4ZNEE

Igg1 fc-fcgammari ecd complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
215
Chain Sequence
b'PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity immunoglobulin gamma Fc receptor I
publication title Structural insights into the interaction of human IgG1 with Fc gamma RI: no direct role of glycans in binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 215
sequence length 215
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zneE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zneE01
2W59A 4GXVL 3SE8L 4L9LB 3QDJA 1YEDB 1RZJH 2FD6H 2W65B 3O9WC 2NY1B 1ZWIA 5GPRA 1JRHL 2H41A 4X83A 3DVNA 4YHOH 4JDZB 1A7NH 2IBBA 3UBXB 1F45A 1H9VA 4XNXH 4MB3A 3D3VB 3RGVA 4HWNA 2FGWL 4RGOL 4YDJA 3LOWA 2CQVA 1QBLH 5DHYB 5LBSL 3MLYH 4I0PB 5C9JB 2EH7H 3FB7B 4YBQC 2HWZH 2Y6SD 2P8MB 4PGDB 1AXTH 3HB3D 5H37H 5LGKA 43C9A 1S7QB 5IR1B 1QSEE 3RX7A 3ZE0F 1VEOA 3BIKB 4KAQL 1KT2B 4KH2A 1BQLL 4M7KL 4PJ5D 2NY4B 4P48A 5KOVC 1N3NB 5DRZB 4KTEH 1C08A 4E9LA 2Z91A 4OGYL 1QTYT 5LGHH 1T66C 1TXKA 5KSAC 1EEYA 3OZ9H 5F1OB 2F74A 3HMWL 3C60D 2LE9A 1GSMA 3U4EB 2FHBA 3FRPA 1KCVH 3DX6A 5CJQL 1HHKB 4BSWA 2EXYC 5E24E 1S5HA 3PGCA 3VXME 1PY9A 5C0GA 2UZIL 1KB5B 5GSRB 2X05A 2RJMA 2CO6B 1OB1A 4L4VE 1U91B 1CT8A 3QXVA 4PS4H 1Q9KB 4U1JB 2V5YA 3ZL4H 5CGYD 5BW7A 1NCWL 4AG4H 2CK0L 3OPZH 4R6UA 3DHMA 3V6FA 1CXHA 5F3HA 1LP9A 1CLZH 2EC8A 4B50A 3VXRA 5IVXF 1HH9A 4W70A 5J3HC 5SWSD 5E8OA 3U82B 3ARVA 2CIIA 5E8PB 2A9NH 2M26A 2VSCA 4WFFD 3QIWA 3VWKA 1YEFL 4OZGA 2P46B 3DV4A 2OZ4H 3HC0B 3MJGX 3S5LA 2CKBL 3FKUS 4MB5A 1YPZE 4OUOA 3PHQA 4PJBE 5HYJA 2WQRA 3PQYE 4MDIA 2JLLA 3VGAB 4RZCA 1CDBA 3GBMH 2JJWA 3JBG7 4UIKL 4J1UB 2XXCB 3WO4C 5MEOB 2OP4H 2CD0A 1X5YA 3DRQA 1J8HE 3U7YH 2X4RB 2HJLB 4UINL 5HDBF 3FQRB 3QSKB 4XI5D 1MHEB 2PYFA 5DUMH 2GAZB 3N1PC 5EZLB 1RZ7H 4KDTC 3VD9A 4WU7B 1OP5H 3DX8A 1NUFA 3GFUA 1MREH 3VA2C 1CU4L 2ZKHL 5J57B 4ZFZA 1UJTA 1I3VA 3SE3A 3BE1H 3DYPA 4A6YH 4Y2DD 3EOYG 5CZXC 1IBGL 5EZJB 3VMOA 2VLME 3IETB 2VNCA 2FHCA 4YHLL 1ZANL 1KIPB 1QKZL 4NUGH 4QF1A 3VRIA 4WV1A 4M1GL 3H9SE 2XZZA 5GRZA 2YBRA 2ARJB 2OR8A 1N6UA 3O4LA 4Y16B 1CFVH 4X99B 3D85B 4Q9QL 5ERWB 4J4PC 3TH2T 5DQ9B 1LWRA 4IHOB 1EDQA 2YRZA 1U2CA 1KJ2B 1RFDL 3LQAH 3MRCA 1TQCB 5E5UB 3CXHK 1FN4B 3KNBA 3TVMB 3CZFB 4K9EH 2X4UA 4P2RA 1TCRB 4YHYC 3UBXG 4OQTL 1VFMA 4OSUL 4K2UL 5LXGL 5HI5D 2NYYC 1VGKA 1NGYB 3SDDD 3BRDA 4XT1C 1T89A 1KN2L 4EVNA 1MPAH 2YPLB 1U8PB 2R56L 4NM8H 5KN5B 3EYSH 5HHXH 4D0CA 2NZ9D 4HH9A 3MLZH 3OHXA 1ZHBA 3MCKA 4OB5H 4R26L 5DVOA 3SDAB 3CDGB 3KPQB 4JPIA 4UNUA 4OTXH 4HULB 1GIGH 3TPUA 5DD6B 4YH6A 2IG2H 3MLTB 4G9DA 3VFTB 4JO3H 3QDMD 1KYOJ 3AB0B 3OB0K 1UM5L 3FQWB 1LNUB 1I1AA 2JE8A 1KIQA 3LZFH 1TETH 5D7JB 4NQCD 3L3KB 4FFWC 2EDXA 5HPOA 3RL1B 4PLJD 1MOEA 3LH2H 4HKXA 5HD8D 2OR7A 3FB5B 2QJDA 1OD9A 2DQDL 2L0DA 4JRYB 3BW9A 3VI4E 5HGAA 1QBMH 2N56A 1UWXK 1I9JH 3LMJL 3GBNL 4OQTA 4V2BA 1YYLL 4HGMA 5AYUH 5ITFB 1IJ9A 2OLDA 2BVOB 2ZPKH 1OAUH 3WLBB 3WXVL 1QFPA 4G7VL 1R3JA 5T3XL 5EN2B 4ZOAA 5EU6B 5HGHA 4LSQL 3REWA 3UXFA 5KAQF 3VFNA 4G5ZL 1OQXA 2ED9A 1KULA 4PJAE 1ROWA 4U1GB 4Y1AA 3ZT6A 2X4OA 3VXSE 2XG5A 2BY2A 3S96B 1X5GA 4JE4B 4UNTA 5D93C 2VWEC 4MJ6B 3T1FB 3CH1B 1D9KD 1FNEA 4MA1C 3DI2B 1NGXB 5BXFB 1JTOA 2HFFA 4M8VA 3RZCA 2CKNA 3X3FH 3BZFA 3HMXA 4YZFF 4L8DA 5EBMA 4Y4KD 2E7CA 5F8RC 1S7TA 5FO8A 1MQKL 3T77B 2BK8A 4XXDB 2E5EA 2BX5A 4X98B 1X5IA 2C1OB 2Y5TB 3P11L 5ANMA 3N0PB 5ICXB 2BERA 4LLAA 1UZ8B 4XMKH 4N9OB 1CYGA 5MENA 2DTMH 2AQ2A 3INUH 3TGXA 3MLWH 1H8NA 1HCVA 3PV6A 2E9IA 1RJZA 1GGCL 3KYAA 1EXUB 1HHGA 3VI3F 4XBEH 5C71A 2PNDA 3UAJC 2BFVL 3U46B 1Q0YL 4PLKD 3BPNB 5B3JE 4X4YA 1NC4B 3AM8C 2V9QA 2R1XA 1QD0A 4F9LC 3ULUE 3RDTD 3FFDA 1V5JA 3S34H 3FO0L 2R1YB 3QJHA 4JFZL 4GRMA 2VISA 5CKAA 4LGRB 4KRPB 4HWZB 2VKXA 2ADFH 3BP6A 1UACH 2BNRE 4X80L 1CBVL 3BPOB 4RGMC 3C5JA 1CGVA 2UYLB 3ARED 3O6FA 3QXAA 1EHNA 4GG6B 2BSRB 1KTDA 1XH3A 4JO4H 4LSPH 4XMLL 3VRLF 2YKLL 1KOAA 4PG2A 5I1GH 2DMCA 5FM4A 1I9IH 2P43B 4WUUD 1IKNA 4P2QE 4QT5B 4XNQB 5IW1B 2QQKL 4WWID 3D3VE 4P5TA 4N0CD 2XZAL 2VMFA 2XY1A 3PP4H 4UBDC 4LNRB 3WJLC 1HHHB 2PR4H 4HXAH 1IGFL 1PW3A 1OAQH 4H25B 1OL0A 3SGEH 4ZUSA 5IB4A 2H8PB 4O58H 3AUVA 2GJ6A 3VGFA 3Q1SL 5F6IB 4OGXL 4RCAA 4W81A 2HYMA 3MFFA 2L7JA 4HF5L 5EOQH 3T09A 2O93L 1A4JB 3L3HB 3MRMB 4XP1L 2XWBA 3QIUA 3PP3K 1RZ8A 4IM8A 4PJFB 3EYQC 3HN3A 1IFHL 2OXHA 5FM8A 4G9FA 1UVQA 4AQ1B 1ZMYA 3ARDB 4ISVA 1YEJL 3GSWA 1F3JA 5SWZA 2A73A 4LCYA 5D7SL 4IJ3B 4FFVC 4NJAH 4X8JB 3PDGA 5I8KL 4U6HA 1IEBB 4QWWC 4WU5B 4WHDA 1HYSD 1B0WA 2BRRH 4W6WB 4OF0A 5CUSL 3Q6GL 5JZ7D 4U1SB 4OLUH 1W72L 3EHBC 4FOMA 4NCDA 2XFXB 4KJYA 4NO2A 4PV8A 2WK2A 4HKBA 4U0QB 4P2OC 4JGUA 4F57L 4ETQA 1UM4L 4E0RB 1YY8B 1FGNH 2HRPL 3SQBA 4H1LB 3U6RA 2H9GB 2R4SH 2ILLA 4PREA 2RFXA 1KN4H 3HTLX 1MI5D 3K3QA 3QUZA 2AXJA 1XR9B 4LLWA 4HZLA 4R4FL 2VH5L 3OJVC 3MRJA 4MA8L 1YZZA 3HAEB 2NY5C 2BDNL 3BXNA 5E6IC 3NACL 5D4QA 2QADC 3RVVD 5SX5K 5MEPA 4D0DA 3IDUA 1KPUA 2PYED 5DEGA 1U8KA 5C9KA 2Y4SA 1PLGH 4OCXL 2SEBA 3VXUA 3NA9L 4GS7C 1FL3B 4RBPH 3TA3B 3CDYA 3MROA 1W72A 4OKVA 1NFDB 4HQQL 3W0WD 4FRWA 2BY3A 3W39B 4HDIB 4K94C 1BEYL 1G0XA 2JCCA 2UY6A 2NY6B 1RZKL 4L3EE 2GY5A 4UMGA 5IROA 5C0NC 2AKRA 3FHQA 3UJIL 4CBPA 4QNPE 1PKQB 4MNGB 4C4KT 4XVSH 2ORBH 4JCMA 4OI8A 4CMMB 1FCCA 4M1DL 1SHMA 2HFGH 5KSUA 1MCCA 1QSFA 4Z8FL 2LU4A 4X9IA 5GGSA 1IQWH 2FX7L 2JIXD 4GO6B 4HUUB 4WTZG 5DMGC 5BO1L 1ZLWH 1V7NH 2IH1A 3BP5B 1U8LA 5TQ0H 4OLVL 4IOFD 2V2WB 4NKDB 2R0WH 2P45B 3L7EA 2LV4A 1RVFL 2J4WL 4IRSA 1JNNL 4F7TB 1FIEA 4NN5B 5J6HB 2X4PB 4HKZB 4HUXB 1A1OB 3FJTA 4MZ2A 4JG1L 4OFYD 4N1HB 1GPOL 2W0FB 3LPGA 4JFDB 4QGYA 1IGYA 1QOKA 4LRIA 2YPLE 1XF4B 1ACYH 1OAXL 3S6CA 4S0SD 2BJML 4XP5L 5IBUG 2BP3A 3B2UD 5DJ6B 5C6TH 5IFHH 5DSCB 1AJ7L 4AEIL 1NLBH 3GMRA 3V5HB 2ADJB 5IOPA 4NO3A 2G60H 2Z31B 2AJYH 5D2LE 4LKXA 3EO9L 1RUAH 4GXUN 1YY9D 1D5IH 1G7LA 4Q6IC 3AAZA 3WIFB 4DKDC 2UZXB 5FYJD 1SJHA 3O8XB 4IRJA 4G8IA 3SN6N 4LLYB 4XC3L 4GBXA 3L3GB 4Z78A 5B39B 3QEHB 3R4DA 3CAFA 4Q6YA 1TJIH 5DJCA 4F58H 5CCKL 2OI9B 5I66B 2QLVB 1M6OB 3LKNA 3RQ3A 5JW5A 5EO9B 2Y06H 3VFMA 1YEHH 3QPXH 4YE4L 4KY1H 1PVHA 4RISH 1YJDC 3SDXF 2ZG2A 3IJYA 3GIZH 3VXNB 3FO1B 1DBML 1E0OB 5C0CB 4MAUH 1FFPA 4ZO8A 1IAIH 5L6YH 5EU6E 1MCKA 1ORSA 1K5NB 4RRPA 2WINB 5EOTB 3ZKMC 4RNRB 5HDQL 5HHNA 2C3VB 4H1LG 4FQCH 2FEDC 2VDNL 3OR7A 4PJHF 3RVWD 2WNGA 3LN9A 2VXQL 3HHRB 3QG7L 4C56D 5IT2L 5IB5B 1MH5A 3ULSA 3Q2CA 1ODAA 3KPTA 5H8DA 4NHCH 3H42L 3OKDA 2A83B 3LHPL 3IXTB 1IAOA 4X6BB 3F62A 2HFTA 1CR9L 3U30C 2DBJA 2DYPD 4S1DD 1CXEA 3HAEG 5LAXA 2G5BB 1B6DA 1BJMA 5C6PB 2MKWA 1ZAGA 4BUGA 2R0KL 4PJ5A 4HWBH 4MNQA 3JV6A 4DN3L 1A1MA 1I3RB 3KPNB 4FN0A 5DMYA 3E8UL 3THMH 1BQHA 3BZEB 3I85A 2A0LD 3PWVA 1J0YA 3C60A 4NYLB 3NOIA 1GAFL 2DQHH 5DVNA 1D6VH 1T83A 2NMSA 3TO4C 5DJAB 3I6GB 2NY5H 1M7XA 4D3CH 4U6YB 1QP1A 5LCVL 3VWJA 4JAMA 1NCBH 1WLHA 3VFSA 3IF1A 5IKCA 1MJJA 2CRMA 1RIVL 3MRIA 2FB4H 1ZVHA 4UIMA 1AIFA 1YMMB 4K94H 4F7EB 3V0VB 4WI8A 1Z9MA 4JO1L 2XG4A 4HG4K 3D69B 4GG6E 3ULUC 5LJYH 4Z9KB 5E08H 4NNPL 3DIFB 1F4YL 3CXDL 1QRKA 3RKDC 5F1IB 3VFGL 3X11A 3MRFA 2ICWJ 4ZFOL 1UJ3A 3PL6D 3U1SL 4I1NB 2H1PL 5J7CC 1N26A 4RWHA 4N8CH 3TIDB 4POZD 3M45A 1G6RL 2R23B 3OKEA 2AW2A 2ED8A 4QXUL 2RAMA 3V5DA 3KS0H 3OJDA 3QAZB 3G5XA 1CQKA 3EUUA 3UYRL 1BBDL 3AGVA 4YDKH 3OGOE 4XCCL 4ZUWB 5EUOB 2WBJC 3LN4B 4LHUB 4YBHA 5F9WC 5T5FH 3UCRA 5EOCL 1NGQH 2VDLL 1UYWL 2DD8L 3O6KL 3QXDB 5IW6B 4DVRL 4DK3A 5FGSA 5HYSB 4KDVA 3BPLB 2APBA 3VXQB 4DKEL 3MRNA 4WHTA 4JM2B 3RZWA 5HYIA 4PJBF 2BNQB 3TBTB 1AHWC 1XMWA 5B39G 1A4KB 4Y2DA 2D0GA 4ODHH 1ED3B 1NDGA 4Z7VE 4DK6A 2ATKB 4JQXC 3WD5L 5M94B 4Z5RA 2CR3A 4ZXBA 3H9YA 3RPKA 4ZFOA 1J10A 4IRZH 3IRPX 2ZNWA 2HH0L 5DD0H 2OCFD 5IMLB 3E3QE 4XHJC 1KFAL 3VFVA 1AP2A 3JWOL 4MQTB 4O2FB 3JV5A 5D7IE 1AD0B 3F58H 1T1ZA 3G04A 3GJFH 4YXLL 3QQNA 5E00B 2MCPL 1KJMA 3QEQB 1F3DJ 1S7VA 2XN9D 3D25A 4JPWH 5C0AD 2V5MA 2PO6B 3LPWA 4PJEA 3LB6D 3O6ML 3KXFB 2ADIA 2ESVB 1X7QB 3ZKSD 5E1AA 1L7IL 1YJDH 2OTUB 3SDDA 4P5MB 4JJ5B 1A3LH 1WFNA 3MRDA 3UTSD 4GRLD 3WFZA 3SE9L 5DT1H 5TDNB 3IGAA 3IFLL 5ADOH 4LKCA 4OAWA 4CRPA 4DVBB 4NZTH 4NFDA 4JZOB 1OTTC 4ZPTB 3UEZA 2NX5E 4OUUA 2Z0BA 4R8WL 4DFHA 4Y4HD 4OZIB 3NIDF 3SDCD 1Y18B 3F65A 5JLZB 4HIIB 4M9PA 1JYVA 5SWQB 2VABA 2DLFL 4XX1G 1ZT1A 1BOYA 3DMMD 1BLNA 3MO1B 4JFHD 4NQCA 4NZUH 4OCSH 4RIRA 5JORB 4IIQA 1S7RA 4GOSA 5JXEC 2X70B 1ADQA 4R7DB 4OZFA 2DM2A 1D5BA 3GMPB 4N5EC 2Q7YB 1G7HB 2CMRL 3BQUD 3CLFH 3L5XH 3HNTL 3EJZC 1EHXA 2X4QA 5DJYA 5A16B 4KK8D 1VKXB 5CJ8A 4GXUM 5IK3A 4GT7A 3S4SA 4WW2C 1YNLH 4KKAD 5C0FB 1WZKA 4NQEB 3T3ME 4ZYKB 5T1KB 1FGVL 5GS1A 3TN0C 5TDPB 4CAGA 3MA7B 1VESA 4XWGL 2W9LA 1JGUH 4NRZA 5T5NF 3BZDA 5E8NA 1GOFA 3D48R 5CSZB 2PCPA 1MCNA 4PRNA 4Q0XL 1U93A 3VI4F 1NJ9A 1FNGB 2EDRA 1BBJA 3SKMB 2HT4C 5T33L 3U9UB 5E2WH 1DFBH 3QP3A 2P5WB 5DRWB 3FT2B 3DBXB 2RCSH 3GSQB 5GGVL 1HEZB 5IB2B 3TC9A 4Y4KA 5EIIA 4ZG1A 3RTQB 3IU4H 3NIFE 1ZLUH 1JPSH 1SM3L 4ZO9A 4YLQT 4FQ1H 4WI5A 1XGUA 1MF2L 3EO0A 2FO4A 3NFNA 4RA3A 4PJAF 1J0ZA 1SY6L 2BY1A 3MNVB 4JFYA 1WWWX 4PJDA 3B9KD 3BGMB 5DVMA 1UWEL 3LQMA 4CU7A 1FIGH 1CL7I 2O5XL 4Z0BL 1ZGLP 1OGAD 3TZVC 3AB0C 1N5YL 2DQJH 4JFFB 1DUZB 3OMZA 2D9CA 5D7JC 4ZSOE 5CAYB 3QUYB 2Q3ZA 3O11A 3OKKB 4HUVA 2R0ZL 2BSSA 5DQDL 2F19H 1A6AB 3NIGF 5CSBA 1IC1A 5JOFB 3WE6A 4OJFH 2CO7B 4R96A 5C0JA 4MJID 1NUNB 5C0CE 3AREA 2ZG3A 4KGLA 2XRAL 1OGTA 3B43A 1Y0LA 3O3BB 1SYSB 1GGTA 1BF2A 4K3DH 3REVA 5I1KL 1VFOA 5TPWH 3NGBB 4NN7B 4NO0B 4QXWA 3OV6A 4XCNA 4L8CA 3CFKA 1SY6A 2NQCA 5F9OH 3ULUF 5I0DA 5I1DA 1QO3A 1NAKH 4RQQB 2IQ9H 2NY2C 4M3JA 2ZUQC 3CFCL 3PGDB 5F1NB 3QFDB 1DQJB 3BKJH 4JFEA 2F53A 3PV7A 1QEWB 5D9SA 2CRIA 1MCWM 1U41A 1S7XA 3ZDXF 1ZLSL 2A38A 5D1XA 4GKZA 1JMZA 2IALB 4HIXH 1F4XL 1JNHA 5EPMB 1G7QB 5EWIL 1PAMA 4L3AA 3L7FA 2YD6A 2B7DT 2XTJD 3FTGB 3KLAA 3IAGC 4TN9A 5L7XL 2CKBB 2I9LB 4WVRA 1NAMB 2EDEA 5IV2B 4XZUA 4TPRL 3QDGB 3B5GA 4OCWL 2AVGA 1U3YA 4KU1A 4NQVB 1IEAA 5FKAA 4QHMB 2YN5A 1CICC 1OP5K 1S7UB 3UTZB 2E8YA 4LMQI 1VADA 3CMOL 3MJ9L 5D7LE 1INDH 5IVXA 1YMME 1WIUA 1CIDA 1WISA 5E2TL 5TF1H 5DK0B 1L7TL 1GGIL 1PYWA 3BH9A 3W81A 3T4AA 1GGYA 3EBAA 4L3CB 2R0LH 3VFPA 1FG9C 4WHYH 5GHWL 1DQLL 2Z8RA 3NCJH 4X7EC 3NZ8A 5CBAA 5D1QB 4U2YA 1P6FA 1ZGLA 3H9HA 2PW1B 1U6AL 3BPCA 3GMLB 3S97C 2Z93A 4MNHB 2OQJA 4ZUVA 1JF6A 5JA8B 1CG9A 2VJXA 3GKWL 3H8NA 5D7KE 35C8H 1KEGL 4I48A 2D31B 3SO3C 1NBZB 1MFCH 2QL1A 3U4BL 3FT3A 4JDVB 1U8IB 1QR1B 3N9GH 1V3MA 3MRLB 1TCMA 2APFA 2BOBA 3ARYA 1SYVB 2VXTH 2PYEA 1MCSA 4BFIB 4WFGD 3TYFA 3C2AH 3FRUB 2Z92B 4OZHB 3BGFC 1EK3A 4PB9L 5IESL 1MIML 3HI1A 4MJ2A 5B8CA 5JHDD 5C7XH 2PXYB 2UUDH 3MJ9A 4UILL 4U33A 5T1LA 4G6AC 2ADGB 5IVOA 4M7LT 1P5UA 3SOBL 4XMPH 4RX4A 1PY4A 1EAPB 2QSQA 4MA3A 3ZYZA 4PGJA 5KVEH 5DLMH 4N0FB 4JFQB 2VDPH 4LCCA 4LU5L 2Y07H 4XNUL 2JJUA 4EI5B 1I7UB 2DKMA 3UTPD 3PWNA 4PIRF 4XCEA 4J7RA 3K80A 5IMMB 3GI9H 4O9HL 1CCZA 4R0LC 5FOJA 1MLBB 4FQHB 3KJ4B 5F6HI 5IIEA 5FYJL 2WUCH 3BWAA 5I73C 2A6KB 2FLRT 1P4BL 3ZTNL 2NLJA 2VXUH 1Z3GH 4PGEB 3QPQC 5JIHA 2EKJA 1WWBX 3P9LB 4QCIA 4CKVX 5FUZL 12E8H 2AJZA 2HMIC 3PJSB 5JO5A 3GJEA 4ODVH 3E3QC 3QEQE 5CEZD 2VZTA 4HFUH 3GMNB 4G80B 4IMLA 3IKCA 3A67H 1NBYB 3P40A 3QRGH 2QBWA 5AG8A 1AR1C 1N0XL 4OFYA 4LSTL 5DD3H 2YUVA 4QNPF 4PRAA 1U8NB 2UVFA 3WDIA 2HRLA 2BXZA 1EH9A 3FOLA 1GZQB 4D8PB 2DB8A 4PRHD 4F7CA 4MHHG 1D7FA 3U83A 5FB8B 1TJGH 5C08D 1L9MA 1HHJA 1MJ8L 5FO9B 2ZCKL 5BZDB 2HLAA 2VIRA 3QWOA 1HOCA 3NFPB 4FZ8L 4G8GB 1MCOH 1LEGA 4HWEL 4CU8A 1A9EB 1FG2B 2VITA 1WT5C 1I8KB 1K2DA 2B1AL 2FR4A 1DQDL 4WI9A 4NWTH 5LGJA 3QXUA 2VTFA 4GAYB 4IS6A 4GMSH 1CFQB 3KLHD 1FZJA 3DX7A 4KKLC 4U1NA 1UA6L 5HDOA 2YUWA 1SBSL 3WN5C 3WXWH 3Q5YA 3C6SA 3AU1A 2V17H 1X3DA 5JQHC 3OSKA 2A6IA 3X17A 3ARBB 4NQEE 4L8SB 1IM9B 2IAMB 1RULH 4QHKI 1NGZB 5F70A 3RWCA 5GRWA 2NY0B 4XCFH 4R3SB 4FXLA 4IDJH 2F54A 1YNKH 2NR6C 5ICZB 4NBXB 1MRDH 3KHQA 4XPFL 4BJLA 3MLUH 3MV9A 3UPRB 2E7LC 5TE7L 4C56A 3O9WA 1L6ZA 5BZWB 4OFIA 1JI2A 3X14A 2X4NB 3MV8A 3V8CA 4X7DC 3P73B 4HJGB 2UV3A 4YHNA 5IVNA 3TFKC 3OX8B 4H8WC 1PZ5B 5DUBA 1GCFA 4HJ0D 3OXRA 1T7ZA 2R8SL 4K3HA 3PGFL 3PWPB 3MFGB 1JHLL 3RPIB 1WZ1L 1MJ7L 5FM5O 2Q6WA 3RWJB 3CC5B 4PBXA 5J12C 1WTLA 3MRGA 4QYOA 3BJLA 2DQCL 4DOHB 4LVHB 4WGVB 5K9OB 2G2RB 4U1KA 4HC1H 3WLWD 3WNOA 4UQ2A 5GISL 4P5KB 3NH7H 5JW3H 1B90A 2Z31C 2NTFB 4J3XA 4D0BA 5IMOA 1FPTH 3CVHL 4JFFE 3WIHL 1AGCB 3VXRE 4BKLA 1KF9B 1PG7H 4R97C 2DQUL 5IMKB 1N6QH 3DTXB 2G5RA 3MJ7B 4LCIL 5CJXC 5HGDB 5KG9A 5B4MD 3X13A 5EO1A 2ZUYA 5E0QA 4HS3A 3RGHA 1XZ0B 5FHBH 4PLNC 2OI9C 3HI6L 1VSCA 1MVUB 5GGUB 1S3KL 1DP0A 2DQFB 2NXYC 2WANA 2X89D 4LSVL 5BS0D 1M4KA 1HCFX 1HZHH 3VFRB 1ZEAL 1P4LA 1A7PH 3C08H 3QCUL 4JANA 4NQUA 5K59F 5D6DA 2HTKD 5D96C 3I9GL 1KBGL 1LEKB 3DROB 5I9QB 3HE6B 5HHVL 5GRVL 4JFPA 3TNNB 1UCTA 1T4KB 1NCAH 3FHAA 3SPVB 4F9PA 2YSSB 3UTTB 4BH8A 4RMRA 1IGJB 1JNLH 4TVSa 4K3JL 3G6DL 1R3IL 1BZQK 2F58H 5HHOB 4XRCA 5EU7E 2YZ1A 2Q8BH 3U0TB 5LWYH 2NY1D 3CVHA 1RIHH 3WIHA 2AAVA 4OT1H 4EJ1C 4GG6F 2P24B 7FABL 2HLFC 5IGXL 4N8PA 2QSCL 5C0BB 1NMBH 3RVUC 1E28A 4NC0B 4ODTL 1DBBL 2X41A 4DN4H 4U1IA 1MAKA 4HK0B 1CZ8L 1KCUH 2QQNH 4XCYB 4D9RD 1K8IA 2R2HA 3H6JA 4M7LL 3KJ6H 4TTDC 4BQCA 3O4LE 4I0PD 1X4YA 3TT1L 4KDTA 2FSEB 2J5LC 4I18C 1CE1L 4U7MA 3MUZ1 4GKSA 4RBPK 3VFWA 4N8VA 2DMBA 2XY2A 1LO2L 3F7YB 5DJZB 2NY4D 4FQJH 3Q3GB 3EYUH 4PTTB 4V1DD 4PJFF 3BVNB 4N0YL 3F7QA 4AQOA 4JR9L 4JN2A 3HLAB 1RAMA 4YDVB 1ND0A 1ZA6A 1JGLL 4GAFB 1KJVA 5BRZB 4JKPH 1NMAH 2KZWA 2ENSA 5ISZB 4PJ8C 4GMTL 5T3ZH 2WW8A 2XN9A 3E6FA 5C1MB 1HI6B 3KPSA 1T04A 2VQ1B 1WBXA 5GS3A 4TQEH 4AT6A 1FRGH 1ZA3B 4JLRA 32C2B 3IDGB 1ZLWK 4WHYG 4KVNH 5ILTH 1CD8A 1YQVL 1T03L 5F71A 2O5ZL 5A2IH 1OSZA 1EUUA 3TH4T 1X5FA 4M6AA 3ECBA 5ACZB 1X9QA 1TPXC 3GM8A 3MTRA 5D7IF 1AXSA 5KVGL 1JK8A 2VDQL 2OS7A 3FONA 5H35B 1WJ3A 4YNYA 3LPFA 4MXQC 4QRPB 1UZ6E 2CDFA 1BAFL 2EE2A 1S9XA 3SBWA 1RUMH 4PY7A 4X4ZA 3VG0L 4FTVB 2AJ3B 4NZRH 5D1ZD 1N2RA 5IJKA 3GM0A 3P77A 2P1YA 4FZEH 3OL2A 2EYSA 4NT6B 5FA3B 4LLUB 3QUMA 2VAJA 1D5MA 4H8WH 5E99L 1BJ1J 3QQ4B 3A6BL 4NGHL 4WO4C 4CN4A 1KTLA 3B5TA 4GLRI 1UGNA 1LDPH 3BQUA 4QRQB 1ZXQA 3DVGA 1IKFH 1F42A 3OJ2C 3BKYL 4I4WB 3KPLA 1CWVA 4YHMH 2DTSA 1UKSA 1GC1C 4N0UB 3KPOB 2H32B 4B7IA 1W8OA 5C3TA 1KIRA 5AZ2L 2XKNB 3HE7B 1AR2A 5CWSB 3CSPA 4MAYB 4OCRL 1NFDF 3LS4H 5ID1B 3C5ZD 2AXFA 1Q0XL 1IC7H 1G9EA 4A2LA 1HHIA 5ESQB 1WFUA 1B4JH 5D72L 3PWJB 5F89A 5EO0B 2DRUA 4S1SL 2OTWA 1C1EH 4X4XB 2BHYA 4LLVB 4Y16D 4LPVA 5IBTL 3NFSH 3RUGB 1IAKB 1J1PL 4MS8C 2FJFB 1LGVA 4FQIH 3FCTA 2IFFL 4Z7QE 2GT9B 3GSRB 4P59L 2RR3A 4ENED 3MLRH 2CIKB 2MFNA 4M6MH 3T3MF 2VR9A 1SEBA 4MQSB 3TVMD 2UVEA 4GG8A 5T3XE 4XTRC 1LDSA 4HAGA 1YN7B 4G8GE 1T20B 4ZOEA 2UWEB 5LQBH 4KMLB 4CUCA 2LFGA 2HA1A 1AE6H 3GB7A 3U2SB 5FYLD 2XPGB 5EDXA 4KQ4H 5I19H 1EZVX 3B9KA 3PWUA 1DVFC 1X6NA 1B6UA 1B0GA 4AEFA 3L1OH 3IS1X 3VXTA 4JHWL 2P8LA 1INEL 3FO9B 5I30L 1FDLH 2AEQH 5CIPH 4BQ9A 5DEFB 4NKOA 2FJGA 1JWUA 2LVCA 5B38G 1JPTL 4MCYB 3SDAD 5SWSB 1NSNL 2B0SL 1J7VR 2EKSA 3NIFF 2QKIB 3SDXA 1BPVA 1JPFB 1MFEH 5I1EH 1TTUA 4M61A 1YN6B 4Q9BA 1A6UH 2XTLA 3WHE1 4MJIA 1BP3B 5I76A 1BQSA 2FRGP 3AM8A 2A9ML 4ZODA 3F6IA 3HPLB 1NKOA 3RWDB 1XGRA 2WAHA 1X5LA 1N5AA 5IHZB 4OD2B 2NXZC 3N1QC 2JJVA 1RJYB 1J1XL 4LLMB 1DBJL 4JRYD 5T1DH 4PJHA 4HS8H 2DQGH 4H88L 1DUYA 4OLZL 4YDLB 5I15H 4RDQF 3U0PA 1NLDL 2GJ6E 4Y2OA 5CHNA 5C8JA 2BNUA 3O0RL 3RGVC 2DJ4A 1G7IB 1C16B 3STLB 1VPOL 2BVQA 3FMGH 5D5MB 4MA7H 3S3JA 4LFHD 3VMPA 3MRQB 4O2CA 4DW2L 4WW1B 3CFBA 2Q86B 4TNWF 2RIKA 4G8FA 1FFNB 3TT3L 5AAWA 3QHFL 1A8JH 3RWHB 2ITDA 4G9FE 5E70A 4JEGB 4JY6A 3TM6A 3WL9A 1I3GH 3MGAA 5SWZE 5I1LB 4DCQA 1IVLA 1CFSB 2JB6B 1R5IB 1P7KA 5BVPH 4QRSB 4Z6AT 3C2SA 3LRHA 3B9VA 4QHLA 4YFLF 1CGWA 1A22B 4PJCB 3WNPA 3K0WA 3K46A 3MRHB 4OD1L 4ZUTA 5GJTH 1A02N 5AEAA 3G6JB 2BOCA 5EH1A 4PJXB 2WIIB 1P7QD 1ZHKB 1UCBL 3IVKA 3P0GB 4ERSH 5ICYB 2AEPL 3EDDA 1U8JA 4J3TA 3B3IA 5J11B 3IXAA 3MRKB 5E94A 1MY5A 1XCQA 4BQ6A 3RWFA 3SGJA 4P4KB 3KPMA 1OLZA 1FBIL 1HXYB 5DMIL 1XR8A 1S8DB 3KYOA 4UZGA 4LF3B 4M5ZL 4FABL 3ILPB 1AKJA 1IGIL 1VA9A 3ARGB 3WFEL 5I8EA 3MLVH 3RX8A 3RVTD 1CIUA 3QIWC 4M7JH 4O4YH 3VXMA 4NPYB 4K07A 4Q9RH 3NN8B 2DL2A 4P46A 1NC4D 4ONGH 1MCFA 2EIZB 3DNKA 4L4VA 1RUQH 2GK0B 2K1MA 4P2OA 15C8L 3HG1B 1QG3A 4OD3L 1XGTB 3IDXH 1YEIH 4PJ9B 5BV7H 3BO8A 1F11A 4KRPD 1JHKH 4EQ3A 1UQSA 2IANB 3GJFK 3CZJA 4UV7H 2IQAB 3AMLA 4RAHA 4NN7C 1MFAH 4P57B 4Z7WB 1KELL 2BC4B 3PDOB 5ABDE 1LO4H 5E2UH 2NY7L 3U4AA 5CEZL 2FGZA 3BZ4B 3C9NA 5CINL 1NEZB 2EDWA 5CP7A 5C2BL 3IDIB 3MCLL 1BFVH 2JCCE 5HJ3A 4C59B 2I5YL 1F4WH 1M05B 1BD2D 2MCG1 4NBYB 4TSAH 5EU7C 5A1AA 2OSLB 4LIQL 4PJBA 3PQYA 3O4OB 4FXGA 2CR6A 1A14L 4DZ8B 2DQIL 3FQNA 1AGEA 4MD4B 2XV6B 4QHNA 5GGVY 1YMHB 4JHAH 5ACMA 4CN6A 4WWKB 5HVWA 5I8CB 3IFNL 4GKNA 3O3AA 3SQOL 3T65A 1G84A 4BH7A 4WTXA 3IDNA 5GIRA 2A74A 2CLRB 4W4OA 1T22A 4YX2L 2FBOJ 3HC3L 5EUOF 2NNAA 4ONHA 1QLFB 2APXA 2VUOA 1K8DB 3B2VL 2BMKB 1FL5A 1WCQA 5F9AC 1VACB 1BFTA 5HHMD 2AGJH 4F7MA 2EDFA 3ARDD 5DJ2A 4AIZB 1D9KB 4E41B 5JDJA 4FQPA 4ZPVB 2G75B 1A7QL 4JM2F 4KI1A 1A9BB 4OF3A 2DIJA 2DI8A 2XWJB 3L3OA 3U36B 4JM4H 4LAQH 3MBEB 1F8TH 4OGAD 1HNFA 2EDKA 5I17A 1R3LA 1UH3A 4Y5YC 4Q9CA 2DQEL 4YO0A 5HHQB 4AIXA 2V2TA 4Y5XA 1FNSL 4QTHB 2VDOH 1CL7H 1T2XA 4JG0L 2NPLX 3TP4A 2D7OA 2CDGA 3KPPA 5FGCB 3C6LB 1BZ7A 3KYKL 5C08A 2X42A 1FV1A 4Z76A 4PR5A 4Q2ZA 1B0RA 4QRPE 4C83A 1RUPL 3WUWB 4NBZB 4G42B 1LO3H 5FF6A 5E5MB 3TCXA 5EBWB 2EO1A 4QRUA 4GAJH 4M48H 3MRRB 3EO1B 4FMFA 1IGTA 5GGRA 4HHAB 3MJ8A 5DS8A 3RDTB 1ZLUK 5CILH 1R5WA 2HKFL 5IB3A 1F90L 2AEWA 4Q6IA 1NEUA 5IBLD 2IBZX 4UV4H 1WF5A 5CEYB 4OZIF 4QY8B 4DGYH 3Q6FA 4Y89A 4XNMB 1K85A 3RHWK 4HH8A 5C0IA 3N1MC 5L2JA 3MYJA 3OKNA 3TA3D 1UENA 4WUUB 3QCTH 3EYOA 2EZ0C 3QQ3B 3QI9D 4I3GA 3TLRA 5EB9A 1KNOB 5ELIA 4GXVH 3SE8H 4XNZC 2DLHA 1MCEA 3ARQA 1RY7B 2YMXH 2VSDA 3O6LL 3MNZA 3WJJA 5J4MA 4HBCL 5E4EB 5DTFB 1KG0B 2X6MA 1LK2B 1N6VA 1U3HC 3LCYA 2VDML 1HDMA 4IOIA 5GJSL 5FIEA 2YUXA 1NANI 2GCYB 2FGWH 4I9WD 4LLQA 2W9DL 4PJ5E 4KWUA 1XCTA 3S36X 3HA0A 2R9HD 3RZCC 3VRJB 4I2XB 1CDCA 5MEQA 1JZ2A 5SX4I 4NRYA 4X5XB 4EUPB 1SJVA 5IEHB 2GHWB 1I8MA 5BV7B 1OP3H 2ZOLB 5IEKB 2ITCA 5IF0B 4S1QL 3U0WL 4LSRH 4AYFA 1NEZG 4YHKL 1ONQB 4PJAA 1BQLH 4M7KH 4N9GA 4JPKL 1UEYA 3BDXA 2H3NA 3OGCB 4HIHA 4JFDD 4CMHB 5F88A 3HMWH 4D9LH 1FVEA 1UWGL 1EO8L 4APQB 3E6HA 3MMEA 2UZIH 4XH2B 3ZHKA 4OGZA 5F7EL 1ZHLA 1RZIA 1D5ZA 4J4PD 5SWSE 4HWUA 3RIAK 4ETYA 5JR1H 3QIBD 4X6CB 1UB5B 3TO4A 1QNZH 4KJWD 4WFFE 3TJHC 1AC0A 4TUJA 3TBSB 2CK0H 5CJBA 1X4XA 4ONOA 1TZIB 2JKXA 1R3KB 1MFNA 3KR3L 3O8XD 3O6FC 2BSTB 5DUPL 4YQXL 1MI5B 2X89A 1N7ML 5BS0A 3FOMB 3P4MB 4XBPA 1NGWB 1V3KA 3GMQA 1REIA 3EJJX 4HFWA 4KK9D 3ZKND 2I27N 1IKNC 5E7BA 3ARBC 3UTQB 1U8MB 2CLVB 1CD1B 5TGBB 5SV3A 1KLGB 2IAMC 4PG9B 4V2CB 4P5TC 2DI7A 1NCCH 4OI9A 1XF3A 1KGCD 5D5ME 2FATL 1L6XA 5L9DL 4X6FB 4GRWB 4UIKH 1QA9B 4LOUC 4L9LA 1AY1H 1YEDA 2W65A 2YA2A 1GYAA 4U6VH 1F02I 5ENWB 4RMWA 3LS5L 4UINH 4XAWL 3EOBB 1P7HL 1S78D 1KB5L 1MCIA 4KMTH 4KXZH 1BJ8A 3QIUC 3WUWG 1WZMA 2W0PA 3D3VA 4PJCE 5IQ7L 4GH7B 1QRNB 1CU4H 1X5JA 2ZKHH 3X3GL 5HTSA 4PJXE 4Z0XB 4I0PA 4M1CD 1FC1A 1H0DB 5ESVB 3FB7A 2BVTA 1F6LL 1A6ZB 1IBGH 3SJVD 1TVBB 1MWAB 2P8MA 5JUEH 3CUPB 4UOW0 4ZQKB 2GEEA 3VG9B 4TVPH 2JIXB 3BRGC 1S7QA 5IR1A 4MQ7B 1QFWL 1JBJA 4M1GH 3BIKA 1KT2A 5GSVB 1AHWA 4LLDA 2HFEB 4PUBL 1CFNB 2OR9L 5MP6H 1N3NA 1EFQA 5DRZA 43C9B 4JQXA 1SEQH 1T3FB 1T2QL 4PJEE 4BFBD 3U4EA 3FL7A 4O5LL 1KB5A 5GSRA 3OAYH 4OQTH 3GMMB 2BVEA 3K74B 1U91A 1S5HB 1Q9KA 3WDJA 4U1JA 1GHFL 3QUZC 4EEEA 4RWYL 1XEDA 4MLSA 3WS3B 5DJXB 3T0EB 1CT8B 4QXTB 4TULL 3QDME 1OAZH 4JKKA 1RURL 4TRPH 4NQCE 5E8PA 3KPRD 4R26H 5FDWB 4KV5F 4Y19D 1RUKL 5IG7A 4DQOL 3HNVL 1Q9WB 5I8OL 3BEVB 3D0VB 4W4NA 1SJXA 3HC0A 3LKPB 3VWKB 1FL6B 4PRID 2E9BA 2KL6A 3FFCD 4N68A 3HMXH 2D7TL 4NC2B 1KJ2L 4ZFFB 4J1UA 4PD4K 5KSVB 3T3PF 5L0QB 4MDIB 3JVGA 1WWCA 4OV5B 2VXVL 4JO2H 2HJLA 3X12B 2RB8A 2ICWA 1ZK9A 5CZVL 3FQRA 3KDMB 3VGHA 1MHEA 2FD6L 2GIYA 1OTUC 1YYLH 4WFED 2GAZA 5EZLA 4OZHF 1A7RH 5FYLL 2EDDA 1G9MH 4WU7A 2X44D 5E2JA 5F7DB 3PE9A 4KUCF 5T3XH 5HDLA 3P4NB 2X9XA 4JM2D 5EZJA 3NMEA 4G5ZH 4IRSC 3IETA 4L3EA 4ZFZB 1Z2KA 1KIPA 3VGEA 2VN7A 4WNQA 1I85A 3MLYL 2DYPB 2MPAH 2CUHA 1P2CB 2ARJA 1AXTL 4Y16A 4OCYL 4X99A 3D85A 4LRIC 3SGDI 3OKYA 3SKNB 5A3IC 1DSFL 5ERWA 3DGGB 3NCBB 5DQ9A 4IHOA 4PV9B 3TV3L 4I0KA 4ODXB 5DHVB 1K3ZA 4YPGA 1RZKC 4PJDE 1MQKH 1FN4A 4LVNB 1LK3H 4O2EA 4XNYL 3TVMA 3OZ9L 3CZFA 2X5PA 3VA6A 1TCRA 3QCVH 2PO6D 1HSBB 5HVHC 1UT9A 3KXFD 2ESVD 3V5KA 1VB9A 1NGYA 3HKFA 2XQYG 4G8EA 3O45B 4Y4FB 2PW2B 3W11C 2FH8A 4IRJC 4RGNB 4HUWB 2COQA 1GGCH 2YPLA 1U8PA 3DX9B 1VFAB 3S98A 5CS7A 4RFNB 4PS4L 4CW1A 2D7PA 2BFVH 1L4IA 1RZGB 4FQXD 4AG4L 2MQ3A 4WJ5A 5D8JH 3SDAA 3QYCA 3CDGA 4YHIB 3BN9C 5JQ6L 2GTZB 2X4TB 3BUTA 5DD6A 3FO0H 3MLTA 4U1HB 3VFTA 4JFZH 5HYEA 4Y0GA 3TZVA 4WUUE 3FQWA 1LNUA 4AEEA 3PL6B 3WFBH 2VRAA 5D7JA 4FA8A 1ES0B 3L3KA 2A6JB 4ZAKD 3RL1A 2OZ4L 4ZNEA 3AC0A 4XMLH 2V9TA 3FB5A 4XAKD 4NKMA 4N0RA 3S37X 3W2DL 2IGFL 2C1PA 1JL8A 2QQKH 2YHGA 3ROLB 3ZE0E 2FEEL 2IF7A 3G5VA 1IGFH 5ITFA 2BVOA 3WLBA 3PNWB 2PTTA 3QWQB 2Y6SC 3T8XB 3Q1SH 5DUML 3HB3C 4OGXH 5EN2A 3DO7B 1HWHB 1RZ7L 4HF5H 5EU6A 5T1KD 3P4LA 3S36L 1MREL 3I6LD 1AI1L 4QO1A 1OM3L 3S96A 5E2VH 5HGHB 2E6PA 4R2GB 1IFHH 4MJ6A 3T1FA 3JZ7A 1DANU 1F97A 4Y1AB 5E9DD 1CD9B 3V0WL 5ID0B 2P5WD 4OI7A 1YEJH 1NGXA 5BXFA 3C60C 4CADB 1J1OH 5EOCJ 4QRTB 4D2NA 1MRCH 1JUFB 2DLEA 3L5IA 5DDHA 3RWGB 3S5LG 3VWJC 5IVXE 2BVUA 1F00I 3NTCL 2EIEA 1PEWA 4TUOB 3RTQD 4YWGL 3BWUC 3MGTB 3T77A 3ZE1F 5CUSH 3Q6GH 2ARWA 1N8ZB 4X98A 2C1OA 4JKLA 2VZSA 5ICXA 5CGYC 1W72H 3MR9B 1UZ8A 3OXSB 3RFZC 5DRNB 3OAZK 3WHXB 3PF2A 5C0AB 4K9EL 2XT1B 5ANMB 4YFDB 1C5DB 1CICA 1MI5E 4F57H 1EXUA 5DFTA 4H20L 3ZKXB 4GRLB 2YD3A 2Z8WC 1UM4H 3U46A 5JIIA 4R7NA 2Y36H 1GGBH 3IAPA 1D5XA 3PV6B 2HRPH 1MPAL 3KYMB 1NC4A 1UJ3C 4NM8L 2FECL 3EYSL 3QUYD 1EEZB 4Y4HB 4LASH 3SDCB 2R1YA 2PYEE 4X4YB 1W0YT 4HWZA 1I1YB 2VH5H 4GRWE 4OTXL 3LSOB 4YUEL 3FFDB 1G9NL 2UYLA 4YDLC 2IG2L 4F15B 1FSKB 2BDNH 4X9FA 3FQXB 4JO3L 4EDWH 3W0WE 5JIPA 4GG6A 2BSRA 4GLRH 4R4ND 4QOKB 2E27L 1FCGA 1TETL 4NQSB 3MV7B 3C5JB 1MVFA 4OCXH 5CKGA 4XI5C 4QT5A 4XNQA 3QXAB 4NO0D 5KJRL 3NA9H 3LH2L 1YEGH 1YA5A 4HQQH 2YPKB 4AJ0A 4LNRA 4WEMB 1HHHA 4AEHH 4PGCA 4H25A 1YEEH 1BEYH 1S7WA 1L9NA 1NL0H 2H8PA 3V7MA 4Y2DC 5KZCD 5J8OA 4XPAL 3RIFF 2H6PB 1A4JA 3K7UA 1MCWW 3L3HA 1BFSA 4J6RL 4XC1H 3UJIH 2WIMA 3KGRA 1HNGA 4PJFA 4M1DH 1L0YA 2FCBA 3V2AR 2FX7H 1DQQB 3FB8B 3QO0B 3ARDA 4OLVH 4EXPX 3D0LB 4PP1D 1DL7L 5DD5L 3UPCA 1BMGA 4X8JA 2FL5A 4WI2A 3QHZH 1RVFH 1TIUA 1IEBA 2J4WH 2VLJD 1JNNH 4WU5A 5CEXB 3GSWB 3QDGD 4UT6H 3VXSD 1QFUL 1G7JB 2X1QA 4J23A 5HI5C 4U6HB 3LY6A 1BM3L 1KENH 3SDDC 1V3LA 4M7ZC 1PQZA 5C3LD 5INDB 4U1SA 3PWLB 1ERNA 1OAXH 4U2ZA 3W5MA 5H2BB 1M7IB 2DIAA 4Y8DC 2XFXA 4XP5H 1KPRB 1CVRA 5D7IA 2NZ9C 4LDEB 1EV2E 4XMKL 5FYJE 2LABA 5DVKA 5EBLB 1XAUA 3FT4B 5D1QD 4KJYB 5DJDA 3INUL 4E0RA 1YY8A 3MLWL 2DLTA 5KW9H 3EO9H 4H1LA 1AO7D 4JVWA 2F5BL 4HMCA 2NW2A 4NN6B 4EQ2A 3JWOC 4UB0H 1PFCA 1XR9A 1SMAA 4B0MM 4XC3H 3NABH 1XGQB 5HD8C 3S34L 1CLOH 1FO0B 4KJQD 1VFUA 1LVEA 1TQBB 4UAOC 1H3XA 5CCKH 4HLZG 2OL3B 2NX5A 3WFHB 1WT5A 1YECL 1LEIA 4LPXA 4U6XB 1I7TB 4X7SL 3QXWA 3KVQA 1HKFA 5TFSL 4YE4H 3BH8A 2Y5EA 5ALCL 1FL3A 2PXYD 4LSPL 4D0DB 4UT7H 1KPUB 1NFDA 4LPUA 5F96L 5I1GL 3GSUB 1I9IL 1DBMH 3P0VL 3VFUB 3MV9E 3W39A 4HDIA 1MHPH 3VXUB 5FK9A 1QPXA 4C56E 3LKOB 1BIIB 3PP4L 1F5WA 4EI5D 3QB7C 4HXAL 4YZFE 3H3KA 4MD0B 5JA9A 4R90L 5HDQH 6CGTA 4YDIH 2VDNH 4O58L 4MQXD 2VXQH 1PKQA 4MNGA 3ZDZF 1D9KC 4G7YL 5AUMB 1CXLA 4CMMA 1KB9K 1FYHB 4GFTB 4DGVL 3RKPA 4GSDL 1YDPB 4HUKB 1CR9H 4P23B 4NDMA 1Y6NR 3BP5A 1GL4B 3ROOB 4Y4KC 1HH6B 1MQ8A 4ZNCD 4MSWB 2V2WA 4NKDA 3V6BR 5KSUB 4KHXL 2WP3T 1OVZA 2YK1L 1IT9L 5GGSB 4XP9L 4HX1B 4F7TA 1BVKB 1U8OA 5J6HA 2IH1B 2R69H 1U8LB 2XTJB 2X4PA 4HKZA 4HUXA 1A1OA 1EJ6A 4YHPB 4NJAL 1BZ9A 4M6NL 2XZCL 4DN3H 3ZTJG 3QEUB 2FLBT 3DUHA 4JFDA 2GTWB 3LKRB 4TTGA 4NQDB 1FJ1A 1XF4A 1CDYA 1BVLA 5E03A 2BRRL 1GAFH 4OIAA 1T21B 2CUIA 1ITCA 3RUGF 5LCVH 4PLKC 1QHOA 3FAWA 4F2MB 4OLUL 5DJ6A 2P48B 4HGWB 2IEPA 4BK5A 2ADJA 3IJSA 3RDTC 2Z31A 5EORH 1NDMB 1RIVH 5JNYB 2K3TA 3ZHLA 2HTLD 5FCUH 2UWEF 4NO3B 3O8XA 4HW6A 3AREC 1N64L 5EU5B 2R2CA 4LLYA 5GZND 3L3GA 5I6XB 5B39A 1F4YH 3CXDH 1KN4L 3QEHA 4WIQA 4PTUB 2AJUH 4WEUD 4UI2A 4FP8L 3U1SH 3RAJL 4GBXB 5I66A 5FYKH 1M6OA 3CFIC 5EO9A 1G6RH 4QXUH 1OTTD 4N0CC 2DBLL 1QR4A 4UQ3B 4YBLC 3VXNA 1J11A 5E4EC 5JW5B 3UJJL 1EJOL 3FO1A 2EDYA 3NAAH 2IPTL 2XICA 4HLJA 1PLGL 5C0CA 1BBDH 1T1YA 4LPCA 4AK1A 4YFEA 1IM9D 4LSUH 1XT5A 4XCCH 2NY0D 3IS0X 3W5NA 3I75A 3UP1A 2BVYA 4H0HB 1K5NA 1ETZB 2WINA 5KSBB 5EOTA 1J5OL 4RNRA 2C3VA 1UYWH 4HMEA 3JTSA 2DD8H 1RIUH 4RMUA 4K55A 1IC4L 1BX2B 4DVRH 5IB5A 3SKUD 5HHNB 4DKEH 3WS6C 1XIWB 3IXTA 4JRXB 4X6BA 3PIQB 5JPNB 2YN3A 2Y25A 5D5MF 1BVZA 4XVSL 3WD5H 2G5BA 4AL8L 2HFGL 1HYSC 5E56A 3OG6B 3S88L 4CMHC 2GITA 2D4FA 1I4FB 3BOVA 3PWPD 2HH0H 5JZ7C 3BI9X 1FFRA 1KFAH 1AQDA 3TN0D 2R0WL 3JWOH 3D5OF 2A1WL 2KQNA 1I3RA 2XN9E 3KPNA 5C0AE 1HKLH 4G6JL 4DTGH 1Q9OB 4K7FB 1ADQH 4NYLA 4PJCF 4OZFH 5L2KB 2PN5A 3UTSE 3C09B 3EFDH 5DJAA 3I6GA 1A1MB 4FXKB 4YXLH 2MCPH 3G6JF 4U6YA 4PJXF 1BQHB 4ZFGL 5I74C 5CD5D 4LEOB 5I75B 1QFWM 2P8PA 3O6MH 4PRHB 4GW4B 1L7IH 2IADA 3V4VL 3VFSB 3UJTL 3SE9H 2CUMA 5C6TL 1Q94B 1SVZA 3L95A 5J13C 3TF7C 3IF1B 3IFLH 3MOAL 1YMMA 4F7EA 2FJHB 3V0VA 1X4ZA 2AJYL 4JDTH 3D69A 4F80A 4R8WH 1GGUA 1I3UA 3PHSA 3O2VH 4JFHE 5KOMC 3RVVC 1OPGL 3DIFA 5DRXB 3RBSA 1AIFB 4HJJL 5CMAB 2VXSL 1WCBB 5HVFB 2AP2A 3LD8C 2DLFH 5JHLL 5B8CC 2R23A 1A6WH 3HE6D 5FO7B 4JN1L 3X11B 5GGTA 1TJIL 3RJDA 4F58L 1MLCA 2VLLB 5B22A 3UTTD 3GI8H 4LCCC 2Y06L 1JTTA 1YEHL 5HHOD 4Z7WF 4RISL 3HNSH 4ZUWA 2CMRH 5EUOA 3LN4A 3P3YA 4K7PX 4LHUA 4OFPA 4EBQH 4MAUL 2WMPA 2EDJA 2APTA 2QV2A 1NANH 5C0BD 4H5SA 4J12A 4WO4A 4O00A 5GRJH 4MB4A 3WKMH 2D3VA 4K71B 1EFXD 5EC2B 5HYSA 3ULVF 3VXQA 4IOFC 1EA9C 2IWGA 3SO5A 4JM2A 1FGVH 4FQCL 2BNQA 3TBTA 1A4KA 1ED3A 4JGMA 2E6JA 5C0DB 4I5BB 1T5WB 2ATKA 3MNWB 4NHCL 4URTB 2VC2L 1WC7B 4Q0XH 1IZJA 1QFHA 1LILA 2AJVH 5T33H 1JPST 5IMLA 25C8H 4ZXBB 5DF0A 3CFJB 4I3RH 5GGVH 4L9DA 3AMKA 2VERN 5J1TC 3S9DB 4JY5H 4HWBL 1JV5B 3B2UC 2VZ3A 1A64A 5BRZD 1PBYA 5E00A 4OQ1A 3THML 5ISZD 3QEQA 2HJKA 4ELMB 1MF2H 4FS0A 5D2NB 1YEKL 1OGAE 1SY6H 3CD4A 3G04B 3KXFA 1YY9C 2ESVA 1X7QA 1FNLA 4D3CL 3FAXA 4HUMB 2OTUA 3U9PL 1FVCB 1S7VB 4P5MA 2ERJC 3D25B 5TDNA 1OP3K 4DVBA 5C0RL 4JZOA 4ZPTA 4BA8A 3MRDB 4MJIE 3S7GA 1TVDA 3T0BA 1TJHL 3GSNA 1MCLA 1LE9B 1N5YH 2FB4L 2X1WL 1Y18A 1DVFA 5JLZA 2JB5L 1OAYL 4HIIA 3JUZA 2LQRA 5SWQA 2ICCA 1IM3B 2R0ZH 4FQLH 4QRRD 4OUUB 3VDCA 3CSYA 4I3SL 4PJIB 4FTVD 3V4UL 1RK0B 5DJ0B 3MO1A 4QTIL 1LQSR 4KKCD 1J87A 4LPWA 5JORA 3NZHL 3P2TA 1ZT1B 2X70A 1BLNB 1K4CB 1DLFH 1BQHG 3GMPA 1C5CH 1G7HA 2Q7YA 2QQLL 3D39B 3QUXB 5FGBA 4ONFL 4X6EB 3RVWC 4MGXA 5DGQA 5A16A 5DFVD 3CDFA 1NBVL 4JREB 5C0FA 3WIIL 4NQEA 2WWMD 3HE7D 1NGQL 3IDMB 2X4QB 4MAYD 3RX5A 4S1DC 2APVA 3QEGH 5T1KA 5TDPA 3MA7A 4KVCL 1IGCL 4H0GA 3GSOB 4DUWA 2XTJE 5ITBH 3OKOB 1ZLSH 4XVUD 5CSZA 3BKCL 1WITA 4BZ2L 3WFDL 3QDAA 3QQ9D 1FNGA 3M1BB 1SQ2N 3SKMA 1RK1A 3U9UA 1HYRC 2P5WA 5DRWA 2A0LC 5A2LH 3STBA 2R39A 3FT2A 3DBXA 3BYYA 1QLRB 1NMCB 1RMFH 2BCKB 5LG1A 4OLYL 1CVSC 2VL4A 4NRXB 4V1DB 4TPRH 4HKJB 3WO3B 1ZT4B 2WWKO 3JTTB 4PBWD 3P4OA 3QPQD 3CXHJ 4P3CL 3F58L 3MJ9H 5IHLB 3MNVA 5FGRA 1AFVL 4JZJB 5E2TH 2E7HA 1ZV5A 4MXWL 3EO0B 1L7TH 3BGMA 4JPWL 2FO4B 1GGIH 2YC1B 3SGKC 1CLYH 3CVIH 2C3GA 3UX9B 4JFYB 1XGYL 1U6AH 4MD5B 3PL6C 4JFFA 1DUZA 5D6DC 1K6QH 5EIQA 2BHUA 3GIVB 3DVIA 3F7RA 3QUYA 5ADOL 4N90D 2VO5A 4POZC 4MVBD 4NZTL 1DBKH 1B4RA 1U8HB 1KEGH 1A6AA 1BECA 4X6CF 2IPKB 1HQRB 4WFGE 4F9PC 1WSST 1G7PB 1JWSA 2W60B 5JHDE 4UTAH 4RMSA 4M9OA 4Z7UB 5D1ZB 3V4PL 4NM4H 3OAYK 2CJUH 3O3BA 5GXBB 4HK3J 1SYSA 1NAML 1JF1B 2FX8H 5IESH 4NO0A 3JV4A 1JHTB 1G1YA 2EICA 4KKBD 3V7AE 5EZOH 3SOBH 2EYTA 3PABB 3ZYJA 5I1CL 1A1NB 3K2UH 1LMKA 5T3ZD 3SCMB 3CLEL 3CLFL 3L5XL 1A7OH 1MCQA 4TNVF 5JXAH 4XNUH 2M1KA 3PGDA 2XZQL 3QFDA 4GRWF 3UO1L 1WAAE 1YNLL 1QEWA 2JK5B 1DJSA 1MCHA 3C5ZB 1R0AH 1I9EA 2ARJQ 1OW0C 1T1XB 5CEZE 4X6DB 4JFEB 5FYJH 3SGDH 4MDJB 2F53B 1P4BH 1UKQA 3LIZH 4F3FB 5EPMA 2B1HL 2H2SD 1G7QA 5D1XB 3FTGA 4G3YH 4LSDA 4GKZB 5JW4N 2CKBA 2I9LA 4LIQE 5E2WL 2VLRD 4NUJB 5IV2A 5FEBA 2NY3B 5JOEA 4TOYL 5KBNC 2RCSL 4PRHE 3LB6C 3NIDE 4NQVA 4QHMA 3MUGB 4LSTH 4OZFG 5C08E 5E8DL 2AERT 3MA9L 4P4KD 1G1CA 5DD1L 4PB0L 1IC5H 2M8XA 3UTZA 3ZKXC 4GRLC 5MERB 4XZUB 3ZYOA 5DK0A 3F7VB 1R3HB 2IBZY 1QPPA 1A2YB 4L3CA 2B5IB 4Y5YA 4Y4HC 5DMKB 3ARGD 4KQ3H 1MJ8H 3SDCC 4S11A 5D1QA 2ZCKH 2FWOB 2PW1A 1WTGT 3T1WA 3R06B 3V0AC 2ICWI 3BH9B 3GMLA 3T4AB 4FZ8H 3SBWC 3DMMC 1T1WA 1VGEH 5IJKC 3HG1D 1ZGLB 3LN5B 4PJGB 2B1AH 1T0NA 4PJ9D 2D31A 1DQDH 2W9EH 3RWEB 2IAND 5C07D 4JDVA 1U8IA 1VFBB 2EEAA 3W82A 1QR1A 3FQTB 2A77L 3MRLA 1EMTH 2XQBH 3VXPB 1GZPB 3OF6D 2DAVA 3BQUC 4BFIA 3OKLA 3RNQB 2WBWB 3V79C 2Z92A 1JWMB 5A43C 1KEML 4KK8C 4CVWA 2NXYD 1BFOB 2PXYA 5EC1B 4OV6F 3ULVD 1AGDB 4KKAC 4K3DL 4K7PL 3DURB 3GNMH 4EN3B 4KK6D 4HPOH 4N0FA 4JFQA 4HPYL 4EI5A 4WWKD 5JPMA 1I7UA 4NWUH 2E8ZA 5TE7H 1F2XK 5HPMA 5HBBA 5I1AB 1A0QL 3VU2A 1YYMH 4Y88A 1MLBA 1ZLVH 3ZE2F 3PWNB 2A6KA 4Z77B 2EIBA 4CNIB 4PGEA 4KI5D 3P9LA 1MCJA 1U3HA 3ARFD 1LHZA 3QNZA 2Q7NA 5CD3B 4E41D 3O3EA 3PJSA 2R8SH 5MI0B 4ELME 1P7QB 1PDKA 2DIBA 5D2NE 1WZ1H 1MJ7H 1NBYA 3MBED 1KTKE 1VENA 5JO5B 1N0LA 1G0YR 2VAAB 1FH5L 4LDLB 5CLTA 3B9KC 1U8NA 3NIGE 3D2UB 5BQ7B 5DR5L 4PP2B 4YK4B 1GZQA 4D8PA 3MPCA 2PTUA 3C6LD 3MUJA 1GOGA 3MCG1 4S2SB 4NN6C 1JMXA 3CVHH 5FB8A 3WIHH 2DLIA 2Z8VC 3TJEL 3WNNA 4M4RA 5FO9A 5I1JH 2DQUH 3HZVB 5TF1L 4AM0B 4DGIH 5BZDA 3CNKA 5BS0E 3KG5A 1WIPA 4KRMB 4G8GA 2AJXL 1A9EA 3OKMA 3NCJL 4D94A 1FG2A 1U95B 1GH7A 3AS1A 4KC3B 1I8KA 4PJ7B 3G6AB 2CDEB 1QHPA 3BT2L 2JJTC 4A6YB 1FQ9C 1S3KH 1LO0L 4LSVH 4GAYA 3IAQA 3L5WB 4KGJA 35C8L 3QCUH 2IPUK 4NNYB 5FKPB 3I9GH 3N9GL 2XOTA 5HHVH 1LE5A 4ZOBA 3ZDXE 3GUTB 2JTDA 3EJYD 1EVTC 2X09A 3KYNA 3V9FA 1HXMB 1RQ5A 3ARBA 4L8SA 5IW3A 4PRPB 3DUSB 1F58H 4K3JH 4YC2C 1BD2B 3G6DH 1R3IH 1IM9A 2IAMA 2VZUA 2WM0A 3A6CL 5F1SA 5EZIL 1NGZA 2YRLA 1NCUA 4D9RE 2YEZB 4R3SA 5ICZA 2QSCH 3FQUB 3GHEH 4ALAL 5IBUB 2D7QA 4ODTH 5EU4B 1DBBH 5EFIA 3UPRA 2Y07L 1T2JA 1QZ1A 1FZOB 5BZWA 4U31A 2YD8A 4HS6B 1CZ8H 4PGZA 2K7QA 5F7NC 1JPGB 4P49A 1R5VB 3T2NL 4JPVH 5FYKU 2X4NA 2P5EB 1S9VB 2XTJC 3K4ZA 1I7ZB 3P73A 3GI9L 4D9QD 3OX8A 4V1DE 1NCDL 5H37G 3X14B 1T7VA 5D71L 5HHMB 1FC2D 1JZ7A 1BWWA 4CVXB 2VXUL 3SGJC 1UC6A 4S0TD 3RPIA 3D18B 5DUBB 3ALPA 2FZ3A 3RWJA 3GGWB 3CC5A 4NHUA 4XP4L 5K9OA 5TQ2H 4HFUL 2G2RA 3C87A 3QUMH 4JR9H 1WICA 3BYTA 4LVEA 1B2WH 1ZKAA 1A7BA 1JGLH 1A3QA 1WK0A 4APQD 5DD3L 1I7RA 3L6FB 2J88L 4HEME 3W9EB 3VCLB 4GMTH 4LFHG 1AGCA 5F9JB 4P46C 1G7MB 2IH3B 4CVZB 5DC0A 3MUY1 3DTXA 3MJ7A 5C9JA 3G08A 5HGDA 1ZSDB 3QULB 5KSAB 4ZUUB 3O2DL 1XZ0A 4K23L 1YQVH 1ACZA 2O5ZH 1BGXL 4XTRD 1UWXH 4Z7UE 1MVUA 5GGUA 2F5AL 1A5FL 2DQFA 5KVGH 5JW4M 3VFRA 2VDQH 4KPHH 1FAKT 2D03L 3K1KC 2FECI 1CDIA 3DROA 1LEKA 3HE6A 3EFFB 3TNNA 1T4KA 1PSKH 3SPVA 4K3EH 4I13B 2HKHH 2YSSA 2V2XB 2YD9A 4F37K 4WEBH 4JFPB 5E99H 4NGHH 4F33B 5HHOA 2JF1A 3QI9B 3QUKB 3U0TA 4ORGB 3GRWL 4L4TD 2V6HA 1NH6A 3BKYH 2P24A 4W4OC 3QDJD 5C0BA 1OF2B 3PUCA 3MSPA 4XRCB 4MXVE 4WFHD 4Z7OE 4XCFL 4IDJL 4HK0A 3ZSSA 1ITBB 4FQ2H 4JFOB 1JZ6A 1VHPA 3O2DA 5AZ2H 1G0DA 1ORQA 1QRND 4XCYA 3MXWL 3MLUL 4XPBH 1Q0XH 4HXBL 1TVHB 4P3WA 3CFEB 1JFQH 3RGVD 2BVPB 1JE6A 1AD9B 4GKOA 5TDOB 5L8KB 4S1SH 1HINL 8CGTA 2AK1L 3S3SA 3F7YA 5DJZA 1IAIM 3Q3GA 2FIRT 1Y6KR 5IBTH 3ALXA 2CSPA 3B6SB 4LQFL 4Y5XC 4PTTA 4JY4B 3G5YB 4YXHH 2LU3A 2J12B 3HLAA 2ZCLL 3SDYL 1M7DB 1XGPB 4YDVA 5BVJB 4P59H 4RFEB 5FYLE 5BRZA 3RJQB 3C5SA 4KDWA 4HC1L 3QT2A 1HI6A 2C5DC 4NQXB 3NH7L 2VQ1A 2FO1A 2VLKB 1ZA3A 32C2A 1AGFB 2VZVA 1FPTL 2HG5A 3KPSB 1MUJA 5C09B 3QIBB 1PG7L 4Q7DA 4JHWH 1N6QL 3T0ED 5I30H 5J89A 3N1FC 5ACZA 3KLHC 3WNMA 4HG4J 1JPTH 5FHBL 5GZOD 5IP4A 5IWLA 3GHBL 3VXRD 3MRPA 4ZNEE 5H35A 4KJPD 3EAKA 4L5FL 4QRPA 3ECBB 4JRYE 1DANT 4ZTOH 2E3VA 4N1CA 3QIWD 1N4XL 3VWKD 1A7PL 3C08L 2HN7B 2EDBA 3VD3A 2F8VA 4NT6A 3ZHDA 5FA3A 4LLUA 1N2RB 3NPSC 1J1XH 2AK4B 4LARH 1DBJH 3WJJC 5T1MB 3QQ4A 1NCAL 3VFOB 5HYJD 3BHBB 3HR6A 1TZGL 4WCYL 4H88H 4OLZH 5JDSB 1JNLL 2KBGA 2YRPA 3O0RH 2F58L 5F44A 3MGOB 1EBPA 2Q8BL 4N0UA 5LWYL 3KPOA 1RHFA 5FHAL 4M93C 1JJUA 2H32A 1RIHL 1ZVSA 1I8IB 2XKNA 3HE7A 5CWSA 4MAYA 3LV3B 4LVOC 1SJEB 5ID1A 3TT3H 3QHFH 4HJ0C 4DN4L 1T80A 4K8RC 3CPLB 3CX5K 5ESQA 5DJ8B 4M6OH 1XF2B 5GRYA 1KCUL 4OBSA 2WSKA 4MX7B 5I2IB 3PWJA 5FUOH 5EO0A 4OLWH 2MJWA 3SJVB 4B41A 1TITA 4X4XA 1OCWL 3DARA 4MCZB 1UXWB 3WLWC 5DZNA 3RUGA 1IAKA 2LAGB 2FJFA 4RAVB 4CGTA 1QVOB 3DJ9A 4LEXH 3UZEA 1X5HA 3O4LD 2GT9A 2AEPH 3GSRA 3I50L 3QFJB 3EYUL 4OLXL 1FYTB 4AMKH 2F9BT 2W0LA 5D93B 1YN7A 3MLXL 1T20A 5B4MC 5K59E 1FBIH 5GQBA 5D70H 4JKPL 1NMAL 4MA1B 5DMIH 5KS9B 2DKSA 3DXAB 1CGYA 3U2SA 4PJ7E 4Y4FD 4P2RD 5T3ZL 5C70A 4RGND 4M5ZH 4FABH 4TQEL 1IGIH 2CXGA 3WFEH 1X6LA 3FO9A 1W0WB 1OSPH 2H2PD 1ZTXL 1F4HA 4FFYH 5DEFA 3DV6B 1UB6A 4RMTA 2HTKC 2AQ3A 4X5WB 4MCYA 3VXTB 4WY7H 5SWSA 1JGVL 4YFLI 5TF0A 2QKIA 15C8H 3M8OL 1JPFA 1IMHC 4OD3H 3KPRB 2QSTA 4Y19B 1TTGA 5HI4C 1ZHNB 4N8VG 3ARTA 4TVPD 2Q76B 1I8LA 3UZQA 3HPLA 3HR5B 1BD2E 1INQB 4LPTA 4L9LC 3RWDA 3FB6B 2CK2A 3RI5K 1RUML 4PRIB 2NY7H 3DVFA 1IGML 1ZVYA 2GSIA 5CEZH 5IHZA 2NY1C 4LCWB 1I1AD 1RJYA 4KK5C 3FFCB 4LLMA 4ZMAT 3MCLH 4FZEL 1RJCA 4KZEL 5E8EB 3EGSA 2I5YH 4XPTL 4OIIH 4LIQH 4OM0H 4PJHB 1G7IA 4RGMB 1A14H 1LDPL 5J56B 5D5MA 4U1MB 3DUUB 3MRQA 2DQIH 2Q86A 2BNUB 4I0PC 4PJFE 3D87B 2V7HB 1EHAA 4YHML 1CF8H 3IFNH 3RWHA 1QQDB 3R0NA 5K9KB 5HHME 3STZB 3ZLQC 3CFBB 2VE6B 1CFSA 1KIUA 4YX2H 3HC3H 4G8FB 2JB6A 1R5IA 3LS4L 4QRSA 2KUTA 2NY4C 5KSBF 3QA3B 5ESAA 3B2VH 5J9PB 4R2GD 5BJTB 4RMVA 3HFMH 3RA7H 3H3PL 4PJCA 4Y1AD 3T0WA 3HUJB 2VN4A 3G6JA 4PJXA 2WIIA 3FZUD 1ZHKA 4X9BA 1C1EL 1G6RA 1ULVA 5I16A 5ICYA 3NFSL 1NGPL 3DI3B 2X9YA 3UMTA 2HT2D 3MRKA 5FCSH 4UUJA 4L4JA 4P4KA 1WAAF 1H5BB 5TE4L 3ULVL 2AQ1A 1HXYA 2D7NA 3V52L 4JG0H 1QSEB 4AENB 4LF3A 4NO5B 1ZE3C 3B5HA 2EEDA 3ILPA 3BKML 5FYJU 3I6KB 5MEND 4NPYA 4KQ4L 5I19L 1Z6JT 3NN8A 4HCRL 4LP5A 4CN1A 1RUPH 3HC4H 3BD5A 1AKJB 5L88L 2EIZA 5D1ZC 2GK0A 4FQXB 1XGTA 4PJ9A 4UOW1 5M95B 1CDHA 2D2OA 2V5RA 3VGAC 1J86A 2C7UB 3OQ3B 2IANA 2IQAA 4Z7WA 3QDMA 2BC4A 1F90H 1MFEL 2JELL 3LEYL 2XACC 4K8RH 3JVGC 1NFDE 3OF6A 4OLEA 4ZO7A 1X5KA 4QOKD 1NEZA 2MHAA 2DM3A 3IDIA 4ZAKB 3MV7D 3H3BC 2MMXA 3LKSA 1M05A 4XXCC 3WSQH 1J05B 5HHPB 3C9NB 3IDYB 4HV8B 3I02B 4HS8L 4JHBA 2R4RL 1PKQE 4MNGE 4I9WE 1IL1B 1LD9B 1E4WH 3G9VA 1FLRL 5E6IB 2OK0L 2QADB 4MD4A 4JQIH 1YMHA 4X0KB 5I8CA 4WWKA 1YPZB 3U48A 4HBCH 3ABZA 1NFIB 4HCRA 1I85C 2CLRA 3V6ZB 2ZUUA 5F21B 2VDMH 4UDUB 5GJSH 4YGAB 4GS7B 2GJ6D 1Y6MR 1K8DA 4Y16C 3T65B 2IFGA 2W9DH 3KWWB 1J8HB 4BH7B 2VYRE 1I3GL 3IDNB 4ODWB 2A74B 4CVUA 1VACA 2R29L 1DBAH 3UYPA 3UC0H 4AIZA 1M1SA 1QFOA 3LEVL 3GO1H 2XWTA 1D9KA 4JFDE 3EOTH 4E41A 4ZPVA 4ENEC 5E9DB 2G75A 1TQCC 2AV7B 4S1QH 3FN9A 4W68A 1A9BA 3TVMC 4F7MB 1WQVT 4NIKB 2XWJA 4JPKH 2H26A 3U36A 3ULUH 3MBEA 5INCB 3RBGA 4ERSL 5C92A 1MAMH 2HVKB 2NTSP 5HHQA 3L3OB 4HT1L 4ODUB 1UWGH 3ZT7A 1V7ML 1EO8H 1NQBA 2C3XA 3H9SB 4Z7NF 2YD1A 3C6LA 4JZNA 4YO0B 2EECA 3ZYIA 1TLKA 2W0KA 2V2TB 1BHGA 1U2HA 2VQTA 3MV11 3HRZA 3SDAC 2V7NB 2EYRA 1MHHB 5GGQH 1MRFH 4ELMF 2B4CL 1A6TB 3MLVL 4O4YL 5E5MA 1RPQA 3TPKA 5EBWA 3T2OA 5HYFA 2DF3A 3EO1A 5DUPH 3RDTA 1JNJA 1N7MH 5CP3H 2X1OA 1KGCE 1YEIL 5BV7L 3QUZD 2B8OT 3H0TB 1SBBA 4OZ4B 3BX7C 4UV7L 5CEYA 4OF5A 1DQML 4QY8A 1T5XA 4M43H 1U58B 1C5BL 1LO4L 4XNMA 3L9RB 4XPGL 4WENB 2FATH 4Z95L 4WUUA 2L4OA 3QQ3A 3MREA 5A2KH 1OTSD 4PJIF 2J1KA 3DGCR 2AXGB 3VXUD 1P69B 1F4WL 2ATPB 3GJFB 1DN0B 3LS5H 2BZDA 1KB5H 4U1GC 1R6VA 5DTFA 3SJVE 4LHQB 1KG0A 5KZCB 1O0VA 1EAJA 3MACL 1LK2A 5IQ7H 1JRHI 2ICEB 4F8TA 5BOPA 3S35X 2GW5A 5MI0C 1EO5A 1EHLL 2ZUTA 4XX1E 5FDYA 3VRJA 4P23D 4I2XA 1JGDB 2CGRH 4GW1A 4X5XA 4EUPA 5IEHA 4BZ1H 1QSFD 3K1DA 2ZOLA 5IEKA 1FFQA 5IF0A 1QBAA 4KUZL 1JCKA 3WS6A 1ONQA 2AGJL 2ICES 1Q72L 4EDXB 2OR9H 5AWNH 2GFBB 4PY8J 2VLJB 4RAUB 4XP6H 3OGCA 4YGVB 1T2QH 3I2CH 3VXSB 4NQDD 3MOBL 5GRUH 3RU8H 1F8TL 4APQA 2H3NB 3RVTC 3ARWA 1FZMB 3BPNC 3QJFA 4IEFB 1CL7L 2KQMA 4PRBB 5DWUH 2XYCA 3MODL 2WUBH 4X6CA 3TBYB 4JVPA 1UB5A 3KPRE 1GHFH 4Y19E 4RWYH 3TBSA 4KRPC 1J88A 1TZIA 1RZIB 1R3KA 4I8DA 3BPOC 1AO7B 2OBGA 4E5XB 5TH2B 2BSTA 4K7PY 1QBBA 4TUJB 2E7BA 1MI5A 1RURH 1MWAL 4MHHI 3FOMA 4PFEA 1LO3L 4RA0C 4G6MH 4M48L 3TO2B 5I8OH 4MWFB 5JMOC 3UTQA 1U8MA 2CLVA 4GBXD 1CD1A 1KLGA 8FABB 4PG9A 2XXMB 2OJEB 1T7YA 1FAIL 5EUOE 4CDGC 1IQDB 1BOGB 1VEPA 4YAQB 4K9EC 4JJHA 1UADC 5E5RB 4BQBA 4WFEE 4X6FA 4QHUB 4DGYL 3BAEL 1QA9A 5F6IC 2O5YL 1CE6B 3W0WA 5ENWA 3QCTL 4Z7UF 3EOBA 2BNRB 5CZVH 2XA8H 2ZNXA 2BNQE 5AZEL 5F7WC 3F5WB 5ADPH 5FYLH 2YMXL 3N1GC 5K9JH 4R4BB 4BFGA 1QRNA 5DK2B 3HUJE 1YC7A 3ARDC 3MBXH 4P2QB 3H7LA 1XIWD 1G9NC 4Z0XA 4IJ3C 4JRXD 4HBQA 1H0DA 5ESVA 4KXZI 1A6ZA 1TVBA 1MWAA 4POUB 2WBJB 1F3DH 3CUPA 1P84K 4ZQKA 3UDWC 5F9WB 3OB8A 2JIXA 4MQ7A 2PF6A 1NCTA 2I60H 4OGAC 4O51A 5GSVA 3VD5A 2HFEA 4J8RB 1CFNA 4OCYH 4PBVC 4S1RL 4OF7A 43CAB 1DTUA 1DSFH 1V3JA 4LSRL 4X6DF 1H3WM 1T3FA 4GAGH 4MXVF 4ZTPH 4Z7OF 1AHWB 3KXFE 4LLDB 2ESVE 3TV3H 4MNQD 5HI3D 5L2KD 4YIQB 5IFJB 4L8BA 3UTOA 2HT3D 4EI6B 4XNYH 5FA4B 2X4SB 4M5YL 1UXSB 1ZLVK 4D9LL 1MJUH 1KV3A 1FZKB 3GMMA 4DUVA 5IQ9B 5HVGB 1JGEB 5T5NG 3CU7A 3VWJD 4OZIE 2B39A 5I1IL 1DE4B 1S9WB 2V9RA 5J1SC 5DA0B 2AEIT 3Q48A 3WS3A 3SKJH 3JXAA 1DCLA 5DJXA 3WDHA 3T0EA 4JFXB 3TBVB 2P44B 4QXTA 5JR1L 1JZ3A 3DETD 1QNZL 2KZ1B 5FDWA 5IBLC 5GS0D 3BSZH 3LRGA 5JQ6H 2ZSVB 5EU3B 1Q9WA 1RU9L 1V05A 3BEVA 3D0VA 5IJVB 4XAKE 1HE7A 3TA3C 3LKPA 1FL6A 3I84A 1YUHB 3QI9C 5IG7B 4DZBA 3H7BB 1A47A 3VH8B 4PJGF 4AIOA 4DKAA 3HZKB 1M71B 3LKQB 4ZFFA 1NCCL 2NY6C 5KSVA 4OV5A 3BD3A 5E4IA 3IFOB 4KZDL 2CH8A 3X12A 3BEWB 4J3VA 3W2DH 3SY0B 2IGFH 3KDMA 1PD6A 3ET9F 1AY1L 1E27B 4U6VL 2IC2A 1KPVA 4DAGH 1WBYA 1E4XL 3I6LE 4WI4A 5DC4B 2ICWB 2R9HC 1WBZB 3LRSB 4NOBA 1JI1A 5F7DA 1KJ3L 2C3HA 3P4NA 4KMTL 2E7MA 2V5SA 5E9DE 2P5WE 4AH2B 3S36H 5GRVK 4NN5C 1JIBA 3IFPA 2I07A 1AI1H 1OM3H 2DYPA 5J06A 3TYGL 4KROD 1P2CA 3DYOA 3M17B 4TSBL 5ALBL 5JUEL 4WW2B 3WEXB 3KHOA 3V0WH 4L3EB 4EIGB 5LKNA 3T0DA 4MJ5B 3ZT5A 4TVPL 5EUKB 4ZXBD 4WNQB 3SKNA 4YJZL 2VL5B 3DGGA 2MQ0A 4WHCA 5FYKD 1B88A 3TN0B 4PV9A 2J8UB 3NTCH 1ZT7B 5MP6L 4ODXA 5DHVA 4YWGH 1X5XA 4BFEA 5JOPD 3O3UN 1SEQL 5IHBA 1JTPA 2VZOA 3QIBC 1EPFA 1U42A 4HIJB 1CFTB 4HIEB 4KJWC 4CL7A 3VXOB 1HSBA 4YPGB 4G6KL 4ODSH 4O2EB 3O45A 4Y4FA 2PW2A 3C8KB 3O8XC 4HUWA 3FN0H 3DX9A 3DRTB 1VFAA 3QH3B 1PGRB 1V8HA 4H20H 1KTRL 3V5KB 4HD9A 5AD0B 4G8EB 3IDJB 3VGBA 4KK9C 3ZKNC 1RZGA 1KCRH 2C4FU 2YD5A 4YHIA 2XNAB 3SGKA 1MCPL 4CW1B 3GK8L 1DN2A 1OAZL 2GTZA 2X4TA 2X1XR 2QHRH 4M8QB 4U1HA 3W9DB 3R1GL 3S3PA 4TRPL 4WJ5B 3L3JB 3PL6A 4ZS7L 4TSCL 1ES0A 4YUEH 2A6JA 1G9NH 2LVEA 5D2LB 4PJ7F 3TZVB 1RJLA 3Q5OA 2E27H 1WFTA 4JQVC 1S78C 2R2BB 2DDQL 3LDBB 5KJRH 3D39D 1TNNA 3QUXD 3HMXL 4EOWH 1JN6B 1MHCA 3ROLA 3SKOB 3BP7B 4LK4A 2FDBP 4NKMB 2Z8SA 4JO2L 1Q8MA 3PNWA 2QSVA 3PHOB 3TIEA 4TYUA 2C1PB 4CJ0A 3VW3L 4M1CC 1MEXL 1CN4A 1HSAB 3T8XA 4XPAH 4WDIB 3G5VB 3DO7A 4BM7A 1EFXB 3IJHB 4NFCA 3S35L 1A7RL 1S9KC 1G9ML 4M62L 1T7WA 4J6RH 2PTTB 4E42B 3MOQA 4H1LH 3BDBA 2D7MA 3O41B 3CMGA 5IVZB 3MX0A 5DI8B 2VLJE 3G5ZB 3L3IB 1UM6L 4FNLH 3TNMB 2FX9L 2PETA 3GBLA 3QDGE 3WFCH 5B38B 5ID0A 2HJFA 2NY2B 3VH8G 5L8JB 2ZUQB 4CADA 1OW0A 1E6OL 1DL7H 2MPAL 4QRTA 5DD5H 2Z9TA 3HAEH 1JUFA 1N59B 3RWGA 2CPCA 1H8SA 4XPHL 4TUOA 4B53A 4M4PA 3MGTA 2Q8AL 5MHSD 4NNXA 5KVFL 3P30H 1QFUH 4KV5E 5DDHB 1HIML 1BM3H 1N8ZA 1H15A 2QR0B 3MR9A 2Q20A 3OXSA 5DRNA 3WHXA 1LK3L 4WI7A 3BUYB 5C0AA 1AO7E 3FO2B 3ILQD 5DVLA 1C5DA 3QCVL 2F8OA 3A0OA 3IU3B 4KTDL 3UTSA 3QO1B 4GRLA 1FVDB 1TMCB 5J6GB 3Q5TA 1MFDH 4RMQA 3T3PE 3KYMA 1CICB 2FYYB 2GYSA 5J1AB 3HI5H 1EEZA 2F5BH 3GMOB 4NP4L 4R7NB 4Y4HA 5DQJB 3SDCA 1D5XB 5D8JL 1I1YA 3O3DB 4OZHE 3QAZC 1MCDA 4QRRB 1MFBH 3QNYB 5I18H 3LSOA 3AVEA 2AI0L 5J0BA 3DMMA 3N85H 3FQXA 2UY7A 1YECH 2EXWD 1KYOK 4QOKA 3WFBL 4X7SH 5I71B 4NQSA 3MV7A 1RZFL 5TFSH 1A6VH 5FOBB 3HS0B 1W8NA 4QXGH 3CDCA 2D4DA 4OM1L 2BXYA 5ALCH 5F7MC 3SO3B 3EDFA 5F96H 2YPKA 5DK3A 3P0VH 3BPLC 3TH3T 2AABL 2R2EB 4NFBA 4JM2C 3RY6C 4GQ9L 3SCMD 3BD4A 2JJSA 5CBEB 2EC9U 2H6PA 4PGCB 4R90H 2CXKA 1S7WB 3BGFB 2LTQB 1R24B 4G7YH 2ZOKB 3A6OA 4Y7MA 4DGVH 4YHZL 5IB1B 4JFED 3WV0A 4X9HA 1F6AB 2F53D 3TWCL 4GSDH 3K8MA 1DQQA 3FB8A 3KS0J 1E4KC 5B21A 3QO0A 2OMNA 5D6CB 3D0LA 5D1XD 3NCYS 5E2VL 1FO0L 1H5BC 4KHXH 2YK1H 4FQQA 1IT9H 2YD2A 2OL3L 4XP9H 1DLHB 4NKIH 4WI3A 5CEXA 2NY3D 1QYGL 2PO6C 1J1OL 4R0LB 2UZYB 4M6NH 2FL5B 1G7JA 2XZCH 1MRCL 4XBGB 4Z7VB 5I73B 2X7LB 5INDA 3PWLA 2QQQA 1DEEA 3U7WH 5DZLA 3MYZA 5H2BA 1M7IA 3HCVB 2N4IA 1P9MC 2AV1B 1KPRA 1PQZB 4LSSH 4FQXC 3SE4C 2EE9A 5EBLA 3FT4A 3L3DB 1Z5LA 5D7IB 3NVQA 3OR6B 3EYFB 4GUPB 4U1LB 1OGAA 1I1FB 5KVDH 2ID5A 3EYVB 5DJDB 2Y36L 1GGBL 1N64H 4LCUB 1AC6A 4ZAKC 2VKWA 1XGQA 4DEPB 2HVJA 2NW2B 1FO0A 3RVXC 3CFDB 4LASL 1EERB 5TE6L 2OL3A 3WFHA 4FP8H 3RAJH 3IDYC 1QLEH 4U6XA 4F7PA 1I7TA 1CK0L 1S9YB 2JJTA 5FGBC 3TEUA 1S7SB 2DBLH 3GSXA 1BIHA