4ZNCA

Fc fragment of human igg in complex with the c domain of staphylococcal protein a mutant - q9w
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
53
structure length
53
Chain Sequence
FNKEWQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 21
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4zncA00
1H0TB 4EYYQ 4NPFX 1S3JA 1OVVA 2QVAA 2QRXA 2P58A 3PH0A 4HKZH 4NPDA 2KS1B 2R44A 4ZMDA 1X0TA 1Y47A 4WWIA 1BDCA 2KZJA 1EC5A 5DJTB 3MHVA 2LR2A 2KZIA 1FC2C 1OVRA 2OTKE 1EDIA 1BDDA 1NVOA 1EDJA 2I8DA 2B87B 1LP1A 5CBNA 1EDLA 3FXDA 4CPGA 1ZXGA 4JBZA 2RKLA 1SS1A 2K3RA 2KIKA 4K3AA 3RGUA 2M0BA 1LP1B 4HJGH 2WMMA 1DEEG 1U7MA 3FXEA 4ZNCA 4HB1A 4IOIH 4NPEA 1EDKA 4ASWA 1JM0A 2SPZA 1H0TA 2LXCB 1U7JA 1MFTA 2HR3A 2B88A 2ZAEB 2Q1KA 2JWDA 5K5GB 1ZW0A 5CBOA 1OVUA 5DJUB 2KUBA 5C39A 4ASVA 4MN4C 4BXLA 4GOFA 3QWOC 1JMBA 2KI7B 2M5AA 3S1KA 4GOEA 2UWJE 2B89A 2LXBA 4GODA 5EFWB 4KJMA 3ZDMA 3MZWB 1LT1A 2B87A 4K35A 1Q2NA 2M5AB
chains in the Genus database with same CATH superfamily
4EYYQ 1S3JA 4PV1B 2ZYAA 2LKMA 1KILC 3L73G 3OA7A 1OX3A 1VQ7P 1QVGO 3H1HD 3GW6A 3SWYA 2R3CA 4HKZH 3Q3DA 1HJ0A 2XNXA 3CXHI 2YNYA 2KLUA 1K05A 4N78E 5M1BA 2Z5HA 2IFMA 5CCHA 3AEFC 5AW5B 3L75G 1Y8AA 2QE7H 1USDA 1VQKP 3RK2D 1JNMA 1WRGA 2Q9IA 5APSA 3H32A 5CCHC 1JTHA 3A2AA 3VP8A 1MUUA 1VQ9P 4KT0J 1P84I 2P10A 1KTMA 1NTMJ 5KAIE 4IFDK 1SQQE 4H0LD 3NMDA 1BCCD 5AVUB 3L4FA 1NTZD 1IFDA 1PV3A 3V2NA 2WZ7A 3WMM0 3CWBE 3TGUE 3AE3C 5KTBA 2KUBA 5C39A 2PFXA 2FKWB 4MN4C 4PJ0H 4C46A 5KLVE 3QWOC 3VYIA 4RKUJ 1M8OB 5AVSB 1LT9A 3H1IE 2HFED 1GU5A 3AE9C 5AVWB 3PRJA 1SQVD 1ZRTD 3BASA 1GL2A 1LT9C 1J1DC 1K9MQ 5AW9B 1SQXK 3H1HG 2P1JA 4C7NA 3SSUA 1A02F 3JCUH 3Q1MA 5AW0B 3H1JJ 2I8DA 2B87B 1LWUB 3I55P 4IL6E 1NKNA 4W80A 2NPSB 3C9IA 1RF1B 1KZUB 2B9BA 4HJGH 1YTZI 3VMXA 3VOPA 4YXWH 1DEEG 1RQUA 4RO0A 1L0LK 1FZCB 2IYPA 3P8MC 3GHGC 2XZRA 4U7JA 1SQBJ 4QMAA 1Q90D 2O01H 2QM7A 3B4SA 1T3UA 1W2EA 2E42A 2AXTH 2YKOA 1T3JA 5CBOA 5TISE 3L70J 1S5LH 3AEGC 2OYIA 1NH4A 3L74E 1PGOA 3PTZA 2FFDC 2M3BA 2KI7B 4PD4E 3H1LJ 2UWJE 2ZVNB 2B89A 4UB8H 2BCCJ 1JMMA 3VTPC 2OYIC 3PHLA 3KDPB 3A0HE 3PLNA 4NPFX 1OVVA 3GF7A 1HVVA 1NGMB 2P58A 3USSA 2GM4A 3GG2A 2IFNA 3N7NA 1NTMK 3MD0A 3GMAA 4W7ZA 1PIXA 3MUDA 3PP5A 3CCRP 2HODB 4Y28J 1N86A 3MTUE 1OVRA 5KAFE 1YIJP 1IFJA 1S4XA 2WQYC 5KLIB 3MIWA 5APWA 3L71D 1SFCB 3MUDC 3CXHD 5KLVD 5GTIH 1ZP0C 1U57A 3KQGA 2Q7CA 1YITP 2E76D 1VF5D 4OGQB 1VQPP 1J1EC 2W27A 1YBKA 4WVZA 1OW8A 2JEEA 2XNDH 3PJSK 5TJHA 1AVYA 3D70A 2FYZA 2XU6A 2H89C 1VQNP 2P7JA 3AE6C 2GUSA 4B86A 1P84D 2WPRA 1NHLA 3HE5A 1PP9J 2KSJA 4BRYA 4GOFA 2QSIA 3CCQP 1GW4A 2W6JH 1KD1Q 2E5YA 3ZDMA 3NFQA 4I6MC 1FZEA 1KQLA 1PPJE 1USEA 2OGUA 3CX5H 1NTZJ 5KKZB 3BCCJ 4GIFA 5AW8B 1SP4A 4NPDA 4JPZB 2D2CD 4EI2A 1KQFB 1SQBK 2KS1B 3HD7B 3H1LE 3KXDA 3WU2E 3L72E 4N6JA 3TNUB 1HJBA 2V4HA 4RESB 1EZVE 1VQLP 3CPWO 1OW6A 1RE3A 2IBZE 2E74B 1KB9H 3T97B 1L0NE 4PD4D 1SQVJ 3AE4C 3L71G 1NU1E 4PV1D 1NTMD 1RE3C 1YTZT 4HB1A 1RHZB 1SQPJ 1OZHA 2QJYC 2O1JA 5KJ7D 1SQXG 2JDIH 4PJ0E 1AVOA 3CMEP 5AW2B 3RK3D 1ZMEC 2E75B 3TYYA 2QIWA 1BGYJ 4WY4B 2A06D 3S1KA 4IL6H 3AE8C 4UB6H 2FYUJ 1VQ5P 2R5BA 4H13B 2QJPC 2MKVA 1YI2P 1Q2NA 4H44B 3JCUE 1N73B 2J58A 1NAFA 4L74A 2K1AA 1K04A 2PRRA 3SWFA 3V6IA 4IFFA 2QJKC 3MHVA 1NOHA 5TISH 3AE7C 1AQ5A 3EFFK 4M3LA 2YXRB 1SQBD 2AXTE 1Q7YQ 1NTKE 2D2CC 3A0HH 3O6QA 1S5LE 3I5CA 1FDIA 1SQQJ 2MJZA 2OYHB 1URQB 1M1JC 1NTMG 1PPJD 2Q6QA 1NTZK 1MFTA 3RL0D 4UB8E 2ZAEB 3CWBJ 1FOSE 3CC2P 3TGUJ 3AE1C 1IO4A 2V7QH 1N7SD 2HPCB 5KJ7A 3H1LD 5KAFH 2H88C 3HTKB 1S9KD 1Q86Q 2ZYDA 5KLVJ 3P8CE 2BCCD 5CJ0A 4PV1C 1EXIA 1JMBA 2A06G 1EZVD 5KJ7C 1JY3O 3MZWB 3H1IJ 2IBZD 2M5AB 5B5EH 2R5DA 3WUUA 2H7HA 3RK3C 1SQVK 1KN7A 3G9RA 1DEBA 5GTIE 4WWIA 1KYOE 1EC5A 2BASA 2WT7A 3V4QA 1LTJB 2WPVB 2G8YA 3H1JG 3LIDA 1AV1A 5CBNA 1S72P 3Q2YA 2A45G 2WSCJ 2O01N 1AA0A 1ZXGA 1GDTA 4D6TE 2Q3IA 4K3AA 4TT3H 3RBZA 2KYVA 4YTPC 4U3FG 2C9LY 1GD2E 1GZLA 2FYUK 5GTHE 4HYTB 4ASWA 1SQBG 2FBWC 3TSIA 2LXCB 2HR3A 3KHUA 1PP9D 1MV8A 4AYCA 3L70G 2Y9YA 3WU2H 3L74J 3A3YB 3CX5E 4LC1A 4DJGA 2H43A 4Z1MH 2IX7C 1R5LA 1Q82Q 2LXBA 2OTJP 3KZIH 1N7SA 2B87A 3AE5C 3FWNA 3BCCD 3RL0C 5BU5A 1GU4A 2QVAA 3Q5RA 1BE3E 1RF1A 2WSFJ 1N7SC 2P67A 2KNCA 1NKZB 1FZCA 1LWUC 1IFNA 2V7QJ 1KB9E 1X0TA 1RF1C 2JWAA 3H1KE 5BVZA 1VQ4P 1IJDB 1DD3A 2AEFA 5AW3B 3KPEA 1FZCC 1Z56A 2YKPA 2QM8A 1EDJA 3F89A 2BEQD 1LJ2A 2OTLP 5KLVK 3TF5A 1N8RQ 1SQPD 1KQSO 4PD4I 2KP8A 3VP9A 3H32B 4EOTA 3AEAC 4NPEA 1JTHB 1Y9BA 1QLED 3G3ZA 3GHGA 3HD7D 3M9HA 1BGYD 4UB6E 1L0LE 1AJYA 1IFMA 4I1LA 4Y99B 2K9JA 2FYUD 1PP9G 2E74D 1UIXA 2HODA 1KORA 1L2PA 3IR9A 1EQ7A 3E7KA 1QL1A 1S5LX 2G3AA 4XA4A 2FFDA 4KHXA 1L4AB 4K35A 1VPCA 1BCCG 1NTZG 2KSEA 1WMKA 1LT9B 2YIUB 3L75J 4N78D 5KLIC 3BCCG 4WBAA 3HE4B 1FOSF 2E75D 1QL2A 1FJKA 5APTA 1QX8A 3L72J 2ZJSE 1NJIQ 1Y47A 1GL2B 1LNQA 5DJTB 4OH8B 2N9YB 1HF9A 3C8VA 3M9BA 3G71P 5CCGC 1NVOA 1QVFO 1LP1A 4C7NB 3FXDA 3AEDC 4CPGA 2Q3EA 1L0NJ 4JBZA 1SS1A 1NU1J 5AVZB 2R32A 1JUNA 3B5NB 1SQVG 1KFMA 1SQQD 2WMMA 4H44D 2Y0CA 1KQGB 5AVYB 4RJTA 2IYOA 2GUVA 3CWBD 2KK7A 3TGUD 1M7LA 2WSSH 3RK2B 3M91A 2JWDA 2O1KA 1ZW0A 3EFGA 4C7RA 1KYOH 4BWNA 1LTBC 2QEXP 1BSNA 1BGYG 5B5EE 1IK7A 1M57D 2Y0EA 3M9QA 1LTGC 1KB9D 2N9BA 2KS1A 1OW7A 3HD7A 3H1ID 4BXLA 1PZQA 2KB7P 5KKZC 3TNUA 3CCSP 2FYUG 2OYIB 4H0LB 1JY2O 1EZVI 1LT1A 2WTYA 5BU8B 3HD7C 3OW2O 1URQD 2CPSA 2IBZI 1IC2A 5GTHH 1A02J 4YPCA 1M1KQ 1G2CB 4I7ZB 3L73E 2C0WA 1VQMP 1CZQA 2FY8A 3OAKA 2M8RA 1FJPA 3P32A 1BDCA 2E74C 3P7KA 2KZIA 3B71A 4U3FE 3VN0A 2OTKE 1FZAA 2O01J 1HUCA 4YXDC 2IZ0A 3L75E 2RKLA 2AXCA 2R3SA 1NTKJ 3IF4A 3RGUA 2H8PD 1LTAC 1ZV8A 5APUA 2E75C 3FXEA 4IOIH 2E5TA 1SQQG 4DOJA 5APQA 1CI6B 4WY4C 2KLVA 1LTIC 4O9BA 2FYNB 3L74D 3CWBG 3RL0g 3KZIE 5AW6B 3TGUG 1N73A 3CCLP 5KLVG 3CXHH 3Q5PA 4H44C 1OWAA 1N73C 1JY3N 2Y0DA 4R4LA 5AVVB 2IZ1A 4BRYB 3CC7P 1JCDA 1H0TB 2HG5D 4IL6X 2I1JA 5L8RJ 2WPSA 3HUSB 2L5GB 2OYHA 1URQA 5AVQB 3H25A 1P84H 2LR2A 2Q5UA 1ZLLA 2AEJA 3H1HE 2KOGA 3NTNA 3E1IA 1PFIA 1GK4A 4D6TJ 2OYHC 1URQC 1HGZA 2Y9ZA 1MZ9A 1W2BO 3V5BA 3TDKA 3HTKA 1CW5A 2HLOA 2YMKA 4ZNCA 2ZXEB 1SLQA 3G6EP 1JM0A 1NYHA 1FDMA 1JY3P 3L35A 1M1JA 1OMIA 3L73D 1GK6A 1DIPA 3L74G 5DJUB 2E76B 3W68A 1KYOI 1VF5B 3WUTA 1YYCA 1PGPA 3E1RA 2ZFCA 3VMAA 3CCVP 3I56P 1N2DC 3L75D 2AEMA 3R4YA 1JO5A 1BE3J 1NTKK 3EQ2A 2C0XA 3VMYA 3L72D 1X22A 1FS0E 2FXPA 3FGAD 4EDFA 2NPSD 1XTGB 2ZXXA 2FXMA 2W6AA 4HH2A 2R44A 3II6A 1QEXA 3H1KJ 1DH3A 1W5CE 1RE4A 1FZFA 1ZRTE 3CCMP 3D71A 1K73Q 3V4WA 3RBXA 1PGJA 1L0ND 2OARA 3GLMA 1NU1D 1MKMA 1SQXJ 2E43A 4DCKA 3U59A 1H89A 2Z4EA 1SQPK 3LIEA 1RE4C 3CX5I 1AFOA 1L4AD 2K3RA 2D2CB 1LTTC 1FU1A 1IZNB 1EDKA 1FE6A 2OYOA 3O6QB 2SPZA 1L0LJ 2L91A 3WUVA 1X79B 2A45H 2K9YA 3A7OA 2ZT9B 1FDOA 1LTSC 1LGHB 5AVRB 2N1TB 3BRTB 3D6ZA 1KB9I 1R8EA 4DT0A 4ASVA 2BEZF 1YJNP 3B5ND 5CMZA 2JR8A 2VRSA 4R4MA 1PPJG 1ZOYC 3RK3B 3AEBC 3AEEC 3UIAA 5E79H 1SFCD 1JOCA 2WVRA 3H1LG 3L72G 3U1AA 2BCCG 1KV4A 5CCGD 3L37A 4OVNF 2OQQA 3CCEP 1FC2C 1LWUA 1EZVG 1KILB 2YO3A 4OGQD 2XV5A 2NPSA 1BDDA 1NTKD 2IBZG 2GA1A 3K5BA 2WT7B 2K88A 1L0NG 1NU1G 1SQQK 2YKQA 1S2EA 1IFPA 2NPSC 1YJWP 3G4SP 3L71E 3S9OA 4ZKUA 4Y99C 3CXHE 1FBMA 1L4AA 3BVHA 2QA4P 1RQVA 3CCJP 1VQOP 1SQXE 3P8CD 4L76A 5AVXB 2ITAA 1OVUA 1L4AC 3HE4A 3M0DA 1T2KC 1DD4A 1RF0A 5CHXA 1NAYA 4A7PA 5AW7B 2YIUC 1JY2N 2I1KA 4GKGA 2W90A 3V2QA 3M0DC 3NXSA 3O8ZA 5EFWB 3RL0B 1RF0C 1P84E 4LGDE 1GL2C 1FAVA 4W7YA 1XTCC 3A0BH 1YQ4C 1N7SB 1KYOD 3B5NA 1BSHA 3L73J 4EIJA 3ITKA 5B66H 2IDBA 4DZOA 1HH0A 3V2PA 4U3FJ 2KNCB 2CK3H 2KZJA 3B5NC 1JCCA 2JP3A 4D6TD 1CSBA 2YMYA 1SFCA 4L75A 1M90Q 1R5SA 3FX0A 1J1DB 3CLQA 3JSVC 3H6PA 5CCGA 1NTKG 2KIKA 3CMAP 1SFCC 3RK2C 1UIIA 2QG4A 3FWLA 4JYBA 3U1CA 4WY4D 1KFNA 5CJ4A 1JY2P 4OGQC 1E5WA 3CX5D 4JF7A 4H13D 1NTME 1QGKB 1AQTA 2WWWA 2B88A 3Q5SA 5H2FE 4H0LC 5AW1B 3AE2C 3EWKA 3GHGB 1G2CA 2WSEH 2A45I 2J5UA 1SQPG 3C1LA 1N7LA 2KXPB 3BATA 3RK3E 1BE3D 4I7ZC 2K9JB 2YO2A 2PP6A 2K37A 2RN0A 2A06E 4LLHA 1VQ6P 2W6BA 2FFDB 2QRXA 1EXJA 1JB0J 3PH0A 3H1KD 1T6AA 1KILE 1RH5B 3GF3A 4ZMDA 2JJLA 3OJAB 3H1HJ 4IFMA 1CI6A 1SQXD 5APXA 1FZBA 4D6TG 3T97A 4TLFA 5APVA 1HWTC 1G1JA 3H1JE 3SFDC 3MP7B 2CPBA 2FYNC 1LP1B 1YQ3C 1NO4A 3N4XA 1U7MA 5APYA 1L0LD 2W83C 3IN6A 4XFJA 3CCUP 1H0TA 1SQBE 1U7JA 3SWKA 4GT1A 3QH9A 4JYCA 2ZYGA 1JEKA 3LW5H 2YXQB 5K5GB 4WY4A 3A5TA 3M06A 1BCCJ 3IAOA 3HUSA 1J1EB 3L70E 5E79E 5KAIH 3R2PA 1IK9A 3HUSC 3CI9A 2IPPA 1S9KE 1GW3A 1BE3G 4JQ0D 2BCCE 4H13C 1FZGA 4ZKPA 2NZ2A 1D7MA 4AUWA 2PGDA 1DX7A 5AW4B 1H88A 2ZT9D 5AVTB 2HYNA 2RMZA 1KC8Q 3W67A 1MFZA 3H1KG 2WSEJ 2N1TD 3HE5B 1HTLC 3H1IG 3D6YA 1Q81Q 2RH0A 1KMIZ 1L0NK 1NU1K 2P2UA 1OFCX 3BRVB 1ZR4A 1RY3A 1S1CX 3JC22 1GTWA 1WT6A 4L73A 1VQ8P 2M0BA 3AECC 2PAJA 2POHA 1NWQA 2DW3A 2E76C 2W8ZA 1VF5C 2XKMA 1L0LG 1SVFA 1HGVA 2HPCA 1IFIA 2WSCH 3M0AA 4N3YB 1KILD 2WITA 2QJYB 1M56D 3A0BE 1K8AQ 1E79H 2M3EA 2O3JA 3VMZA 5B66E 3MGNA 2M5AA 1YJ9P 1PP9E 4GOEA 3CC4P 1ZN5A 1ZR2A 3TK1A 3H1JD 2Z5IA 3SFEC 1YHQP 1BCCE 3L36A 5CCHD 4U3FD 1NTZE 1OXZA 3LW5J 1TU3F 4PD4H 1J2JB 1H8AA 1LTJA 2ZVOB 4I2LC 3BCCE 4AQRD 1VL2A 2QJPB 2XDJA 5H2FH 1GMJA 2JO1A 1EDIA 1X8YA 1LTJC 4GDOA 1PGQA 4WB4A 1EDLA 1HBWA 1OIPA 3L70D 2N1TA 2WSFH 3CL3D 3ABVC 3B8EB 2QJKB 3CD6P 2J59M 3L71J 2ZT9C 1VDFA 1SQVE 2N1TC 3S4RA 2NRGA 1SQPE 3KYQA 3F5HA 1G1IA 1PL5A 4OWFA 2Q1KA 1T8ZA 3HRNA 1T2KD 3IFMA 1M1JB 3V2RA 1BGYE 2WPQA 4XE5B 2C9NY 1KILA 1GL2D 2JKVA 1X9VA 2FXOA 4GODA 4KJMA 2FYUE
chains in the Genus database with same CATH topology
1H0TB 4EYYQ 4NPFX 1S3JA 1OVVA 2QVAA 2QRXA 2P58A 3PH0A 4HKZH 4NPDA 2KS1B 2R44A 4ZMDA 1X0TA 1Y47A 4WWIA 1BDCA 2KZJA 1EC5A 5DJTB 3MHVA 2LR2A 2KZIA 1FC2C 1OVRA 2OTKE 1EDIA 1BDDA 1NVOA 1EDJA 2I8DA 2B87B 1LP1A 5CBNA 1EDLA 3FXDA 4CPGA 1ZXGA 4JBZA 2RKLA 1SS1A 2K3RA 2KIKA 4K3AA 3RGUA 2M0BA 1LP1B 4HJGH 2WMMA 1DEEG 1U7MA 3FXEA 4ZNCA 4HB1A 4IOIH 4NPEA 1EDKA 4ASWA 1JM0A 2SPZA 1H0TA 2LXCB 1U7JA 1MFTA 2HR3A 2B88A 2ZAEB 2Q1KA 2JWDA 5K5GB 1ZW0A 5CBOA 1OVUA 5DJUB 2KUBA 5C39A 4ASVA 4MN4C 4BXLA 4GOFA 3QWOC 1JMBA 2KI7B 2M5AA 3S1KA 4GOEA 2UWJE 2B89A 2LXBA 4GODA 5EFWB 4KJMA 3ZDMA 3MZWB 1LT1A 2B87A 4K35A 1Q2NA 2M5AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0T B;  4EYY Q;  4NPF X;  1S3J A;  1OVV A;  2QVA A;  2QRX A;  2P58 A;  3PH0 A;  4HKZ H;  4NPD A;  2KS1 B;  2R44 A;  4ZMD A;  1X0T A;  1Y47 A;  4WWI A;  1BDC A;  2KZJ A;  1EC5 A;  5DJT B;  3MHV A;  2LR2 A;  2KZI A;  1FC2 C;  1OVR A;  2OTK E;  1EDI A;  1BDD A;  1NVO A;  1EDJ A;  2I8D A;  2B87 B;  1LP1 A;  5CBN A;  1EDL A;  3FXD A;  4CPG A;  1ZXG A;  4JBZ A;  2RKL A;  1SS1 A;  2K3R A;  2KIK A;  4K3A A;  3RGU A;  2M0B A;  1LP1 B;  4HJG H;  2WMM A;  1DEE G;  1U7M A;  3FXE A;  4ZNC A;  4HB1 A;  4IOI H;  4NPE A;  1EDK A;  4ASW A;  1JM0 A;  2SPZ A;  1H0T A;  2LXC B;  1U7J A;  1MFT A;  2HR3 A;  2B88 A;  2ZAE B;  2Q1K A;  2JWD A;  5K5G B;  1ZW0 A;  5CBO A;  1OVU A;  5DJU B;  2KUB A;  5C39 A;  4ASV A;  4MN4 C;  4BXL A;  4GOF A;  3QWO C;  1JMB A;  2KI7 B;  2M5A A;  3S1K A;  4GOE A;  2UWJ E;  2B89 A;  2LXB A;  4GOD A;  5EFW B;  4KJM A;  3ZDM A;  3MZW B;  1LT1 A;  2B87 A;  4K35 A;  1Q2N A;  2M5A B; 
#chains in the Genus database with same CATH topology
 4EYY Q;  1S3J A;  4PV1 B;  2ZYA A;  2LKM A;  1KIL C;  3L73 G;  3OA7 A;  1OX3 A;  1VQ7 P;  1QVG O;  3H1H D;  3GW6 A;  3SWY A;  2R3C A;  4HKZ H;  3Q3D A;  1HJ0 A;  2XNX A;  3CXH I;  2YNY A;  2KLU A;  1K05 A;  4N78 E;  5M1B A;  2Z5H A;  2IFM A;  5CCH A;  3AEF C;  5AW5 B;  3L75 G;  1Y8A A;  2QE7 H;  1USD A;  1VQK P;  3RK2 D;  1JNM A;  1WRG A;  2Q9I A;  5APS A;  3H32 A;  5CCH C;  1JTH A;  3A2A A;  3VP8 A;  1MUU A;  1VQ9 P;  4KT0 J;  1P84 I;  2P10 A;  1KTM A;  1NTM J;  5KAI E;  4IFD K;  1SQQ E;  4H0L D;  3NMD A;  1BCC D;  5AVU B;  3L4F A;  1NTZ D;  1IFD A;  1PV3 A;  3V2N A;  2WZ7 A;  3WMM 0;  3CWB E;  3TGU E;  3AE3 C;  5KTB A;  2KUB A;  5C39 A;  2PFX A;  2FKW B;  4MN4 C;  4PJ0 H;  4C46 A;  5KLV E;  3QWO C;  3VYI A;  4RKU J;  1M8O B;  5AVS B;  1LT9 A;  3H1I E;  2HFE D;  1GU5 A;  3AE9 C;  5AVW B;  3PRJ A;  1SQV D;  1ZRT D;  3BAS A;  1GL2 A;  1LT9 C;  1J1D C;  1K9M Q;  5AW9 B;  1SQX K;  3H1H G;  2P1J A;  4C7N A;  3SSU A;  1A02 F;  3JCU H;  3Q1M A;  5AW0 B;  3H1J J;  2I8D A;  2B87 B;  1LWU B;  3I55 P;  4IL6 E;  1NKN A;  4W80 A;  2NPS B;  3C9I A;  1RF1 B;  1KZU B;  2B9B A;  4HJG H;  1YTZ I;  3VMX A;  3VOP A;  4YXW H;  1DEE G;  1RQU A;  4RO0 A;  1L0L K;  1FZC B;  2IYP A;  3P8M C;  3GHG C;  2XZR A;  4U7J A;  1SQB J;  4QMA A;  1Q90 D;  2O01 H;  2QM7 A;  3B4S A;  1T3U A;  1W2E A;  2E42 A;  2AXT H;  2YKO A;  1T3J A;  5CBO A;  5TIS E;  3L70 J;  1S5L H;  3AEG C;  2OYI A;  1NH4 A;  3L74 E;  1PGO A;  3PTZ A;  2FFD C;  2M3B A;  2KI7 B;  4PD4 E;  3H1L J;  2UWJ E;  2ZVN B;  2B89 A;  4UB8 H;  2BCC J;  1JMM A;  3VTP C;  2OYI C;  3PHL A;  3KDP B;  3A0H E;  3PLN A;  4NPF X;  1OVV A;  3GF7 A;  1HVV A;  1NGM B;  2P58 A;  3USS A;  2GM4 A;  3GG2 A;  2IFN A;  3N7N A;  1NTM K;  3MD0 A;  3GMA A;  4W7Z A;  1PIX A;  3MUD A;  3PP5 A;  3CCR P;  2HOD B;  4Y28 J;  1N86 A;  3MTU E;  1OVR A;  5KAF E;  1YIJ P;  1IFJ A;  1S4X A;  2WQY C;  5KLI B;  3MIW A;  5APW A;  3L71 D;  1SFC B;  3MUD C;  3CXH D;  5KLV D;  5GTI H;  1ZP0 C;  1U57 A;  3KQG A;  2Q7C A;  1YIT P;  2E76 D;  1VF5 D;  4OGQ B;  1VQP P;  1J1E C;  2W27 A;  1YBK A;  4WVZ A;  1OW8 A;  2JEE A;  2XND H;  3PJS K;  5TJH A;  1AVY A;  3D70 A;  2FYZ A;  2XU6 A;  2H89 C;  1VQN P;  2P7J A;  3AE6 C;  2GUS A;  4B86 A;  1P84 D;  2WPR A;  1NHL A;  3HE5 A;  1PP9 J;  2KSJ A;  4BRY A;  4GOF A;  2QSI A;  3CCQ P;  1GW4 A;  2W6J H;  1KD1 Q;  2E5Y A;  3ZDM A;  3NFQ A;  4I6M C;  1FZE A;  1KQL A;  1PPJ E;  1USE A;  2OGU A;  3CX5 H;  1NTZ J;  5KKZ B;  3BCC J;  4GIF A;  5AW8 B;  1SP4 A;  4NPD A;  4JPZ B;  2D2C D;  4EI2 A;  1KQF B;  1SQB K;  2KS1 B;  3HD7 B;  3H1L E;  3KXD A;  3WU2 E;  3L72 E;  4N6J A;  3TNU B;  1HJB A;  2V4H A;  4RES B;  1EZV E;  1VQL P;  3CPW O;  1OW6 A;  1RE3 A;  2IBZ E;  2E74 B;  1KB9 H;  3T97 B;  1L0N E;  4PD4 D;  1SQV J;  3AE4 C;  3L71 G;  1NU1 E;  4PV1 D;  1NTM D;  1RE3 C;  1YTZ T;  4HB1 A;  1RHZ B;  1SQP J;  1OZH A;  2QJY C;  2O1J A;  5KJ7 D;  1SQX G;  2JDI H;  4PJ0 E;  1AVO A;  3CME P;  5AW2 B;  3RK3 D;  1ZME C;  2E75 B;  3TYY A;  2QIW A;  1BGY J;  4WY4 B;  2A06 D;  3S1K A;  4IL6 H;  3AE8 C;  4UB6 H;  2FYU J;  1VQ5 P;  2R5B A;  4H13 B;  2QJP C;  2MKV A;  1YI2 P;  1Q2N A;  4H44 B;  3JCU E;  1N73 B;  2J58 A;  1NAF A;  4L74 A;  2K1A A;  1K04 A;  2PRR A;  3SWF A;  3V6I A;  4IFF A;  2QJK C;  3MHV A;  1NOH A;  5TIS H;  3AE7 C;  1AQ5 A;  3EFF K;  4M3L A;  2YXR B;  1SQB D;  2AXT E;  1Q7Y Q;  1NTK E;  2D2C C;  3A0H H;  3O6Q A;  1S5L E;  3I5C A;  1FDI A;  1SQQ J;  2MJZ A;  2OYH B;  1URQ B;  1M1J C;  1NTM G;  1PPJ D;  2Q6Q A;  1NTZ K;  1MFT A;  3RL0 D;  4UB8 E;  2ZAE B;  3CWB J;  1FOS E;  3CC2 P;  3TGU J;  3AE1 C;  1IO4 A;  2V7Q H;  1N7S D;  2HPC B;  5KJ7 A;  3H1L D;  5KAF H;  2H88 C;  3HTK B;  1S9K D;  1Q86 Q;  2ZYD A;  5KLV J;  3P8C E;  2BCC D;  5CJ0 A;  4PV1 C;  1EXI A;  1JMB A;  2A06 G;  1EZV D;  5KJ7 C;  1JY3 O;  3MZW B;  3H1I J;  2IBZ D;  2M5A B;  5B5E H;  2R5D A;  3WUU A;  2H7H A;  3RK3 C;  1SQV K;  1KN7 A;  3G9R A;  1DEB A;  5GTI E;  4WWI A;  1KYO E;  1EC5 A;  2BAS A;  2WT7 A;  3V4Q A;  1LTJ B;  2WPV B;  2G8Y A;  3H1J G;  3LID A;  1AV1 A;  5CBN A;  1S72 P;  3Q2Y A;  2A45 G;  2WSC J;  2O01 N;  1AA0 A;  1ZXG A;  1GDT A;  4D6T E;  2Q3I A;  4K3A A;  4TT3 H;  3RBZ A;  2KYV A;  4YTP C;  4U3F G;  2C9L Y;  1GD2 E;  1GZL A;  2FYU K;  5GTH E;  4HYT B;  4ASW A;  1SQB G;  2FBW C;  3TSI A;  2LXC B;  2HR3 A;  3KHU A;  1PP9 D;  1MV8 A;  4AYC A;  3L70 G;  2Y9Y A;  3WU2 H;  3L74 J;  3A3Y B;  3CX5 E;  4LC1 A;  4DJG A;  2H43 A;  4Z1M H;  2IX7 C;  1R5L A;  1Q82 Q;  2LXB A;  2OTJ P;  3KZI H;  1N7S A;  2B87 A;  3AE5 C;  3FWN A;  3BCC D;  3RL0 C;  5BU5 A;  1GU4 A;  2QVA A;  3Q5R A;  1BE3 E;  1RF1 A;  2WSF J;  1N7S C;  2P67 A;  2KNC A;  1NKZ B;  1FZC A;  1LWU C;  1IFN A;  2V7Q J;  1KB9 E;  1X0T A;  1RF1 C;  2JWA A;  3H1K E;  5BVZ A;  1VQ4 P;  1IJD B;  1DD3 A;  2AEF A;  5AW3 B;  3KPE A;  1FZC C;  1Z56 A;  2YKP A;  2QM8 A;  1EDJ A;  3F89 A;  2BEQ D;  1LJ2 A;  2OTL P;  5KLV K;  3TF5 A;  1N8R Q;  1SQP D;  1KQS O;  4PD4 I;  2KP8 A;  3VP9 A;  3H32 B;  4EOT A;  3AEA C;  4NPE A;  1JTH B;  1Y9B A;  1QLE D;  3G3Z A;  3GHG A;  3HD7 D;  3M9H A;  1BGY D;  4UB6 E;  1L0L E;  1AJY A;  1IFM A;  4I1L A;  4Y99 B;  2K9J A;  2FYU D;  1PP9 G;  2E74 D;  1UIX A;  2HOD A;  1KOR A;  1L2P A;  3IR9 A;  1EQ7 A;  3E7K A;  1QL1 A;  1S5L X;  2G3A A;  4XA4 A;  2FFD A;  4KHX A;  1L4A B;  4K35 A;  1VPC A;  1BCC G;  1NTZ G;  2KSE A;  1WMK A;  1LT9 B;  2YIU B;  3L75 J;  4N78 D;  5KLI C;  3BCC G;  4WBA A;  3HE4 B;  1FOS F;  2E75 D;  1QL2 A;  1FJK A;  5APT A;  1QX8 A;  3L72 J;  2ZJS E;  1NJI Q;  1Y47 A;  1GL2 B;  1LNQ A;  5DJT B;  4OH8 B;  2N9Y B;  1HF9 A;  3C8V A;  3M9B A;  3G71 P;  5CCG C;  1NVO A;  1QVF O;  1LP1 A;  4C7N B;  3FXD A;  3AED C;  4CPG A;  2Q3E A;  1L0N J;  4JBZ A;  1SS1 A;  1NU1 J;  5AVZ B;  2R32 A;  1JUN A;  3B5N B;  1SQV G;  1KFM A;  1SQQ D;  2WMM A;  4H44 D;  2Y0C A;  1KQG B;  5AVY B;  4RJT A;  2IYO A;  2GUV A;  3CWB D;  2KK7 A;  3TGU D;  1M7L A;  2WSS H;  3RK2 B;  3M91 A;  2JWD A;  2O1K A;  1ZW0 A;  3EFG A;  4C7R A;  1KYO H;  4BWN A;  1LTB C;  2QEX P;  1BSN A;  1BGY G;  5B5E E;  1IK7 A;  1M57 D;  2Y0E A;  3M9Q A;  1LTG C;  1KB9 D;  2N9B A;  2KS1 A;  1OW7 A;  3HD7 A;  3H1I D;  4BXL A;  1PZQ A;  2KB7 P;  5KKZ C;  3TNU A;  3CCS P;  2FYU G;  2OYI B;  4H0L B;  1JY2 O;  1EZV I;  1LT1 A;  2WTY A;  5BU8 B;  3HD7 C;  3OW2 O;  1URQ D;  2CPS A;  2IBZ I;  1IC2 A;  5GTH H;  1A02 J;  4YPC A;  1M1K Q;  1G2C B;  4I7Z B;  3L73 E;  2C0W A;  1VQM P;  1CZQ A;  2FY8 A;  3OAK A;  2M8R A;  1FJP A;  3P32 A;  1BDC A;  2E74 C;  3P7K A;  2KZI A;  3B71 A;  4U3F E;  3VN0 A;  2OTK E;  1FZA A;  2O01 J;  1HUC A;  4YXD C;  2IZ0 A;  3L75 E;  2RKL A;  2AXC A;  2R3S A;  1NTK J;  3IF4 A;  3RGU A;  2H8P D;  1LTA C;  1ZV8 A;  5APU A;  2E75 C;  3FXE A;  4IOI H;  2E5T A;  1SQQ G;  4DOJ A;  5APQ A;  1CI6 B;  4WY4 C;  2KLV A;  1LTI C;  4O9B A;  2FYN B;  3L74 D;  3CWB G;  3RL0 g;  3KZI E;  5AW6 B;  3TGU G;  1N73 A;  3CCL P;  5KLV G;  3CXH H;  3Q5P A;  4H44 C;  1OWA A;  1N73 C;  1JY3 N;  2Y0D A;  4R4L A;  5AVV B;  2IZ1 A;  4BRY B;  3CC7 P;  1JCD A;  1H0T B;  2HG5 D;  4IL6 X;  2I1J A;  5L8R J;  2WPS A;  3HUS B;  2L5G B;  2OYH A;  1URQ A;  5AVQ B;  3H25 A;  1P84 H;  2LR2 A;  2Q5U A;  1ZLL A;  2AEJ A;  3H1H E;  2KOG A;  3NTN A;  3E1I A;  1PFI A;  1GK4 A;  4D6T J;  2OYH C;  1URQ C;  1HGZ A;  2Y9Z A;  1MZ9 A;  1W2B O;  3V5B A;  3TDK A;  3HTK A;  1CW5 A;  2HLO A;  2YMK A;  4ZNC A;  2ZXE B;  1SLQ A;  3G6E P;  1JM0 A;  1NYH A;  1FDM A;  1JY3 P;  3L35 A;  1M1J A;  1OMI A;  3L73 D;  1GK6 A;  1DIP A;  3L74 G;  5DJU B;  2E76 B;  3W68 A;  1KYO I;  1VF5 B;  3WUT A;  1YYC A;  1PGP A;  3E1R A;  2ZFC A;  3VMA A;  3CCV P;  3I56 P;  1N2D C;  3L75 D;  2AEM A;  3R4Y A;  1JO5 A;  1BE3 J;  1NTK K;  3EQ2 A;  2C0X A;  3VMY A;  3L72 D;  1X22 A;  1FS0 E;  2FXP A;  3FGA D;  4EDF A;  2NPS D;  1XTG B;  2ZXX A;  2FXM A;  2W6A A;  4HH2 A;  2R44 A;  3II6 A;  1QEX A;  3H1K J;  1DH3 A;  1W5C E;  1RE4 A;  1FZF A;  1ZRT E;  3CCM P;  3D71 A;  1K73 Q;  3V4W A;  3RBX A;  1PGJ A;  1L0N D;  2OAR A;  3GLM A;  1NU1 D;  1MKM A;  1SQX J;  2E43 A;  4DCK A;  3U59 A;  1H89 A;  2Z4E A;  1SQP K;  3LIE A;  1RE4 C;  3CX5 I;  1AFO A;  1L4A D;  2K3R A;  2D2C B;  1LTT C;  1FU1 A;  1IZN B;  1EDK A;  1FE6 A;  2OYO A;  3O6Q B;  2SPZ A;  1L0L J;  2L91 A;  3WUV A;  1X79 B;  2A45 H;  2K9Y A;  3A7O A;  2ZT9 B;  1FDO A;  1LTS C;  1LGH B;  5AVR B;  2N1T B;  3BRT B;  3D6Z A;  1KB9 I;  1R8E A;  4DT0 A;  4ASV A;  2BEZ F;  1YJN P;  3B5N D;  5CMZ A;  2JR8 A;  2VRS A;  4R4M A;  1PPJ G;  1ZOY C;  3RK3 B;  3AEB C;  3AEE C;  3UIA A;  5E79 H;  1SFC D;  1JOC A;  2WVR A;  3H1L G;  3L72 G;  3U1A A;  2BCC G;  1KV4 A;  5CCG D;  3L37 A;  4OVN F;  2OQQ A;  3CCE P;  1FC2 C;  1LWU A;  1EZV G;  1KIL B;  2YO3 A;  4OGQ D;  2XV5 A;  2NPS A;  1BDD A;  1NTK D;  2IBZ G;  2GA1 A;  3K5B A;  2WT7 B;  2K88 A;  1L0N G;  1NU1 G;  1SQQ K;  2YKQ A;  1S2E A;  1IFP A;  2NPS C;  1YJW P;  3G4S P;  3L71 E;  3S9O A;  4ZKU A;  4Y99 C;  3CXH E;  1FBM A;  1L4A A;  3BVH A;  2QA4 P;  1RQV A;  3CCJ P;  1VQO P;  1SQX E;  3P8C D;  4L76 A;  5AVX B;  2ITA A;  1OVU A;  1L4A C;  3HE4 A;  3M0D A;  1T2K C;  1DD4 A;  1RF0 A;  5CHX A;  1NAY A;  4A7P A;  5AW7 B;  2YIU C;  1JY2 N;  2I1K A;  4GKG A;  2W90 A;  3V2Q A;  3M0D C;  3NXS A;  3O8Z A;  5EFW B;  3RL0 B;  1RF0 C;  1P84 E;  4LGD E;  1GL2 C;  1FAV A;  4W7Y A;  1XTC C;  3A0B H;  1YQ4 C;  1N7S B;  1KYO D;  3B5N A;  1BSH A;  3L73 J;  4EIJ A;  3ITK A;  5B66 H;  2IDB A;  4DZO A;  1HH0 A;  3V2P A;  4U3F J;  2KNC B;  2CK3 H;  2KZJ A;  3B5N C;  1JCC A;  2JP3 A;  4D6T D;  1CSB A;  2YMY A;  1SFC A;  4L75 A;  1M90 Q;  1R5S A;  3FX0 A;  1J1D B;  3CLQ A;  3JSV C;  3H6P A;  5CCG A;  1NTK G;  2KIK A;  3CMA P;  1SFC C;  3RK2 C;  1UII A;  2QG4 A;  3FWL A;  4JYB A;  3U1C A;  4WY4 D;  1KFN A;  5CJ4 A;  1JY2 P;  4OGQ C;  1E5W A;  3CX5 D;  4JF7 A;  4H13 D;  1NTM E;  1QGK B;  1AQT A;  2WWW A;  2B88 A;  3Q5S A;  5H2F E;  4H0L C;  5AW1 B;  3AE2 C;  3EWK A;  3GHG B;  1G2C A;  2WSE H;  2A45 I;  2J5U A;  1SQP G;  3C1L A;  1N7L A;  2KXP B;  3BAT A;  3RK3 E;  1BE3 D;  4I7Z C;  2K9J B;  2YO2 A;  2PP6 A;  2K37 A;  2RN0 A;  2A06 E;  4LLH A;  1VQ6 P;  2W6B A;  2FFD B;  2QRX A;  1EXJ A;  1JB0 J;  3PH0 A;  3H1K D;  1T6A A;  1KIL E;  1RH5 B;  3GF3 A;  4ZMD A;  2JJL A;  3OJA B;  3H1H J;  4IFM A;  1CI6 A;  1SQX D;  5APX A;  1FZB A;  4D6T G;  3T97 A;  4TLF A;  5APV A;  1HWT C;  1G1J A;  3H1J E;  3SFD C;  3MP7 B;  2CPB A;  2FYN C;  1LP1 B;  1YQ3 C;  1NO4 A;  3N4X A;  1U7M A;  5APY A;  1L0L D;  2W83 C;  3IN6 A;  4XFJ A;  3CCU P;  1H0T A;  1SQB E;  1U7J A;  3SWK A;  4GT1 A;  3QH9 A;  4JYC A;  2ZYG A;  1JEK A;  3LW5 H;  2YXQ B;  5K5G B;  4WY4 A;  3A5T A;  3M06 A;  1BCC J;  3IAO A;  3HUS A;  1J1E B;  3L70 E;  5E79 E;  5KAI H;  3R2P A;  1IK9 A;  3HUS C;  3CI9 A;  2IPP A;  1S9K E;  1GW3 A;  1BE3 G;  4JQ0 D;  2BCC E;  4H13 C;  1FZG A;  4ZKP A;  2NZ2 A;  1D7M A;  4AUW A;  2PGD A;  1DX7 A;  5AW4 B;  1H88 A;  2ZT9 D;  5AVT B;  2HYN A;  2RMZ A;  1KC8 Q;  3W67 A;  1MFZ A;  3H1K G;  2WSE J;  2N1T D;  3HE5 B;  1HTL C;  3H1I G;  3D6Y A;  1Q81 Q;  2RH0 A;  1KMI Z;  1L0N K;  1NU1 K;  2P2U A;  1OFC X;  3BRV B;  1ZR4 A;  1RY3 A;  1S1C X;  3JC2 2;  1GTW A;  1WT6 A;  4L73 A;  1VQ8 P;  2M0B A;  3AEC C;  2PAJ A;  2POH A;  1NWQ A;  2DW3 A;  2E76 C;  2W8Z A;  1VF5 C;  2XKM A;  1L0L G;  1SVF A;  1HGV A;  2HPC A;  1IFI A;  2WSC H;  3M0A A;  4N3Y B;  1KIL D;  2WIT A;  2QJY B;  1M56 D;  3A0B E;  1K8A Q;  1E79 H;  2M3E A;  2O3J A;  3VMZ A;  5B66 E;  3MGN A;  2M5A A;  1YJ9 P;  1PP9 E;  4GOE A;  3CC4 P;  1ZN5 A;  1ZR2 A;  3TK1 A;  3H1J D;  2Z5I A;  3SFE C;  1YHQ P;  1BCC E;  3L36 A;  5CCH D;  4U3F D;  1NTZ E;  1OXZ A;  3LW5 J;  1TU3 F;  4PD4 H;  1J2J B;  1H8A A;  1LTJ A;  2ZVO B;  4I2L C;  3BCC E;  4AQR D;  1VL2 A;  2QJP B;  2XDJ A;  5H2F H;  1GMJ A;  2JO1 A;  1EDI A;  1X8Y A;  1LTJ C;  4GDO A;  1PGQ A;  4WB4 A;  1EDL A;  1HBW A;  1OIP A;  3L70 D;  2N1T A;  2WSF H;  3CL3 D;  3ABV C;  3B8E B;  2QJK B;  3CD6 P;  2J59 M;  3L71 J;  2ZT9 C;  1VDF A;  1SQV E;  2N1T C;  3S4R A;  2NRG A;  1SQP E;  3KYQ A;  3F5H A;  1G1I A;  1PL5 A;  4OWF A;  2Q1K A;  1T8Z A;  3HRN A;  1T2K D;  3IFM A;  1M1J B;  3V2R A;  1BGY E;  2WPQ A;  4XE5 B;  2C9N Y;  1KIL A;  1GL2 D;  2JKV A;  1X9V A;  2FXO A;  4GOD A;  4KJM A;  2FYU E; 
#chains in the Genus database with same CATH homology
 1H0T B;  4EYY Q;  4NPF X;  1S3J A;  1OVV A;  2QVA A;  2QRX A;  2P58 A;  3PH0 A;  4HKZ H;  4NPD A;  2KS1 B;  2R44 A;  4ZMD A;  1X0T A;  1Y47 A;  4WWI A;  1BDC A;  2KZJ A;  1EC5 A;  5DJT B;  3MHV A;  2LR2 A;  2KZI A;  1FC2 C;  1OVR A;  2OTK E;  1EDI A;  1BDD A;  1NVO A;  1EDJ A;  2I8D A;  2B87 B;  1LP1 A;  5CBN A;  1EDL A;  3FXD A;  4CPG A;  1ZXG A;  4JBZ A;  2RKL A;  1SS1 A;  2K3R A;  2KIK A;  4K3A A;  3RGU A;  2M0B A;  1LP1 B;  4HJG H;  2WMM A;  1DEE G;  1U7M A;  3FXE A;  4ZNC A;  4HB1 A;  4IOI H;  4NPE A;  1EDK A;  4ASW A;  1JM0 A;  2SPZ A;  1H0T A;  2LXC B;  1U7J A;  1MFT A;  2HR3 A;  2B88 A;  2ZAE B;  2Q1K A;  2JWD A;  5K5G B;  1ZW0 A;  5CBO A;  1OVU A;  5DJU B;  2KUB A;  5C39 A;  4ASV A;  4MN4 C;  4BXL A;  4GOF A;  3QWO C;  1JMB A;  2KI7 B;  2M5A A;  3S1K A;  4GOE A;  2UWJ E;  2B89 A;  2LXB A;  4GOD A;  5EFW B;  4KJM A;  3ZDM A;  3MZW B;  1LT1 A;  2B87 A;  4K35 A;  1Q2N A;  2M5A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...