA 4YECA 2O7RA 2GEDA 4R84A 5JISA 4JASB 1UJMA 2N75A 2Q29A 2OZKA 3BYZA 4RIFA 5LLDA 1UMDB 1ORRA 2Q9AA 3C1AA 3L05A 2KMLA 3GLTA 2SECE 4I1VA 1Y80A 4MUJA 4JR1A 3RYHA 2WJIA 4Q9LA 2H2WA 2JIMA 3K7EA 1E3SA 1K2WA 3E2PA 5EMLA 4EG8A 3RIYA 2ECQA 5DSTA 5JADA 4KFSA 5ARCA 5DTMA 1RLMA 2D00A 5T8KA 1H3NA 3MTIA 1GA4A 1LJ8A 4K8RB 1NIJA 1P1IA 4R2KA 5CXSA 2QBYA 2VDNB 2ZTUA 5D1HA 1FW8A 2CHVA 2EZ8A 3OG9A 3FJ1A 4MP8A 1B43A 1KEZA 1RABA 2IYNA 2A9VA 3N0WA 3QMWA 2ZFUA 4TGLA 3VYUB 3WNDA 3UGQA 1CK4A 1Y6ZA 1JE1A 5D84A 4MO9A 3LXRA 2WVAA 3E61A 3N8GA 1JQAA 4NECA 5FLEX 3NH6A 4A92A 2MINB 4Q7QA 1EMDA 3EXEA 2PVPA 2G77B 3DB1A 2XODA 3GLVA 3OQJA 3DAGA 3I0MA 1V8FA 5DGTA 5I6DA 3TKYA 4YTEA 3RUIA 1ZMRA 1KI9A 3MMSA 4DRZA 4QT4A 1G8JA 2CUNA 2QTHA 3AR2A 1W4AA 3D54D 1N2CA 1UM8A 2WTAA 3W34A 2NTEA 2QVCA 3G0BA 1ZW1A 5E1MA 5K20A 5KWIA 1XMIA 1TJYA 4KSBA 1I14A 4D4HA 2H00A 4O2AF 1XMJA 2ZETA 4R1PA 1KAQA 1QANA 3LBAA 4ZU1X 1NV9A 3LECA 4BLRA 1CE8A 3FNRA 3HCDA 3I58A 2WW8A 5AM3A 3QENA 1SHUX 1U0SY 2HA4A 4XQGA 2F43B 4ZC8A 3HCPA 3UAOA 4BDSA 1P72A 1QGYA 1OIXA 1RXYA 3D59A 3A27A 4MPJA 4FDUA 4ABYA 1Q16A 2MSEB 1UPXA 3ZBPA 2J3QA 4NBKA 3WK8A 3ZZMA 5DNUA 4QQ8A 4YAIA 1JEAA 1C0PA 1HRDA 3HO8A 3OFJA 3WGQA 1M7HA 3HDYA 3QPWA 3I9OA 4N7MA 4B0OA 5HR5A 1V16A 3QU7A 4MV7A 1L1QA 1AMOA 5T6MA 1QMPA 4ND8B 3LPCA 1V35A 5TJ9A 3LRXA 2R6HA 1VFPA 2QZPA 2JK1A 3G5TA 4NBSA 3ZIDA 1SG9A 1NVKA 3GRPA 2ZUTA 4E31A 4B4KA 3DVAB 3L93A 3Q0IA 3W5SA 3HCCA 2E87A 1CRZA 4ZYLA 5ED4A 1CKEA 1K5HA 3K30A 3ZLUA 4DQDA 1WU8A 2ZBDA 5AJHA 1FLAA 1HE4A 2J0SA 4NY1A 2O2ZA 3QPAA 3J81k 2OQRA 4LX8A 4AKSA 1E3WA 1I01A 3HGTA 4M0PA 4CR7A 5JNVA 1WZ2A 3FGOA 3P94A 3LD9A 1XJWA 1RRMA 3WLMA 1YBMA 1ZW6A 3AT1A 3NRJA 5JJKA 4TMKA 1DFHA 2AKAB 4HLUA 1NN0A 1D04A 1N5OX 1UPFA 3OZDA 1XB2A 4ZOAA 3TZCA 1N3YA 1QHXA 3O91A 3R0JA 3PKIA 3SQNA 3VJKA 4D0GA 1W5SA 1VCHA 2GWHA 5IJ9B 3T3HA 4O4HA 2V7QD 2ZU0C 4P1ZA 4IHJF 4KO1S 4I3FA 4Q9DA 2F1HA 5DEIA 1LQTA 3TLCA 4RZ2A 2YV2A 1Z0KA 1NN3A 3DLAA 3PRJA 3PI6A 4TMVA 4H7FA 2HLDA 2Q7XA 2ZYAA 4NMMA 1W73A 2UKDA 1Z4JA 3HXPA 2AJDA 5ALHA 3RASA 1QIGA 1NVAA 1R0XA 1AGNA 1M2WA 5CLLA 3A6FA 2R6FA 4TTVA 2GWRA 4MQLA 3V33A 1W5BA 3VI3B 1XELA 5KTMA 2FG5A 5LP6C 4G5QA 2VF7A 3K3PA 3OE7A 2JH9A 3DVLA 3DW1X 4NZPA 5ENZA 4EUFA 4TKUA 4DR5B 1UBUS 1EDEA 3KKEA 3Q7PA 3FB4A 5EHNA 5LBIA 5DGIA 4ZREA 3WJ1A 3QFSA 5P8WA 1Q0LA 1ZK4A 4IP0A 2GNOA 4WK0B 1X8JA 1U63A 1T5SA 4RDCA 4FBGA 2YQ5A 2C2GA 3IUMA 4NCHA 3V4FA 3W1WA 3N2KA 1D1TA 1M10A 3DL0A 4R8MA 3GLFB 5EKTA 3QXHA 4GFDA 2X8BA 4FYVA 4RKYA 4TMXA 4LDNA 1GUZA 3GA0A 4NZ9A 1XL1A 1CUUA 2NSLA 3CLSC 4IZHA 4N39A 1IY0A 5CITA 4YCLA 1SKQA 2NQ8A 2RHDA 2R2GA 4EMBA 1L3BA 2QYSA 3UH1A 5D3MA 4A15A 4D9HA 1ZUIA 3QE3A 3FHLA 1Z12A 1ZK3A 3EUEA 4D26A 1XV5A 1ZUNA 2A14A 2R8PA 3IP5A 4QDZA 5H83A 1PR9A 1TTTA 5JS6A 5FPTA 4D4GA 3T38A 4HDNB 5JD3A 2I65A 1CZUA 3VMMA 3E2MA 4EZIA 4MUGA 5AW1A 3U39A 4LVOA 4DDUA 4AP5A 3H1TA 3ZLBA 2GPBA 5HBGA 2PBRA 3ORQA 4P32A 1V43A 1TUBB 3L41A 4KN9S 2JCYA 2H1FA 1NA5A 3VUEA 4E6EA 1EDBA 1DS6A 3FJOA 2GS9A 3Q2IA 1O8BA 4FGZA 1M0TA 4UTNA 4FOPA 5FLKA 3JR3A 2RH4A 13PKA 3PXUA 5CT5A 4YPFA 3IVRA 2YDXA 4ZT5A 3EC2A 3W3AD 1EK2A 3CEMA 2XY4A 4Z4GA 4TMWA 5H82A 1QZ3A 3DEKA 5KYXA 4XWOA 3FTFA 2IS6A 1X2EA 5MGNA 2WABA 4H4EA 5IRCD 4E08A 3ABZA 4IIGA 3O4RA 1CHNA 2B3DA 3LVQE 2KLHA 3CTPA 4BFUA 3T5AA 2ZTSA 2PZBA 1F1BA 2VF4X 3JQ7B 5I8PA 5KTKA 1PGJA 4A0SA 5BW6B 2C9BA 2YV4A 3KYIB 3QX7A 1YJQA 3Q0EA 1EE2A 2AZXA 1ZUWA 2JFXA 4ALKA 5ENVA 5CIWA 2RHWA 5F3RA 4ZAZA 3ZZNA 4UHDA 4NDAA 2FWMX 1N7GA 1EYZA 3SXJA 1WU7A 1X80A 1RQ7A 1QE3A 1F2UB 1ETHA 4MDHA 5FAXA 1HFJA 1RLJA 5ETJA 1YIOA 5C8ZA 1NQAO 3K6SA 1CNFA 4GS5A 2AXNA 2EG9A 3ILYA 4DV4B 2BJWA 1YRAA 1AG9A 1CW2B 1OAOA 1YOBA 1V45E 3AH8A 3LZCA 4D56A 1Q20A 4GU5A 4D3SA 2HAEA 4F4FA 5B4UA 2Z83A 2IOFA 4L0MA 2QLFA 4OG2A 1YZTA 4DXAA 3U56A 1A1SA 2ZUSA 3UK1A 1JR6A 3PENA 4KXVA 3AIIA 3WB9A 2HHAA 2WZBA 5BOSB 3SVTA 3GFOA 3OQOA 2ZJZA 3A9CA 3TEFA 3G79A 1ZN8A 1PR4A 3ZBTA 5JSFA 1KRHA 4I5DA 3ESCA 4QARA 4EHNA 5F3WB 1H1LB 1JAHA 3OMXA 1WSDA 3NGXA 4G56A 4WY8A 1C3LA 4RENA 1N7IA 3ZDEA 2R65A 3L5KA 3WL4A 4OF4A 3VZSA 3JQRA 3CFYA 3KXDA 3Q15C 4B3JA 4X97A 4ZN6A 4IVQA 1N6KA 4TLMB 1TT5B 4Z86A 5EJ7A 5FWXB 5ITVA 1JYEA 2FAXA 2BUBA 5JLJA 4MHTA 1E58A 2EV9A 4LF5B 3G7UA 3UWPA 4C6HA 3OTQA 1ZGCA 1W30A 1CJKC 4PZYA 2JAXA 2VXOA 1BVHA 4MGIR 2IK8A 2DR3A 3DC2A 2K6GA 3G8YA 4KR9A 2J0QA 5CBPA 5BN4B 1M34B 3B6MA 1FUYB 3HUUA 2AF3C 4ICIA 1MQ8B 1P7VA 1NW7A 3FMPB 2RGDA 4QKQA 2QTBA 1IRIA 1XRLA 1X6VA 2AGVA 1U7TA 3N2GB 3RREA 2XB4A 4HOYA 2WIGA 3X1XA 2NUTB 2CLDX 2VWHA 4LQLA 1BU8A 3RS3A 3LHSA 1HDEA 1LBQA 2XE7A 1QUFA 2YVUA 3AHHA 4LCEA 3SR3A 2QWXA 2CDAA 3PHLA 2AJ8A 5A5GA 4RA6B 1GQQA 4LIPD 3MUEA 3P4XA 2WM2A 1ZXBA 4QSMA 4DJAA 4KP7A 1JTVA 4CQNA 4DJ5X 2ODTX 2PUAA 3GQBA 5TT0A 1W1IA 2J3LA 1OZGA 4CG1A 1MPTA 4C7XA 4IXNA 1N8SA 4MUNA 1SIWA 1I1HA 2DECA 3L1VA 3ILHA 4FIDA 4KYIB 5JAIA 4HDAA 2CHUA 2G72A 3DWEX 3Q41A 4YCCA 5DRTA 2O8EA 4FXOA 3FZEA 4WE3A 3FAKA 4GMFA 2CXXA 4X95A 3M3PA 3M4JA 3RLFA 3MBOA 4DPKA 4IDCA 5E7QA 2I66A 3BQNB 4OAQA 5AQEA 1QDUA 3W2GA 1U6JA 4H2DA 3KTFA 1MJGA 4MLDA 1VPEA 5G0SA 5JYDA 1A7JA 1BA2A 2LDXA 4LDRA 5CVDA 5FOXA 3B7PA 5CDFA 4AF8A 4L4YA 2IW1A 2AOXA 3G7SA 5KTPA 5LU8A 3NIBA 3TQIA 2HJSA 1Q0UA 6REQA 3WFIA 1N6PA 4J3JA 3LOQA 5ERXA 2IZ0A 1PWHA 4AM8A 4TLDA 1XRRA 4PO1A 3UGTA 5JI2E 1E4OA 4PC6A 5DGXA 1EG2A 5F21A 3RWBA 4INPA 3INGA 2A0UA 3U3JA 2GJ8A 3AGPA 2XXJA 1EVJA 5KMGB 1UZUA 3LUHA 5FBHA 2YMQA 4D9NA 4Q4LA 2ZB2A 3TL3A 3KB1A 3LG2A 1UIMA 1Y7PA 1SURA 1VYHA 2A33A 3F90A 4UE2A 2VCHA 1TZ2A 1XFDA 3HU1A 4N3NA 4D4LA 1VBKA 1S6YA 4NZZA 1VE9A 5ALOA 421PA 2OCLA 1FP4A 2QOEA 1T10A 5T4FA 1UBOS 1IIRA 1SVIA 3WP0A 4GPBA 4QHTA 4BQEA 1GFZA 1S8AA 1Z3IX 1JBEA 4DSZA 3TQRA 3HN7A 1XZ8A 4OB6A 7ADHA 1IQ0A 1GAQA 2GFQA 3PX3A 3DW3X 3H0EA 4N0QA 3K4HA 4BRSA 1WBJB 1R6UA 1T2NA 4UPEA 4L75A 1AK2A 1TLFA 3T3NA 1XKLA 1XAHA 1PR3A 3OX2A 3SOZA 3UV3A 4LOHA 2C9DA 1DC5A 1GU1A 4CQLA 1NX6A 4S24A 4B3BA 3H1PA 3UXYA 3O2QB 3SIPA 4N7BA 5LLSA 3B1VA 3T3MB 4C20A 1DG1G 2CE2X 4Q1FA 1HDRA 3DMTA 1QWOA 3C85A 3WLHA 3H2SA 4W8GA 1QWSA 3MIZA 1I4TD 5KOJB 4BLUA 1L5QA 4E51A 3EXAA 5BMVF 1L7BA 3MB5A 4IUCS 4J2TA 4CLHA 4WCFB 4NX2A 2BFMA 1J9GA 3CNHA 3DTTA 3UJ8A 2PCJA 1T1RA 3PC8C 3OTOB 4LZPA 4BVKA 3TSOA 4GG1A 1LV8A 2WF9A 3UHAA 3UA3A 3FYHA 1JHQA 3FDIA 3I52A 3KL2A 3W5AA 4FONA 4OMCA 4TVKA 3ZU3A 1UF9A 3O8NA 5AR1A 2NN3C 2XWPA 3WBBA 1Y98A 2WHEA 2X41A 5TGZA 4Z0HO 1JDBB 1LDMA 3Q5DA 4PZ0A 5A4KA 2XB2A 4KXYA 2JHGA 3QWAA 2Y1GA 4MVJM 5I9SA 1XU9A 4EA9A 5JSQA 3DBHB 3T4PA 5G3ZA 4IFTA 2X0KA 1FNNA 4RDXA 1TKRA 5EJ8A 5KVAA 4LRXA 4PAQA 1QX3A 3O2NA 1Q1ZA 1VE7A 1QIDA 3CWQA 3CE6A 1V5WA 1NXPA 3IGFA 4X85A 4WL0A 2XVYA 3HPQA 3RW9A 1DCMA 1NP3A 4RVNA 4S1NA 1KOFA 1J5XA 5GGYA 4Q16A 3SCZA 3ZCQA 4UOZA 3PVSA 1ATIA 1ZGBA 4NYIQ 5I8WA 4F96A 2CSXA 3ZNOA 2PO5A 2R7MA 1KJ9A 3KWLA 1XP5A 3ZE6A 3HXQA 4M21A 1XDZA 2IKSA 1M6HA 2AMLA 4JQSA 1DHRA 3QKSB 2B6HA 4WESB 1T8WA 5DWVA 1CY4A 5EG5A 2IBSA 1YVEI 2C54A 4RAQA 4KGXA 1E8DA 5ELXA 1JH9A 4HDQB 1ZK0A 5DX1A 4OP3A 5EHZA 1HE2A 1UBNA 2IXTA 1NVBA 4IDHA 2FZWA 2J87A 2C7BA 2ZT6A 1PJ8A 1SCUA 3B6IA 1U2SA 4AKHA 4EMSA 1G3RA 1IC6A 5DH9A 4MCIA 2KS6A 3LCJA 1Z39A 4C0QC 2D62A 4NAVA 4UFPA 3OZXA 2EZ9A 1MH1A 3FVWA 3KJFA 2QU7A 3N39C 1VRWA 2IV7A 4MJLA 1JL3A 4EHFA 3RU9A 2GK4A 2VH1A 1JAIA 3O03A 3NVKI 1G63A 1ZJWA 3WLOA 5D87A 5HZMA 3JD1A 1Y7HA 3L7BA 3N2EA 4FFVA 4YCJA 5LQSA 4P0QB 1XVUA 4Z9YA 3T3GA 3ETDA 2GUWA 4M1OA 1A1VA 5THQA 3KELA 5A4FS 1NJ8A 2CLIB 4GUDA 1DAGA 2ACVA 2O7SA 3NOOA 3PGXA 4UQOA 1XVTA 2VL7A 1H8EA 3IUBA 4Z4QA 1I6LA 3E05A 1KZYC 4BZQA 2AS0A 4BX2A 2J5KA 4N12A 2JCVA 2H48A 1QQTA 5KHAA 4GE0A 4ERXA 4MS1B 2CNLA 2VT3A 2HL6A 1TMOA 3AKDA 5HJEA 2R751 1JTEA 2B82A 2ILTA 3ADKA 1TI7A 2BN4A 3VKFA 1GKYA 4MS4B 4EQ6B 4BGEA 5C7YA 1QO9A 4HEQA 3QPCA 3WLRA 1WR8A 2JLYA 4IQ0A 2JDID 1JHOA 3B2EA 1ORTA 2P68A 3KPVA 4OKIA 4UDXX 5HCIA 1I2ZA 1H8ED 3NIGB 1BEUB 3NVMB 3BJMA 4R9NA 5BRNA 4OK3A 1AZTA 2PAAA 2PUJA 2WP0A 3EHEA 2ZTLA 2OXRA 1ULAA 3W5IA 1YR8A 4U6QA 1F6DA 1Y8AA 1T8SA 3VHRA 1U7DA 3LUJA 5IJ9A 3GLKA 4I6JA 5FYDA 2YOFA 2QM7A 3FUWA 1G9TA 1A0OA 2VK8A 2IS1A 5F9FA 4GVLA 2I4NA 2PRIA 5CUQA 1WP4A 4R6WA 4II3A 1KI6A 1PKXA 3D8HA 4S3MA 4F8YA 4PW0A 3DYIA 3K4PA 3OT4A 1OZHA 2C31A 5L7TA 3K8OE 2CNOA 3W5UA 4U2CA 5BN5B 3WHLA 2VNJA 4TWIA 1T5LA 1VL1A 3SJBA 3FWKA 3IH5A 1R66A 2P0EA 2R6GA 3UUFA 1RYNA 3OJXA 1PTJA 2EYUA 3ER6A 2IXDA 3OJFA 4LTNA 3AINA 2PGJA 2Q3LA 3H99A 3NB0A 3U7GA 3IVGA 1DRWA 3E4CA 3D7SA 3HBNA 4LYYA 1CVIA 1X1DA 1JDNA 1G3UA 3BAZA 1G21E 4O5AA 1DG9A 5AVTA 5JFTA 3RJ9A 4BEVA 4EH1A 4PRZA 3MT8A 4OM8A 1I2CA 4MLPA 1XYVA 3ZBUA 4AK9A 3A2KA 1KETA 4P08A 4Q66C 2CVZA 2ENUA 2IW3A 5BXQC 2N1MA 1DJOA 4LDJA 1S1CA 1W88A 3DNPA 1JH8A 1TIKA 4YP1A 3PTLA 5CIYA 3G3EA 4F85A 3RIEA 2B8TA 4E2WA 1P0CA 3HSYA 1IHPA 4H6VA 4XWTA 4GOXA 2BHSA 1THMA 4ZAWA 2X5XA 3LL7A 2ERYA 3IDZA 2CFOA 4MYHA 1E7WA 4BGIA 1NZFA 4KUEA 4ZHQF 4J0EA 2WG2A 4GNRA 2ZI5A 5D3ZA 3TMKA 3F5SA 4EW2A 2DH6A 3WL3A 3SHWA 3M6VA 3V9AA 4MS1A 2JFYA 3TN7A 4G36A 5C8YF 1OSNA 3JWHA 1N1DA 5D2CA 1A8QA 1GZDA 4H15A 5GOZA 3T4EA 2C5BA 4NCJA 4CLDA 3NYRA 3TMYA 4ENVA 4M22A 4C89A 5L7WA 3FSGD 3LY9A 1FQOA 3WOHA 4DYVA 3B89A 3N2IA 4M86A 4TYNA 3TSAA 3BD7A 3I12A 4JFRA 3V8EA 1N57A 2QRHA 2A4KA 3FVRA 3V6LA 3TLEA 1YZGA 4DUGA 3K96A 1T3HA 4F1KA 1DIRA 1BFDA 3B3GA 3ZCXA 4DMKA 5LJLA 2W48A 4JYPA 2XE8A 3FNBA 1ZXLA 1JQBA 4S1TA 4UXIA 4B3RB 2WWIA 3G1UA 1A9RA 4ZGGA 4BJ1A 3EE6A 2A78A 3WWPA 4HPJB 4CG0A 2RKOA 1NYTA 1EWQA 1ZHFA 2RHHA 3C97A 1YVRA 1JIUA 2OO7A 3W77A 1RSZA 2ZOSA 4C4YA 2C8LA 4CGZA 1Z0DA 5DHQA 2YWJA 3EIHA 3HADA 3WRVA 4A0RA 5IJ0B 4EJ0A 1V3QE 3A31A 3MTBA 4B8YA 3RIXA 5DHFA 4B35A 1G2QA 1MRZA 2HSJA 3K2IA 4JYCA 4M9RA 2P0YA 5LCXA 1CP2A 2B2CA 2IDKA 3CSUA 3CVJA 1DC6A 5CNKA 5IC6A 1XZJA 5B3AA 4PNEA 5A0FA 1PV2A 1WCV1 5I51A 3FOFC 1TUEA 4PAGA 2YN2A 3OOYA 5GY7A 4MEJA 3L8FA 4EO7A 3OOWA 2V1XA 1DJPA 4R1NA 3KYDB 4ESVA 2P78A 2AEMA 4YJFA 1KOGA 1L0BA 5IVIA 2AI2A 2GJ9A 4HWRA 1QORA 2ZE6A 3ITKA 2QLMA 1O5OA 1F0KA 1UQTA 2Z43A 1TLLA 2AZTA 3URMA 4WXMA 2QZZA 5A06A 4KFTA 1TZJA 3QITA 2P3SA 5IYZF 1K6XA 3NMUF