4ZMRA

Structural characterization of the full-length response regulator spr1814 in complex with a phosphate analogue reveals a novel conformational plasticity of the linker region
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
207
Chain Sequence
GLVPRGSHMKVLVAEDQSMLRDAMCQLLTLQPDVESVLQAKNGQEAIQLLEKESVDIAILDVEMPVKTGLEVLEWIRSEKLETKVVVVTTFKRAGYFERAVKAGVDAYVLKERSIADLMQTLHTVLEGRKEYSPELMEMVMTRPNPLTEQEIAVLKGIARGLSNQEIADQLYLSNGTIRNYVTNILSKLDAGNRTEAANIAKESGWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the full-length response regulator spr1814 in complex with a phosphate analogue reveals a novel conformational plasticity of the linker region
pubmed doi rcsb
source organism Streptococcus pneumoniae (strain atcc baa-255 / r6)
molecule tags Dna binding protein
molecule keywords Response regulator
total genus 77
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zmrA01
4KZKA 2JVJA 5TE9A 2CD7A 2QR3A 8ABPA 3UUGA 1JWLA 2OQRA 3GT7A 3O75A 1RXIA 1NXTA 3O2QB 3SG0A 2FN8A 4Z4FA 4MRMA 5CHYA 1YS6A 3OMWA 1RXEA 3CKMA 1DCMA 3H5VA 3IDOA 1MVOA 4WUTA 1RPJA 1E6KA 2BGGA 3LUFA 1YIOA 5HQJA 2ZAYA 2MYTA 1RZRD 3RVSA 4Z99A 1E6LA 1P6QA 3MM4A 2VYCA 1L5ZA 2V0NA 3F6PA 5EWLA 3SAJA 1NXOA 1JLKA 4ZMSA 4TMYA 2MYUA 3H5LA 4QYWA 1NXVA 4D74A 3FFTA 4YWHA 5FWYB 3FFXA 3H5IA 4IF4A 3HM9A 3RVPA 3HS3A 1SRRA 1DG9A 2PJUA 1UDRA 3GWGA 3LFTA 4JAVC 5FWXA 2HPHA 1LBHA 5IX8A 4Z9BA 4DADA 3ILHA 1DC7A 3O1HB 3T95A 1SXIA 5KQMA 4G0MA 4YP9A 1APBA 5BR1A 3H5OA 4EYKA 2E4WA 1P6UA 3I09A 1DBWA 4RS3A 4RY0A 1BDHA 4LE2A 1QP0A 1Z2DA 2W42A 3C3WA 2A9QA 1TJYA 3H1GA 3B2NA 4EYQA 1OXBB 1JYFA 1M5UA 4EVRA 2IPMA 3I42A 1DRJA 4WZZA 1SD5A 2QSJA 3IP7A 1MIHA 3OLWA 3QLVA 4W5QA 4KRFA 1NXPA 3Q41A 4F12A 4Y9TA 1EAYA 1HEYA 1ZDMA 2E4YA 3D8UA 3H5TA 1K66A 2PLNA 5IUJC 5HSGA 1BDJA 1DJMA 4D6XA 3GBVA 4KQ9A 4MQFB 3KG2A 1VLZA 4RK5A 1D2AA 1KGSA 1USGA 5TQ2A 1Z2EA 2HJ9A 3C6QA 4Q7EA 1ZAYA 4JB2A 2L2QA 2JBAA 4RV5A 4LE1A 1MB3A 1Y1LA 4OBBA 4H3KB 5T3YA 1PUXA 5F64A 3O2SB 4L85A 3Q7RA 4ETMA 1WETA 3LUCA 3HXMA 1XWWA 1GCGA 5IUKC 3CZCA 2GI4A 4Z9AA 4G97A 1JFSA 5FBHA 2FVYA 4CBVA 3ROFA 3BILA 2LUOA 2JK1A 3CZ5A 3E3MA 4JASB 3Q9SA 1JDNA 4GPAA 2CWDA 3CU5A 2NZUG 5IC5A 4PE5B 2QZJA 3F7NA 1ISRA 2A9OA 1E2BA 5TQJA 2PKXA 1BAPA 2L18A 1E6MA 2YHBA 2WJAA 1EWTA 4N41A 3OLZA 1DBPA 4PEVA 4Z0NA 4S05A 3IPCA 3LUAA 1KRXA 3NHZA 1JBEA 1Z17A 4G0XA 2RGYA 3LUJA 1ZVVA 5BRAA 4KMRA 4UHJA 2FTKE 3TX6A 3QX8A 5DTEA 3MYYA 2HQOA 1LJUA 2JBAB 3K4HA 3K9CA 4JA2A 5TPWA 4PICA 2MYPA 3MA0A 3SNKA 5FWXB 2GKGA 1F4VA 2QVGA 3LUKA 3CRNA 2RDMA 3EJWA 3VNAA 3Q15C 3UK0A 4RK7A 5E3JA 2RJNA 5TQ2B 3QEKA 3CHYA 3CLKA 3KLNA 4IGAA 4HYEA 2PUAA 1DRKA 3TB6A 4S04A 1EWKA 3OQNA 1KRWA 1FQWA 1A2OA 1NXWA 5BRJA 4YO7A 2GBPA 4WXEA 3RVRA 3JVDA 4MGEA 1ZGZA 1FFGA 4MYRA 2F8TA 3I5AA 3O1IC 4YS6A 4IMJB 2PL9A 3O2JA 2FSPA 4DN6A 4F3TA 1YK1A 2Q5CA 4MRMB 4RY8A 5CNMA 5I4CA 1ZN2A 3SM9A 1JYEA 2O20A 5CNIA 1JFVA 4EVSA 3NHMA 3L6UA 1EFAA 2AYXA 2FLKA 4NV3A 1D5WA 2WRZA 1JF8A 3HZHA 1B00A 2XDYA 4MS4B 4UHKA 5EWLB 1ZITA 1DCFA 5IULC 4RK6A 2OENG 1YK0A 3KYIB 3DBIA 3OLYA 5ABPA 5IEJA 4OLAA 4RWEA 1MAVA 3HK2A 2PUBA 2R25B 3MMNA 5FBKA 3SQNA 3JS5A 5C5EA 3KTOA 3QLVC 5TPWB 1VPWA 3O1JC 3QEMB 3F73A 3KS9A 1QKKA 2A9RA 4KFCA 3H6HA 2WY2D 4EYOA 4W5TA 4RXTA 4IRXA 4TN5A 4ZPJA 1MB0A 2JVIA 3RQIA 5DGCA 2QVCA 1AB6A 1TVMA 2CHFA 2E4XA 1AB5A 2R48A 4H60A 3H1FA 3N0WA 2HQBA 1QO0D 5KQPA 4N47A 5KI6A 1PHRA 1PNTA 1D1QA 2KYRA 2YHAA 3H5WA 4W5NA 1CYEA 4N0QA 2FXIA 2E4VA 4LZLA 3BREA 1QMPA 1EWVA 1LK0A 2I6FA 2DRIA 3HV2A 4Z4HA 3KJXA 2GWRA 5KWSA 4L4UA 3LUGA 4IILA 4LE0A 6CHYA 2J48A 2LBPA 3MF4A 3CTPA 3KCNA 4ZJPA 3EQZA 4Z4CA 1P8AA 5JNVA 2B4AA 2MSLA 3C97A 3OO0A 4EUKA 3FGZA 4NCAA 1DBQA 5EWMA 2NT3A 4MS4A 3RVQA 4QYMA 1GLGA 3DGFC 5GOTA 3DLBA 1ZH4A 5JNTA 1FFSA 1DCKA 2VK2A 3H75A 4QICA 3Q7SA 4LRQA 3BRSA 1S8NA 2PL1A 2ID9A 2JRLA 2LP4Y 1U2QA 2IPNA 4G0PA 4XLTA 4TLMB 1USIA 2MYNA 1Z12A 1BDIA 3JTEA 5EWMB 1IIBA 4YRZA 4RU1A 2PUFA 1M2FA 1JDPA 1Z26A 2M1ZA 1D4ZA 3C3MA 3GV0A 4FE4A 4F11A 3HEBA 2FKAA 1ZGGA 5DCLA 3RH0A 3D02A 3KHTA 7ABPA 3I45A 3OM0A 1U2PA 2JB9A 1OXKB 1ZY2A 2P9HA 1ZH2A 3A10A 4MR9A 1QPZA 3EDCA 1LJLA 1XHFA 1DC8A 3RVKA 3TO5A 2QV0A 3BBLA 2PUGA 3W9SA 1USKA 4YR7A 4Z4IA 3M9WA 2PE5A 3N6VA 2P4UA 4WT7A 4DQDA 3N75A 4LDAA 4E7OA 2GX6A 4NCBA 3F6CA 4F8JA 3N0RA 1TM2A 2QU7A 3R0JA 3BRQA 5KC9A 3SY8A 2H0AA 4QPJC 1Z18A 2PAFA 2IKSA 3CG4A 3KKEA 3OO1A 3A0RB 4H3HB 4ETIA 2FQYA 2VUHB 1VKRA 3L49A 1C0EA 4EYGA 2QW1A 3JVIA 4W5OA 4LDZA 1NATA 2WJWA 1GCAA 3OQMA 4B09A 3RVNA 3N0XA 5HKOA 1CEYA 3C3KA 4KQCA 3HUTA 2WB4A 4MS3B 2FEKA 2FMFA 2R47A 2LIVA 3MQ4A 5EWJA 1KMIY 4ZMRA 3EAFA 5CNKA 4GNRA 4KK4A 4W5RA 2CHEA 4RKRA 3G85A 4MR7A 2NZVG 1JFTA 4HNQA 4KK3A 4MS1A 5D2CA 5JS2A 4ZYLA 3HO1A 4MS3A 4MR8B 5IBQA 4FB4A 1RNLA 4Q6BA 1SXGA 3GYBA 5ED4A 3LOPA 1GUDA 5JNSA 1YTUA 1YMVA 3JY6A 1QNLA 2PMCA 4XXHA 3GA5A 4O1HA 2N9UA 2R4QA 2QXYA 5DKFA 2FW0A 4RY9A 2PUCA 1C4WA 3E61A 4P98A 4KPYA 5KQGA 3CG0A 4RSMA 5JS1A 4RKQA 1A04A 1NXXA 5C5CA 1QP4A 2L17A 4N03A 4YLEA 1BVHA 1FSPA 3ILYA 1T34A 3GL9A 3EODA 2E4ZA 2L19A 1JX6A 4RK0A 4OTZA 4OG2A 4OLBA 4G0QA 4XASA 2FEPA 4RXUA 4XARA 3FFWA 3EQ2A 2IYNA 2VUIB 2IOYA 3CNBA 2E4UA 3HJFA 3P9YA 1CHNA 2HSGA 1RZRA 3T8YA 4Z4GA 3LKBA 3Q7TA 2FMKA 3HVRA 1P2FA 5HM6A 3G1WA 1Z25A 3URMA 3RVOA 4PYRA 2FMIA 2MSWA 4HNSA 2FQXA 3QEMA 2ZWMA 3LUDA 4WXMA 3RVMA 3VNBA 3DGEC 3KLOA 1PEYA 4YV7A 5DLEA 3RVLA 1W25A 3QK7A 4O1IA 1PNRA 4RDCA 6ABPA 1NTRA 3TD9A 3A3KA 1EHCA 3OQOA 4MQFA 3IP9A 1YVUA 5JNUA 3O74A 4P1ZA 1U8TA 4MR8A 3LTEA 3EGCA 3OLVA 1URPA 3TMYA 1K68A 3NNSA 1ABEA 3CS3A 2JCGA 4G0YA 4LX8A 1NXSA 1ZHHA 4EGSA 1Z16A 1DP4A 3LKVA 4JOQA 4PZ0A 1GUBA 4Z4EA 2B1JA 3IP6A 1TLFA 4MAAA 1JHZA 4M88A 4OATA 5EWJB 1W9HA 4MLDA 5TPZA 2RJOA 5TQ0B 3ROTA 4MR9B 1H9CA 1I3CA 3IPAA 1QQBA 2IDMA 3FDFA 3O21A 2JVKA 3OMXA 3T38A 4MR7B 1Z13A 2M98A 1QP7A 1A0OA 3A0UA 3FMVA 3LUHA 5KC8A 2WMYA 1ISSA 1U0SY 1U04A 4ETNA 5IEBA 1J56A 2FQWA 1M5TA 3JPYA 2H3HA 3MIZA 4NICA 3NNNA 1NY5A 5PNTA 1LBIA 3CFYA 4WWHA 1M2EA 4E7PA 2ID7A 2PUDA 4HNRA 1JL3A 2FN9A 3N8IA 1YS7A 4YCSA 1D1PA 3OLXA 1L5YA 1BA2A 3M6MD 4G0ZA 3RVJA 4XFKA 5IUNC 4KNYA 1XHEA 3N53A 3QLUA 5B3JA 4KREA 2NT4A 5BQ3A 4XAQA 4RXMA 2A9PA 4RZSA 4JP1A 1VRVA 9ABPA 3IP5A 1ABFA 3H1EA 4EY3A 3M9XA 4IMIB 4ML3A 4O5AA 5T7BA 1QO0A 5JNRA 4TLLB 5GQSA 3HSYA 2F8SA 3GRCA 3QLTA 4MS1B 2WWVD 4KV7A 3S99A 2AYZA 3OM1A 1YMUA 1ZESA 2TMYA 1SXHA 4G86A 3EULA 3HCWA 3QX9A 1F51E 4MQEB 4RK4A 3H6GA 4MPTA 2FMHA 4JB0A 3NNDA 3UKJA 1Z15A 3QELA 3LMKA 3HDGA 3KSMA 1DZ3A 3HDVA 4G0OA 5JNWA 5TQ0A 2NUBA 1QQAA 3NBMA 2FLWA 3HUUA 3QLUC 3T6KA 5B3JC 3KYJB 2X7XA 1FFWA 4NQRA 5FWYA 3GBPA 2PUEA 4MQEA 2FEWB 1PEAA 4D6YA 1R8JA 2IPLA 4FE7A 5TPZD 4F06A 3DZDA 4N0PA 4YGXB 4Q6WA 3JPWA 4MLCA 2LPMA 3QELB 4KVFA 4RK1A 4EVQA 5KQLA 1JH9A 2IPAB 5CNJA 2HQRA 3DLHA 1TMYA 2MSKA 4N76A
chains in the Genus database with same CATH superfamily
1G8SA 1PJLA 3C6ZA 3IQDB 5LR6A 4K0RA 1AU9A 1TB4A 2R6CA 3KFXA 2X1HA 1ZCBA 4HX9A 5JMPA 1E62A 2E85A 2OQRA 3LRTA 3L7AA 4JC4A 5FBZA 5F9MA 3RRNA 9GPBA 1XL1A 4ALIA 4W1QA 4J90A 5DHTA 2JZCA 1KI9A 4UCXA 4BQIA 3SF8A 2BKUA 1I7QB 1PYOA 3L06A 4WGGA 1XDZA 1OX5A 2H4YA 2VNKA 3O4JA 5TGZA 2PZFA 4X54A 4EGAA 2D06A 2ZR0A 3TYXA 2I6QA 1L4UA 3EDMA 5AJWA 2Q41A 2ZJ5A 3U3JA 4E22A 5J4LA 1QH9A 4ZALA 5GVSA 4AWAA 2MYTA 2Z43A 3MXTA 3BTOA 1OREA 3GVHA 1FFBA 1LU9A 4DXDA 5FWDA 1UM8A 5EWLA 1COWA 3U4CA 3WNCA 1EHIA 4OLHA 4UARA 3ZY2A 4IG4A 5BR7A 2IEGA 5F35A 3TSYA 2O5VA 3VTFA 3UT5A 5IBCA 4B3MB 3EC7A 3HB7A 4M9UA 5B6IA 3MJ4A 1OFGA 1QHXA 1RKVA 1O57A 4JR2A 1BROA 1DAIA 2OFXA 2QJTA 4YJHB 1EM8B 1BGVA 5CIQA 5B3LA 3IFSA 5TT0A 1NRJB 2VJDA 1LBHA 1FXSA 1K88A 1DADA 2WF9A 3RG2A 4AKTA 2BISA 2F1RA 4AP5A 2GCPA 4Q4HA 1GA1A 3ZHRA 2QRGA 4YAIA 4QBFA 1AO0A 1N6KA 4YP9A 5I9IA 5K4GA 1QYCA 4K26A 4RKWA 3HL4A 3ROPA 1DBWA 3P9NA 2NUPB 3G0BA 5K3BA 3WGJA 4EHBA 5JJLA 1UPXA 1J8DA 4NABA 4TV9B 3UUWA 4FB5A 4YT8A 4OKIA 5AJHA 3HG7A 3VR5D 4HVCA 3C1TA 2UUCB 4D98A 2A88A 1M5UA 4OI4A 1QIMA 2A30A 5IVDA 4EVRA 3F5SA 4LZAA 4LWQA 4QM6A 2FRDC 2J31A 2Z1MA 4NDNE 3K9HA 3PGKA 5AKYA 1WXIA 2E4AA 3KB6A 3OZXA 1YZQA 3X1ZA 1ZOLA 2XWPA 3I73A 4PGGA 4TS1A 5KPDA 3ZTWA 5C8YB 3NIFB 2C4KA 2VHXA 3F47A 3TVTA 1VDMA 1N2CB 1UADA 1L7DA 3UG7A 4F8YA 2HJ9A 2R8XA 4RA9A 3P4XA 1VL2A 1SKQA 4JB2A 5DJ5A 4BQSA 1Y98A 4D57A 2IHNA 3GAMA 4BRZA 5T3YA 1UP7A 2WKPA 5D6OA 1CY1A 4NH4A 3O2SB 3B9QA 1Z3IX 3B1JA 3K7EA 2RG7A 1ACMA 2DT5A 5FPQA 5DGTA 4GWLA 5FLYA 5C5DA 2D4HA 2O6HA 4M9QA 2H9AA 5AMXA 5WRFA 1S3SA 2NM0A 3CKYA 4RD0A 3IQZA 1PGJA 3ZVKA 1X14A 1JFSA 2VBIA 2FVYA 4WXRA 3VAAA 2EX1A 4A23A 4XJVA 2DUNA 3PDIA 1LBEA 1YUNA 1GRRA 1VLLA 1JE1A 1VJTA 2ACVA 2CWDA 4EHIA 1E2QA 3HI6A 3ZN2A 5IC5A 5AUNB 1XNQB 4CV0A 2Q4OA 1WZIA 4EZBA 1ND6A 2X5XA 4JB8A 1EE1A 5ICGA 3I0ZA 2CLDX 4DR6B 3R74A 1F0NA 4Z8XA 1T9DA 4EW6A 1ZL0A 2QSUA 1CJSA 1RPZA 5H59A 2P9YA 3ZDQA 2YQZA 4NBKA 4QTTB 4BNVA 4X6YA 5JW6A 4F4IA 5A71A 1GL7A 2AG0A 4DDTA 3FA2A 5K3SA 1Z5UA 4O4JB 5EKTA 4S05A 4BNFA 3BMCA 1VM6A 1Z5VA 2VATA 1Z17A 3VPSA 2XQGA 1E2MA 2ANBA 3IE1A 2JJ8A 4JA0A 1Q1QA 1FDIA 1PFUA 1CLUA 2CK3A 2GVNA 4KMRA 5ER9A 1ZC3A 2R1VB 1X1DA 1OX4B 1U0JA 3AIOA 4QX6A 1VCIA 4WZAA 3UHJA 4GPIB 1K08A 1XLTC 1UBUS 1XTBA 2H1HA 2OV4A 4LXYA 3ASUA 3N74A 5FWXB 2XGOA 2B5VA 4IJ6A 1B2LA 1RBZA 2ZAMA 2WM8A 1ZVJA 2RDMA 3HPQA 3Q15C 1Y80A 2ZT7A 3VC2A 3Q1KA 4RMNA 4UBMA 5CB4B 5THXA 2NSYA 3I4LA 3KQSA 5L3VA 2NN3C 2RARA 4FFWA 3ZK7A 4Z5XA 2O0MA 4D4HA 4DY4A 3RROA 3KKKA 1JQDA 3P9QA 3RVRA 2BGNA 1NJFA 2C9ZA 2NVOA 3HVIA 4B73A 1U1DA 4R83A 4DIKA 5AW8A 3L8EA 3PB3A 4MV4A 4E5YA 1ZINA 2PL9A 1F2TB 2OBBA 3CRQA 4XCQA 1P44A 3I5UA 1V9SA 1R0WA 1U81A 1XZHA 1XZMA 4IZHA 4O0MA 4W5HA 1UQUA 4B4VA 4BUZA 4OHYA 1G8PA 1ZWLA 3BSWA 2PD4A 2XGGA 4BO7A 4B9EA 1JSLA 3ZDCA 1D5WA 1X7WA 4H4EA 4R0VA 3BXFA 4I1VA 1ZQ1A 4O4HF 4OUDB 4U0KA 2O2CA 3ZY5A 3GNTA 2WU0A 1T43A 3BX1A 2WYVA 4NU0A 4EW2A 1N6HA 1OWPA 1DC6A 1FW6A 2PUBA 3DNMA 5FBKA 3OH8A 3AJAA 4LVNA 3IOYA 4A03A 3RJ5A 1KORA 4P7KA 1Q0SA 3BSYA 3KQMA 3QKSA 2A9RA 3GDHA 3O94A 3VDMA 3WGKA 4GOND 2ENUA 4FFBA 1KFCB 1W2WB 1OYVA 4UUNA 5E8RA 5BV1A 3AYZB 4G5YA 3FHLA 3SQDA 5INTA 1H2WA 2ZDQA 1LNZA 4OJMX 4Q0MA 3RQIA 5C8ZA 2BRUC 2O3QA 4PO3X 1LA2A 2H0RA 2VSXA 2XNCA 3QLEA 3E0XA 4ERNA 2OHXA 2E4XA 3AGQA 1N2ZA 4K6KA 1TI7A 4DSUA 4X8OA 1I2DA 3GFTA 5A5VA 4Z9FA 3V8EA 1D7OA 1O3YA 4PYLA 3JVEA 2F1OA 1NV9A 4XGRA 4ZU1X 4KUHA 1CZLA 4F6CA 5H9WA 1DWQA 2O3SA 4I5FA 4WA7A 2I2XB 2O1SA 4YMTA 1KOGA 1XCMA 4EG1A 3HNOA 3T52A 4WUVA 1N4DA 4Q01A 4INOA 2J4DA 1A9OA 2BC9A 3JQAB 4L28A 1QB7A 1XZJA 1QMPA 3GFBA 3KU1A 5BSGA 2Z09A 4P38A 2Z0MA 4ROTA 4QDKA 3U13A 4B2PA 4UEKA 3OA0A 1H6DA 4OXYA 4I36A 5JASA 5HVNA 4OQEA 3CX3A 3ODGA 3A6JA 3MLBA 1MC8A 4A4DA 4Z4QA 3ZS8A 4JJIA 4L8GA 3SHFA 2VAMA 4AUNA 5K3OA 1IM2A 4HYQA 1W1UA 1F7VA 1SEVA 1KA9H 1EP2B 5KVSA 3KJIA 3PL5A 5LKAA 5IAGA 2Q62A 3P0IA 5DLPA 4J4TA 3R6TA 1N9ZA 4UATA 3STHA 4GXNA 5BW4A 2R8EA 3HBLA 3ZIAD 4NE9A 4OIFA 3TW8B 1BWSA 2Q21A 4KIWA 4BRWA 3WYGA 2Q29A 3RT1A 3NHYA 4G89A 3V8NA 4DSAA 1DQRA 1GL9B 1RACA 3O3CA 4QOSA 1M1NA 1A4XA 4YBRA 3IEVA 3L7BA 1AKMA 1U3TA 2YXEA 3QI2A 2RH9B 4MW1A 2Y1KA 2FR1A 4NAVA 1MLDA 2R4UA 3B6JA 1UBMS 1CNEA 4MRRA 1KVSA 4NK4A 2IEDA 3C3MA 3NBYC 4NFLA 4DA0A 2W6PA 3PUXA 1BX3A 3EXFA 3ZCTA 2PSEA 3EEIA 1RWPA 5D5QA 1FDWA 4GGMX 4MA5A 1XRSB 1ZY2A 1V7CA 4YJ2F 1AG9A 1LJLA 4DMHA 1YFKA 1XHFA 2ZYGA 3R5XA 1ZSYA 3Q6NA 2OKGA 4IEFB 1CRZA 1NF2A 4QWWA 3BHMA 1M6EX 3BD7A 3W5AA 1MAWA 2PX3A 2WYHA 2W5UA 4HRAA 2HU8A 1HZJA 3RYTC 1QIIA 4PNPA 1XRNA 4LDAA 3S70A 3I2HA 3OZ7A 4WKOA 4KXFB 4U2DA 4ZI7F 3PFNA 1TX4B 2HLHA 1K89A 3QZUA 1JAYA 1I30A 5LYJB 3UJ3X 1R4MA 3A28A 2VPPA 4IPTA 1NW4A 3V8MA 2VXCA 5IF3A 3WLNA 1PR4A 1WXGA 4PZCA 3KOUA 3PHIA 4DJEC 3QEOA 1ZLYA 3UGQA 1NZDA 4CLRB 1VSTA 4J16C 2QUAA 3SDZA 3I05A 4MV3A 5TT1A 4BFUA 4DV2B 2L82A 3T3IA 1ELOA 1T4CB 1FNSA 2EW1A 1AZTA 4UEOA 4WERA 3C3KA 2MSDB 3S8EA 5EVCA 4M87A 4MITA 3U40A 3F67A 2IYPA 1C9EA 1GZVA 3E9QA 4I4IA 3GEDA 2X8AA 5K20A 1BS1A 1TVEA 3GEMA 1XDWA 1ZRSA 2AZDA 1GL3A 4M7WA 4EQ6A 3LXUX 3D6MA 5EIBD 3GFSA 4HQFA 5KYVA 3U80A 1C30B 2A35A 3LLSA 4H31A 2R1TB 4Q24A 1TK9A 3I9NA 1LF0A 4ZQGA 2IUUA 5JS2A 3U3XA 1MZPA 4OHZA 3AO0B 1T5OA 4G5OA 3HDQA 2GCIA 4KXXA 1Q77A 2O54A 4HAIA 2IXEA 2HV8A 3KT3A 4GDFA 4EIWA 3FF4A 1XSEA 3NJRA 4HX2A 1EQAA 1FEZA 4RTPA 3DE4X 4F04A 2ORED 1XKXA 3KELA 2DKFA 2H1LA 1D4OA 1MIOB 4RSMA 3UMCA 3D3EA 3PNOA 3EZ9A 4XWOA 2PUWA 1JIJA 2X4IA 1TMKA 2FEXA 3DT8A 1WPXA 3MWDA 3R7DA 3WMRA 1HM5A 1ZMOA 5HZHA 4ZI7A 5EJ6A 2O2DA 2EL9A 2XMZA 2E48A 1O1YA 2O52A 3NHWA 4R4JA 4U00A 5HP4A 3OZVA 3ORRA 2X7JA 4MEAA 1TTHA 3PTZA 4MV7A 4FYXA 4EOGA 1RYEA 2IYNA 1WF6A 2H6EA 2ESRA 3CNBA 1K7SN 3PRJA 3S8MA 3TS1A 4ZV4A 2VK4A 2YZNA 4L9AA 1KFJB 2CMDA 2IZOA 3BIWA 3JAWA 3PFWO 4ZK2A 2PY6A 3AUFA 2OBXA 4R69A 3HVRA 4A8JA 1E94E 4GBMA 1JQEA 5MFZA 3TWOA 5I9LA 1Z6ZA 3QGMA 4G0NA 2OHHA 3VV2A 1V71A 3OJEA 3PUJA 3LBNA 2DUMA 3P97A 5JEEA 3A06A 3NBUA 3ER9A 2RAUA 4BMXA 3I01A 5DEIA 2V4UA 3PVSA 3KZKA 1YHNA 4Z51A 2JI7A 4Y1FA 4IGEA 5KTKA 4J75A 4MQ4A 2BKXA 4FX2A 1MZVA 1XDDA 4MWTA 4DEVA 1OXSC 1W88A 4EKYA 1T4DA 1UP4A 1U8TA 1NN0A 4NS1A 4P1ZA 1N75A 3BL6A 2VPYA 4UM5A 2IUFA 2P30A 3MLAA 1B8OA 3TMYA 2X1VA 5D6NA 4EO7A 3SJ7A 3QPBA 4OAPA 1XMQB 3VFDA 2AN1A 3QWIA 2E87A 4EGSA 4L57A 4YXWA 3ZLTA 4QJ4A 3IP6A 3T0GA 3ZU2A 1ZJJA 2A67A 3IA2A 4JR1A 2BUBA 3ROTA 3JSAA 1RLIA 4C29A 4WFJA 3EEYA 3IPAA 4JLNA 2QHXA 4XR9A 5CGZA 1KQFA 2WKWA 3PXAA 3EFOB 5JWRA 2JVKA 3IPXA 1O9BA 3K94A 3OMXA 4EA9A 3VJRA 1JLSA 2XUGA 3TIFA 1CRWG 5FPSA 2VHVA 1JDZA 2PBRA 1LLUA 1XZDA 3FPBA 3O38A 4K9NA 4L0QA 1EBUA 5JH7A 3RKRA 4ESEA 5KSOA 4Q9LA 2H3HA 1LBSA 3I6ZA 4QG7A 1VCNA 1Z74A 4AO7A 4L7QA 4BJ3A 4BVBA 4XJTA 4F3YA 3ERCA 3O3NB 4YQZA 2VHCA 4U8HA 4LJ7A 3MT7A 1HURA 1DFHA 1O95A 4FNOA 2Z5FA 4GM4A 2CJPA 4OQYA 4ZAVA 1FP6A 3G6WA 1NQXA 3JVVA 3B8EA 3IR5A 3OZEA 1EK1A 4FHZA 1IPEA 2JCVA 4AIIA 4DR7B 4CN8A 3U7FB 2Q9BA 3RBAA 2GZ3A 4JEHA 4NZOA 1GSOA 1I80A 1K5HA 3GCGA 3V2GA 4LF7B 3JALB 1AZWA 4ER7A 5LNK6 4UNIA 4ABYA 5IUNC 2XUDA 1XHEA 1IG0A 2BGKA 3QKTA 1RJGA 1GA4A 2I1QA 1A1VA 1G38A 4RVFA 2YC2C 1E4VA 3M6IA 4CNQA 1HC7A 4RAOA 2F7SA 1ZGHA 3EEFA 1QC5A 2QPTA 4RZSA 1OIVA 2R8RA 3QNUA 4S12A 4TX1A 4XRRA 1UKCA 3TDKA 3O4IA 4H08A 4O8CA 1OB2A 1XAIA 2HPZA 2ZE6A 3AJ9A 3ES9A 1LW7A 3LJKA 4KODA 3B9RA 3ZIUA 2R5NA 1KEWA 5T7BA 2I71A 1JWBB 4TLLB 1XJ0A 3ZCXA 4JQYA 5LN1A 4DV3B 5I7WA 3GRCA 1GNTA 2WVAA 4HGQA 2QGNA 5FV7A 3OM1A 2VK8A 5DB4A 3RIHA 4D0LB 2WSSA 4MW7A 2BBTA 3I9V1 2CL7X 3EULA 4MLPA 3OTOB 2WG1A 1ADJA 1QH1A 3HCWA 3QX9A 4ID3A 2ZUFA 5AKZA 5L95A 4G09A 5KU7A 5FOWA 2HAEA 5DW0A 3K4QA 3TCNA 3TNJA 2R87A 5G40A 1I6MA 4C5BA 4FMDB 4XUGB 4YJFA 4XDYA 1S1MA 1SUPA 2FLWA 2RIPA 4TSKA 4WZBB 4C2TA 1NN3A 2P5YA 5DTJA 6Q21A 5FWYA 3CKKA 4X8LA 5AKXA 1J5PA 3O6VA 2NU8B 3DB1A 2Q4EA 2KBFA 4CM5A 1IWOA 3PNPA 4KDFA 3IUNA 4M8NE 2I33A 1T8WA 4GLBA 3PTLA 1VMAA 1KE2A 4CM9A 2G25A 1GZ6A 4K0KB 1BCRB 1K06A 2FH5B 1ECJA 3DBLA 4XUCA 2IE8A 4QGBA 5CNJA 2CV1A 5AVJA 1IOVA 2J5RA 2HWKA 4QOHA 2H2DA 5TE9A 2WHQA 2C5GA 3PNBA 4RENA 2FK8A 2EAUA 2JGDA 4MI1A 1GTL1 4DWWA 2J0QA 3P2IA 4O59O 1LCIA 3THWB 1T15A 2Q4RA 2C20A 4KXVA 4PPGA 3O2QB 4DHWA 2WWYA 2BW0A 3HCPA 3GQBB 4EYSA 1LVGA 3PF9A 2PCLA 5A4FS 3NWBA 5CVUA 3OMWA 3LSTA 3O8QB 5B7GA 5K0BA 1PIWA 1A8QA 1XJCA 2CXSA 4H6VA 4P5PA 3WNQA 1UJ2A 4ZZ1A 1J20A 2QE6A 4DC0A 1GZ7A 1DPFA 1U2RA 2J67A 3I30X 2J3EA 4NZMA 4E1VA 4XLLA 3STWA 5ADWA 3TFWA 5GV7A 2D74A 1ODSA 1GQRA 3LKDA 1JEAA 4HAUA 1GGVA 3JV7A 2VQDA 3EGXB 3TLZA 1VP3A 3DMHA 4BU0A 2DMRA 4HAOA 1L7EA 4L7VA 3WGTA 1ZXLA 1TIPA 3PVCA 4OJNA 3ZZNA 2J41A 1AS0A 2JKVA 4I50A 3ZHTA 3ENNA 3LVBA 1ESMA 2ONZA 3FCCA 3NEJA 3VJMA 2VZ9A 1UR5A 3NAMA 3O9VA 2Q07A 4B85A 2P4QA 1S3IA 4HYTA 5IMSA 3PT9A 3EJ6A 3H5OA 5FDFA 1SHJA 3UWSA 1N5JA 4RY0A 3NOVA 3WKDA 4I99A 2P6OA 1COWD 2HSWA 2CD9A 1TJYA 3H1GA 4HXYA 2W42A 4KR3A 3JASB 2PH1A 3DM9B 4QEDA 3KRTA 4YUAA 3MD0A 1KI6A 4R1PA 4DDVA 5D1HA 4L22A 4MWBA 4D3XA 4LN1A 5DNAA 5I01A 1M54A 4QUEA 3H5TA 1JV2B 3FNBA 3I1YA 4KBFA 2CEAA 1PJAA 1NMQA 3CVJA 4J4BA 4UTOA 2JIMA 3SKVA 2Y1FA 2WNHA 4LVCA 3WMEA 1J7KA 1RRFA 1USGA 4U0JA 3L6OO 3Q11A 2ECFA 4DQLA 5KSZA 3DTVB 3B6EA 2PS3A 3FMGA 5DXAA 1UBSB 2FR8C 2WUEA 3BF7A 3I0NA 4GRAA 1Y4DE 2GPYA 2QL6A 2E6KA 4I1SA 2ORVA 2WZQA 3RIGA 3TXYA 1PUXA 1CR2A 2C03A 1E7YA 2NV2B 2W22A 1E8NA 1ST2A 2QRJA 4YV0A 1RCUA 1FTYA 1N8TA 3AU8A 5FYQA 5IWCA 1KO1A 2FPKA 2XOXA 3VDXA 3B5JA 4RZ2A 4G97A 5J3JA 3UK1A 3GJ0A 1A7UA 3VC7A 1XDUA 3G2JA 3TLCA 1J24A 1M0WA 4MAFA 4ERXA 7AT1A 1FYFA 4IO1A 4QEKA 4AFNA 1EUYA 3WSVA 4LF4B 1KAMA 1OX4A 2JIQA 3CU5A 4J1TC 1CDOA 2V7QD 4CU5A 1HSOA 2PKQP 1ISRA 1KVUA 3MRVA 3G3EA 4BBJA 2O2EA 1OFHA 3P0RA 3VR4D 3KKOA 2H54A 2HF9A 4UHCA 1L9KA 1LNSA 4P22A 4Z0NA 5SYAA 4NJEA 3HKDB 3UBTA 5EJMA 3UMMA 4KN5A 5KVQA 1WMBA 2QP3A 4JCOA 4EEZA 3PIDA 4JI8B 3BG5A 2XMGA 1QHHB 1AHPA 1OT3A 3CSDA 3QX8A 3EA0A 4ZQIA 2NACA 3WI7A 1QUFA 3MAJA 3ZCSA 4WPGA 4B71A 1V4BA 2UUBB 3KKPA 3V8PA 1PKEA 1V5IA 3SNKA 2MYPA 2WD9A 3SHWA 4BO3A 5A4IS 1OYYA 1PWHA 1F4VA 1LDNA 2M9MA 2Q3HA 2QVGA 3LUKA 4QIHA 5CXSA 4FJ1A 1MUUA 2IYSA 4BGVA 2IHUA 4ZMBA 4PLVA 4AYWA 4IDEA 1MRNA 4ON9A 2QT9A 1FBNA 3BJZA 1EWKA 1H8ED 2B35A 2D5BA 4FFLA 5DBHX 4WN3A 3BE6A 1OFVA 3D6FA 3LCMA 1U0EA 2H17A 4GZ3A 4X45A 2F8TA 1G8JA 2F4VB 2PVCA 2VSYA 1O7JA 4IMJB 4AG5A 4GLJA 3G2PA 3ICWA 4JBIA 3Q10A 2QVLA 2PR7A 5H5JA 5CGQB 1I3OA 5K3DA 5JFGA 1SVSA 5JS8A 4GPZA 4TM8A 3IURA 4BNMA 3QRWA 3FKSD 2OILA 2VEOA 3MS2A 3S27A 3UENA 3PFFA 2XDYA 3LW7A 3PWSA 1IN6A 4BMYA 1BQEA 2VHWA 5DCWA 2HDWA 3NPMA 1IOZA 1SHLA 2EF1A 4N8EA 5E4FA 2CL6X 2WFLB 5A4AA 5ABPA 4U2EA 2GXQA 1I1QB 4NULA 2P5SA 3SQNA 4KQXA 2OT3B 2QX6A 3A2LA 2ROQA 2ENWA 3RT9A 4B8YA 5DNUA 1W44A 2E2WA 3BCSA 2J6HA 3IQXA 3WIVA 1QF9A 3NANA 4O4JA 5F2NA 3C8MA 1MF7A 1DG1G 3E82A 3SZUA 3WGIA 2AA3A 3KVRA 5KIAA 3TD6A 3PC8A 3SHQA 4DMMA 3P2MA 1TEXA 4RABA 1J33A 1USWA 3GLGE 1ORTA 2BGLA 1AB6A 3JQAA 2G5TA 2D13A 3E22A 3AI1A 4JKOA 5DVZA 3W3AD 2WZBA 2X15A 3FCEA 3UFBA 3E05A 3KOYA 2ET6A 2ZRIA 3MINB 4IOJA 1OXVA 2JAXA 3DV9A 4B4UA 2JCYA 1YCHA 2ZYRA 5KHOC 3AF4A 3AVOA 1PU2A 2ZSFA 1MG5A 3HHEA 1CE8A 1EDBA 4TRRA 1UBTS 1R4MB 3EGIA 4LDQA 5FPKA 1O4WA 4LJ5A 2XGSA 1REQA 4BVKA 2DERA 1S3FA 1O5TA 421PA 4Z4HA 3OOJA 2Y0PA 3DE3X 3IT1A 3EF3A 1KU6A 4C6TB 2GLTA 2ZWVA 1W4AA 2C78A 6CHYA 4QG3A 1Y1RA 3MF4A 3PZRA 3PC4A 2AMJA 1YONA 3LIPA 3OEHA 4IDOA 1U5BB 1P1RA 1YZLA 1M0TA 4UUMA 1P8AA 2BI7A 5KJ6A 3LX4A 3C97A 3HFJA 4HGOA 1R9JA 3H8VA 3AW8A 4D8VA 4E6PA 2O8DA 4LXQA 1FPQA 4IIGA 4RZIA 5J40A 1D7AA 1MH9A 3I6BA 3E18A 3G9QA 1A98A 2X9LA 3ZG6A 1FTGA 2LNDA 1D2NA 5DWDA 2QE7D 3JQ8B 1U9YA 3ZWMA 4E12A 2NTJA 3ND5A 2Q6TA 5HXAA 5TLSA 2Y4OA 4IDCA 1TU3A 2BCEA 3I01M 5ALRA 1PEDA 2ID9A 2H8GA 2X1LA 5L7WA 3KJNA 4MVJF 1IVYA 3U0VA 3RRXA 5DRTA 4AROA 1T9GR 1UDCA 3U1BA 1YZYA 2PBFA 1GZHB 4UVHA 2XTZA 3CLRC 5TQVA 2VZ0A 2A1TS 1U7HA 3TL3A 1CB7A 1DX6A 4JVSB 4QQNA 4YAFA 1NX9A 5ELXA 3HEBA 1Z83A 2BJWA 4H1WA 4OQMA 3K72B 5HWSA 4G23A 3X44A 4MROA 1CKEA 3A6PC 1U98A 5FHQA 2W70A 3H0CA 3MWYW 3NB0A 1ZD4A 1DIOB 2V8OA 2NUAA 1B4DA 1DC8A 1QTNA 4JLJA 1B16A 3HCCA 1U0NA 4TLEA 3UNXA 1MX9A 2GSDA 4CL3A 3OJOA 2HMUA 2EHDA 1XDGA 2GEJA 2PYDA 4K9KA 1PBNA 4QT0A 4C0JA 1T8PA 1YR8A 3ZGOA 4RPJA 2H57A 2VHZA 3C8ZA 3K8QA 3D6TB 3WTCA 1RRKA 4WCDA 3ZWXA 4BXOB 1DEHA 2EP8A 3L18A 1M0EA 1SBQA 1OBHA 1U2GA 3C3PA 3OQIB 4NATA 3ANSA 1P77A 5FUXA 2IDZA 1D2RA 2FP4A 4RL6A 5TARA 4HVLA 1UANA 3KKNA 3RFXA 1MX1A 4ILEA 2ZR9A 1JG7A 3WOHA 3AM4A 4N7MA 4B6FA 2IYQA 1UFQA 2YCBA 1C1HA 2OZVA 3DDNA 2EFYA 3OCVA 2IOQA 3RASA 1NURA 1GCAA 4YCJA 5DULA 5JATA 5JCOA 1E4EA 1FDUA 2WTAA 2IT1A 3WQRA 2FG6C 2D59A 3ORHA 1E3DA 4NYMQ 3Q85A 3S1AB 2V6MA 4W1SA 5DBEX 2H65A 4F2WA 1CNFA 5BOSB 5CAEA 3R9IA 4FCVA 1TU4A 2C3YA 2FZ5A 3ZWWA 3P0FA 4RC9A 3O4VA 1YFJA 4G67A 1P29A 4MVWA 3BE4A 1YVDA 4PLHA 2AS0A 1UEJA 2W0SA 4S1TA 3NC1C 4HX5A 4UQPA 3UGKA 2G6TA 3HJGA 2A14A 1P1CA 3FYDA 4MVJE 1IG3A 5JAUA 1M6WA 3UB3A 2QN7A 2MINB 1P1IA 4OFXA 1J07A 4IYRA 3AEKA 2BGRA 4R1QA 5IBQA 1GLVA 1C0IA 3NM4A 4TLDA 5HBGA 5JDCC 3F8SA 1J25A 4FYKA 1ZRNA 3OZSA 1WB5A 3IAUA 4OM7A 3HB0A 3NGXA 2W2LA 4X64B 1CY4A 2WINI 4HBZA 1XJ5A 1GFWA 3K1TA 3DVLA 1Z0ZA 4RH0A 4XUDA 2GK4A 2ZT8A 3U3OA 4C5CA 1G2IA 5B4UA 3LT1A 3H7IA 3CZMA 5P21A 3IT0A 5CLGA 1DKNA 2X2PA 1WMEA 3LDUA 3MD9A 2BEJA 1QGAA 4TSFA 4EHDA 2YHIB 1S4MA 4KMSA 3QY9A 5JI3E 3AWIA 5LWQA 1HNZB 2ZG6A 3KOWA 4JT8A 1TVKB 3SBEA 4EA6A 4OG2A 1X1RA 4ZT4A 1Z35A 3TW4A 3VUEA 4ZYVA 1ZM4A 1THGA 1K7YA 1S2NA 1SB8A 3O1LA 2ICAA 2RCNA 1Y1TA 4YN3A 3UTDA 2ZUEA 1XNHA 2W48A 3V55A 1I2BA 1TM7E 2ZWPA 1TXGA 2LTAA 1PDWA 3DOOA 4X1IB 3L93A 2XUZA 1CIJA 2NO1A 1E98A 1OA0A 5F5LA 3URKA 3PNYA 3EXIA 2DETA 4F2HA 3RC8A 1V5GA 4Y6RA 3IPLA 3JALA 2G4LA 1SUDA 4F3NA 3QUBA 3RVOA 2GARA 3HI4A 3KE9A 3U4MA 3FJ1A 2OFWA 3O8OB 4R2MA 3WIOA 3L1KA 1N5IA 3CXRA 2VQEB 2QN2A 2JJ1A 3LUDA 1Q7BA 4FT4A 4PG5A 1QSGA 5F78A 4BS9A 2ZS8A 1IDN1 1XMSA 3OP4A 4Q3BA 4V0NA 1ZK0A 4AZ0A 3DZFA 3ZXYA 1EHCA 3DXFA 1NI5A 1AV7A 2IOFA 2EOAA 4ZHQF 4M0UA 5JR3A 1N8SA 2IBMA 3AUYA 1CZHA 2PIAA 3FCUB 3MWEB 3A26A 3WOVA 1RT9A 5LDDC 2O5CA 4NOKA 2C84A 4FK8A 4W9MC 4KO8A 3ZJ4A 3SSAA 2HLNA 2I3AA 4D4MA 4R9NA 1C7RA 1OR8A 5BV8A 3L46A 3DOHA 1RZUA 2WZDA 4GICA 3C8HA 4LX8A 3EA4A 4Q5IA 2AN9A 5CH5A 3GLUA 1C3LA 5BSTA 1Y9ZA 3E8XA 2FMUA 1CX9B 1GUBA 2HI0A 5JCJD 1JHZA 3FWPA 4HSGA 4F6RA 1U9IC 1T5DX 1VJGA 2Y3IA 1KAQA 3CNHA 4MR9B 3V6MA 1MB2A 2H1OA 4I50F 4JEMA 2JD1A 2WFMA 1ZEMA 3D59A 1N3LA 3I04A 1F60A 1E3WA 2YZ2A 3QWFA 4A5SA 4F5WA 3C39A 1J1UA 4QGHA 4JX8A 1GNPA 3PGVA 3FTFA 3KXDA 1Y3DE 3FMVA 1FNMA 2HM7A 5KC8A 4IX9A 2Q9AA 3RS2A 2O8DB 5FA5A 5SYNA 3CZ9A 1II8A 3WQSB 1FZTA 3EBLA 3PD1A 3JPYA 3RRZA 3MIZA 2WIAA 1GFIA 2DPMA 5D85A 2OPBA 1DC4A 4OA5A 4FGUA 4KIGA 3IGFA 1UJ4A 2JFPA 5HKBA 2PUDA 4HNRA 1E9EA 4CETA 2WDPA 3NAZA 5B7QA 1D1PA 3K4PA 1E4OA 1KQ3A 4DDKA 1VI6A 4EQZA 4EF6A 3HCBA 4YFVA 3GARA 1IXSB 4HWSA 1RQGA 4X1KB 2C61A 4W6ZA 3H8WA 1GPAA 4BMZA 1E4EB 4LFAB 2IU4A 4GZ6A 1H05A 1MW8X 4IRUB 1I4WA 4YRRA 1T1SA 1JECA 2WF7A 4QAJA 5DM70 2VQFB 1YZVA 3KYDB 2BDUA 1TZCA 5ELMA 3VU3A 2FSVC 2P75A 4BZZA 1C7JA 2JGDB 2VNJA 2E37A 3GF4A 5EERA 3HH8A 3HSYA 3H3FA 3IQHX 3JWHA 3DMPA 4D8WA 5DSTA 4UM9B 2BEVA 5B1SA 3QLTA 4JNKA 2DX7A 3M49A 1J70A 4OQPA 4AMBA 1H69A 4BX3A 4N3GA 4J9UE 3HP1A 2WMOB 3BFJA 2QJOA 1DEKA 1G8FA 3DWFA 2PO5A 4EJ2A 3PE6A 1KO8A 2NU8A 1PD0A 2Q1WA 5E2BA 3ZGLA 1KR5A 2VDVE 5IN4A 3GG9A 4RLSA 4PPFA 2X7HA 4QGFA 4A6XA 2ZTVA 3IHLA 4R2HA 4UHEA 2YUIA 2YIDA 4J0QA 4O1MA 5BV7A 1T3HA 1PT8A 2I0FA 2NUBA 3A9TA 4GP9A 3B20A 2O8FB 2QI9C 1P4GA 1FFWA 1ONPA 4NQRA 5ALZA 1L8QA 1L4FA 2CLLB 1FDVA 4MQEA 4ZVPA 3RPEA 2ZIGA 3HJNA 4R9RA 5TR9A 1YC5A 2VDLB 3D4IA 4IHJB 3ZVLA 3AP2A 4UXHA 5TPZD 5BN3A 1D4FA 1FX0B 1OLSB 3IYLW 2Z6AA 1JH9A 5KU1A 2JF0A 5DYTA 2IS2A 4MW9A 1E1CA 2JVJA 4OFZA 4W5JA 5DLDA 2V7PA 5BW6B 3FW1A 4AF6A 5HZKA 3GPCA 4UEQA 1HE8B 3WGHA 5A4KA 2PUJA 1RXIA 4NAHA 4QRHA 1Z22A 2EF0A 4KYTA 3UV7A 5B4TA 3LQKA 2IWRA 3I92A 1M1YE 4DSZA 4ICIA 3BSFA 5A9RA 3ENZA 1E1LA 5LQAA 3EGXA 1Z68A 1EXVA 2BHLA 4Q00A 1LLDA 4HL6A 5KKNB 1E6KA 3DOFA 1OZAA 3K30A 3UWPA 1DO0A 1RTTA 4DTCA 4ZHQA 4IHJF 1SUWA 3Q3CA 1KDPA 4WJKB 3RVSA 4LBVA 2QG4A 2VYCA 3LCJA 3R3VA 2O06A 4XVCA 2BM0A 2MYUA 3WYAA 1U0FA 3DWGA 2AX3A 1NXVA 1ZMTA 1DDIA 1P3JA 4AZWA 3H5IA 2HT1A 1VDZA 5G4KB 3LY9A 1X1AA 4FHFA 3QF7A 4DUGD 2WAYA 1NW8A 5FA6A 3DFZA 4I4NA 3E35A 3I1FA 3G2OA 4JLOA 1SNYA 4Z9BA 1RZ3A 2VT3A 2PGXA 3ILHA 4FFRA 1FP4B 2WUVA 4Y2RA 1FVFA 5E1MA 4DLRA 3W04A 1KJYA 1CUGA 4CZ2A 2YOHA 1H2ZA 4MWGA 4LE2A 2ZWAA 1SQGA 5DV9A 2QVZX 4ZPXA 3VR6H 5A4DA 4BVFA 5LQKA 2C7GA 2IBSA 1XR3A 3FMOB 1JDBB 4PF1A 2ZRGA 4WOKA 1THTA 1M2VB 2XB6A 4EUFA 4G2NA 3DKPA 4AKEA 1SXJE 3G0OA 3DBLB 3OLWA 4QM7A 2DY0A 5DBGA 3T4PA 5FHRA 4F12A 1TD1A 4Y9TA 1IONA 1UMKA 3HYNA 2E4YA 2RI1A 2A0FA 3TFOA 1I5EA 4D0RA 2H9IA 1DJMA 1L5HB 4M38A 4PCLA 1JR3D 2F3PA 2ACKA 2QJWA 3D2AA 1II9A 5I7HA 3SSOA 1L8XA 2JS7A 3WNZA 2IZ6A 1AK9A 2Y66A 1I4TD 3IDSA 2YXBA 1RKUA 3GJZA 5HCIA 2R2AA 2ERCA 5AOAA 1ZAYA 3T7DA 1SURA 2KHZA 4HXFB 5A1TA 3C2QA 3SE7A 2ALJA 4FINA 4M1TA 3B1ZA 1FX1A 1XRPA 4J6EA 2Q8NA 4CMJA 5AVZA 5D86A 3G9UA 4C3VA 4MW5A 3QBJA 4NC9A 4RD2A 5IM5A 4KAAA 4YHBA 4Z9AA 3ZHYA 4ZCMA 3G9XA 1XD9A 1U5AA 3LUBA 3L02A 4MGKR 4HJXA 5JBIA 2R0QC 4F5YA 3VVCA 4R7TA 1DJNA 2P69A 2AW5A 1NKSA 1HT0A 4KTVE 1QLJA 4TTAA 1U1EA 3EDYA 4HDOB 2QV7A 3R5JA 4I50B 4GP7A 3OUUA 5EIFA 5HMMA 1AQIA 2FV8A 1KU0A 3WGGA 3IV6A 3TECE 3T0IA 4A0HA 3M4YA 2OVBA 4AJJA 2QZ9A 3LW8A 1WSWA 5IJ0A 1NOJA 1JALA 1IM8A 1KPGA 3RJ9A 1ICEA 1YZHA 2O0HA 1W36B 3BQMB 4H7EA 1JLMA 5C46F 1QHIA 5HGXA 3TQIA 5C7OO 1KDZA 2YUTA 4R3UC 4WX2B 5DTEA 3MYYA 3OP1A 3CCCA 3F3YA 4B8ZA 2OCDA 4K6CA 2TECE 1C9YA 2BFBA 1OQAA 2AG5A 3QPAA 1OJ7A 3BICA 1JIVA 2C54A 2UU9B 3P2KA 1YQ9A 2C5FA 3C1OA 1JA9A 3MUEA 1CRPA 1VPEA 2BKLA 3HXKA 1R5NA 4X3PA 3ACBA 1TADA 3Q8LA 4B7UA 2PQMA 2P4HX 3RRBA 2FQQA 2XVAA 3F5QA 3QKRB 1T6XA 4YO7A 3UICA 1NBIA 2EXXA 3LS2A 3NZEA 4L9SA 3TL2A 3LKZA 4KH1A 4MTLA 2X0EA 3LM8A 1XNJA 3PXDA 2IH4A 1NLYA 2XGMA 1HNWB 1PR9A 1SXJA 4BJ5A 1QQ6A 3DL7A 4AP6A 3I5YA 1ISPA 2XT6A 2SICE 3L40A 4RZHA 4DG9A 1DT5A 1ZN2A 4Y6OA 1T4CA 1SB9A 2UDPA 4OH1A 5JSHA 5SZHB 1NW6A 1US8B 4BX9A 1D9XA 2QX9A 3IP8A 2PQ0A 2JIBA 2WRZA 3HZHA 3JQPA 1EMDA 3L0CA 4HJRA 1Z0IA 4HADA 1XCPA 2OOSA 4ZN6A 5EMLA 3LDGA 4A0QA 5AD1A 3P9ZA 1JKIA 3Q87B 1DTWB 1Z2CA 1IZ8A 3T7AA 3EVCA 4BKUA 3AUUA 4XR4A 4H27A 3DTTA 1Z06A 4ZVOA 3EXEA 1UL1X 3WB1A 3L4KA 2Q8QA 4CTJA 2ZBQA 1Q1EA 3MMNA 4NXMB 2R1VA 2CNBA 4RDHA 1PW5A 2HMSA 3QLVC 3QXHA 4JH0A 4N40A 2W43A 3QV1A 1Y1PA 3ESAA 4IEIA 2D0OB 1SR8A 2D0IA 1XD8A 3CCFA 4Q18A 4UAVA 3SS8A 3FVRA 4ER0A 4YC7A 3TZBA 3ZLUA 4U4AA 4E3WA 2H85A 3AR6A 3G8AA 4WN9B 4YVFA 5DGCA 5A3QA 2QVCA 3NC0C 1XLUA 1K86A 2AI3A 5D01A 2WYWA 3H3XA 2ZCJA 1C8KA 3P9XA 4EAQA 2VP5A 1GU0A 4WBSA 1W5SA 1ZI6A 2X5OA 3P0JA 4JC5A 1ZNWA 3PI7A 4NPAA 2DFPA 1Z5OA 3KB1A 3QH4A 1Z2PX 5THQA 2FWIA 4XJXA 2OM6A 4MGZR 2ZSUA 4W5NA 2NU6B 1ZOOA 4J0IA 4J94A 4J0FA 1Q0ZA 4YRGA 3RYFB 5CEEA 2E4VA 4JXXA 1UMBB 2PGAA 1J8VA 1SJ9A 3P9KA 4HEJA 2IUSA 3L8YA 3NFRA 5AK3A 3VPGA 2YWJA 4MTCA 1YA4A 2OG1A 1IB0A 4RW0A 5BV0A 3HV2A 2VSFA 3K0FB 1O4VA 3OHMA 4NYIR 4DYVA 3JQ8A 1UZAA 1M2GA 4YONB 4QPPA 4OUKX 4JI4B 1EDOA 1EYZA 3H2ZA 5C8VA 3HR7A 4NNOA 5B7PA 4Z4CA 1U0GA 3BHIA 2CHGA 3SIXA 3KTDA 5AHWA 4BKOA 2HQ1A 3WP0A 3ZDDA 1HI9A 4TZTA 4ENRA 1QIGA 1DBSA 2CZGA 1N6LA 1O8CA 1QO9A 2AOUB 2YRWA 5J59A 2EC5A 4D0NA 2O2XA 4QYMA 1CQWA 4F4CA 2QYOA 2W6OA 3B13B 5KNCH 1CVRA 3LNTA 4XB2A 5JNTA 2D1FA 2Z6VA 4QICA 4WZ6A 5FT9A 4P4TA 5H02A 3SZOA 1U2GC 3KVYA 5EQDA 4XEHA 3ZDZB 3D5TA 3VYVA 4Z54A 4BBZA 1Y9DA 3VDNB 3A1WA 3PGXA 2FPWA 4LMPA 1JQBA 1HQKA 1DSSG 1BSVA 2C2HA 2O23A 2QRZA 4L1KA 2AF4C 4TTIA 4MP8A 1ONBA 1RQ7A 4UDXX 5CVCA 3SJZA 2XHZA 3DBRA 1DTEA 5HR5A 3OCZA 2H1FA 2OCBA 3PSHA 4IX1A 1XL0A 3OQIA 2ZSIA 2M1ZA 4UFOA 3QHPA 4H3VA 5HS6A 4FMBB 1HQYE 2B98A 3F1LA 3VKHA 3FDJA 1ZGGA 3BMOB 1WA5A 1NC3A 1T6YA 4B0OA 2JB9A 4TYNA 2QZSA 3IB3A 4M0CA 1F5SA 1RWXA 5EHNA 4DCJA 1XTJA 4M0EA 4GBGA 3I9LA 1AKEA 1ZJZA 4AS1A 4CEJB 5A3VA 3I9OA 5FD8A 4WDRA 3VXKA 1G21A 5DHQA 4B6JA 1V48A 3Q1LA 5HUJA 4OSOA 4QSHA 1CQIB 1SCUB 1T0UA 1DKOA 2W37A 3N75A 4IDDA 4RGBA 4E7OA 3W1EA 4BDTA 1G8MA 3DAOA 3TQTA 1J2RA 1U1FA 1X39A 2G0NA 4JMPA 4MYSA 1KFKB 3LWDA 4GECA 2HT6A 1M8GA 1ZCAA 2AMVA 2MCFA 2WE8A 3HN6A 2IYWA 2IKSA 2J09A 3GGJA 2VBCA 1Z6TA 2Z2KA 4M1MA 3I1JA 2JD2A 4ETIA 1SVKA 2QDXA 2QWXA 2EFHB 5E6SA 2JJYA 1FSSA 4KRXA 2QGZA 4QXQA 4FN4A 5CX4A 4U9HS 2H4WA 3ZW8A 3ECCA 1UOEA 2NTNA 4HDKA 3SIRA 3L0IB 2YV3A 4KAFA 1O6BA 2WSSD 3OKAA 2PKQO 2XA1A 4S24A 3KYCA 4US1R 5HILA 4LF5B 1JTVA 1TF5A 1MB9A 1AK1A 2YVLA 1GOTA 4PIPA 5DMHA 2X86A 4GNRA 1QOPB 3FGNA 4W5RA 1EFPA 3IOMA 3C4QA 3DEHA 5JYDA 1CS4C 1KY4A 1PZMA 4RKRA 4BMDA 4WXHA 1EVZA 2CLEB 1UF9A 3CB4A 4KIUA 3ZZTA 3GJTA 3FKJA 4XDHA 3K6JA 2VRWA 4KVZA 5ALDA 3EYAA 1LPMA 3OPNA 3OT4A 5KVCA 5KBYA 4XIGS 2OBNA 3AY6A 1FSZA 1SXGA 4L16A 1GUDA 5JNSA 3P9PA 1YMVA 1YTUA 2PMCA 4Y9SA 1LDMA 4AMUA 2P1ZA 3FVVA 4EG3A 4P4LA 1IUPA 2CFTA 3T1NA 1NP6A 1PLLA 4QHSA 5D3MA 3RAPR 1KOLA 4PAOA 4R0MA 3WKAA 5EZYF 2WD7B 3VX4A 1FU7A 4GQIA 4YRLA 4EPRA 3O8OA 1WO8A 2JFXA 3COWA 4LZZA 1WZUA 2D2VA 1Q22A 3RS8A 1T8TA 1L3BA 4K9QA 1X9HA 4CVNA 2B20A 1ULSA 3NHRA 2YZGA 2KQUA 4G25A 4WESA 5DK6A 3RUPA 3UWKA 1G7TA 4DRXB 221PA 1RLMA 1CQZA 2FCAA 2ZYIA 5JCXA 1V4NA 1ZCFA 4BO0A 4BLRA 4BB6A 4FBGA 1QIHA 2VRCA 4F3CA 3Q7IA 5J4VA 4KE8A 2OO3A 4PHFA 1CHNA 4RS4A 1Z3CA 1DTWA 1BXRA 4Q4JA 1RZRA 4NDAA 3LKBA 1BKYA 2YC4C 1GILA 4J0EA 1P2FA 3A3YA 1SCJA 3I2JA 1Z25A 3RS3A 3URMA 4L5BA 3BUSA 4PYRA 1Z38A 1DS6A 4C0KA 4DT1B 3EZXA 3GQBA 2ZWMA 4LJYA 3L7OA 1OHHD 2GZMA 3IQGX 3VGJA 1LSOA 3U9SA 1BD3A 3VGPA 4MB2A 3OIWA 5F2EA 4EELA 1M8JA 2UZAA 3IO3A 4MYHA 1NYRA 2EIHA 3QWAA 4Y8VA 3KAJA 3WRYC 4L8FA 1S9DA 3FTPA 4ESHA 4R2XA 2Y67A 3ZV4A 4DIDA 2QTAA 3EAGA 1VYUA 4UNRA 1DAFA 2ANCA 5BW8A 1Z2OX 4D9MA 1NQ5A 4LGCA 3X43A 1K75A 5EE9A 3RR2A 4A2CA 2ORYA 1SHUX 3KHKA 1Y1KE 3AZQA 4DCCA 4RDXA 3USES 3E3NA 2AIRA 1PQUA 2JJ1D 4IOLA 1RS0A 4IHKA 2WTBA 5TF0A 1I1NA 3HJCA 4RD3A 3W90A 2JRCA 2P5UA 4BP3A 5ICMA 5IYZB 1UOOA 1W9HA 3SBXA 1FNDA 4C6RA 1EBBA 5GINE 1EGQA 2P77A 1Z08A 4Q3CA 2FZWA 2PX2A 3DUFB 4QOFA 3HJTA 2HX1A 3T38A 3FJOA 1T5IA 5FADA 2I29A 1E3MA 4YAUA 3GAFA 3OICA 1G41A 2AJBA 1IXKA 2ZTLA 3DEAA 4OYYA 4C2BA 3WB9A 1QHSA 3BXZA 1IEXA 2RGWA 2UUPA 3RS0A 3NFYA 2FN3A 2EYUA 2NYUA 4DNPA 3ZDAA 1U04A 1WP9A 4TLBA 1FRVA 4PYOA 4U6QA 4JI3B 5C7LO 2XMRA 3R6DA 3A8TA 3ER6A 3K96A 4BMCA 3Q40A 4NV1A 2J0SA 2AOXA 1YRWA 3R40A 4B79A 2HTFA 3DOIA 1L7PA 3RSHA 1LBIA 2JA2A 3T4EA 1KI8A 2W6JA 1W19A 4XA8A 4UD2A 3N8IA 4HLCA 4S2EA 3F96A 5K99A 1L5YA 3NEPX 4JJZA 4PHGA 3SYNA 4K6FA 4G0ZA 5K0ZA 4XFKA 1RQRA 2AZTA 5K45A 4MVJH 3JQEA 3MGGA 2QTLA 4DT1A 5EZSA 2C98A 3LWZA 1YV9A 4XIIA 1O87A 4KBGA 2QMHA 5IFLA 1NX6A 5LLTA 1OH8A 4FKMA 1J4AA 3FCSB 2NP6A 4YUZA 3E1GA 3K1ZA 1HUQA 1T6NA 2PNJA 3Q7QA 3O3MB 4HNTA 1EFRD 1GZUA 1OKKD 2XR1A 3PPYA 5G2OA 5A2GA 1J0XO 5ILOA 4S0ZA 2LKDA 1UP6A 1JHAA 3C98A 3CUUA 4RHUA 3UK6A 1Z47A 4OJKA 2F8SA 2EP5A 3WDKA 2G40A 1DJOA 1N5KA 2F43B 5DNVA 1MO2A 1J0CA 3STYA 1BE0A 1HYQA 4V2IA 1PE0A 1NIPA 2PZ8A 2WUWE 1SVNA 4MQEB 3VNUA 1CQPA 5EJ8A 4O2AF 3ZWPA 1WG8A 3GRRA 4MPTA 3SFTA 2I2WA 4YQFA 2HMVA 1RM0A 4HUQB 3RK4A 2FPRA 4HQLA 4RQUA 4UDOA 1N2OA 2O3UA 2R96A 3QELA 2B0JA 3LMKA 4K9LA 3TDNA 3WIBA 4Q93A 2QX4A 1GD1O 2LRHA 1JIUA 1IUOA 1QBGA 3A6LA 4HNVA 2IRWA 4D4LA 2CKMA 5T4FA 2C7PA 1U65A 4AZVA 3OIFA 1WBDA 2W7TA 4DLTA 2DM6A 4NBSA 3P94A 2GRAA 5CB0A 1FC0A 2ZUCA 4YREA 4OHFA 1A2KC 1I7NA 1AJEA 2EBHX 4N5IX 5H8WA 5IYZA 1WQ4A 5HUHA 4QHYA 5KNBH 1MABA 1X7YA 3CPHA 4PC1A 3RIEA 2QR3A 3M3DA 1SU7A 3ADOA 3ZZUA 4CG0A 5BVHB 5M2QA 4TL9A 4KO2S 1F6BA 4YRCA 1E7SA 3AF3A 4UUAA 5F2KA 1JEYB 1M2NA 3DEYX 5BSFA 3TN7A 3ZBTA 1QRAA 5EI5A 1FLNA 1QC5B 5EQTA 2PLAA 4Z9XA 4WOPA 1Q6ZA 1MVOA 3OT5A 4WADA 1NUHA 3HMQA 1SHZA 3UB2A 5SY6A 1P9NA 1YQXA 2YTZA 4TKMA 1Z62A 3A1FA 4NKRA 4RIFA 5GZ6A 2ZPTX 5IMBA 5A3SA 3SAJA 3F6PA 4EHAA 3RUDA 1YVPA 4O8ZA 2JHCA 3Q5DA 3ZJYA 3Q3VA 3EWNA 1C7IA 1N2XA 2F9LA 3CIOA 1L9XA 3WP1B 5AVSA 5CX1A 1OI4A 1LEHA 2QN6A 4ZRMA 1UBFA 4F5EA 3P26A 3RU7A 1KZHA 3QVUA 4R40A 4RLHA 3EGOA 2O8VA 3Q3EA 4WXPA 1SRRA 2PJUA 4UCWA 4ZZ3A 2D1RA 3G2LA 1NU6A 3O5AA 2RAFA 4KN8A 4YROA 5LBUA 2GPSA 3AG6A 3QU9A 4DAOA 4HEQA 1U9CA 3LWNA 5JSYA 1FYDA 3INTA 2Y76A 1F17A 3AB8A 4H7IA 1Y42X 4I1OA 2C3UA 3TTTA 3H16A 5ESRA 5CDFA 1YHZA 5EINA 3TLEA 2YWBA 2QNIA 4N7RA 3EGVA 3VH2A 1JAXA 4JBHA 1P2VA 2OWDA 1Z7GA 4TL8A 1AKRA 1KPHA 2J32A 3GGGA 1PBTA 2HLDD 4ZOLF 4X6XA 1A9TA 1WUTA 3IP7A 1BVYF 2AFIB 1JR6A 3EG5A 2X6TA 2CC2A 1AKWA 1ATIA 2W98A 4CV1A 5JCOC 1HEYA 1JG3A 1EKXA 1QB8A 2J46A 3RNLA 4MULA 1YJBA 2WU1A 4LPKA 3GG2A 1R6DA 1O94D 2SCUB 1QIJA 1QGOA 1D2AA 1KO4A 1KGSA 2MSNA 2POCA 4H77A 4AJ2A 2REBA 3TOVA 3OCCA 3C6QA 4JX9A 4Q1EA 2FAXA 4LRTB 1YQEA 3B3JA 1SHKA 3KE8A 1EXDA 2MJLA 4TMFA 1U3UA 1V7QA 4ZXPA 4KACA 3ZGYA 5G0UA 2C1ZA 3FF1A 3LUCA 1G60A 1F8XA 4HPXB 4BNDB 1W4RA 5C7YA 5BOVA 3AILA 4OSEA 4YCDA 1E69A 2QRHA 1ODTC 1E2DA 1UKAA 2MOKA 3DTYA 4QYTA 3R7BA 2ECPA 4UMEA 1YZFA 1YOVB 3UO8B 4AY4A 3QTTA 5B6JA 3GLQA 3BT7A 3IVCA 3EC2A 2XTJA 3DKRA 3IT3A 2VIIA 4ZT5A 1NHWA 1NAHA 1B8VA 1E2BA 5HBRA 2ZVQX 5ALYA 4HLUC 3TLYA 4I9HA 1QANA 1A9YA 2BTOA 3TTSA 4XWGA 3DT6A 4K40A 5JRDS 2ZTMA 1E20A 2BIFA 3WBKA 1II8B 1EWTA 3IKLA 5BT9A 5EUMA 4U9IS 2D1SA 4NH0A 4DCVA 3G0IA 2VSNA 4XDZA 3S40A 4R2KA 3OPMA 3CC8A 3LUAA 4YMLA 3HKCA 4WW0A 4KDEA 1N6NA 4ZVKA 4IMRA 4LYAA 3A37A 2WF5A 1SU8A 2C4WA 2CVZA 3TTXA 1FUYB 2H7CA 4JJFA 2HQOA 5AKJA 2PR2A 4QDOA 2XDAA 3SJUA 2BDEA 4BEJA 1VBMA 3KDAA 4LISA 3IPYA 1QGDA 2EQAA 2ECKA 1OMOA 1V1JA 3PC3A 1R0XA 3V2UA 1AQNA 2WYUA 1HV8A 5DLQC 2FZVA 2ZJ7A 3VISA 4QL3A 5LQJA 3LVFO 4R9SA 4DDUA 4R8VA 2IPOA 3H9UA 5E38A 4HYEA 4J1TA 5ERGB 3HUDA 4EGCB 3E23A 3ILXA 2C5SA 1KRWA 3DO5A 3B6KA 3BFXA 5IT9A 3R77A 2ETXA 5DM0A 3JVDA 4PGMA 4D80A 3JSXA 1DGQA 4D9JA 1SBHA 1D2MA 4MIOA 4KSCA 5U9CA 4Y0VA 4DN6A 5I4CA 4BKQA 3DMGA 1VL0A 5KJEA 3D3WB 4LWOA 4AUEA 3V33A 4FFPA 4JP3A 3WK7A 4YT2A 3U0BA 2BHTA 4UPVA 2IYVA 4BU1A 4BVAA 1UUFA 1QRUA 4HAZA 4MS4B 1C3EA 3G5TA 3ESQA 1ZITA 4I9UA 5IAEA 4JI0B 5IULC 3DNPA 2SECE 3BGOS 3N7AA 1PJCA 1VFPA 2ASEA 1YH3A 2FUCA 4ZEMA 2JBHA 3FPGA 4G9EA 1M2KA 3TXXA 4YXWD 3WYDA 1T3GA 3ABZA 3BWXA 2HJRA 5TPWB 5KTTA 3CWZA 4FPXA 3EFBA 2VAWA 4KFCA 1DWUA 4GPBA 2M6SA 1DINA 4WCFC 4YCMA 1KZ7B 5C5IA 4DRYA 1H1DA 2YVKA 5B7NA 1JPVA 4HNGA 4UHFA 1JIIA 4UNNA 4ZCRA 3DFUA 1CJBA 1W93A 4ZQFA 3KQQA 4TV9A 1N5RA 5EHGA 1JWAB 4OJTA 5AI9A 4C2UA 4QEZA 4ZQHA 1T1EA 3RSZA 2PH3A 2IDKA 4HDSB 1Y6QA 2Y77A 1BS9A 2ZATA 5EE1A 3BWYA 4JP2A 5KI6A 2XZOA 2OXTA 4ILKA 1L5KA 4KQ1A 1PHRA 4QOJA 4XB1A 4DB2A 1TZMA 4ZVVA 1CYEA 3UMBA 2HCTA 4FGSA 5ALLA 2VHYA 3OFKA 1BG6A 4Q9KA 3O03A 3T5GA 1QYVA 4B6EA 1WB9A 1UMCB 4WFKA 4MA4A 3BGVA 4ZYXA 3ZDRA 4DIFA 4MNTA 4LTMA 4MXDA 4FW9A 4POAA 1WLSA 5DHPA 1WXQA 1XXHA 1SOUA 3OY7A 2OGSA 3K0CA 4LWZA 9LDBA 5JNVA 2PGOA 4GOKA 3RWMB 3P71T 4E08A 2WFZA 2UYQA 1KSJA 3R0VA 4QNMA 4GKKB 3N70A 5AVOA 3DLBA 4D46A 1FYVA 1G18A 4R8KA 1O5IA 5B6PA 2I55A 3EF1A 1C2TA 1XA3A 3GEBA 3R20A 5BV2P 3VR3D 3MWEA 3BRWD 4JI5B 2GHQA 1C9NA 3D31A 3UTCA 1K8YB 2ZBDA 4DSTA 1EJ2A 4YRJA 1PQWA 1SXPA 2GDZA 5BR8B 2HYDA 3H9CA 5EJEA 3ILVA 2XCTB 1RFLA 2RGRA 3QEAZ 2IX3A 1KK3A 1VQ1A 2ZRDA 3HGTA 2Q1SA 2VPXA 1EZ1A 4IH1A 721PA 2FKAA 4ZXFA 4DPMA 3KHTA 3HXOA 5BPHA 2IYUA 3KNZA 1U2PA 4M76B 3HDJA 1MN6A 4IDQA 3KQKA 3WL6A 1QXSA 1PS8A 3LECA 3KHUA 3LQ1A 4P6VF 3GXOA 3WSWA 2AWOA 1J8MF 4GG1A 3BBLA 2O5RA 3OX4A 4KR0A 1JDTA 4WSOA 4RYDA 3SC3A 2Q5EA 1L4YA 3UJPA 3ZE0B 1H3NA 4JYBA 2ZS9A 5E9JA 1PYGA 3HFRA 3IQEA 4AX8A 2OYRA 4X71A 1ZM7A 2BSXA 3KO8A 3R4VA 5EQFA 2FHSA 2HBZA 4RPHA 2VJPA 5J47A 2VSOA 3RUCA 1GGFA 3NS7A 5EHXA 1YTLA 2PX0A 1MH1A 2ZAGA 1GQYA 2PAAA 3CURA 3QV2A 5J5CA 1T5SA 3PDIB 4UU1A 4YRNA 4YHHB 1N32B 3FPSA 1E9DA 2RGEA 4PO1A 1Y48E 2VS1A 3E15A 4HLUA 3CG4A 4WAUA 1JI0A 3GRVA 1V8DA 4H3HB 4CR8A 5C3MA 3R5FA 4WH0A 3VSDA 2FQ1A 3HYLA 2QW1A 3TE6A 2JEZA 4DUYB 1CFZA 3DB2A 3RCBA 3LT5A 5G1OA 5AW7A 4I1IA 4WV3A 5ANRB 2B34A 5TMDA 3X1YA 4F5ZA 1L7RA 2VJLA 4GYJA 1IE3A 3SFVA 4ASUD 5K3FA 5E6SB 2ATVA 2ADMA 1YFLA 1FJGB 2B4QA 2ZE5A 3UW1A 4BJ6A 3N6RA 4TS3A 3CX7A 3WLJA 4HNQA 4OQNA 3ZE2B 4ZAGA 4MUEA 4AVYA 5JO0A 3R9XB 2FZKA 4QGSA 4U9UA 2P2DA 1X15A 2OAEA 4RPIA 5DTMA 4QC2A 2W0MA 2JH8A 3DVRX 3H2GA 1RMYA 3UM9A 4DCUA 1JI3A 3EXG2 1OH6A 1TJ4A 1KS2A 3FBWA 3N2EA 4QJ5A 3GRPA 3PQ6A 4JYCA 1JHMA 3RFFA 1U0HC 4GKAA 3RS9A 3TG8A 3F4BA 2XNDD 4NNPA 1NXXA 4QA9A 3ITKA 1QHEA 3X1WA 4N03A 2C7VA 1ISFA 3UK7A 1UXOA 2C2MA 3WB2A 4F4FA 3SDSA 3NBKA 4WZBA 2JFZA 3F3MA 4EHHA 4EX7A 1M9NA 2WG2A 5AKLA 1YQGA 1HNNA 2C00A 2QTNA 4YMWA 3X1JA 4DARA 1TUBA 5ILQA 3GUVA 3FUWA 4QNRA 1E6UA 1LQ2A 2B2NA 2JGMA 4FOLA 1FYXA 1YCDA 3U3DA 1JFLA 3HDHA 1MV8A 2BGIA 3H19A 4CMIB 2AUMA 4IZOA 1EZZA 3QUSA 5L8VA 1G59A 5I7UA 3EXHB 3K3PA 4WKPA 4EY5A 3D0RA 4EG4A 2WAMA 1RMQA 1X87A 4RCYA 2Q7XA 3TPCA 4RLQA 1XE3A 1QMGA 1U2DC 1PZNA 2FQXA 3V34A 5CG1A 1MPXA 4OI0A 1RD4A 2Q4DA 1DDGA 2NO0A 3OHSX 2W2TA 4ENVA 1BWPA 5T4BA 1C1YA 4CNBA 3MTBA 1GKIA 2YYYA 3CJRA 1PGOA 1KIMA 3BJMA 3FPJA 3QK7A 2KJQA 1LZLA 4C22A 4DA9A 3DUFA 3UHPA 3AETA 4ZHQB 1EGMB 2BLLA 2WWFA 4RESA 5I4IA 3VR6A 3SX4A 1R6BX 2P3OA 3QFHA 3SSMA 4F4HA 4B76A 3NI2A 4LZJA 1G5HA 1FJ2A 2WJIA 2BFNA 3PXGA 2ZYUX 3DZHA 2UVQA 3KXPA 4YAGA 5BWNA 2GFQA 5IJWA 4CIWA 4FC7A 2FR0A 3SXUB 5KUTA 4Q1CA 4S1VA 1Q3HA 2Q9CA 4G0YA 5L9AA 4U7DA 2F9FA 1GIAA 1UMBA 1AT1A 1DP4A 1RCTE 2F43A 1P1HA 4WKCA 4PPNA 4OATA 4ARZB 4BLUA 4B3JA 4ZCTA 2FG7C 1MC5A 2XXAB 1KEKA 1CF9A 4FMPA 2XF8A 4HWRA 1RHRA 4AKHA 3QE0A 4UDNA 4D9KA 4DLZA 3Q9LA 3FNHA 1XU4A 3AKCA 5AIAA 1PR2A 3ICEA 3KJQA 3E27A 4OHKA 2ODBA 2WMYA 2O2GA 2PS9A 2YINC 3K1YA 2W6ZA 4RHTA 4ZO7A 3D81A 3ECSA 3LY7A 4MW4A 2DLCX 2GMWA 1XV5A 4H7HA 4M6WA 3QBEA 3K8OE 3ACDA 4OU5A 2GJKA 3BEDA 3X2EA 1NY5A 1FXWA 4N6GA 5LYJA 1BHQ1 4JJ6A 1NVBA 3L7DA 4JVMA 4O2BF 3FVWA 4DWVA 4QUBA 2PRZA 4MEBA 4D3ZA 2C82A 4L02A 5B58C 5BORA 5KS2A 5KOYA 1E3SA 4BEWA 1EG7A 2ZWOA 1UZNA 2V74B 1FSGA 2QIOA 3EXIB 1EVJA 2C3OA 4GNKA 4GVXA 4C01A 1TVKA 3QJGA 2R4TA 2GZAA 4TT3D 3RABA 2GF0A 3RIXA 3JWGA 4S1NA 4DREA 1FS4A 1L4BA 2RJ3A 3UOWA 1T2NA 5EYPB 4DPKA 2IOFK 2A9PA 2N75A 2WWXA 3D1LA 4ZO8A 1VRVA 5FBRB 1A97A 1DQPA 1Y1SA 3OJXA 1HQCA 1PR3A 3H1EA 4EY3A 1HGXA 2FMXA 3OE7A 2NXWA 5CLJA 2PRIA 3QNMA 4M1OA 5T6BA 2IVZA 3O95A 2WR8A 4J7AA 5JZVA 3WWPA 2QUIA 2VAXA 3MJDA 4KV7A 5AP9A 2DHQA 2I66A 3U3RA 4COOA 3FUUA 4DQUA 1CP3A 1O95C 2GCOB 1JQ5A 2R6ZA 1Q1NA 5JAMA 1TF2A 2E7ZA 3MTEA 3T5TA 1P5JA 5ESWA 1A9XB 4N5MA 1PS0A 4DMKA 3CZ4A 4CXMA 1CZUA 4O4JF 2CVFA 4RV4A 4MJ3A 1L0BA 3ZY6A 4JL8A 4PS0A 1VB3A 3AETB 4PVDA 4Z1MA 3ID6C 2I78A 1RYDA 1X38A 4MYUA 1P3DA 4RACA 1ZUNB 2CF6A 1MA0A 4RSRA 4H6PA 3HUUA 3MWDB 3R3XA 3ROXA 4OIMA 1E2HA 1GN8A 2CJWB 3OM8A 3OOEA 2YZKA 3IA7A 1PL6A 2AE1A 2FEWB 3SXUA 3UWOA 5AVKA 1LWNA 4FP9A 1ADYA 5FAKA 1XYVA 4ANFA 2WK1A 5KYYA 1P5HA 1DIBA 4L6AA 4N0PA 4CM7A 4PHTA 5F4BA 1N0HA 1H1LB 2QL5A 3O8NA 3CR3C 2J9RA 4P9NA 1B73A 2HDNB 4LVOA 1XUOA 2WJYA 1JEOA 1QQ7A 4WEOA 1CUSA 1PF7E 4RH3A 3ZDBA 2UZ1B 1Q11A 4TTPA 4RSGA 5IZCC 2GNOA 4XOUA 2XB4A 2ID4A 2J5KA 1VLHA 2PGJA 1E1QA 1Z6QA 4OPMA 3WHPA 1JDBC 1VMEA 1NW7A 2BR3A 3I53A 3SHOA 5J5VA 4OYRA 2XE8A 1YS6A 2ZB4A 5DPMA 3MRXA 5TVGA 5AUPB 4UULA 5I8WA 3A7DA 1UIMA 4A36A 2XQJA 4B3IA 3IDOA 4RIIA 1EM8A 1G9SA 4G65A 2I4RA 4Y3UA 1D1SA 4Y1RA 1XAHA 4X90A 3VPHA 4DV7B 5HW0A 3A9VA 1Y3HA 3TW6A 2V0NA 3GC6A 4L5JA 5H83A 4E3ZA 3LIIA 4I1UA 1R0BA 2B9EA 1AA9A 5L3RA 3MUOA 3HA5A 4CG2A 4YQEA 1S02A 1H2HA 5LC1A 3GIDA 4X41A 1KK0A 1DG9A 1UDRA 2BM8A 1IHXA 3H5RA 3B38A 3NTRA 3O1HB 4CCAA 3AEQA 1W49A 3MG9A 5G3YA 5JANA 1QM5A 2ZRJA 3NKVA 4J0HA 5FWNA 3LO8A 3JWEA 4BNZA 1QP0A 2IYOA 1Z2DA 1ZSVA 1H2EA 3BEOA 2PLFA 4YWJA 5I9NA 5CFPA 3OFND 1NJ6A 3FWZA 3HBMA 2XGJA 1EFKA 3LC7O 3TLMA 5KMGA 1KJZA 2AOVA 3GEGA 2WJ6A 2TRSB 2ZRPA 4RA9B 3CH4B 3QSYA 1UKBA 2PBLA 4JK3A 4EM6A 1Y4UA 3Q41A 1TQ6A 1ZD9A 3BDVA 2KW5A 2QW8A 1KAOA 4DNQA 1ENPA 5IUJC 1G64A 2B8EA 1YASA 3AFNA 6GPBA 3S3TA 4DLXA 4CKZA 4IVNA 2QKYA 3DD5A 3HQ4O 4J3NA 3KQUA 3Q2OA 3OTQA 4B5LA 2OLJA 2FXVA 3A3PA 3LZCA 3PR1A 4P3OA 1XX6A 4Q7EA 3VVLA 2YJ5A 4C88A 5C1BA 1FJXA 3SKYA 2AB0A 4RV5A 4JI6B 4HDMB 4OBBA 1P0IA 1VMIA 1ZCJA 2YV2A 4Y2TA 3T7TA 5HDQA 1VBNA 1JFFA 2Q5IA 1SCUA 2VP9A 2XRYA 1ORIA 4MI6A 4K9OA 5EYPA 2DFNA 3VUFA 2PA3A 1TW2A 2PZJA 1SQ5A 2DECA 1WCV1 3JD2A 3W4JA 1RQLA 3C6BA 3V42A 3BILA 1U8XX 2GTPA 1GR0A 3I0MA 2C2GA 4URHA 3TQSA 4II7A 5B3KA 1ZRMA 3TJRA 3Q9SA 4KLAA 3D64A 1GNRA 3HY6A 4IUBS 2JLZA 4AN1A 1HEUA 4PAQA 4UPEA 1WTAA 3LOUA 3SE0A 5KNBD 1JEEA 1VPLA 2GF9A 3F7NA 1Z7EA 3FDIA 2HMWA 3LK6A 2P6NA 2ZRMA 3MINA 5AO9A 2PKXA 1RRGA 5AH0A 3N05A 2XV1A 1E6MA 4YA6A 4DCTA 3ZGZA 1W34A 1OJLA 5BN4B 2VEDA 2VJYA 1H6BA 4DXAA 4MUNA 3NJ8A 3IAFA 1TMGE 9LDTA 3DW1X 4EHKA 4QAQA 4PX2A 4XGQA 4TLAA 1Z6YA 1EP1B 2AOTB 3L04A 1AUOA 1R4NA 2FWBA 3TSWA 1ORHA 1U1GA 4D8UA 4NE2A 3TNDA 1JBEA 5K0SA 3D4NA 1YE5A 2XNJA 4TWJA 4KO4S 4AY6A 3DL2A 3K16A 3LUJA 1UDXA 5DE3A 3K2BA 1ZVVA 3A9UA 3FOCA 1N4AA 4DIBA 3K4HA 2VUUA 2WDZA 3E48A 4E1BA 4DANA 2P9GA 3QVSA 3G1UA 3ABOB 4DJAA 4F4DA 4ARUA 3L0DA 2GA9A 3BJIC 1DKPA 4I3HA 5JY1A 3BE5A 5KOJB 5KYYB 2IH2A 4JBNA 1TGYA 2BKEA 3R6WA 1E9BA 1H2BA 3ZDEA 4F85A 3KLNA 2DHDA 3WRYA 4X92A 3PQEA 3EXHC 5BSVA 4XWKA 4E13A 4HWKA 2W4IA 5CU7A 2CLKB 4FYHA 1XXHB 4W1PA 4G9GA 4CKXA 2XW6A 1WXDA 1WW3A 1S1CA 4KXWA 4P84A 1FFGA 2J7KA 4QDTA 4W6QA 4WOBA 4YRFA 4FR5A 3FZGA 2H16A 2G76A 4M9SA 4X7MA 1EPUA 2J5XA 4HATA 1BTOA 1IZZA 1ILEA 3OM9A 4IOKA 1KSGA 1JYEA 1SCKA 2RB4A 3JD1A 2Z4SA 5C8DA 3L0OA 4XKJA 4CDGA 2IHKA 1GNSA 2VYND 4NRDA 1XZIA 1Z0AA 4Y2JA 4FIZA 1B00A 5GGXA 1IXYA 1E92A 1Z0JA 2X1MA 1UOPA 1O97C 1IAVA 1TCUA 3OF3A 1NE7A 4XEUA 3QVOA 1B6RA 2ZIAA 3DBIA 4YP0A 2ARKA 3C4VA 4RPGA 2EU8A 3RK0A 2D6FA 2CXTA 4Y6SA 1NA5A 2EFCB 4TN1A 5JZSA 5BWCA 4LRWA 1BS2A 3O1JC 2ZBVA 3MHTA 4HDSA 4I9GA 5MGNA 4IBOA 3MUNA 4PFKA 3U5TA 2XT0A 4P32A 1OZGA 3GXBA 1DKUA 4DL9A 3H13A 1W4BA 3IRVA 3QI7A 3RAJA 3W34A 2IJGX 2YYAA 3R76A 3T35A 5AVTA 5J23A 2WAAA 1AKQA 2JHAA 3SQLA 2HHHB 3VZRA 2Y05A 5IFKA 1M1ZA 5TSDA 4IJUA 4KWHA 1TTQB 1K0FA 1L1FA 2W9XA 3H65A 2C9DA 4PZ9A 3AEZA 4B6PA 3CNQS 3MELA 4N47A 1YJAA 5JO9A 5HJ5A 1WM1A 3ADPA 3O0TA 4D0GA 2XH8A 2XNHA 5CDFE 3NOXA 1PR6A 2Y2UA 4BB5A 3N2LA 5K0GA 3GJSA 5E1OA 5EJFA 3IERA 2YXPX 3HP7A 3B36A 1AQUA 2JLBA 3K9QO 4DXHA 5LQDA 4LOAA 3R75A 2A3NA 4MVYA 3V9AA 1UK7A 3DLAA 2X9NA 3D3WA 1G6KA 3BMQB 4QUKA 5JAQA 5T3UA 2YXNA 3EPRA 3QX7A 1Z28A 1SZCA 1JIQA 3DV0B 2B4AA 4PXAA 2DKOA 4YMIA 4BQRA 1NBMA 4P8RA 3RAGA 4LOJA 2CMGA 2EKZA 1DBQA 3CV3A 5FEMA 3WQHA 4F4JA 1LZKA 4XGKA 3ETCA 5ENVA 5ADHA 1GLGA 2ODWA 3A04A 4WY8A 1M83A 1FFSA 2GT1A 2XNSA 3C41J 2R44A 3B70A 1Q84A 2GERA 1QYXA 3LA8A 3QKRA 2XCQA 3FMPB 5K0JA 4CGYA 3V9PA 2CSXA 1USIA