4ZNEE

Igg1 fc-fcgammari ecd complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
215
Chain Sequence
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the interaction of human IgG1 with Fc gamma RI: no direct role of glycans in binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords High affinity immunoglobulin gamma Fc receptor I
total genus 38
structure length 215
sequence length 215
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zneE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zneE01
1JZ4A 4QY8A 2KZWA 3IS0X 4GLRH 4HWUA 2H41A 4MJIB 1HCVA 1YYLL 1IAOB 5CMAB 3KPOB 1LK2A 3L3DB 4AZ8A 4HUUA 3FAWA 1F8TH 1S9YB 3IKCB 4JM2F 3SPVA 2JB5L 4LOUC 3TEUA 1YUHB 3EOAA 4E5XA 2NXYB 2EEAA 3GIZL 3QCVL 2H2PD 4PRDB 4PJEA 5MENA 3C6LD 3MCG1 3PQYE 3GJFH 2R2EA 4NZDA 3CLEH 4P4RB 3D18A 4JFOA 3VCLA 1KC5L 1GYAA 4GRWF 1RZJC 3DVGB 5CINL 4TSCL 3C2AH 1CZ8L 1A1MB 3HKFA 1T4KA 4AEEA 3U30C 4N0CD 3VFNA 1I1CA 3DYOA 3HRPA 4WJ5B 4K3HA 1MHCA 3INUL 3OR6A 4X6CF 3MLTB 2ADFL 4HGMA 3ULVC 4LSTH 4XXCA 3KJ6L 3QDMD 4ORGA 4KKCC 1QSFD 4MVBC 5GGUB 3MRQA 4Y7MA 2I9TB 5EZJA 4B7IA 4F58L 1TQCC 3ARBA 4XWOD 5K9QG 5ELIA 4DW2L 5ID0A 4HG4J 1LHZA 5JXEC 2QHRL 4LLVA 2DTML 2NY2B 1XGYL 1JGEA 2VDLH 4OZGB 5KVEL 4XC3L 4Q6IB 3TT3H 5I9QB 3QWRD 1SVZA 1U8OB 2VR9A 4YO0A 3KDMB 3VA2C 1S9XB 1ZLUH 3TO4D 5CGYC 3UO1H 5DVOA 5F1SA 2AI0H 4BELD 5AWNL 1K6QL 4WRLA 1S9YA 2JELL 3MROB 1XCQA 3MZTA 4M61B 5JQHC 2QSQA 1J0KA 5DSCB 5CJQH 1KXVC 4NQXB 4NGHL 2XTJE 5DFVD 5JLZA 5L0QC 4KJYA 3W5MA 1UVQB 4YXHH 2DM3A 5FUOL 4RSVA 4WI9A 2BVPA 3WJJA 2A74B 1I4FA 4PJDA 1JWSA 1YEJL 4M48L 4PY8J 1C5DA 1P53A 5IQ9A 3L3GA 1FL5A 3V5DB 4FFVC 5E9DB 3QCUH 2DQGL 4OLUH 1A6WL 1S3KL 4XAKE 1A22B 3B2VH 5SX5K 3WLBA 1EHAA 2Y5TA 4KRPC 2XQYK 5MI0C 2R69H 4C59B 3UMTA 2ADIB 4KK8D 2NPLX 3PP4H 5IB2B 4GAYB 3DRQB 1J1PH 2OLDA 1DBBL 1U36A 5ALBH 1R6VA 3GJFK 4XGZB 1ZLSL 4FFYL 1KJ2A 3JBG7 4RNRB 1V7MH 4L3CA 4NZUH 3JWDL 4P2OA 4OLYL 4I77H 4XMPH 3EYOB 1MIEL 5DD5H 3RGVA 1FYHB 5KTEH 2ENSA 3LKNA 3NABH 1CT8A 1KC5H 4AQOA 4G8EB 4JAMA 1CBVL 5IW6A 1YYMH 5DR5H 4UNTA 3KJ4B 4LAJH 1B0RA 3BQUD 5D1ZC 3V7AE 1NBZB 3MRCA 1FORH 1KN2L 1YNKL 3ZTJG 2MSPA 5C0IA 4OLVL 4U1MB 3ZDYF 1QVOA 1V05A 4HS6A 5F3HB 5F7DA 1FYTD 3V5KA 1V3LA 3H6JA 2NY1D 4PJAE 4ZOCA 4RAUA 2XWBA 4P5MB 1IGFL 4IOFD 4LHUB 2RCSH 5T1DL 5IP4A 5JW5A 3NPSC 3PJSB 4CVUA 1CCZA 3DUSB 3M8OH 3QPXH 2IF7A 1NDGB 1P7HL 2A2QT 5D96B 4X7EC 3U0WH 1AQKL 4U2YA 3MRLB 4PRIB 3FQTB 2CKNA 1WT5A 2YS4A 4XAWH 3SEPA 5DQ9A 4L4TE 5T1LB 1MPAL 5C0FB 4K3EH 2XN9A 4C56A 4HX1B 1IC5H 1KB9J 1J5OL 2Z93A 1EO7A 5ENWA 5BS0A 3I6KA 1C8PA 43CAB 1RUQH 4POYA 1LVEA 4OLWL 3UYOD 2D9QB 1RIVH 4WW1A 3QXAA 4EOWH 4PBWD 3FAXA 5DYOA 5HYSG 4NC1C 1CZ8H 4RFOH 2CD0A 4D0DA 2XZCH 1WCQA 5FA3B 1XR9B 1CXHA 4PGBB 5EZLA 5CZXD 4N0UA 5IVXF 3CDYA 4N8PA 1NAML 4M3KB 5AWNH 5I1HH 4WEBH 4WW1B 3CCHA 1U2HA 5BZWB 4H25B 4Q9CA 2EE3A 5IMLA 5DMKB 3TO4B 4XP6H 1MCWW 2GJJA 1JRHH 1Q72H 3ARDC 5GGTH 4O2CB 4F7TB 4WW2B 4N0UB 4LVNC 1N2RA 4XHJC 4F33B 1I7RA 1VFUA 4A6YB 4DUWA 1O7VA 5I1DA 1LEGA 2NYYD 3NPZB 5DQ9B 5TQ2H 1XIWD 1CL7L 4RAVB 4XP1H 2CIIB 4JDTH 4FZEH 1E28A 4JRXB 4JFDE 3GI8H 4R2GC 3MC0A 4JRYD 1GVIA 1TCRA 3GMOA 4MAYB 4WI3A 3TIDB 3PGCB 1IAIM 5M7QA 4P5TD 3G9AB 5GRVK 1OGAD 3SDDD 1EBPA 1FFRA 1T7ZA 4PG9B 5ENWB 5F7WC 1UH2A 3S36L 3KPLB 2CUIA 4LLMB 3V7AG 3ZKQD 5B38A 3QHFL 2EE6A 5DEFB 4RRPG 3QUZC 1HHIB 1T7XA 2DWDA 3OB8A 1JE6A 4P9HH 1S9WB 5SWZE 1HILB 3MGOA 4HKXB 2AXJA 2ICWA 2L4OA 3QYCA 5IV2B 5C0CD 1FNLA 1T83A 3T4YB 2WBJB 2Z4QA 1A6UL 1OWWA 2E3VA 2BSRA 1MVUB 3S88H 1KEMH 2CR3A 3LV3B 3BZEA 1FZJA 3LOWA 3MCLL 4OCNC 1U8MB 2ZUQC 5HHVL 2P42B 1F45A 1L7IH 5KW9L 3VWKA 1ZTXL 1XF5A 1DUZA 2O5YH 5D7IF 2V9QA 4OV5B 1NUGA 4G8FA 1O0VA 4MNQD 4PJCF 5C0AD 5IOPA 5T33H 2XWJB 4KDWA 4DN4H 1MVUA 1KJVA 2DN7A 1KB5H 4H1LB 5FA4B 4NWTL 1MRFH 3BP7B 3VFTB 1FYTB 4M00A 3ZDZE 1R0AL 2ICEA 2R39A 3IJSB 1IT9L 5DS8B 2BP3A 3AB0B 5FDYA 3JSSA 1XF2A 4NWUL 5CSZA 4G9DB 3OHXB 3QUYA 1GGYA 4TRPH 4XBGB 3RWEB 1C16A 4IMLB 4MDIA 4GJTB 2F74B 4GQPH 1KLUA 2FGWL 4PTUA 2CQVA 4P5TA 3EJYD 1HI6A 3WYRA 4OZHE 4ODTH 2ICEB 3MUJA 3I3BA 1FVDB 4IRSC 2C7UA 3LKRA 5DMIH 4HWNA 4BZ1L 2EIDA 5GGVY 2GSIA 5GISH 2R8SL 5T1DH 5K9QI 1YMHA 2VXTL 5IROC 2K1MA 4PJIE 4CKVX 2WM0A 3FOMA 4HUUB 2ARJB 4LNRB 3RPKA 2FSEA 3GJEB 2PO6C 2ZCLH 3KPQA 4ZTPH 1MNUL 4MB4A 4TVPE 4ZG1A 4P2QA 5DZNA 4KKLD 4P49A 4PRBB 3DUUB 1H3WM 1U3JA 3EYQC 3ABZA 4JDTL 3HR5B 4U1SA 1U41A 4GBXA 4ENED 2D4FA 2AQ1A 3RY4A 3IRZA 4LNRA 2HMIC 1Q8MA 3LSOB 2K7PA 3BZ4B 5HYQB 2IAMB 4ELMA 2YRLA 2VR5A 2KBGA 2R1XB 1GCFA 1K2DB 3HNSH 4G5ZL 5GGTL 2NTFB 3TN0A 5A2LH 1OB1B 1TETL 4U1SB 4UNVA 4GG6E 4JY5H 4JY6B 3G04B 5FO7B 5C0CB 3OKMA 5CEZE 1FIGL 5ICXB 1KIQA 1OAQH 1CDHA 2ZCKH 4F15B 2J5LB 1VKXA 2NXZD 1G1CA 5F3BA 3CD4A 3OHXA 1AJ7L 1I3UA 5I73C 4L4VE 5D71L 3MRNA 5FGSA 1U95B 3H7BB 5ETUB 5C8JA 2PNDA 4PJXA 5C0DB 3X3GH 5I1AA 1DBJH 4JRYB 1IAIL 2VXUH 3MJ7B 3HZYA 3IDJA 2W07A 1AR1D 3ZE1F 3HFMH 1P6FA 1OGAB 4JO3H 3SE3C 4AEHH 3PWVA 1A7PH 4PB9H 2X70B 3DX8B 5D9SB 1RZ7H 4EBQL 3D0LB 1ZHLA 5D1XD 1KNOB 4NQXA 4HMEA 5FM5M 1LO4H 2Z31A 5J11B 3QWQB 3X11B 4TSAL 2GY5A 2A6DA 1D6VH 3AS2A 4DN3L 1P4LB 4X6BA 5GGSY 5DJ2A 3IFLL 5DZLA 1KB9K 1ZVYA 4E5XB 4PY8I 2B1HL 5E08H 3STZA 4M48H 8CGTA 5EWIH 5KOMC 1JP5A 3W9EA 2NY3B 4GRWB 4LSUH 2ADJA 3QEQA 4CN6A 4RMRA 3AFLA 1CLCA 1YEHL 4LGSB 4Y5VB 3X11A 1CE6A 3G5YB 4NQTA 1FN4B 5IGXH 1H15B 3MLUL 1NCDL 1IGYB 2LU4A 3HE6D 4Q0XL 3CDGA 4BKLA 2P46B 1WZ1L 1I3GL 3CFEB 1J8KA 1T20B 4PRAA 4X6FA 1IAMA 1QR4A 1UCTA 1Q94B 4BUHA 1PVHA 4F9LA 1IJ9A 4PJ7F 3SKJL 1VPOL 1NCUA 1S78D 4XNUH 5F7MC 3P0YL 1TVBB 3P3YA 4NQEE 2HFGL 2P5ED 4FQ1L 2X89A 3JWOC 3MGTB 3PWVB 5D9SA 2YA1A 4IIQA 5DS8A 3KYKL 4KY1H 4OCLC 2OXHA 5BRZA 3PWJB 4QF1B 1QKZL 4ISVA 1LK2B 5CBAB 5HVWA 2OZ4L 3T2NL 2X09A 3WFHA 1M7XA 5IT2L 5EPMA 2NNAA 3C5ZC 3QHZH 4U0QB 3SJVA 5F9OL 5JDJA 4EOWL 6FABL 2EKSB 2R0ZH 1MQ8A 3KPNA 5C09E 1KYOK 2EC9U 3QQNA 1MLCB 2VMFA 3GSWB 4HKZB 1S7VB 1BLNB 3FO1B 1GJIA 3C2SA 3Q2CA 4PJCE 4H0GA 1F3JB 4JQXA 1MQKL 5IB3A 1ZE3C 3ARFD 4ODXA 2M2DA 2ARJQ 3TPKA 3U7AA 1DN0B 3KHOA 3VXUB 4ORGB 2RR3A 2IAMD 4X5XA 3QIUC 3MBEC 4FNLL 5L8JB 3KPOA 3ILPA 1MNUH 4PRNA 3GJFB 5DD3H 2P8LA 4AJ0A 5FOBB 3SDAB 2EXWC 4N0YH 1QSEE 5DJXB 3B2UC 2HT4C 1ZLVH 5B39A 4JANB 1JGLH 2QSTA 2R2EB 4JR9L 1EA9C 2AJVH 2OYPA 4IDLA 3VD3A 4L5FH 1TMCB 3D9AH 3QFJD 2RFXB 1F11B 1JN6B 2FD6L 4YGVA 4CRPA 3LQAC 5HY9B 1T89C 2P5EA 4ONHB 5DD0H 3VWJB 5EUKB 4BZ2H 1X44A 2WIMA 2Z92A 1X4ZA 1NBZA 4O2CA 3LIZH 3SE9L 3QUXC 2HTLD 5JOPD 3FB8A 3SCMA 4XCNA 3VGDA 1CICC 3ARSA 5D1QD 4Y19B 5I8KH 1TVDA 2F58H 3GBNH 2B7DT 2R2HB 2P1YA 5FM4A 1BD2E 4TPRL 3HE7D 5KJRL 5C71A 4R9HA 4AIZB 4L8SC 5HBBA 4HWBL 3H42L 3SQBA 2UZIH 4ETYA 4ZDHB 3QUYD 4XCNB 2IADB 4MXQC 2FWOA 4WFFD 2YBRA 2NY3D 3U46A 1ETZB 2E7LA 4Z8FL 3U1SL 4NFBA 1ZSDA 2HH0H 3C8HA 3VI4F 4LSVH 1AGEA 1OAZL 2WQRA 4LSRH 1NMAL 1FFPA 4DKEL 3P0YH 3MR9A 1HHGB 2J8UB 4AH2A 2PTTB 5F44A 1R3JA 1BMGA 2ADIA 3B4NA 5FM8A 3BYTA 4Q9RL 3OKOA 1R3IL 1X5YA 1MRCH 5DGRA 4JRWA 1H9VA 1A14L 1LDPH 1Q9KA 5EOTA 4DKFL 2XA3A 1RZKL 2VQ1A 3SKJH 5FAAA 1WFOA 1Y0LA 4ZS7L 2MWCA 1LO0L 5DYOB 4JFQA 3O6ML 1J10A 4HFUL 3S4SA 5ACLA 2JJSA 2ICES 4QNPF 4NQSB 3FONB 5KSUB 3BFOA 2ED7A 3L3JB 5DUPL 3HB3D 5GZND 1AXSA 3W39A 1EUUA 3LEVL 2WNGA 3QHZL 2VDLL 5DO2C 4OCXL 4HZLA 2OJEA 2YXMA 3TYFB 6FABH 3BT2H 4L8BB 4Y5XC 4YX2H 3QFJB 1VPOH 1JF1A 1NGZA 3FQXA 3KPRA 2OBGA 2V5YA 4NKDB 1RURH 1KPUA 3U6RB 1PDKA 5CJBA 4DJMA 1JV5B 4JAMB 1C16B 4IMLA 2GT9A 1NDGA 2E7BA 1D9KC 3GKWL 4KI5F 3K2UL 3VGGA 2P45B 4GQ9L 3ZDXF 3AC0A 3VRLE 1IGTA 2XICA 3W2DL 1BLNA 1D5IH 2GT9B 4HBQA 4LSPH 3QDMA 3REWB 4KI5D 3ZTJH 1JPGB 4DCQB 2Q8BL 4XPFL 3EO1B 2X4NA 4D0DB 5C09A 2X1PA 3OXSA 3DVIA 4ZO7A 4UTAH 5M95B 4HXBL 2CRMA 3B2VL 4GBXD 1GHFL 3SGKA 1WTLA 3QCUL 3T8XB 1E4XL 3QPQD 4M43L 1MFCH 1DANU 2Z93B 3MXWH 3F12B 4FG6C 3NGBC 3DUHA 2NW2A 3S96A 4RGMC 3NABL 5T1MB 1WICA 5FO8B 1XF5B 3P40A 1I1AB 1NCAH 2EEBA 2OS7A 2FX7L 4K3JL 4LVHC 4F7CB 5CP7B 4AEHL 1OLLA 5DQJB 1CGTA 2DIBA 1SJHB 5BOPA 2IJ0C 5I75C 3F12A 1DEDA 4H1LA 4OGAC 4JO4L 1UFUA 4NO5B 4OZFG 1MWAH 2QR0B 3IETA 4EI5C 1FAIL 4N0RA 5EOCJ 4I2XE 1RULH 3ZL4H 4RAVA 3ZT7A 2PO6A 5E0QA 4HCRH 2J4WH 2NTSP 3M45A 4IRZH 1I7TA 1LO2H 1B0GB 1S7WB 5DVLA 4WHTA 3CFJB 4WW2A 3EO1A 1MY5A 3VG9C 3KPLA 4ODTL 5EUOA 3VXNB 1AXTL 5D1XA 4Z7NF 1IGJA 4Z76B 1PGRB 2HAZA 3QRFM 1CXFA 3RL1B 1CI5A 1WEJL 3VI3E 2EDBA 1AD0B 2MCG1 5CIPH 2P5EE 2P5WD 2BNQE 3T4YA 3PWUA 5DURD 4GG6B 3S7GA 2VOTA 5ESVB 5T1KD 1MY7A 3IU4L 2X4PB 2W0FA 4LPTA 5FYLD 3VFOA 4ELME 1CFTB 5FDWB 4U1JB 3VRJA 4HLJA 2CMRH 2CDGA 1TENA 5D7SH 1MJ7H 4XVUC 3L5XL 4IS6B 1BZ7A 1F4HA 1XMWA 5TE4L 3JWNC 4Y1AA 4L1HA 3O3EB 1JYWA 5CSBA 4GG6A 1NCWL 1DLFH 4W6XB 3UEZA 2YPKA 4JKPH 3QP3A 3I02A 2DQIH 2KUTA 5DJCA 5FECB 5SV3A 4NQCE 1MI5D 3IU3A 4IS6A 1IAII 4FQCH 4U6TA 2GFBA 4EN3A 3O3DA 3RAJL 5F3BB 3S37H 4OIIL 1V3MA 3IFNH 4KKNA 4U7KA 3PL6B 1EDQA 4M7JL 4JZNB 2JF1A 6CGTA 4HSQA 2FHCA 1KLGB 5ESAA 2E8ZA 2P7TB 3O0RH 5F1NA 2XPGB 4XH2A 3FN0L 5EULV 5FKAB 1YMHB 2VIRA 4P2RA 4I3SL 4X7SH 2ZCHH 1CD0A 5IW1A 1NC4A 2VZOA 4HLZG 1F58H 1M6OA 3IXTB 4NZJA 4ODSL 3QEHA 4CVXA 3SBWA 1CDJA 3FRPA 5C07A 4POZC 3V8OA 2BC4B 1JF6A 1Q0XH 3RVXC 2B20A 3GI9H 2EXYC 3GJEA 4I13B 2GJ6D 3BUYA 3MZGB 3NN8B 1M6OB 3PGFH 2APVA 4L4TD 3BKYH 4YZFF 3TZVD 1CGVA 4UT6H 2GYSA 3NTCL 2XY1A 2CDFA 4PRDA 1QTYT 4R3SB 3RWFA 3UTOA 4U4BA 4GBXB 5GS1B 1IC4H 1RU9L 4QGYA 4K9EL 3ZYZA 4HF5H 1WGOA 4TOYH 1FCCA 4Y2DC 1G6RL 4XZUA 3ULVE 1U0QA 1EVUA 2F8VA 5MHSE 3OGCA 1L4IA 5F21B 4P2OC 4G43B 3PIQB 1NAMB 5KSAA 3OKMB 3BEWA 3AY4C 3B83A 2AJSH 1A3RH 5E70A 4ZTOH 2JIXD 2FLRT 4P9MH 4S0SD 1JZ8A 5F1NB 3HLAB 1BFSA 1UZ8A 1FIEA 5IHUH 1Z9LA 4WUUB 3GGWA 5C08B 3ULUL 2H9GA 4R2GB 1TVBA 2O5ZH 5JO5B 5H2BB 3VXMB 3QA3B 1BOGA 5GGSB 4PGEB 1FORL 5BZDA 2BXYA 4AENA 2WP3O 3MNZA 3MCLH 8FABA 3GMPB 1KN4H 4Y4HC 4C54A 1AY1L 2NY7H 4QNPE 1L0XA 2XFXA 2DQFA 1SEQH 4S1RL 1P84J 1P4LA 4ZUUB 2RCSL 1IVLA 4U1GB 3QEGL 4Y4KC 4Z7WE 3IGAB 3RVTC 3STZB 3S4SG 3THMH 2IBBA 3V9FA 2R29H 3U0WL 4LCIH 4FXKA 4PLJC 3UCRA 1Y6MR 4GG6F 4YHPA 1T7WA 3L3KA 2WBJC 3Q1SH 3MRBB 3P4LA 1KELH 1JGUH 3N1GC 4ZUTB 3QQ4A 4EKXA 1P4BL 5CBEB 3K2UH 4BA8A 2DBLH 5J57B 5E5UB 3HC3L 5HGAA 3IFOA 3QAZB 5EC2B 1OPGL 2I9LA 2AS5M 1I8LC 2Z31B 4M62L 1D5BB 1E6JH 2Y07H 5JOFB 2FHFA 1NCNA 3VXOA 2NZIA 2JJVA 2F5AH 3EOBB 3V4VL 5EUOF 3QUMA 2BOCB 5E5MB 4JFQB 2JIXA 1HZHL 1F3DJ 1S7UB 2BNRB 4M1DH 3BP6B 4O2EA 5IWLA 3KR3H 3OPZH 1XF4A 4JM2C 4D0BB 1Q0XL 5KVDL 1ZVHA 5FUZL 1UH4A 4ZSOB 4G9FE 4PBXA 3GSNB 5KG9A 4K23H 5BO1L 5C0EB 1F58L 4RFEB 2NY0B 1IM9B 2LQRA 4FQQA 1N5YH 3V6OA 5GIRA 4AIOA 2EYTB 2FNBA 3O8XD 5B21A 1INEH 1A4KA 1PFCA 4X5WA 4X98B 2OI9B 3L3KB 3RDTB 1XF1A 2XT1B 1CICA 3MUHL 4ZFFA 4UDTA 5CAYB 1IQDB 1N6QL 4O51A 2ZPKH 1PSKL 1ZEAH 5E8EB 5ERWA 4ZD3L 1NFDB 4HKZA 5I8EB 1EUTA 1HHHA 3BD3A 5E95B 3ZL4L 1A7NH 4JDVB 4URTB 1JK8B 5B4MD 3D18B 2J3SA 4FFYH 1MJ8H 4JFOB 3VCLB 3BXNA 5DHXB 1TNMA 4H1LH 1INDH 2X41A 2O5ZL 1M71B 3GJFA 5FB8B 4RFNC 2BDNL 3OR7B 1CDIA 3IF1A 4OFYA 3E3QE 4F15C 4UIMB 2BERA 2J5LC 2D0HA 4P2RE 5D6CA 2H45A 3QI9A 4P9ML 2AKRB 4TSAH 1JGDB 5J1AB 4ONHA 3W11C 5BV7L 1DE4B 1BM3L 3SDXE 1JZ2A 2VLRE 1NAMA 1MCKA 2ICWJ 5LXGL 3V8CA 1EO8H 1XIWB 4I18C 5DRZB 1J0YA 4TN9A 4K94H 4JPWH 4M1CD 5CP3A 5LJYH 1J0JA 2DBLL 3B3IB 4KK9C 3O9WC 5CEZD 5DHVA 5I16B 3BMVA 1CT8B 4PJ5E 2BY0A 4UT7H 4G8EA 4XMKL 1FHGA 2XTLA 5GS0C 3GBLA 2FGZA 4R4ND 4P57A 1RJCA 3OKKB 4Y19A 4DKAA 4OIBA 5DA0B 1BOYA 4NN5C 4F9LC 1S5IH 2J8HA 3SKOB 2AJUL 3KPNB 3U46B 3U7WL 4HK3J 2IH1B 4X5LA 2CKBA 5TDNB 4OF6A 1ADQH 1AGCB 1S7VA 2NZ9D 5F1OB 3INUH 3BZFB 1JMXA 5E6ID 5E8DL 4PJEB 5MENB 2PXYC 4IMKC 4LK4A 2RHEA 3ULUD 1GGUA 3BRGC 3FQTA 5J6GB 5ISZA 1TVHA 5TE6L 1IFHL 2BY2A 1IGTB 4NO2B 3BIAX 2ADFH 4WTZG 1ZK9A 3WHE1 3T0EC 2PTTA 1BJMA 2R9HD 4D94A 5AYUH 3U7YH 1AGFA 2X1OA 1A6PA 5KANI 1LO3L 4S0TD 2PYEA 1R5VB 3OV6A 2B5IC 5DRZA 3D9AL 4C55A 3L7EA 1F4WL 4UOW1 1LP9B 4YGVB 1Y0LB 1JGLL 4DQOL 3L5IA 4O2FA 4QKXB 3VWJA 1JHTB 5ID1A 5CZKA 1BJ1H 3ZE1E 2EDJA 1OD9A 4TUOA 1QHPA 1QQDB 4PJIB 2PETA 2PCPA 4X99B 3WIHH 3J8F7 4NHUA 4PJDE 1P7QD 3W39B 4QRPE 3T4AB 4FZ8H 1A0QH 1HIML 3D85B 2BCKB 4HH9B 4N68A 3RIFK 5DJYA 4LBEB 1YNLH 1OCWH 3GIVA 4K9EC 5HHPB 2C4FU 1GAFL 3AVEA 3TA3D 4G6KH 2VDOH 4R0LB 5CD5C 4P2QE 3ZSSA 1X9QA 3IJYA 3F7YA 4G9FA 3MRKB 4XNXL 1YECL 5J6GA 1UADC 4PRPA 4M5YL 4TOYL 1OOAA 4LSDA 5F88A 3KPRD 2JE8A 1FV1A 3G5VB 5I1JL 1T5XA 2A0LC 3EBAA 1YDPA 3V6OE 1MWAA 4CVXB 3E8UL 4YHNA 3LS5H 4YHIA 3LPGA 4KJYB 4GKOA 2BX5A 2OL3B 2BNUA 4NKIL 4QXUH 4NQDD 4X9FA 3S5LB 3IXAA 2QBWA 3SY0B 3GBNL 1HWGB 5I8CA 1EEUA 4N5UA 4M93C 1FZKA 5B38B 4NRXA 3JV5A 3VJ6B 2KQMA 3EKCA 2R0WL 4Z7WB 2E7MA 4WW2F 3TNNA 5TH2A 3C8KA 4XI5D 3RI5K 2BNUB 4ZNEA 1HH6B 1MRCL 3WEXB 1GC1C 3KYNB 4U6YB 1E4KA 4U1JA 4WFHE 4Y16C 3A6OA 1GGBH 5KSAD 3G6JF 1RUMH 3OAZH 2HVKA 3VWJC 5MEOB 1YN6A 2YHGA 4XZUB 3ARPA 4MB3A 5IVXE 4TYUA 2Q8AH 3S96B 3TV3L 5BVJA 1DDHB 1YJDC 4Z7VA 3EYOA 2XV6B 2LV4A 5DEGB 4Q7DA 3UP1A 4X4YA 4N1HB 4PJHA 4Y16A 4PJFF 5I17A 5DDHA 2BK8A 3MLXL 1T1ZB 4E41D 4G8FB 3PP3H 3SE4C 5I1IH 1TIUA 3MV7B 4NZTH 4Y2OA 1PY4A 4HS6B 1ZKAA 4RDQG 3RVVD 3CVHH 1WBYA 5IB1B 4O5LL 5EG6C 4H0HB 2R56L 3MRCB 2Z35A 5FYJU 3ZKMC 3PHOA 3VD4A 2NY4C 4PIRF 4X4YB 1G7IB 2WINA 5SX5H 2VJXA 4JEGB 3MACH 3JV6A 3VFSB 4JG1H 1IFHH 4LCUA 3WJLA 1OPGH 1DVFC 2M1KA 1P84K 1ZHLB 5HI3D 1RUAL 4FXLA 5HHNA 4IRJB 3UBXB 1EJOL 2ITCB 1BGXH 3SGDH 4GKSB 4LMQI 3A6BH 2V5MA 1CK0H 4FTVD 3VW3H 1S7XA 4P2YA 1CLOL 3BAEL 3EUUA 5GRZA 3WNPA 5GSRA 4Q9QL 4KKBC 4HEME 5IBLC 4EN3D 4OLZH 1BFOB 5HGAB 1KCUL 5HGDA 2D7QA 3FQNB 3JTTA 4RA0C 4RMQA 3RWHB 1T0MA 2XA8H 3WHXA 3RWJA 4UAOB 5IB5B 3LKOA 1UM5L 4XNMA 4PJCA 4I5BB 3K4ZA 5A2JH 1G6VK 4O58H 1A1NB 4D0CB 4N90E 4JREC 4YIQB 3DSNA 4X6DF 4QOKD 2ZJSH 4XCCH 1I7ZB 2A9MH 2VB5A 1CD1B 1C7SA 3MCKA 3TO4A 1X5FA 4CU6A 4JFZL 5EH1A 4A6YH 3QUXA 1D5XB 3QUZA 4JRXD 5C7XH 1D9KB 4MWFA 4FN0A 3ARVA 3BPOB 1MAJA 1VGKA 4JO1H 1DFBL 4PB0L 4QHKJ 5C07B 4NQCB 2R4SH 1RZ7L 2BVOB 1ONQA 5DJAB 3NIDE 2PYEE 2YA2A 3IU3B 2EYTA 1YPZA 2GIYA 4MAYD 1MCFA 4NFCA 5ADOL 3RWDB 4ZMAT 3RP1A 2YD9A 4JDZA 4K3JH 1FGVH 4NSKB 4YWGL 5DC0A 2NLJA 1YEKL 4P9HL 1YC8A 1FNSH 5HD8D 1N6QH 4OZIB 3BQUA 4O5LH 1KFAL 2AEWA 1BFOA 3EDDA 4YQXL 3D1MC 4J3SA 3S36X 1NUDA 12E8H 1QYGL 3H9HA 3MLXH 4JDZB 3MOAL 4QRRE 5FKPA 4LLQA 4W6YB 5KW9H 5J6HA 1FLTX 4QYOA 5LAXA 5DZOA 4UI2A 3MJ6A 3O2DL 3UROR 2FATL 3OJVC 3I02B 4PJAF 1I1AC 2P48B 3SPVB 15C8L 1FZMA 4LVHB 2B4CC 1WUNT 3TFKD 1SY6A 1RJZB 4YHZL 3HAEA 5IBUB 1Z0NA 2R1XA 3K1KC 3RZWA 1WAAA 5E2UL 1U8HA 2D3VA 1EEZB 1F4AA 4Z0XB 1CK0L 5F8RC 5CEZL 3VXRE 1QBLH 2Y72A 3LHPH 3FN3A 4JFDD 4M7JH 5EORH 4OSUH 4Z78B 1VGKB 4XX1G 2AGJL 5KS9B 2VXVL 4ZPTB 4KUZH 5IWLC 3GSRB 3A6BL 2OP4H 1U8HB 5CJOL 2AP2A 4L29A 2MPAL 5KG9B 5J3HD 4PJHE 3MMEA 3GSQB 2G75B 3GSOA 1I8IB 1G6RB 2ORBH 4DKFH 1KT2A 2HVJB 2VXSH 2I26N 1MEXL 1SBBA 1LEIB 2HN7B 5CS7A 3ES6A 4XMLL 3WLWD 3V6ZB 2YK1L 2OK0L 1A7QH 5HHOD 2YD3A 5HGBA 2XXCB 3VW3L 2ZJSL 2GSGA 4K55A 1T1XB 2D31B 3S36H 4P46C 2Y36L 5SX4H 1U6AL 3QDGA 4XVTH 1YEGH 3HC0A 5HJ3A 4P23D 5D70L 2F53A 4ODSH 4MNQE 3H0TB 4PJXE 4TTDC 3U48A 4GKNB 3HE7B 4U6XA 1UACL 1A0QL 1HIMH 2WV3A 3KYMA 3TN0B 3KLSA 3WDHA 3I6GA 4KROB 4MNGE 3RNQA 5FYKE 3KPRE 3UTQA 4K8RC 1MCBA 2JCCE 3MJ9L 1YEFL 4JM4L 1B9ZA 1UCBL 4UQ2A 4LQ1A 2DJSA 3VH8A 1DQDH 1ITCA 3KPMA 2WK2A 5D2LE 1JPSH 2CUHA 5DJ8B 3H42H 3IFOB 4R6UA 4U1HB 3H7BA 4KZEH 3PDDA 1YMME 5DR5L 4HIJA 1YYML 1R3KA 3MNZB 4NRZA 5CLWA 5EOQH 5ICYA 1H3XA 1R5IA 2HFTA 2IWGA 3HG1D 3G6JA 4EUPA 3BKJH 3WMSA 4NQCD 2WUBL 2ZNWA 3IAQA 1YEHH 3JTSB 1T5WA 3QEQE 2W60A 1TPXB 2YPLA 2AK4B 2R1WB 5CD3A 4L3EA 5DRXB 5FUCC 4WFHD 1T3FB 3DSFL 3JVGC 2CLRA 1HXMA 5EU6B 4YO0B 5EIQA 1EAJA 3D3VA 4KJPC 4PJDF 3FL7A 4JFEB 3EDJA 2Z8SA 3D39D 4D9QD 4NNPH 5TF0A 4HIIA 4LSQH 2C5DC 4QEGA 2P5WA 2C1OB 3FKUS 2R15A 3VD7A 2X42A 4M61A 4JGJA 2C3GA 5I8EA 5DMGC 3TVMB 4V1DD 2B8OT 5JPMA 4X4XA 3IKCA 2BNQD 3TF7C 5TE6H 1MFNA 4ZFFB 1KJ2L 4K3GA 3BD4A 3DYMA 4P2OB 3A67H 1FFPB 4XTRD 3RBGA 3OR7A 5C09B 4KFZC 2CK0H 4Y4FC 1NMBL 4JN1H 5L2KD 1KCLA 4WUKL 4L4TA 4OD3L 4HIJB 4UT9H 3SGEI 3NIDF 3N9GH 5ICYB 5HHOA 3ZKNC 4G8IA 2NQCA 3BGFC 5IW6B 1CG9B 1OARL 4U3HA 2DYPD 4JGUA 4RDQF 1OLZA 5C0EA 5I15H 3X12B 5EFIA 5I66A 3WKML 1LQSR 3GSVA 3UAJD 3WIHL 1QOKA 1B2WH 1MREH 3IDXL 4PS4H 1UQSB 3UJTL 3ARGC 5C9JB 4RMVA 1NCBH 1AFVH 4HIXL 5IFAH 4KROD 5SWZB 5C0BA 5L8LB 3D25A 2FEDD 5EU5A 2ESVE 5DURB 2IMNA 4NUJB 4P4KC 4LKCA 1MFEH 4K71B 3T2NH 5ISZB 1MJJA 3NVQA 4FQ2H 3E6FB 5DXWA 4WHCA 2JTDA 3SDCB 4QOKE 3WXVL 4L9LB 4M6OL 4YGAB 1YMMB 5KVMC 2MFNA 4TUJB 4XP6L 1YEIH 2ATPA 4FQXC 5F6IB 1N2RB 5EU6D 5E24E 4LASL 4ACPA 3UX9B 3RQ3A 1EGJH 1Z9OA 1ETZA 4UIKL 3WSQH 3BGMB 5JMRA 1BD2B 5IJKC 2DQUH 3SDCA 4UUJA 2IH1A 4JKWA 3CLFH 1T2JA 4JFDA 4B5EA 1A3LL 4PLKC 4JPIB 1EHLL 2ZPKL 3MODL 2FDBP 3D39B 3QDAA 5EZLB 1PZ5A 4NHCL 5DRWB 3QQ3B 1JNJA 4ZFZB 5GHWH 4BK5A 1WIUA 4UBDC 3VFGL 1OAYL 1BQHB 3MLUH 1VENA 3SDAA 4IJ3B 4LARH 1BZ7B 1EFQA 3DETC 4ETQB 3B3IA 4PRHE 5GGQH 2O5YL 2BSSB 4LBEA 3ZDYE 1DUYB 4H20H 4MGXA 2XIDA 3ROOA 5E6ZA 4JPWL 2Q6WB 5EO9B 5AZEH 1KJ2H 3BPLC 1PSKH 5FCUH 2H2SC 2B39A 4MYWB 5DD0L 4PY7B 4A2LA 4YC2B 4Z5RA 5JHLH 4JRXA 5BV7H 1KIRB 1SJHA 2C4FT 4RQQB 2UZYB 1CE1L 2R56H 4J23A 2YUVA 5ACZA 3FO0H 1CDUA 4UT7L 1KYOJ 4FS0A 3FFDA 4YBQC 4FP8L 1CGXA 2V2TA 1XCQB 3WKNA 5TDPB 4J8RA 4WWKC 2IPUG 5J1TC 1J0HA 3UPRA 5I2IA 5KSVB 1DR9A 1TJIH 4ERSL 5I9QC 3VFWA 5EO0B 1TCRB 3PL6D 4NNPL 1RJYB 3Q1SL 1DLHB 4WHYH 1BQHA 4IBLT 5I8OL 2WIIB 1QHOA 4WU5A 5K9OA 2H8PB 1DBMH 2APBA 5JHDD 4WHYG 5CEYA 5EU7E 4ZUSB 3SDCD 5ITFB 1SBSL 3EYFB 3DMMC 4RISH 4ODUA 3QG7H 3R8BB 4S1RH 4GAJL 2VZVA 1G7LA 1FLRL 4NUGH 3FZUD 2GJ6B 1MHPL 4JPVH 4P2RD 1A6VL 1ERNA 5T3ZH 2ZCKL 1HDMA 1KIRA 1XH3A 2WAHA 3IKKA 3PNWB 1QRKA 2QQNH 4XPGH 3AAZA 3WXVH 3EYUL 1CDGA 1NEZG 5EBMA 4L3AA 5J0BA 1DBAL 1XGRA 5TF1L 2OJEB 2IQAA 1EHXA 2G9HB 1YN7A 4HS3B 3AXLB 4E41A 3D25B 4QO1A 1P4IL 1P6AB 2DQDH 1FVCB 2OQJB 2PW2A 2VZ1A 3NIFE 1X5XA 5D70H 4KVNH 5J9PA 1IL1B 3C60A 3RGVC 3RWIB 5IKCB 2AJZB 5CSZB 4HULB 1FE8H 3T0EB 3VRIB 3RWEA 3O9WA 4NN6B 3OSKA 1YZZA 1PG7H 2X4OB 25C8H 4N0CC 4PR5B 5HYJD 5C08D 4XCEA 4YHKL 4HWBH 4PJ8A 1W72H 1W8NA 4Z76A 4ZTOL 3X17A 2LE9A 1G7IA 5E08L 1AD0A 3MV01 5DVMA 4KKCD 1U3ZA 5IHUL 2BRQA 3VG0H 3V52L 4OM0L 3L9RA 4LLWB 1CXEA 5CIPA 1SMAA 3RPIA 3QXVA 3OQ3B 5I0ZA 2F54D 1N64H 1YPZE 4RRPA 2HKHL 3K7UA 4GMTL 5JXED 3FFCD 4N9GA 4P4KA 3HE7A 1WAAE 4U6XB 3WFEH 5IR1B 4MA7H 4ONGL 5FYJL 4I5BA 3MJ8B 3MLVL 2DL2A 5DDHB 5I30L 1LD9B 5AYQA 5JQ6H 1A6ZA 2Y06L 1RJZA 3BZ4A 1DQLL 3ARBD 3GIZH 3QCVH 4LLYA 5E1HB 2R2BB 4V1DE 3B9AA 3I6LE 4M9OA 1Q9LA 3PIQA 1P7KA 3PHOB 4KV5F 4G6AC 4NM8L 3TT1L 1XF4B 1QSZA 1FVCA 2OQJA 2PW2B 1BVLB 1XZ0B 4WWID 1PX3A 1J05A 3RWIA 4OFYD 4UZGA 2W38A 5DMKA 4FQIL 1L9NA 3OJDA 3VFTA 2C26A 3GGWB 1KCSL 3LQAH 3LEYL 4O02L 1U58B 3UDWC 4XPTH 4Y4FA 4W70A 2PR4H 1IGIH 1INQB 4FFVD 4WY7H 3T0BA 4PJ8B 5GQBA 1FRGL 4PJXB 5A16A 1FNEA 4LRIA 2CR6A 3DV4A 3H9HB 4ODVH 2P8PB 3OX8A 5IEKB 3QI9C 3U36B 1UWGL 5LXGH 3GMNB 2X4RB 4NQCA 5TFSL 3SDXA 3DHMA 3W0WE 5A16B 4HJGA 4LPVA 3JZ7A 5DC9B 5A3IC 1CDCA 5E8OB 4JFFE 2X05A 1RK0A 4OD2B 3DTXB 1KEGH 5KAQF 1OM3H 3HAEB 4HGKC 2VXTH 1RZ8A 5DHYA 3KGRA 4MNGA 1F6LL 2EYSB 3GMNA 3GM8A 2FL5B 1E4WL 5HDBE 2XY2A 1EJOH 4FQHB 5FK9A 1P7KB 3CMGA 2A6KB 5HYJB 1FFNA 3BWAB 4L4TB 4C56D 3T0DA 2MTPA 4ODHL 1QO3B 1XCTB 3IFNL 3CXHJ 1NEUA 2NY2C 2NY1C 3BPNB 5D2NA 3F6IA 4OFDA 3MODH 1U3HB 3DURA 4IOFC 4BKLB 4KTYA 4ZO8A 4PJGE 1FO0L 4G7YH 4O58L 5I1CL 2NW3B 1H5BC 5EU4A 2CRYA 1AO7D 1UJTA 5E4EC 1ZLWK 4GW4B 3O3DB 3ZTNH 3RY6C 5HYFA 1CDBA 3AMKA 3ZSTA 2VDKH 1G7JA 4N8VB 2VDRL 1QSEA 4NO0D 1D3CA 1GIGH 1MCOH 2V7NB 2GKIA 4YWGH 2HTKD 3GSQA 2ZUQB 5FUOH 5A40E 4GG8B 4U1LB 5DD6B 2GSGB 1VB9A 1T3FA 5D2LA 3QIWD 3LDBB 3BQUB 3MYZA 2B4CL 5L0QB 1C5BH 1FFQA 2AERT 3SE3A 3TZVB 1H8SA 4DN3H 3I9GH 5CBAA 3N1QC 2ZSWA 4X5WB 2WUCL 4X98A 4HH8A 1LE9A 4KI1A 3B9KA 3TBSB 1NBYA 1CR9H 1I8KB 1F5WA 3O45A 1V7ML 1QLFA 35C8H 3H3BC 4ZPVB 4PG2A 5MI0B 2XKSA 5GRVL 1FZMB 4LU5L 1MI5E 2G2RB 4JREB 4J6RH 3HUJE 2FR4A 1IGFH 1R5WB 4MJ5B 1JPST 3D85D 1SM3H 3VE0B 1EPFA 5F7NC 1IAKB 5IMMA 1DVFA 2YUZA 4LVOB 4JFHD 2EEDA 3U7WH 3ZMRA 4J3VA 2X4QA 4XHJD 4GW4A 3CFBB 4YDLC 5ALCH 1HOCA 2X1XR 4R97C 1AC0A 2Z92B 2Z31D 4HDIB 5HI4C 1CXKA 3TC9A 3CSYB 1B4JL 4PJIA 5DD6A 1FSKB 2V17L 5B38G 2JK5B 4DK6A 2NY5L 4X6CB 3DBXB 2FO4A 5CWSA 2GJ6E 1U3HD 3MRNB 1DQQA 2AQ2A 3KS0J 2I5YL 4AENB 5IK3B 4WWKA 4PUBL 2F5BL 3GK8L 5D96C 1FBIL 5KOVC 2NY6D 3GKWH 4LPYA 1F6AA 1I1RA 3L5HA 4G9FB 4YPGA 3S3SA 5IVXB 4UDTB 1Q1JH 4MB5A 1AO7B 1YEEL 3M17A 1WF5A 1WK0A 2GJZA 3QXUA 3RWCB 3AM8C 4LPUA 4U1MA 5INDA 1AE6H 5C0AE 3DVGA 1OW0C 4WV1C 4GAGH 2DQEH 2D7PA 5IVNA 1BQHG 1HCFX 4D9LH 3QQ9C 1TITA 3C6SB 2P43B 3BEVB 3KWWB 2DMBA 1AR2A 2DMCA 4JR9H 4OLZL 2I9LB 4MLSA 3ULSA 3C8KB 1K85A 2W65B 4MAUL 4X4XB 2GAZB 1UCBH 4O2EB 4X7FC 1J8HA 3MLYH 4YDJB 4GS7C 1Q72L 2K7QA 5E99L 2BNRD 2VDQL 2ATKA 4D8PA 3UJIH 5LQBH 3RVWC 1G1YA 4J3OC 3VFRA 2UYLA 4I1NB 4OKDA 3QNYA 3WLBB 2AVGA 3UTTD 1AIFB 3EJYC 3S4SB 3O3AB 2ZOLB 1JF1B 1NGZB 3ARDB 3FQXB 4LAQL 1BECA 4WW2C 4JRXE 3OAUH 4P48A 3TIEB 3VFUA 4QHUB 3O3BA 1AXSB 5J89A 1AGDA 3QIWB 2YC1A 2EDEA 3I75B 4HQQH 2PO6D 2Q76A 1YJDH 4WEMB 4P46B 1KPRA 3CFIC 3X14A 1MHEB 4KQ3L 3O6LL 5H35A 4OB5L 1A4KB 3RU8L 3EJZC 3ARWA 5TDNA 4YFDB 1NDMA 3EOTH 3NA9H 3B5GA 3ZZ1A 2Y1VA 5CHNA 4AIZA 2CUMA 2WUBH 4OF5A 1FL6B 4NQDA 5F88B 1TCMA 3KXFA 1DQMH 4JPIA 4L9DA 5LKNA 4XMKH 5T5FL 3VDBA 1EMTL 4G7VH 1AHWB 1KELL 5C3TA 5EOQL 1SY6H 4LFHG 5E6IB 3TBWA 5HPMA 3LMJH 4XP4H 2ATKB 4G9FD 2YKLL 4UILH 1ZXQA 5I18H 3F62A 1N5AA 4DKEH 2F5BH 4UIMA 1I7UB 2VISA 1GOFA 5HPOA 3RWJB 4WV1A 1YNTA 4EZMA 4IRJD 2AJUH 1MHCB 3WUZA 1W0VB 2FHBA 4CNIB 3D3VD 4JQVC 5ANME 3QIUB 1SJXA 1AKJA 4EI5A 1Q9OA 1DN2A 1W72B 4XCFH 4XVSL 1CU4L 1WAAF 2DIJA 1KPRB 1I7RB 1TLKA 5D1XC 2J8UE 3QXAB 1RZKC 4DW2H 1U8KA 1T1ZA 5HVHC 1U8LA 4ODWA 2X6MA 1CLOH 3BAEH 5IT2H 4MAUH 3OXRA 4D3CL 3HG1E 4R4FL 3OJDB 4K7FA 1QP1A 2QL1A 1CIDA 3MJGX 3PJSA 1OM3L 3BP4A 3MRDB 2E27L 1TJHH 3PGCA 3KNBB 1RK1A 3MPCA 1KF9B 4C56E 4DUVA 3QG6A 4F8QA 5IBUG 2BHUA 5E2VH 1MEXH 1MUJB 3V4UH 2PO6B 4OJFH 4Y89A 4DZBA 4C83A 4U33A 1ITBB 5CCKL 1UEYA 5KS9E 5LBSL 3HE6C 2XPGA 3HZVB 4UT6L 3U0PB 3BKYL 2A73B 4BSWA 4YE4H 1FG9C 4XNQA 4ODUB 3FRUB 3TPUA 1A7NL 4QCIA 3PGDB 1T0NB 3RTQD 1HI6B 4J8RB 5GRUH 3G08B 2J6EH 3C6SA 1HNGA 4LLUB 1PD6A 4OM0H 4YR6B 5FHBH 3U9PL 1JTTA 1FO0H 1S78C 5AZ2L 3QDJD 4AEFA 4EBQH 1W0VA 4U6YA 5DA4A 4HWZA 1Q9OB 4KHTH 1J8HB 2GUOB 3B6SB 5IUSA 2YD4A 4O2FB 1U93B 5BS0E 2CXKA 3X3GL 2CSPA 3PABA 2V5SA 5IHZA 2PTVA 3EJJX 3O4OB 4Y5YC 4FMKA 3PNWA 3V6OC 3CH1A 3FONA 4OV6F 3MNVA 1KBGH 3MCKB 3NCCB 1NSNL 4PGDB 4HPYL 2YMXL 1T1YB 1U42A 3T1FB 3Q5YA 4POUB 5DUBB 4HH9A 1VACB 4CDHA 1WBYB 3Q5OA 4F3FA 1CL7I 2G9HA 1QBBA 35C8L 1QFWL 3JV4B 3QZWG 4KWUA 4MWFB 1U8MA 1SYSB 2GEEA 1T5XB 4C58B 4P23B 3VI3F 2DBJA 3CDCA 3IJYB 1S9VB 1JMZA 1GRWA 4AT6A 2JJSC 3ARFC 2C3VB 2X1WL 2QSCL 3G6AA 3GDBA 2A73A 1NDMB 3WS6A 3MBED 2CH8A 2A6IB 4KJQD 4L3EE 1DLHA 2WZPD 1BJ8A 3RWDA 4AEIL 4QRSB 3CX5K 1WISA 3ES6B 4X9HA 1UYWH 4RGOL 4YUEL 4OZFB 5DLMH 1ORSB 3GMPA 3IU4H 2EXWD 4JHAL 1FPTL 1HHJB 2EYRA 3ILQC 3UYRH 5GRYA 2VLJE 3MBXH 3F7RA 4I48B 3MRRB 5D72L 1OP9A 5EBLB 1V8HA 5JXEA 2GITA 2QV2A 1LD9A 1VGEL 2IGFH 5HYEA 4I4WA 1OAUL 1MLBA 4LCCA 3SGJA 5ICZB 3DSFH 1I9JL 3ISWA 4XCEB 5L2KE 5JOPE 2AABH 1CU4H 3HI1B 2QLVB 3V4UL 2V5RA 1CF8H 3R06A 1RZJL 1Y6NR 5DTFA 1A1NA 4M9PA 1KGCE 5DUBA 1VKXB 4GAFB 4WEBL 1OP3H 5F96L 1NBQA 4LF3A 1N0XH 5JDSA 2I27N 3F5WA 1TJHL 3VRLF 3KXFE 1X5AA 3DRTA 1FLRH 3KJ6H 3T0VA 1U3HA 5HYSA 5HHQB 4WNQB 2VH5L 3ELAT 5KZCD 4PJGF 3CCHB 4LRIC 3UJJH 1KIUA 2IAMA 4ELMB 3LN5B 1FNFA 2FIKA 5DQJA 1VA9A 3WFCH 5ID0B 1PEZA 4MXQD 5J4MA 4I0PB 1MHHB 3V2AR 2VZUA 1YQ2A 1A5FH 1NC2B 1ONQB 1OB1A 5FXCH 1RK1B 1FNEB 1T7YA 3VMNA 5HHQA 3O11B 3MV9E 4DWHA 2FJHB 4F2MB 5BJTA 4KKAD 4BQCA 1I8IA 1K3IA 4OCYH 3WO3B 2FD6H 5CJ8A 5I76A 3QG7L 1W0YT 3E2HC 4HK0A 1CXIA 4MDJA 5M94B 1KPVB 2ARJA 3DGGA 2W1NA 4P3DB 2Z8RA 1WCBA 2X4RA 5I75B 4HFWB 5DK0B 1WFTA 3KPPB 1WQVT 2OR9L 4DGYH 5JIKA 2C1OA 1MI5A 3ECBB 4LQFL 3O2DA 3WO4C 2R4RL 5ANMA 5IFHL 5INDB 4KVNL 3LS4L 3H2WA 1NGYB 4Z95L 4N8CL 3RWHA 5FYKU 4EDWH 2NNAB 3WE6B 2O61A 1LP9F 2EYSA 4XNMB 1KJMA 1OQXA 4XBPB 5GSRB 2GTZA 3HG1A 2FECI 5GRWA 1RUPH 4LRNH 3CVHA 2FYYA 4QTHB 5JNYB 2EE9A 4LL9A 5E1AA 5GJTH 3GHEL 1JHKH 4M7LH 5SWZD 1UB6A 3FO1A 2Y06H 3ESVF 1JF5A 1N59A 1X5KA 5C6TL 3RRQA 2BSTB 1GZQB 5A2KH 2FL5A 3EOBA 3QEQB 3RKDD 1PG7L 3EW3B 3ILPB 5DJ8A 1D9KD 2UWEB 3AGVA 5DI8B 1OGTA 5DJCB 1CFVH 1QBAA 4HIEA 2VUYA 3RGVB 4EQ3A 5IMKB 1INQA 3QUXB 1T03H 4RCAA 3MLPA 1IC1A 4WFGD 2AK1H 4G6MH 3BPCB 2W9DH 2L0DA 4EJ1C 4KXZI 1KJVB 3EO0A 4OUOA 5C9KA 5D5ME 1B0RB 4IDJH 3T77B 3NFNB 2DQHL 3O6MH 3G6DL 3MLWL 4JHWH 1G9MH 2Q76B 2QQKH 4K7PY 4L8SB 5C0IB 4DN4L 4GXUN 4OKVA 2Q3AA 5FOJA 3L3IA 5DD1L 5FGBC 4UILL 1WEJH 1KSRA 4J7RA 5E8DH 4J4PC 5EOCH 4LHQB 4PJFA 2E6PA 1R3IH 1WJ3A 2G2RA 4CU8A 1KJMB 1AO7A 1WZ1H 2R0KL 1FVEB 3PWLB 5IVZA 3WS6C 3V0VB 5JPMB 1WIOA 4GRMA 5AYUL 3U7YL 3H0TA 1U8IB 1NLBL 5IFAL 1NCWH 3MV9B 1Y18A 3BOVA 2YZ1A 5BRZD 3B9KB 5SV4A 5TPWH 3O4LB 4PGCB 3TT3L 2JB6B 3GMLB 1A5FL 1JNLH 3KLHC 5CMAA 3LRSB 1JIBA 3I3EA 2YWZA 1HSAA 4H5SB 4OGAD 5TE7L 1C5CL 2VABB 4YXKL 3PP4L 4JZOA 1RIVL 4ZPTA 1HHKB 5I16A 3BP5B 3B5HA 3MLZL 4HDIA 5INCB 5ITBH 1CXLA 3BIBX 4PP2A 1S7SB 4PB9L 2CO7B 4PJ8C 5DMJB 4K07A 4EXKA 3VGAC 1XF3A 2P24B 1TNNA 4PRNB 5JHDA 1OCWL 2EDLA 1QRNA 5E8NB 2AJYL 5TQ2L 5FOBA 1S5HA 1VFBB 3QNXB 4YDKH 1A64A 4HXBH 3CZFB 5ISZE 1FH5L 1TXKA 5DRXA 5HHMB 1U8JB 5E7BA 2DLGA 5K9KA 4JO2H 2MQ0A 1F02I 3QEUA 3MA9H 1JWMA 2DRUA 1I9RL 4YPGB 3AS0A 4KTDH 4UNUA 5E8NA 4MSWA 2HT3D 2UUDK 1MF2L 2DKSA 3WCYA 1QSVA 4NBYB 2XQBL 5F8QC 4WTXA 3HC0B 1OL0A 2NR6C 5DK0A 3ZO0A 5KSVA 1JWMB 4OI7A 1ZVSA 5E8EA 5DJZA 3H3PL 3RZCB 5ESQA 4QT5A 4Y4HB 1T22B 3WBDA 2Y5TB 2JB6A 1DN0A 4YK4B 1J1OH 4P5KB 3U2SB 4V2CB 3MXWL 4M3JA 4OGZA 1OAKH 2B1HH 3BESR 3BXNB 1GOGA 3LQZB 2H3NB 4QXWA 4P59H 1H3VA 1PKQA 1HOCB 3PG2A 2A38A 1P69B 2EZ0C 2FEEL 3D2UB 3MYJA 4HBCH 5DRWA 1QBML 3R0MA 2FECL 2AK1L 3TBTA 3REWA 1VESA 4JQIH 3BKCL 3BJLA 3O6FB 4OZHA 4JB9H 3JTSA 3CFEA 1UM4H 5D7JB 1RJLA 3RKPA 3WV0A 3IFPB 2HFGH 1RUKH 4DUXA 1ORQB 5D1QB 3LDBC 2R0KH 3DRQA 3VXSA 1FL3B 3BKJL 3G6JB 1NL0L 4EUPB 3SDDA 5IMOA 5C9JA 4Z8FH 1VFOA 1JV5A 4H8WL 1U91B 5DRNB 4V1DA 1W2KT 3BYYA 3KXFB 4KMTH 4K7FB 4P57B 3D69A 3LKPA 3LKSB 4KGLA 4LSTL 3SDAD 2GJZB 1BAFL 3FCTA 2CK0L 3VG9B 1RZIB 5CP7A 4NO3B 5MHSD 2A9NL 2DL9A 3BGAA 3FFCB 2H32A 4HUXA 5DEZA 5IKCA 1MCSA 1ZS8B 2OK0H 1T83C 5HPMB 1CFBA 3VGFA 5TH2B 2FBJL 4Q2ZB 3QWOA 4JFFD 5TPWL 4LVOC 4ESKA 1V3JA 2G60H 3OAYH 2OMNA 1BZ9B 3IVKA 4P2OD 2EO1A 4RGND 3WFZA 5JORB 1I7UA 2VISB 5C09D 5EBLA 4PS4L 1TQBC 4F58H 1Q9KB 1MFEL 1X6LA 2ESVA 2ZCLL 2C9AA 3MRPA 1HZHH 3QJFA 3CMOL 5FA3A 4ZAKC 1M71A 3MV8B 4IRJA 3UBXA 2R23B 3OG4B 2ZNXA 4NQSA 3UJTH 1DQTA 3WFCL 4PJEE 3T0WA 5MENE 2F15A 5E6IA 3TBWB 2VDML 1QFUH 2X4PA 4FNLH 2Z0BA 5E5RB 5IHZB 1WT5C 4H88L 5DGQA 2W59A 2ZUYA 4I18A 3BH9B 3QZWB 5BVJB 4HJ0C 1F3DH 3LKSA 5GGVH 4HF5L 1IC7L 1S8DB 4K9EH 4GRLA 5GJTL 1I3RA 3W0WA 1BEYL 5D8JH 1T2XA 4W4OA 1KPUB 4MA8L 3LN5A 4F3FB 5EBGA 5T33L 4LQFH 1JNNL 1FJ1B 4I18B 3P11L 1R24B 4HPOH 1NQBA 4E42B 2AJSL 4EIZC 3VXMD 3E6FA 5HGHB 5BZWA 1SVCP 1U8KB 5EIIA 3UPRB 2CJUL 3OXRB 2AJZA 5EU7C 1JHKL 3GMQB 2XN9B 4NM4H 4M7ZB 1PQZB 2RJMA 4C56B 1XEDA 2ED8A 2X7LB 3SE8L 3AUVA 1JZ5A 4HUVA 4HFUH 1CFTA 1MOEA 5FDWA 5E2WH 1TTGA 4NN5B 1T0MB 1GPOL 3O3UN 5KAQG 4GS7B 3BE1H 4LCYA 2MQ3A 4ZFZA 2DB8A 3NACL 4N8CH 1YNTB 4ZO9A 5I1EL 3GMQA 5J1SC 1A3RL 4Z7UF 4U31A 4HWEL 1GOHA 2AJ3B 4LMQE 1FRGH 4KDVA 3U0PA 4M5ZH 3QB7C 1NMAH 5EORL 4GH7B 4LHJB 2V6HA 4UINL 4OUUA 1UWGH 3ARYA 1HDMB 5DFVC 4MJIE 4Q97A 5F96H 5LG1A 4TUOB 3DYPA 1R3HA 4TTGA 1AGBA 1QQDA 3NFPB 5DUML 1OSPL 4QXGH 3U82B 4NHUB 3IJSA 1X5HA 4H26B 5D6DA 4X6FB 3CNKA 2WQ8A 3N50A 2EE2A 3NH7H 2PR4L 4WY7L 2GK0B 1EHNA 3RHWF 4P2RB 3P4NB 2GTWA 4RMSA 3TH4T 1J0IA 1SYSA 2MKWA 1F3RB 1AJ7H 4WO4D 1YC7A 1VSCA 4KHXH 1ORSA 2KH2B 2QQLL 2Z9TA 2X4TB 4PTTA 3C60B 4JGMA 3T1FA 4KY1L 5LCVL 1JGVL 4XCYA 4H88H 4HUNB 2GFBB 4WUUA 5EU3A 1HKLH 4HS8L 3DV4B 2HT2C 4JFFB 3QUKB 4APQB 5FGCE 5FA4A 5EPMB 1S7RB 2VDMH 4QRTB 4CL7A 4I4WB 3B43A 4P23A 3RWGA 4Q2ZA 5ESAB 5DWUH 3QAZC 2ITCA 4LSSL 5IJVB 1IKFH 1V7NL 5IFHH 3VXSE 2HJLB 4FQCL 2DYPA 5DTFB 3MV8D 1T0PB 4G42A 4HCRA 1S7QA 1UWXH 4M1CC 5F1IA 1BX2B 1XT5A 1JUFA 2GJ6A 3GK8H 4KI5E 1BQSA 1FZJB 1MVFA 4U6VL 2DQDL 2XN9E 1X6NA 4K23L 5BO1H 5ILTH 2EDWA 5AZ2H 4R4NC 1W72L 5HVHB 5FK9B 3ET9F 3NN8A 4TVPL 1YN6B 3GSRA 4ZUTA 3BN9D 1UC6A 4GKNA 5B39B 2OZ4A 1QSFE 2XTJB 2DICA 5JO5A 3O81A 2DI7A 1EEZA 3U9PH 2NW2B 1MCHA 4RA3A 2NZ9C 4NRYA 4KHTL 3GRWH 4Y16B 3HC4H 4YNYA 2XQBH 2IBGA 1RIUH 4QWWD 3LSOA 4PJAB 4ZUVA 4PJ7A 4QRQA 4PYHA 5DQDL 4G3YH 5IW1B 5AG8A 2YMXH 1X7QB 2ITDB 2X4UB 5GRUL 3RDTD 2W0PA 3PXHA 3T0ED 4MQXD 5EZIH 1UENA 1DQLH 1R5IB 5L7XL 3OKNA 3SCMB 1XGUB 3O4LE 1XR8A 2LTQB 2ADGA 4NZUL 1X7QA 2ITDA 2YR3A 5LGHL 1K3ZA 1MI5B 3ECBA 5I1KH 3BKML 4FXGA 2VAJA 2NY4B 5IEHB 4GSDL 4M1GH 4AMKL 4PP1C 1XGPA 4Q9BA 5HXMA 3KPSA 1EAPA 4IOIA 4D9RE 4RFNB 4GRLC 2C3HA 3A67L 4ONOA 4WIQA 3ARUA 3UTTB 3VGHA 4TNVK 3TLRA 1WLHA 3L9RB 3VXQB 3LMJL 2FB4H 4MQTB 2P5WE 1BHGA 3KPPA 4NNYB 4OT1L 5CJXA 2IFGA 1OSPH 4QXGL 5HHVH 1CD9B 1NFDA 3QULB 2R2BA 2IGFL 1NMCB 1XIWC 4YBLB 1IAKA 4RAHA 2DKUA 3MJ8A 4HIEB 5IMKA 2GAZA 2I24N 1F8TL 1L0QA 1A6ZB 3MBXL 3I2CH 2DI8A 1MAMH 1QFHA 1K5NB 1A6TB 2CDEA 5FHAH 2FZ3B 4UQ2B 4PRIE 4ZTPL 4HW6A 4NQDE 4P3CL 5H2BA 3VXMA 3T77A 4WGVB 4RGNE 2R0LL 1ZAGA 1QFWM 5C0NC 1Z0MA 2A0LD 2A83A 3ARFB 1B0WA 3V6BR 1F4YH 4ODVL 3MACL 4XBEL 3K2MC 4LDEB 1AI1L 4DTGH 3LB6D 2IQ9L 2VWEC 3HCVB 5K59E 1A2YB 1PW3A 3ZE2F 1AGDB 2YRZA 3VGEA 2MJWA 1NANI 3HMXA 2IMMA 4RIRA 4Q6IA 4H8WC 3FMGL 5MEND 1KNOA 4U05A 1IC7H 1FO0B 1P2CA 4NOBA 1ZLSH 4ELMF 4XI5C 5EU3B 3HS0A 4OCRL 5F7DB 3GSNH 1GGIL 1NBVL 5JTWA 3V6ZA 1YPZF 3MUGA 1C08A 2AW2A 1FAKT 4JY5L 4N0FA 4HZAA 1C1EH 3TWCL 1BJ1J 2Q86A 4K2UH 1T1WA 4LPWA 4G6KL 4ELKB 5FYKL 5EC2A 3T2OA 5C0BD 2YUWA 2EDRA 1I8MB 3DVNA 3DARA 4MJ5A 1FFOB 3ARZA 5AEAA 2A74A 3DLQR 4PJDB 3CX5J 4GW1A 4M5YH 1IQDA 5KSBE 3NPSB 1ED3B 1GZQA 4KPHH 3P4OB 4NP4H 1T04A 2EKJA 1M7DB 2EDNA 3WSQL 3WS3B 1T6VN 4KVCL 2B0SH 3NCBB 5BS0D 3ZKMD 4EVNB 2X89D 1EJ6A 2VDOL 1NGXA 4ZYKB 3M07A 4KK5D 1RIHH 4GAYA 2W9EL 4Z95H 4R26L 4S1SH 2VLKE 4I0PC 4F7PB 4GW1B 4PJ9C 2VO5A 4DVRL 3L95B 1U8JA 2IAND 4NT6A 2YD6A 3O6FA 5BXFA 5CILH 3ZE2E 5HGGS 4Z77A 3ZHLA 3MGTA 3QNXA 5JHLL 1CGSH 1RUKL 1SYVB 4QRRA 4HT1H 4OKVB 3E2HB 2X5PA 4K94C 3SGKC 2DKMA 3SDDB 5C08A 3I3DA 3MRGA 1B6DA 4PP2B 1XGTA 5HI5D 4S1DD 1WIPA 2DM4A 1SM3L 2M8XA 3VFMA 4H0IA 1LO4L 1TFHA 5JW4N 3D3VB 1BFTA 1J12A 4KKBD 1OW0A 4AMKH 3Q6GL 4HPOL 2D4DA 5HY9A 4XNUL 12E8L 1QYGH 4YDVB 1G7PB 4MJID 1MCIA 3GSWA 1KULA 1XGTB 1F2XK 4Y5XA 1ZTXH 1EX0A 1MRDH 2DAVA 1YNKH 3T08A 1NGWA 3IDUA 1NAMH 3VE0A 1ZGLA 5TQ0H 4MSWB 2MCPH 2JB5H 5FYLH 2NY0D 2VLRA 3CFDB 4W4NA 3B9DA 2EH7H 5EOTB 3OF6D 3PWPB 5I2IB 3CX2A 3KPTA 3AREC 2KDGA 2XZAL 3ULSB 2FX9H 1DUYA 4OCRH 5DJZB 4R90H 1FZOB 1EFXD 3U0TB 2HFFB 3G5XA 1F4YL 3S5LA 2NY5H 1AR1C 4D2NA 4G80A 5KSUA 2R23A 2PTUA 4QHLB 3K4DA 2F19L 1XF3B 2P24A 3D85A 3TP4A 5I8OH 1KJ2B 4NGHH 4J12A 1QLRA 4OZHB 4Z7NE 1RVFL 2Z4QB 3KG5A 2PXYA 4XPGL 2XACC 2EDHA 1GC1H 1FPTH 3L3OB 3RY5A 4X9IA 4YXKH 2AV7B 3UO1L 3VWKC 1J9CT 4U6VH 4D0BA 2JK5A 3F7YB 4KK6C 2YD5A 2UV3A 4BZ2L 5HD8C 4LCWB 4OFKA 2R69L 1MCOL 1ZA6A 2RAMA 5TGBA 4WFGE 3STBA 1WITA 3KS0H 4CGTA 4XBEH 4Y8AA 1OP5K 2AJYH 3JWDH 3E1F1 4QT5B 2H32B 4KAQH 4G9DA 4L9LA 3MA9L 2OTPA 3V79C 3IS1X 1TPXC 4NO2A 4JO2L 1OTUD 1ZT1B 3QUKA 4APQA 3B9KC 1KG0A 1PX4A 4GRWE 4JZJA 2Q86B 4FOMA 5GSVA 4TSBL 1H8NA 1PG7W 3LPWA 5E9DD 3AB0C 3IJHB 1YEJH 4KJWD 3PE9A 4LASH 2L7UA 4QHLA 4JDVA 4LLMA 4LCUB 3RX8A 3FRUA 2FSEB 1KCRL 4OLYH 3HC4L 3TPUB 4OCWH 4S2SA 3RUGB 1KG0B 3JXAA 5KZCB 1LMKA 5BS0B 4JZJB 5ID1B 4Z7VB 4CU7A 1A3LH 1D7FA 3LN4A 4ZFOB 1V3KA 2JJTA 3D0VA 4N9OB 5E56A 3VDAA 2Q20A 1NGPH 3BIKB 1T89A 5IESL 4XAWL 2DQCH 3MRPB 4OUUB 1ZA6B 4JQXC 1TZGH 3QIWA 1XIWA 1YQVH 4IMKA 3H9SD 3TYFA 4D9RD 4NPYA 1UGNA 3KYNA 4MD4A 3V6FB 3GB7B 2HJKB 4WNQA 4R7DA 1KCSH 3LQAL 1NGQL 2VKWA 3ALWA 2WBKA 3HLAA 4O02H 3ARGA 3WIFA 4P46D 5E00A 5EIIB 3U79A 4CW1A 1FJ1A 2IAMC 5E2UH 3ORJA 4CAGA 4PR5A 1DTUA 4PJ5D 5ACZB 4NPYB 1MWAB 3WFBL 2X7LA 3GHEH 4M7LL 4OM1H 1WC7B 3TNMB 4NM8H 5EZIL 3WNKA 4YXLL 5HVGB 1NCDH 4H8WH 4JY4B 3ARGB 3WIFB 4PRID 1PQZA 4RWHA 3P73B 1FDLL 1FZKB 5CJXC 4K8RD 4XPAH 3HZVA 1R24A 4YHZH 4FXGB 2CRIA 4HC1H 4N9GB 4P4KB 3IDMA 4K71C 4E42A 5DJ6A 5KSBF 1H3PH 2VSCA 3QEQD 1K8IB 3TBVB 3N9GL 1M05A 1MIMH 1MFBH 5FIEA 4M4RA 4CJ1A 4PJBE 4X0KB 1RMFH 3VDCA 4FQXB 3LKQB 3QUXD 5D7JC 4M1DL 1P4BH 1CICD 5D1QC 3ZKSD 5GZOD 4YDIL 1QPPA 5KVGL 1Q38A 1IGJB 3NCYS 2FX8H 1YA5A 2WBJA 1I85C 3P9MA 4QOKA 2ZCHL 3HFML 4PJHB 4EXPX 3MOBH 1D5XA 3Q3GA 4QHMA 2OTUA 2ORBL 4KJPD 4LCCC 3CK0L 1KUMA 5D7LD 2NY3C 1RD6A 1S7UA 2DQJH 1JYXA 3LS4H 3WHXB 5GS2D 5SWSA 2QR0A 3IETB 4PJCB 1JFQH 4IJ3C 2D7MA 4Z5RB 1JCKA 3RVUC 4LIQE 5HSFA 2YSSA 4JFFA 4PJ7B 3NTCH 1A2YA 1HK6A 1EBAA 3C09C 3IDIB 3HTLX 1AGBB 3NFPA 4GW5B 1ZA3B 3TBYA 5MEQB 5C8JB 1WWCA 4K7PL 3CFJA 2PN5A 4MNQB 4P2QD 5AD0B 1VADB 5SWSB 5BRZB 2VZ3A 5EB9A 3VXNA 4MA8H 1QSFA 4YC2C 2QADC 1TQBB 4P5TB 2HJLA 4QRSA 4GKSA 2IANE 3CSGA 4NM4L 3KPSE 3WHE0 1ZOXA 5I1JH 4PJ5B 5I1EH 4FFWC 4KRMB 3WJJC 3QO0B 1NKRA 1B6UA 2VR4A 3G08A 1ZA3A 5JXAH 3AS3A 1YECH 3HB3C 4GMTH 5GZNC 5F72S 3RTQB 3TWCH 1DBKH 4CADB 3T3PE 4X6CE 3QUML 1JWUA 1YY9C 4BSWB 4V2BA 4WHDA 1BFVL 1FFNB 3KHQA 3CZJA 5I19L 4PJ5A 2A6DB 4Y1AE 3EDFA 1CFSB 2CJUH 4X6EA 1L7IL 3D87B 1EEYA 3AMLA 5IR1A 1KCVL 3OAZK 4HJJL 5KBNC 5DHYB 1FNHA 3P4OA 4Y19E 4MJ6A 3DOSA 2MOVA 1YUHA 3EOAB 1HSAB 1OF2B 4QTHA 3SOBH 2XKNA 2EH8H 5JW3H 4YXLH 1FAIH 3ULVH 1QFWH 2GK0A 4P4KD 1K2DA 5D7LA 4ZODA 5J1AA 3UBXG 4AEIH 1CWVA 1UWEH 4M7LT 1DDHA 4JFEE 3VXPA 4QHNA 2DJ4A 2VLJA 1T4KB 3RA7H 1R0AH 1XH3B 2VC2H 4TNWK 3DV6A 4BFGA 1OY3B 1RZFL 2BVOA 3UYRL 2OTWB 3H9YA 1OTTD 2A83B 3ARFA 4DGIL 4KGJA 5TDOB 3QXDA 3E6HB 1DLFL 3CPLB 3QUYB 5EUKA 1FBIH 4I9WE 5K9KB 3L5XH 1I9JH 1JZ3A 4YHYB 1H3PL 4MZ2A 3WNOA 4PLKD 3A6CL 4YNYB 2FATH 3HPLA 5KVGH 3PV6A 1QLFB 3TVMC 2ZG3A 4O00A 4ZS7H 3VXME 2HYMA 3K0WA 2BHYA 3B9VA 4OJFL 2YD1A 1CFSA 1BOGB 3BZFA 3DETD 3UTSB 4NNYA 5HDLA 4P2QB 3CK0H 5SWSD 1VERA 4PRBA 1JL8A 2G60L 3C9NA 4WCYH 4Z7OF 4X6BB 1T2QL 3D48R 5C07D 3DVNB 5IQ7L 4EEEA 2IH3B 2H2SD 1OTSD 2COQA 5HGBB 1AKJD 4EI5D 5EUOE 3MV9A 1B2WL 2D2OA 3LPFA 1IBGH 4YHOL 1A6AB 1J86A 5JDSB 1ZT4B 5IIEB 3LZFH 4UDUB 4WDIB 1QG3A 4CJ0A 5MERB 1NC4D 3HA0A 3RZCD 1M7DA 3DV6B 3LKOB 4X83A 3QO1B 3FQRB 5IF0B 2I60L 3DBXA 3CC5A 1OAQL 3CXDH 1HSBB 2D0FA 2V5TA 2WW8A 1TETH 3MRIB 3ESUF 5AAMA 4ZO6A 1EHLH 1U95A 3NZ8B 4Z77B 2XRAH 4TULL 2CLRB 2BXZA 5E8PA 3CSYA 1XZ0A 1JBJA 1NC2D 2AQ3A 4CVWA 4YEFA 1EFXA 2N1KA 3EIFA 2HVJA 4WU7A 4O4YH 4APQC 5C2UB 4P59L 3VFRB 1C08B 4L9LC 4RGNB 5TGBB 2DD8H 4JN2B 4HIIB 2YN5A 4RIRB 4PB0H 5I66B 2GCYA 1E6OL 4YAQA 4O51B 3LKNB 3F8UB 4FXKB 4OZGF 2I25N 4EDWL 2UZIL 4JKLA 1MIEH 3HRZB 2PYED 1PJ9A 4OLEA 3MV7E 3H8NA 4P3DA 5T1KA 4OF8A 3MOQA 3GSNA 2DQTL 5D2LF 3CAFA 1KLFA 4LPCA 5GHWL 3KWWA 4LCIL 3IB4A 1F2QA 4ELKA 2YXFA 4YAQB 3X14B 4P0DA 2DQCL 4PRHB 3KXFD 3N1FC 2IANA 5F1KC 4X8JB 2DWEB 2J88H 4H20L 2UVEA 1AY1H 2NY7L 3QI9B 1RZ8B 4WFED 1N59B 5GJSH 3SKNA 3VXSD 2W9DL 4KH2A 3UTSD 3VJ6A 2XTJC 3SQOL 3BKCH 1DE4A 2VZTA 4N5ED 4FABL 3BDYL 3CVHB 4W68A 4I2XB 3U4EA 3MRIA 1QEWA 1R3JB 5EC1B 3OAYK 1II4E 3C87A 3WIIL 5L88L 3GBML 5KVFL 2YN3A 4BYHA 4POZD 4XVSH 1D5ZA 3RGVD 1HEZB 1LO5B 3RVXD 4Z0XA 1RVFH 2R0LH 3WN5B 4FTVA 2EXYD 3B5TA 4L4JA 5I18L 5IFJA 1HYSC 1N4XL 1B4RA 5EU4B 4X6CA 4NNXB 2P5EB 1HXMB 5EU6A 1NGXB 1A9EA 4H1LG 1G9NC 3OKLB 1IGMH 3GMMA 3TN0D 1JGEB 4OZGA 3QIBB 3FFCE 5HDQH 4PJFB 4WWKB 4XB7A 4LHUD 4MA1B 3OF6A 1DSFL 2YUXA 2P5WB 4HUMB 1Z9SA 2F5AL 3DO7A 1E4JA 1YY8A 2EDKA 5FYKH 4RGMB 2HA1A 3F7PC 5ERWB 3V5HA 4DVBB 2NXYC 2OL3H 2Y07L 4U1NA 1C1EL 3BSZH 4X4ZA 1DQDL 3I2CL 4ZXBC 1KENH 3VFPA 1NBVH 2RGSA 4MJIA 5C0JB 1Z5LB 4R7NA 4UTBL 2PYEB 3U30B 4QXUL 2BFVH 2F53B 1KJ3H 3C5SA 1T66C 5JZ7D 1I9IH 3FB7B 1TZHB 4YXHL 4R26H 4S1SL 5FFLA 3VA6A 5LGJB 2F58L 4ORZC 3EDEA 2XN9D 4NT6B 2B0SL 1AH1A 5IBTH 2W91A 4ZNCD 4H5SA 3RVTD 4WO4B 1OSZB 1YEFH 2X4SB 4P3WA 3FQRA 5IF0A 1D6EA 4JHBA 4WJ5A 5F9WC 2EICA 3AM8A 1KBGL 3O3EA 4LLDB 2MQCA 2C3WA 4NP4L 2W9EH 4HWZB 2ERJB 2H1PH 3MJ9H 4IHOA 4JM4H 1ZLWH 3QI9D 2ARWA 5JW4Q 1YMMD 4L8DB 4DEPB 2GW5A 3HUJA 2W9LA 3P4NA 5L2KB 4R97B 5A3ID 1UJ3B 2P49B 1IEAB 5IHBA 1CGUA 4MQSB 3FOLA 3LKPB 3DPBA 1JTOA 4Y19D 4F37K 3EO9H 2FJFB 1MHEA 5H35B 4EUPG 1VACA 1OP5H 3S35L 1KXQE 1NMBH 4JN1L 2BCKA 1YPZB 2YOCA 4OLXH 1ZS8A 3FRPG 4CN4A 2D0GA 5E7FA 3SDYH 2N56A 1OT1A 3AXLA 4E41B 2OMBA 4XXDB 4D9QE 4XB8A 2VKXA 5BV7C 2VRAA 4NJAL 5JIHA 1T22A 5CEYB 3TIDA 15C8H 3D39A 3M8OL 2E7CA 3QPXL 1JWUB 4XNYL 2RB8A 1EZVY 3T0EA 2FO1A 2VLMD 3O6FD 4S2SB 4OD3H 3D2UD 2X4OA 3P9LB 3BI9X 1CF8L 1FVDA 1ADQL 5I74C 2CLZB 4LLUA 3S9DB 2ID5A 3CH1B 3EHBD 4XAKD 5FCSH 4PJEF 4LEXH 2QKIA 3MNVB 5F7UA 4WV1B 5I17B 3Q6FB 2XKNB 1MJUH 1QFPA 4FABH 4BH7A 1CG9A 3HUJB 3ME0A 1Z6JT 5SWSE 1ZWIA 1NAKH 3MRMA 2UYLB 1U91A 3FQWA 5DRNA 2VLKD 1BF2A 4ERSH 1GL4B 3HR5A 4G43A 3ARQA 1ZT7A 1CLZL 2VC2L 2NX5A 3IDNB 5JR1L 5H8DA 5B4MC 4NKDA 1H3TA 4OV5A 4Y2DB 3MRKA 3OKLA 1F4WH 4NKMA 4BM7A 4DOHB 4OT1H 4PRPE 5JUEH 5C7XL 2NMSA 5I71C 5DVKA 1QPXA 2IPTH 1S3KH 4HAGA 2VH5H 3BISA 1G7HA 3C6LC 1NFDE 3GB7A 3OKEA 4I8DA 1ZHKA 3B9EA 1J05B 3LAFA 1BVKA 1XGUA 2XFXB 3SKUD 1RJYA 4C4KT 4DZBB 4LEOA 4NQEA 4OZ4B 5EO1B 4C83B 1IILE 2AK4E 4X0KA 4LAQH 2H8PA 4LLWA 3RPIB 3GFUA 3LZFL 4DCQA 3H3PH 3MRLA 4PRIA 3TNNB 3K4AA 3O9WD 4MD5A 1ZHBA 3PQYA 1ZANH 3OKEB 3V4PL 1DBKL 5HI4D 5HYIA 4HK0B 4BH8A 4MVBD 5E99H 1OAYH 2Y4SA 1CTOA 4XX1E 3Q6FA 3RGHA 1GGCH 3RL2B 3P0VL 2PF6A 3LH2H 1GZPA 3BD5A 3HMXH 1CD1A 1EEYB 3BPNC 3NCFB 3L3HB 3BW9B 1Q9WA 1ZT4A 4NIKB 1U3HC 3KLAB 1INEL 3P77B 5IIEA 1GIGL 5L7XH 4M4PA 1DEEA 4Q0XH 3DX6A 4PV8A 1ZT7B 2A1WL 3SE8H 4XWGH 3EYSH 1E6OH 4U3CA 5FO8A 1H3UA 2VXQH 5E6IC 1ULVA 3VXOB 5IGXL 3TO4C 5KSBA 1H0DA 5DQDH 4J6RL 4G3YL 4GSDH 4HIHA 4AM0A 2L7JA 4OQ1A 1RHHA 4ZAKA 7CGTA 4HD9A 1HH9A 2HWZL 3CVIL 2AGJH 4JHZA 2AXFB 4AQ1B 3HNTH 3SGJC 1JYVA 3UTSE 3DO3A 2BSTA 5J9PB 1F42A 1TDQA 1FNGA 4WU7B 4DGIH 5IW3A 3MRJB 3PQYD 4ZS6C 3PHQB 2P8MB 3DX9A 3HZMB 1UM6H 3GNML 1X5ZA 4IEFB 1TTUA 1UZ6E 4YH6A 4IIQC 4OZHF 1HH9B 5SWQA 4CADA 4MQ7A 5CEXB 4JM2B 4XVJH 1N8ZA 4Y0GA 3HPLB 3HRZA 3QUZB 4KRPD 1REIA 4HV8A 4MMZC 3MRJA 4KK8C 3WJLC 3QDGD 2ICWI 5JA9A 4GG8A 4U1LA 2EYRB 4HUVB 2WWMC 4ZXBA 2V2WB 4E9LA 3AREA 3U4AA 2D7TH 1GZPB 3UPAA 3RVWD 3JWOH 5D6DC 2GHWB 3CVHL 5IB4A 1Q9WB 4MS8D 3TZVA 3KPSB 3OKYA 4XNZB 5EOCL 3LRHA 43C9B 4P2CG 5JR1H 2EDTA 5IB5A 2CDFB 2OI9C 3GO1L 3FT2A 2IH3A 2LVCA 5T3ZE 1D5MB 2VERN 1J0ZA 4HS8H 5D2NB 4MJ6B 1MIML 2IALB 3HE6B 3CUPA 1QD0A 4X7CC 5J13B 2D03L 2UWEA 3V0WL 1MLCA 4UMGA 2ZUUA 4OM1L 3KYOB 5MERA 4UV7H 4OGXL 2BY3A 1UB5B 3QO1A 1J11A 4HWBA 1G7JB 4N8VA 4D3CH 1A6VH 5T3ZL 3EO0B 3EJZD 4ZNEE 4K2UL 1A6TA 3L95A 3VXUA 4X5XB 3C60D 1MH5B 1FCGA 4H26A 2QQNL 2OCFD 3NH7L 1ZLUK 5EFIB 4JFYA 5IM7B 2UY6A 1PAMA 4JVUA 3VFNB 5DI8A 3T3ME 4UB0H 3S8WA 3LQMA 5DD3L 2R1YA 3ARXA 1T7VA 4PGEA 2G5RA 1Y6KR 3ETBF 4IRSB 4Y5YB 1HNFA 1LO3H 4KPHL 5FO9A 2DQEL 3QO0A 1MCPH 4S1QL 2VXQL 3UC0H 5KSAC 3K81A 1IM9A 1I8KA 3NFNA 4FHBD 3ARBB 2OTWA 4KU1A 4KMLB 1KTLB 3ZDZF 4EIGB 1G7PA 2DF3A 2R2CA 1UT9A 3O9WB 3LN9A 4W4OC 5FYJD 2F8XC 3SBWC 4PJXF 4PLOB 1BX2A 3GMLA 1BFVH 1BZQK 3PQYB 4LSRL 5B8CB 2EKSA 1ZGLB 4OLVH 3FO2B 1BIIB 1KT2B 4ZOAA 5A2FA 3S3PA 4YHMH 2ZP0T 3PWLA 3MROA 1ROWA 3KYOA 4PJGA 4PV9A 3ZHDA 2OSLA 3GUTB 3TCXA 4LCCB 5ICZA 5I1GH 2H1PL 5EBWA 1IC4L 3VXRA 4NJAH 5A2IH 5JNYA 1MRFL 3VXPB 3O4LA 3GEWB 4PGCA 3E3QC 4EQ2A 2APTA 2BVEA 1EO8L 5C3LD 4HLZH 3ARDD 5I19H 4HQQL 4OQTA 1BF8A 1DVFD 1MFDH 5I73B 4ZYKA 4ETQA 1WWBX 3Q48A 3MR9B 2JIXB 2W60B 3GSUA 1JJUA 3S34H 4U7MA 3R1GL 1IRAY 4NDMA 1Q9LB 4WI6A 3T2QA 1CGYA 1QBMH 3KYKH 5L6YH 4WENB 2QADB 4GXUM 1KTKE 1UA6H 4P5TC 5D2LB 1DQML 3BPCA 4NNXA 5D2NE 1NGQH 2CGRH 5IBLD 1EIBA 5KTEL 4EN3C 5F9AC 5J7CC 5L2KA 1AQDB 4QRRD 1EV2E 1IGML 1RZGB 4K3EL 3RTQC 2ZOKA 3G9VA 4R0LA 3BMWA 4X6DA 1IARB 3UTSA 5DUPH 2FJFA 4K94L 3O6KL 3FO0L 1UVQA 4UQ3B 1NGPL 1I1YA 2EDQA 3HZYB 1EAPB 3IDJB 5JW4M 4KUZL 1K8DB 1IM9D 1GC1L 2B1AL 1MAML 5TDPA 2XZZA 2EH7L 3PWPE 4M6OH 2OZ4H 4IOSD 1TJIL 3KDMA 1JRHL 4R0LC 5I1HL 4FQJL 2OL3A 1NGYA 1N5YL 4MNHB 3QNZA 3QCTL 4HXAH 2O61B 4D8PB 4RFOL 2QQQA 1OT2A 2AEPL 1XGYH 2VDRH 3SGEH 3CFBA 1VEPA 3O2WH 4Y1AD 1ODAA 1IC5L 3RUGF 3X12A 4AK1A 3K80A 2HFFA 3G5XB 4Y88A 3D0VB 4U1KB 2VITB 4PJBA 1QKZH 2FJGB 4KZDL 2DJUA 1C5DB 3FTGB 5IQ9B 1ES0B 4JRYE 3VGBA 1CVSC 1YEIL 4HKBB 2YPLE 4K8RH 1IBGL 3BDXA 4I3GA 3ZKXC 1IE5A 3OXSB 4MHHG 4YHYC 3JVGA 3T1WA 4FQQB 1AE6L 3IFPA 3O2VL 4IRSD 2E9JA 2VITA 4PJBB 4B41A 1X5JA 4MX7B 2DD8L 5E4IA 5C0RH 1HINL 5JW5B 3O8XB 2E6JA 1I1AD 2E9WA 3CSBA 4NQED 2ZOLA 3ARDA 3EYVA 1BM3H 4QF1A 2V9TA 2VLKA 4ZD3H 1J88A 1G0YR 3HNTL 1P1ZA 3MO1B 2BVQB 5F7HA 4LSQL 4ENEC 5C6WH 2WUCH 2HP4A 3SJVB 2ESVB 4LU5H 3BHBB 1ZT1A 2Y6SC 1L6XA 4PD4J 3LEXA 4BQBA 3MBEB 3BDYH 1INDL 1TVHB 3HN3A 3QDJB 3L3DA 5F7FA 3FB7A 5J3HC 1UA6L 2E9BA 4WHTB 3RNKA 4OIAA 5C07E 3P9LA 3B8YA 4WTZA 3RUGA 2NXZC 3R0NA 2FIRT 5L88H 1DVFB 4UT9L 3WS3A 1W0WA 4X80H 4GUPB 5GRJL 4DFHA 4N90D 2D9CA