4ZNEE

Igg1 fc-fcgammari ecd complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
215
Chain Sequence
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity immunoglobulin gamma Fc receptor I
publication title Structural insights into the interaction of human IgG1 with Fc gamma RI: no direct role of glycans in binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 215
sequence length 215
chains with identical sequence J
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zneE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zneE01
3STLB 2CMRH 2C7UB 4IM8A 4U0QB 5J3HC 2AJYH 5D1XA 3CSPA 2F53B 3ULVD 2V2TA 4LEOA 1L9MA 2DN7A 1U8IB 3LY6A 4MNHB 2VXVL 4LSUL 3B3IA 3UXFA 3PWPA 1W72A 2QL1A 5I66A 1ONQA 3PWNA 1G7QA 3DECA 4L1HA 2FR4A 3GMOA 1PY9A 5LAXA 4OF5A 1KELL 3QUXB 4Z7NF 4RWHA 1N2RA 3CFJA 1E27B 3MRNA 4HS3A 5I19L 4Z7OF 3UJIH 4JFXA 4P99A 3AXLB 3I6LE 1A9BB 4QRQB 4UMGA 4Y2DB 5ISZB 1IEAA 2ZJSL 4OZHE 1JPFB 4O2CB 3VXRA 3REWA 3JV4A 3T0DA 5DQJB 3LZFH 2WK2A 1EEUA 2VMFA 3ZDZF 3KPSB 1CIUA 1NCCL 3G9VA 3CXDL 2C4FT 4OFVA 3MRGB 4WHCA 4Y16D 3EDJA 2RHEA 5KN5A 2GK2A 2X7LB 3V5DA 2GKIA 4OZGB 2P8MB 2EKSB 2FGWL 3LPWA 3GHBH 2JK5B 4LAJH 5KSAA 1INDL 3S8WA 1AGFB 4PRBB 2FIRT 4KC3B 1RZIB 3MV9B 5JR1H 3ARDC 3OHXB 2EDWA 1I1RA 2ZUQC 1JPGB 4FTVE 1P84K 3QPQC 5H35B 4OGXL 3BXNA 1FFRA 4G43A 3O41A 1KB5H 3EDDA 4I48A 1U8PB 4M3KB 5JIKA 3ZHDA 1D5IL 1E4KA 4D3CL 4XHQA 1PW3A 2G5RA 2HA1A 4FRWA 3DVNB 4KK8D 1U2CA 3MCLL 1Z2KA 2CIIA 3R06A 3W11D 1A6AB 3P2TA 4Y7MA 1N4XL 2IJ0C 4F33A 3G04B 1U8QB 2FX7L 4XWOD 5I1GH 1CD0A 3ZKNC 1DQTA 3ZTNL 3U6RB 3ESUF 1DUYB 3CIQA 2BMKA 1LO2L 3A6CL 5I30H 2XACC 3D85B 1QA9B 2DQDH 4XAWL 5C6PB 4WWKB 3MROB 2AGJH 3MA9H 2CQVA 1J8HD 4MJ2A 1Z0NA 2MPAL 2OX5A 1QBLH 3LKNB 4J4PC 2Y1VA 3WIFA 4HBCL 5D2LF 5CHNA 4G8EB 4NYLA 3VXTA 3QG7H 2PKDA 1WIUA 1D5XB 1B0GB 3JWOC 4M5YH 2MQ3A 1EZVX 3MA7A 1T03L 2YPVL 2WUBL 3QCUH 3PWJA 5D7IE 1CLCA 3NPSC 4D8PA 2YHGA 3T1FB 4Y5YC 2J2ZA 4LNVA 1J1OH 3LSOA 3EFFB 4WTWA 4U3HA 5B38G 1F13A 4FQ1H 1MOEA 4MA3B 4Q6YA 3QIBA 5HHQB 4LFHG 3W5MA 2I9LA 3CC5B 5EC1B 4L4VE 5EFIB 1JZ6A 4O9HL 2ATKB 4RCAA 5DRXB 2ERJB 3T3PF 3ULVC 1P4IL 5DRNA 4R7NA 1FVDB 3RL1A 5LBSH 2D3VA 3WS6C 5IROA 3O4LD 5JZ7D 1T0NA 4H8WH 1IBGL 3LEYL 5DRWB 4Y88A 1I8KB 2BDNH 4CN4A 3QRGH 4OGYL 4KQ4H 4XXCA 1H3PL 3HNVH 1HXMA 4ZOAA 1TMCB 1AD9A 1IAII 4JZNA 4NC0B 4HS8H 1BX2A 1P84J 5F1IA 4MS8D 2IQAA 4K3JL 3IDYB 4KROD 4L3CB 1DQJB 4G7VL 1MFAL 3DV6A 1PFCA 4I0KA 3UMTA 3QG6A 3PGFL 3MC0A 4Y16C 1H3VA 1IGJB 1PDKA 3L3HB 3CLFH 1SEBA 5K9JL 1NQBA 2BSSA 4ODTL 1I8IB 5EZOL 3EFDH 4K7PY 4G5ZL 2ENSA 3GSOA 1KIQB 3RGHA 4CNIB 4K2UL 2NY3C 2WINA 2VLLA 1IKNC 1QLRA 1CD1A 3NFNB 3GSQA 2XTJD 4L4TA 4OLZH 3LV3A 1UEYA 4OD1H 3SKNB 3TPUA 2DJSA 5B8CA 4XBGA 4Y5VA 2VXUL 4G7YH 4KK8C 5HGDA 5IQ9B 1I7ZB 1FO0H 1PY4A 1G7PB 2BVPA 3DBXA 2YUVA 4U1LB 5K9QI 3MUZ1 3W11C 4QF1B 4M6AA 2PNDA 4UU9B 2IQ9L 3AU1A 4S2SA 1N64L 3L5XH 1S7UA 4XWOC 4O5LL 1UVQA 1U58B 4JKKA 2DLEA 3MLSL 4OIIH 2BOCA 4P59H 3MO1B 4AL8L 2AXJA 5HVFB 2X4TB 2VR9A 1ZLSL 1QD0A 3EYOB 3EYSH 4PD4K 5CEYA 4PS4H 3MLVH 3ARVA 2DQTH 2L7UA 3AS3A 5IMKB 1VA9A 5KSUA 3T77A 5KZCD 5DC4B 1FLRL 2BHUA 1XGYH 5D93B 3ET9F 2C3HA 4X99B 3UBXB 1JK8A 2QTEA 2JJTC 4XMPH 3O11A 3ES6A 3BAEL 3FB6A 5E99L 5FKAB 5AWNH 1JRHI 5D6DC 2Q3AA 3M1BB 3GKWH 2ESVD 5B21A 4KGJA 1T1XA 5E00B 4HKBA 2JELL 2W9DL 4QRPD 4XP6H 3RBSA 3CFKA 1ZXQA 1MY5A 4P57A 2VZOA 5CCKL 2VJXA 1VACA 2DKSA 1X4YA 4R90H 4ACPA 3QNYA 4ZUWB 1P7QA 3U36A 3ARWA 4NZDA 4QOKD 4EUPB 4CADB 4PJCE 2DLHA 1JL8A 3H7LA 2Z0BA 1FYTB 4KVCL 1CGWA 4PY8I 4Z7WA 1RZKL 2O93L 5JZ7C 3ULUF 2Z92A 4ENED 1IGTB 3HMXH 1MCOH 3F65A 3FAWA 3HUJA 5E8PB 5KANG 3G6AA 4GRMA 1BEYL 4GMTL 5J9PA 4PJXA 5ACZA 1OGTA 3OTTA 1ADQH 3FN9A 3QA3B 3HE7C 1BZ7A 1OAZH 4RRPG 1LILA 3MNVB 3TBYB 2DD8H 4G8GD 3EO0B 4PJEB 5FA3A 3EOTH 4MS8C 3K4ZA 5D1QA 3L7EB 1L6ZA 3QFJD 1CE6A 4H20H 4KROC 4LDEB 5T1KB 1CICD 4X4ZA 4OCSL 4M6NL 5JXAL 1YECL 5JW3H 2GJ6D 2QR0B 1YQVH 2DQEH 1RMFL 4KJYA 5BO1H 5H37H 4MJID 1N6UA 3FO2A 4JRWA 4QNPF 4G6ML 1GGIL 5D70L 3MRQA 4HG4K 3DUSB 2VISB 5IESH 2RGSA 5ESAB 5IB4B 25C8L 5IB1A 15C8H 1CFNB 4PJCB 3D3VE 3HLAA 3CK0H 3D0LA 4LAQH 1X5JA 1G0YR 3DXAD 4PD4J 4JFFD 4M1DL 1LWRA 3IDIA 1T20A 2D31A 2XTJC 3HNTH 4PJGA 5IW3A 3OR7A 1WV7T 4NSKB 5IVXE 4HX1A 2VRAA 1OM3L 4M43L 1MHCA 4QRTB 3FQUA 5FXCH 4BFGA 1CF8L 5DRZA 2BX5A 5D9SB 3ARDB 3PQYD 4HUKB 4LCYA 2VZVA 5DMIH 4CMHC 1NL0L 4KRLB 1MJUL 1TZIB 1KCVH 3DLQR 2P46B 1A1NB 3KS0J 4LK4A 3X14A 1FFPA 4HCRA 3NFPA 1NGWB 4WU5B 4FZEH 4PJAA 1OAKL 2ADIA 3SE9L 4FQQB 3ULVE 2AV1B 1OTSD 3UEZA 4F7EA 3OJDA 1GHFH 1HZHH 5FDYA 1NBYB 3F6LA 2DIAA 2HKHH 1EIBA 3F6IA 5GGQL 2EH8H 3VMNA 1N0XH 35C8L 3OKOA 4MAYA 1NAMA 1IGCL 4M00A 5IFHL 4RDQG 1F00I 4QTIL 4QHNA 2IEPA 1DLFH 1KC5L 2K7PA 4G9FD 2BP3A 2YD9A 3C08H 3OKKA 1WBXB 2G2RB 4C56E 5HGBA 3UPRA 3TV3L 2LAGB 4MZ3A 4LQ1A 3NPSB 4OLUH 5DI8A 4Y5YB 1A4KB 5DQ9B 1IEBA 4HIHB 1NMCB 3GB7B 5C6TL 5C9JA 4PRAB 3SDYH 1TTGA 5T1LA 4TSCH 1YEGL 4DVBA 1FNGA 4Z5RA 4L8DA 3KYKH 5EU6A 1DUZA 4HG4J 1HOCA 4R26H 2AV7B 4YIQA 1Q0XH 4NUJA 4PYGA 5DEFB 1ZS8B 4ZNCD 3EOAB 4JM2D 4NZRL 2X4UA 3CX5J 1NLDL 3O2WH 5C0JB 3E8UL 1IC5H 1A7OH 2Z4QA 1FZOB 4X7FC 5GGTH 4FQLH 3V0VB 4CMMA 1T2QH 3VCLA 4OQTL 4YDJA 5J1AA 5DO2D 5EBGA 4K8RD 4PGJA 3VXQA 2HKFH 1JNNH 3PDOB 5EU5A 3SDAD 3WN5A 5D2LB 3QHZL 2ADJA 5DJ8A 2H41A 2QBWA 3NACL 1YMMA 5IHUH 1KEGH 1FV1B 4YBHA 2X5PA 2H26A 4QT5A 5KSBF 4H5SB 5MP6H 4JPVH 5B39B 1F11B 5HPOA 3EOYG 3KLSA 1B6UA 3TT3H 1DVFB 4LARL 3U2SA 1W0WB 1PKQB 2A77H 1FGNL 3M17A 4XCEA 5TE7H 4CBPA 4ZTOL 4I5BA 3TIEB 3GM0A 4TUKL 4N1CA 1QQDB 1GRWA 4XPBL 3W9EA 5LGHH 5CP7B 1BLNB 3E1F1 1MQ8A 2BC4A 3K4DA 3P30H 1CDCA 4XPFL 1VSCA 2WM0A 1MF2L 2LU4A 2A6JA 4YHZL 1NLBH 4Q0XH 1I85C 2XA8H 3N85L 4KUZH 4WFGE 4IIQC 2OMNA 4RRPA 3ZTJG 3LAFA 4WY7L 4XTRC 4M8QA 3ROOA 1OTSC 2XY1A 5JQ6H 1IQDB 2GY7B 4NC2B 1VENA 5ADPH 2NW3B 4M6OL 5I6XB 4ZFOL 3C9NA 5J6HB 4PY7A 3FB8B 3LKRA 2ITCB 4OTXH 4U33A 4MJ4A 2NLJB 4JFEB 4HEME 2AXFB 5IIEA 2R2HB 5ESQA 3LS5L 3G6JF 1J8HB 1WZMA 4R97C 1BQLL 4GOSA 4LSSH 2AJ3A 1MFCL 3VW3H 3TLRA 1J18A 3RWCB 3T3ME 1MPAH 5DA0B 4PUBH 3QHFH 4K7PX 1IM3B 2DKUA 2Z31A 1KJ3H 1QLEH 1NC4A 1WCQA 1HWGB 4JZJC 3EO1B 4L9LC 4CVZA 1MH5B 5GXBB 3BH8B 1JNHB 3HI5L 1EFXD 5HHPA 3ARGD 3FO9A 4WDIA 4DVRH 1OPGL 2H32A 3MRCB 3PGDA 1KTDB 1NCNA 1T7YA 5D7JD 3ROLA 3IGAA 3RHWK 3MLWH 2PTUA 4HW6A 4OF0A 3WO4C 3TBWA 1SYVB 3QO0B 1ZVSA 4Q9RH 2HJLB 3SGKC 1FNEB 4IRZH 1LVEA 1F3JB 4JM2C 1H15A 2B1HH 4ODHL 5GRUL 2NPLX 3O4LB 1D6VL 1AKJA 5I16B 5E8DH 3SPVA 4XNUL 4F57H 3UYRH 4EVNA 5DO2C 3GHEH 4HMCA 1E6OL 1HSBB 4TVPH 2UUDH 4LLWB 3WFHB 4KTDH 3DURA 3SDAC 3QQ4A 5EO1B 5C0EA 2X4SA 4ZOCA 3D39B 3LN5B 3AM8C 2I9TA 2Q7NA 3RY6C 4OLXL 4KROB 3KPMA 4HH8A 3GIZH 3VXSA 5GRVK 4W4OA 5F1NB 3MNWB 3UC0L 3C60B 3V7AG 1RZJH 2NZIA 3IAPA 3W9DB 3H0TA 3L95B 4P4KB 5JUEH 2EYTB 4KAQH 3JV5A 2HLFD 1MNUL 2Q6WA 4JCLA 2VLRB 4QEGA 2CXKA 2ESVE 3W39A 4P4RA 1TVHB 3VH8B 1GIGL 4BZ1H 2PTVA 3KJ4C 5GSRB 3FFCD 1AGDA 5BOPA 3AGVA 3ARBA 2XTJB 3NA9L 3KPLA 2BVOA 4M4RA 4FXGA 1B4JL 1EMTH 2GT9A 1U8OA 4JM4L 3WDHA 1F4YL 4NOBA 4X6BB 5EUKB 3GSUB 1YEFL 1XZ0B 2JCCA 2EDNA 2GTWB 4HFUH 1IGYB 4QOKE 1QSFE 4LSTH 4MWFB 4WENB 4OQ1A 4XNMB 3OWEA 4MNGE 4N0FB 5CMAA 3OJMB 2D0GA 2DQHH 4JLRB 3ZDXF 2JJVA 4XVSH 2OK0L 1ZHKB 4JY4A 3S7GA 1PYWB 4J7RA 2R0WH 1XF3A 2P8PA 3QUMB 4NQUA 5DSCA 2MHAA 2PETA 2RQ8A 3KXFE 4GQ9H 1G7LA 3QJHB 4H1LH 5I2IB 1XF1A 4OAWA 3MRRB 5BS0D 1IFHL 1NSNH 2FHCA 3BDYH 4OKVA 4E41A 5HDQL 3A0OA 4GKOA 1EXUA 2KZWA 1IGFL 3Q2CA 3T0WA 2ZUXA 3QFJE 4YR6B 3RWIA 3QUZA 2ESVB 4R4BA 1AY1L 1HHKB 4JY6A 4X7SL 5FV1L 1ED3B 1DFBL 2GJ6E 3QXAB 2HH0H 2GJZB 3S88H 4K23L 3O8XD 4RISH 4QRPB 4MJIE 3LH2H 4UDTA 5D7JC 1EHLH 5A2JH 4W70A 4R7DB 1LDPL 3OZ9H 5FO9A 4QHUA 3PGCB 3MLXH 1YEDB 4MNGB 5CIPA 4ZSOE 2OZ4A 4UTBL 3DXAE 5GJSH 1ZEAH 1YPZA 3WFDH 7FABL 2X6MA 3QWRA 4PLKD 1A7PL 5C08E 4Y4HD 3HAEH 4WIQA 1NCBL 3TESA 5GIRB 1A2YA 3U83A 5BVPL 1AO7D 4HWZB 4KZDL 2JIXA 3LKQA 3BW9B 3SCMD 4J1UA 3KYOB 1U8HA 3BSZH 4G8FA 1HDMB 3GGWB 1MFDH 1CDYA 1DBKH 3U4EA 3NZHL 5FUZH 4XXDA 3MJ9L 4G8GB 4HJGB 3IS1X 4WRLA 4ZUSA 4YX2H 4ZQKA 4QTHB 1KJVB 2X1PA 1ORQB 1JZ7A 1CICB 1PVHA 2P49B 1HHJB 1F4WH 2BCKA 1D5BA 2DQCL 4JHZA 12E8L 2EEDA 5FGBC 2ZUVA 3EYQD 5M7QA 4OBRA 3A6BL 2GITA 3QAZB 3GRWA 2CR3A 3UTPD 4OM0L 5HYJD 1MI5E 2EXYD 1LEKA 2XYCA 2HLFC 1LO3H 1MLBA 3F5WA 2MKWA 8FABA 3MLZL 4D94A 3AY4C 4HLZH 3DV4B 2EKJA 3BN3B 3OKNB 1I1FA 2P5ED 1WAAA 4XVJL 3DXAB 2J6EH 1TETH 4JFFB 1DP0A 3JWOL 5GRJL 5SX5H 4NM8L 4G9FE 4MYWB 3PP4H 2NX5D 3CNKA 3GJFB 5GZOD 3I2CL 1JGEA 4HUXA 1RURH 5DEGA 1U3YA 3WLBA 4JZOB 2GI7A 4LVNC 1FCCA 4EI5D 3QI9D 3PQYB 4MCYB 4F3FB 1EO5A 3DYOA 4ESKA 4R4FH 2H1PL 1R3LA 1P2CA 3M8OH 5H94B 3AB0C 2IWGA 1MRDL 1QFUL 3WD5L 3ULVL 3WFEL 3VMOA 1KBGH 4UIKL 1PSKL 4HPYL 1ZLVK 3P0GB 1ULVA 5FK9A 1OD9A 3WNNA 3CLEL 3MUY1 3WIHH 1AQDB 3P4MB 1BGXL 2DQUL 3SJVB 1VGEL 3STLA 2F54A 4ODSL 3L3GB 2R2CA 4H25B 4HKJB 4JQVA 4M61A 3BVNA 3MJGX 2OJZH 4F2MB 1XCQB 3D9AL 4U7SA 2F53A 2COQA 4HGWA 4NNYA 1U8IA 2DB8A 4J3XA 4Q9BA 4P9HC 4GRWB 4L3AA 1SJEA 4DTGL 4U6HA 1I7RB 4GXVL 1JHTB 1FFNB 4ZO6A 2HTKD 4I77H 5D7LA 4Y4FD 4GXUN 3O8XC 3QUXA 3GNMH 4LLDA 1MFEH 4OF8A 4RZCA 3QDMA 2R56H 2OTPA 3V6OA 2EYRB 5IHBA 4L9LB 4PJDF 4JR9H 5IMLA 5HHMD 3EGSB 1N5YL 4LGRB 2IH3B 1NGZB 4JO4L 2W0FB 5IB3B 1GPOL 2XN9D 4LCIL 1BPVA 2EIDA 3MRDB 3P9LB 4PLKC 4G6JL 5ALCH 3BYTA 4XP5L 2YEZB 2OJEB 4LQFL 3C6LA 2C1OB 4B7IA 2BNUA 1FRGH 2R9HD 3MRGA 1ACZA 3WO4B 1AGEB 4RGOH 3ULUH 2FX9H 2Z8VC 3VD7A 1Q9WA 4ELKA 4OZGA 1FORL 4F7TB 3WJJA 3I02B 3TH2T 4JM2B 3N9GH 2JK5A 1UWXH 3LKOB 1BQSA 4M3JA 5ID1B 2ICWI 1JNLL 1V5JA 1RZIA 3X3GL 1DEDA 4NBYB 2CKBL 1TQBC 4QRRD 2CLZB 2YUXA 5CJBA 1JPGA 3CXHK 4PRNA 1VEPA 2WV3A 5CJ5A 1LP9F 1WWAX 1U8PA 5KAQG 4KJPD 3MBEA 5F3BB 3DVNA 4FFVD 1I7TB 4UAOC 4NQCD 3P0VH 4O58H 2EXYC 4Y1AE 4OV6F 4OQTA 5F7HA 3G04A 2ZKHL 3O3AB 4RMWA 4K7PH 1U8QA 1BMGA 4XRCA 4Y4KA 4OZHA 5EBMB 3WUWG 4DUVA 5TH2A 2X1OA 3SGJC 3DRTB 3G5ZB 3D2UB 5KG9B 3I3EA 3MROA 4Y2OA 1IKFH 4OZIF 3INUL 2Z93B 3VD5A 1JYNA 1DCLA 5MHSD 1QPXA 3VE0B 1YDPB 4FQXD 4X0KB 4FQPA 4G8EA 4EI5C 3CFDA 4ELME 1B0GA 4B0MM 5LGJB 4UT6H 4H0HB 2ZOLA 4JO2L 4TPRH 5DFWH 3SQOL 3MUJA 1MHPL 3H9SB 3O0RL 2XZQL 3LQZB 2CLVA 1P1ZA 4D2NA 1WISA 2CLRA 1MCFA 3EFFA 4FTVA 4NUGL 4BKLB 5HHQA 2YPKB 2E7MA 2VDOL 1YEEL 3CC5A 4JHAH 4IRJC 2ATKA 1FJ1A 1EHAA 5DUML 1VPOL 2EE9A 2I26N 1FZKB 3MRHB 1D6EB 4TVPD 4ZFFB 3WEXA 3DO7B 3CUPB 4N90D 4Y5XB 2FWOA 3QEQD 4YXLL 2NXZD 4GUPB 1OAQL 3MV01 4RWYL 1T6WA 5EH1A 3WL9A 2M1KA 2JE8A 5I18H 1UM5H 4UNVA 5C07D 2HTKC 1HN1A 2GAZB 3OGCB 5EZIL 1UB6A 1I8KA 3NCCB 1YY8B 4KWUA 4ZFOA 1A02N 1NGYA 3IDMA 5DVKA 5EU7C 2EDRA 2FX8H 3DUHA 1UGNA 3QZWB 3CPLA 4ODVL 4N0CD 5EIIA 2ZNXA 1QFHA 3ILPB 1UKSA 2UY7A 1OAXL 5FB8A 2Q1EA 4ELMB 3ARGB 4PRIB 3CXHJ 1YJDL 4LVOC 3CVHH 3UJJH 4MNQE 3QIWD 5K59F 1DQJA 5BOZG 1RJZB 5D7IA 5JIPA 3NFSH 3KYNB 3O2VL 3L3HA 1IE5A 3ARTA 3OAUL 3QEGL 2AEQH 5EUOB 4L4VA 5DUPL 1FO0B 1Z6JT 2H6PB 3Q6GL 2VR5A 3RA7H 2I60L 4R3SB 4LMQE 1VFAA 1RUPH 5I75C 1KIQA 2PTTB 2PYED 2ZNWA 4L5FH 1ZK9A 3GSWA 3SDDD 2QLVB 4QRUB 5C2BL 4UB0L 5IV2B 1CWVA 1AD0B 4JFHE 3H9HA 4UOJA 5EU3A 3NFNA 1AH1A 3PIQB 3SKNA 3I85A 1IAOB 4P49A 2Y36H 4A2LA 1UG9A 4OD3L 1MAKA 4FFVC 5IQ9A 1I7ZA 1HILA 2XIDA 2DL9A 4FFZH 1AGCB 1WSST 2UUDK 4MD0B 3OKLB 3QUML 4XVUD 1G6RB 4UU9A 3BGAA 1DBAH 4N8CL 5D4QA 2MWCA 2V2XB 1BIHA 3QR2A 4H26A 1U58A 3HC3L 4C58B 1Z3GL 4LSQL 5FM5O 3WKML 2VDNL 5AD0B 5BS0E 4WO4B 3F7VB 3PV6A 4I0PA 1E4XI 4KTEL 2Z35B 4JJ5A 3T0AA 4FQXC 1TITA 3RWFA 4JY5L 3J7HA 3FFCB 1XGUB 5ICYB 5L9DH 4NQDE 1I7UB 4KDWA 3UBXA 5SWSE 2Q8BL 1QLFB 1KYOK 4A2MA 2X9WA 4LP4A 4OFYA 5DVOA 2EXWD 4GW4B 5DJAA 5BXFA 4E5XB 5EDXA 1QSEE 4ONHA 1C1EL 1DBMH 1S8DB 1BOYA 3DROB 2L4OA 3QO1B 3R4DA 4NKDA 4DZ8B 4WEBL 4S1QL 1PQZB 1BF2A 3E6FA 1ZT7B 4HC1A 1MJJA 3BX7C 5GZNC 2VO5A 2P4AB 3CMOH 1KGCE 1AO7E 4PLJD 4YXKH 3CFCH 3I50H 5MEPB 2E8YA 3S4SB 4X8XA 1T4KB 2Z91B 2J5LC 2VL5A 3K74B 2FBJH 3TJHD 1RVFL 4MSWA 4L8SB 4G9DA 3BD4A 4X4ME 1IARB 1L4IA 5L8LB 1RZJC 4PJBF 3WUWA 4KKNA 3V6FA 1EK3A 1BP3B 2R2EB 4ONOA 4N0CC 4WVRA 3PHSA 3QEUB 3P77A 2ED8A 1YNKH 5EA0L 3ALPA 1CL7L 3BZFB 4GMSL 1JGLL 4LVHC 3IFNL 1IMHC 1LE9A 3O8XB 4RMQA 3L3JB 1HXYA 2DLFL 1UH4A 3QIWC 1X6LA 3UTPE 5HYJE 3U7AA 4PB9L 4ETQA 2BVUA 2DQGH 4HIXH 3VXMD 2J4WH 2N4IA 1KB9K 4HDIB 2FYYA 5E94B 1CGSL 1MVFA 2W91A 2JB6A 2Y4SA 2P5EE 3P73B 1B2WL 2BVQA 5EOCH 1R6VA 3LKSA 5JA8B 5IB4A 4Y4HB 5F1OB 3B8YA 3RX7A 1J5OH 4C55A 2ZUUA 2NX5E 1QO3A 2CMRL 1CFNA 4PJCA 1I1AD 5DTFB 2FATH 1K6QH 4JVWA 2AJYL 3RIFF 1VKXB 3AUVA 1GJIA 2GCYA 3OKEB 1OLLA 3SO5A 2DDQL 3WSQH 2E7HA 3HPLA 4NT6B 1AFVL 3SCMB 4HUVA 3SDXF 4JAMB 1J11A 4LPTA 4HAFA 3BQUD 4QRTA 2FEEI 5HDBE 3ARDA 1KYOJ 4J3TA 5DC9B 4XVUC 4P2RD 4OJFL 1NFIA 4CVUA 1MWAA 1RK1A 3D87B 4UT9H 1I9IH 2OL3A 2IH1B 3PABA 1JRHH 1NGWA 3UJIL 2DM4A 3RJDA 2VE6B 3MJ9A 3PWUA 4PP1D 5IK3A 1TJIL 5FF6B 1ZGLP 5D2NE 2AV1A 1EEYB 2EDOA 3OKYA 5EOQL 4AQ1B 1ZA6A 2P5EB 3T4AA 3U0WH 3TO2A 3DRQA 4JG0L 1SVCP 1CFSB 1T66D 2NX5B 1LGVA 3D3VA 1WWBX 2EXWC 3OG4B 4J4PA 5E5MB 2RBLA 2D0FA 1QYGL 2VLME 4LCUB 4GG6F 2D7NA 5JR1L 5HHME 4EI5B 4Z7UF 3QI9B 2X4NA 2BERA 4XMKH 4UQ3B 5GSVB 5IVXA 2G2RA 1T3FA 2XN9E 2J88L 3IU4H 5HXMA 1JN6B 3WFCL 1KB5L 2A6DB 4LHUG 3DETD 4G3YH 5DQ9A 5DGQA 1OTUD 1S9XB 1KPUB 3V9FA 4MAUL 3GI8H 3IFPB 3U1SH 1N59A 4PLJC 1KB9J 4DOHB 3ARFD 2OBGA 3F58L 1WZLA 5I1GL 5I15H 3TJHC 1RSFA 1CVRA 1OP5H 4JKLA 3U82B 1TPXC 3E6HA 3BKJH 1C12A 5SWQB 2DRUA 2AABH 4XP1H 1T2XA 4K8RL 2FD6L 4IBLT 5CJQH 3PP3H 1M6OB 2DQDL 3WS6A 2AGJL 5IBUB 3TA3D 1C5BH 2X4RA 2NY7L 1NDMB 4PRPD 1CDIA 4PJ9D 4Y4FB 5DR5H 3PHOA 3QG7L 4DGIL 3ZT5A 3TN0D 5D7SH 3DVIA 4NQCE 1OAYH 3MJ7B 4X83A 5HY9A 3KPNB 4NKOA 3SKJH 3QCUL 5FFLA 3HR5B 4MMZC 5L6YH 1EJ6A 2FIKB 5D72H 4YAQB 4C56A 3OMZA 4POUB 1FV1A 1C08B 4NZTH 2H3NB 2W65A 4HKZB 3WIIL 4Y16A 3AVEA 4H5SA 1SEQH 3TZVD 1FSKB 2B7DT 1DQMH 4X6DE 2E6JA 5FGCE 1TZHB 1FFOB 5LBSL 1B0WA 3PL6A 5I75B 4QCIA 1KIRB 1X5IA 3B4NA 4N9GB 5IM7A 4LLAA 5JPNB 4KKCD 2H9GA 5I1IH 1TVBB 1JYWA 4POYA 3BOVA 2UZIL 4QRRB 1ZHNB 5D1XD 2BDNL 1IKNA 1BLNA 4Y8AA 3QRGL 1F8TL 2YPLB 5FYLD 3HNVL 1HH9A 2IFFH 4Z7VB 3TBSB 4TVPE 2F74B 4PP1C 4Z7NE 3TBTB 1FNSH 4S0TD 1CFVH 5E8OB 2CKBA 2YK1H 3QEQE 2QSTA 1NAKL 4Z7OE 5C2UB 3HZMA 3BGMB 4MDJB 3WLWD 1K8IA 2IFGA 3GEWB 2WBKA 3FB8A 1I3UA 3DIFA 3O6KH 2WBWB 5L0QC 4X80H 3U0PB 1UH3A 2AXFA 4AEHH 1I9RH 3WCYA 1BVLA 2H2PD 5DVMA 5DK2B 1A7NH 4FQXB 1XR9A 3KLAA 1EUUA 1YN7B 1QEWB 4N68A 3AC0A 2CGRH 2JJTA 4OLZL 1N8ZB 3MLTA 4QHLA 4Y0GA 4YNYB 4YK4C 4U6TA 1FAIL 1A9EB 3DETC 1ETZA 5ANMB 4U7KA 5KSAD 1OTUC 3WJLC 1FO0L 3FT2A 4R4ND 2ZUTA 3L3DB 1RUQL 3C6SB 3V6BR 4LLMA 3AS1A 4V1DD 4PGCB 4PJ8D 4OIIL 4XNYL 5TDOA 3QEQB 3O3UN 5H8DA 1FNEA 4P59L 2NXZB 3QUYD 1NGPH 4ODXB 3RZWA 1FVCB 3TF7C 1F3JA 4QRSB 3MLVL 1RPQA 5T1DH 4FXKB 5HVHC 1INQB 4DFHA 3NIDF 5I16A 1PBYA 1E6JL 1M1SA 2A9MH 5E4EC 3S37L 5C07B 2P7TB 4PJ9C 5GGVY 4YHLL 3MSPA 1N7MH 1CGVA 2GK0B 3TN0C 1T7ZA 1LDSA 3LEXB 5AWNL 1A7BA 2YD2A 4LLWA 3GKWL 5FHAL 3GDBA 3HE7A 3GMNA 3SE3C 1EGJH 5EO1A 1NCWH 4LVHB 4AIZB 3KPPA 1FC2D 1JFQH 5IB2B 4HFWB 1IEHA 3QIWB 1LK3H 4U1NB 1K4DA 3WDJA 4R90L 2C3VA 4EI6B 1WBYB 3FN3A 3EAKA 5F1NA 4M02A 3ZL4H 2R1WB 3TZVC 1M71A 1D7FA 1UJ3A 4LHUA 5BVJB 2OR9H 1HKLH 3GMLA 2EYTA 1A6TA 3V95A 1ZT4B 3JVGC 1G9MH 3MXWH 5AZEL 2OS7A 3QIBD 4U1JA 2PYEB 3B9KB 4KY1L 1CZ8L 3HE6D 3HMXL 1WTGT 3SDDB 5I1JH 3VJ6A 3MRLB 4KKCC 5TE4H 5BCAA 3DGGA 2R0LH 3VH8A 2AJVL 5GSRA 3KWWA 2OQJB 4TULH 5JW5B 5ALBL 1AQKL 5DJYA 1OD7A 2IPTH 2NY4D 3BH9A 1ADQL 1HCFX 3C5ZD 4LLVA 5BMFH 4P5MB 1RUMH 1OAZL 3MV7E 5EUKA 5F89A 5KVDH 4N5ED 1XZ0A 2DD8L 4JGMA 4NKMB 1OAUL 1CI5A 5ICZB 2OLDA 4JFDE 1MLCB 3HRZB 4XNMA 4I13B 2IPKB 4CAGA 4PJBB 4DWHA 5FM8A 1L0YA 4QY8B 5JW3L 3CDYA 4JLRA 5E56A 4UQ2A 1YQVL 5ERWA 4YDKH 4OV5B 1OL0A 1IL1B 5FO7B 3HZYB 1ZHKA 1JV5B 3U9PH 4CUCA 4P9HL 3C09C 3QUMA 1S5IH 2LQRA 5C0AD 3VI3F 2H2PC 3MV8B 1U41A 3GSNH 4U1KA 15C8L 3Q1SL 4DCQA 2FSEA 2E9JA 5IOPA 4M6MH 3CK0L 1B3JA 4LAQL 3UDWA 3RI5F 2IPUG 4WGVB 2VR4A 4ALAH 6FABH 5I8CB 4BK5A 2ESVA 3OL2A 2XA3A 3PXJA 1K8DB 3S34L 4PG2C 3VXME 5C09D 4PGBB 4C57C 1BIIB 1GZPA 4R4NC 2IADA 4FA8A 1K85A 5DMIL 3DX6B 4MCZA 1U8KA 4N0UE 1NJ9A 5E2UL 4FP8H 4J3WA 3U7WH 1B9ZA 1DN0B 4PJ8C 4YPGB 2DTMH 1R3KB 3HC4L 4QOKA 1QSFA 5I8EA 3FRUA 3QUYC 4MNGA 3SN6N 2XY2A 3WHXA 4OIAA 1MAMH 5LXGL 4MXVF 1D5ZB 1KENH 3UTQA 2R1XA 3EZ8A 4XB8A 5TE6L 2W0PA 2QHRH 5CLWA 5JHLH 1ZE3C 1TPXB 3CSGA 1HZHL 4HWZA 3O6LH 1ES0B 3UAJD 5FCUH 2HKHL 3KXFA 1N0XL 4P2RE 3FB7A 4NO3A 2DMBA 1DLFL 5JORA 2O61B 1BZQK 3MCKA 1C8PA 2R1YB 2VDQL 4RBPH 4OZFG 5DJZB 3Q3GB 1Q0YH 1TCRB 3QFJA 3BDXA 3RUGE 1DTUA 43C9B 5IF0B 4HEPG 4X6CE 3BP6B 4X5XB 5E9DE 1J0HA 2YWZA 3VXMB 2GJ6A 3JTSB 3OKMB 2C1PA 5DJ6B 4MJIA 4OLUL 3BYYA 4GG6B 5CEZD 3VFWA 2CO7B 5CJOH 3SDYL 2ICWB 3Q5OA 4TSCL 3QWQB 3HE6C 2ZUYA 4M7LH 1I1AB 3VFGL 2BNQD 5DD3H 3NAAH 4ZSOA 3DXAA 4TSAH 1P7QD 2X4PA 4R26L 4GKSB 2BY1A 1G7HA 5C08A 3S3JA 2Y06H 3FOMB 4D9QE 3KJ6H 3GJFA 2NY4C 3BQUB 3C5ZC 3EDEA 4ZDHA 5T3XH 4ZD3H 3A67H 4N5EC 1NEZB 5GGTL 2CSPA 4FQLL 3BIKA 5EZJB 3PQYA 1BOGA 4W4NA 1T2QL 3U9UB 5JW4Q 1F4XH 1S9VB 5BV7B 5GS2D 2AK1L 2QQNH 3HPJA 2Y25A 1JGUL 4W68A 4NNPH 5H94A 2NCMA 2HKFL 1JNNL 1OP3H 4IEFB 3HS0B 5H2BB 1I85A 4LLUB 4IIQA 5CILL 3NIFF 4M62H 1UWGH 4OF7A 4M1CD 3ARPA 3NGBB 5B3JF 1PAMA 1I1YA 1VFUA 4GAYB 4F2MA 1MCIA 3PWVB 5MP6L 1XCQA 4NGHL 3X12A 4XCFH 4PRPE 1T21A 4LLQB 5L0QB 3A6OA 1TIUA 5DJDA 1RHHB 3PF2A 4YLQT 3GUTA 3LRSA 4DJMA 2A73B 3MRJB 4LFHD 3QPXH 2ICEA 3MRKB 1QRNE 4G9FA 1GC1H 1JYVA 4LBEB 4NO2B 1C7TA 5LGHL 1J1XL 2AJZA 2ZSVB 4JZJA 3UP1A 2EYRA 4L9LA 3UO1L 4BZ2L 1UQSB 2QSQA 2V5RA 2W9EH 4YK4B 2PYFB 4K3DH 5I0DA 5E8NB 4Q0XL 4KUZL 5ILTL 3U46B 1UXSA 3CSYA 4M7ZC 3NH7H 5EBWB 1QG3A 4BM7A 2YEZA 3ARFB 4Z7WF 4XPHL 1A22B 5ADPL 1JE6A 3ARUA 1KB5A 3B2UC 1ITBB 5KVGH 4P2QB 3JV6A 4KQ3L 4R0LC 5FIEA 3SGKA 3UAJC 5DJXB 3HUJF 3KVQA 3I02A 5T5NF 3B5GA 4Q9CA 5HVHB 4PJXF 3TA3B 3FT3B 1U8MB 1AXSB 2I07B 5FYLE 2VDKL 4PJ9B 3HZVB 4QHKI 1YEIH 3TN0B 1MPAL 3QHFL 5JOPE 2UZYB 1QHPA 4P2OB 4RAHA 3L9RA 4NNXA 5EN2A 3EYUL 4EBQL 4U1GC 4LKXB 3TO4D 2LVEA 3I3BA 3SDAA 4PP2A 4MAYD 3VRJB 4PGEA 1PEZA 3RWJB 5J12C 1VFOA 1C7SA 4DVRL 1OY3B 3AM8A 2VAAA 4PFEA 3RY6A 1XGQB 3HI1B 5I74C 4U05A 4EIGB 3IFOA 1D5MA 3MLRH 1CDHA 2HN7B 3IDNB 1CLZH 1NCAH 4HXBH 4K3EL 3FN0L 5FGSA 1AC0A 4Q9RL 4PLNC 4FFWC 5KG9A 4K07A 3UTSE 5FUCC 2X1WL 4NFDA 1E4WH 1VEOA 2Z93A 2EO9A 1BAFL 1UJTA 4PJGF 1L7TH 3VE0A 1BQHB 3FRUB 5D5MB 1A8JH 5C92A 5FEBA 5D1XB 5EU6D 3ZLQC 4EXKA 5LGJA 1FBIH 5DJCA 4U1IA 5D71H 2R8SH 3TIDA 4NFBA 4NPYA 3BRGC 4TVPL 2V2TB 4HWBL 4YXHH 2R0ZH 4PY8J 4KTDL 4NQVB 4NN7C 3PWPB 1RU9L 3SEPA 4V1DE 5I66B 1ONQB 3G6DH 3PWNB 4JDZA 3FQRA 4PJAF 1G7QB 4CU7A 3GMOB 4WNQB 4M1CC 5LAXB 4GAJL 4LASH 1EBAA 4KJWD 3KR3L 1N2RB 3MRHA 3CFJB 3ZDYF 3MRNB 4URTB 4HS3B 2ZWLT 2D7TL 2OCFD 4Y1AA 3TWCL 4JFXB 1M7DA 4OI9A 1WFOA 5JUEL 2FZ3A 1IEAB 3FMGH 5KSBE 3VXRB 3REWB 2V5SA 1GAFH 2DQFA 2YRPA 1JPSL 5C0CD 3O4OC 1OGAD 1YY8A 4MZ2A 5TF0A 4BZ1L 2ZP0T 2W07A 3OPZL 5EWIH 4XCYA 5KN5B 4JFZH 1IC7H 5BQ7A 5DT1L 5IGXH 1U6AL 1EFXA 4BSWB 2JJSA 4ELMA 5KSAB 5HYSB 3MUGB 5C7XH 1MIMH 2VNCA 1KCSH 1BM3L 2EDEA 3CVIH 5D7JA 4JRYE 1WCBA 2HFEA 4LSVH 2DQHL 4V1DB 2EIEA 3BXNB 4HPOL 4PJ8B 4G43B 3O41B 3NCJH 4I48B 4P23D 4XVSL 1FO0A 3IDUA 3V4VL 1KUMA 1XCTA 4IS6A 4FN0A 3QDJE 2CIIB 3R06B 1X5AA 3KDMB 4GQ9L 4F33B 1WLHA 3QB7C 5FYKH 3DJ9A 1AD0A 5F6HI 4FFYL 5KBNC 3MODL 4J2XA 3RPKA 4PV9B 1TZGL 3G6JE 3IFLL 2EIBA 2NTFB 5KVEL 3O2DL 4R2GD 3TO4C 5J13C 1TTFA 3BJLA 4P5KA 4MAYC 2VZ1A 4F8TA 2HH0L 5GJTL 3OKLA 3EOBA 2LU7A 3LH2L 5F9WC 5CHNB 2AS5M 3QCTL 4NYLB 3VXTB 2KUTA 4RA3A 4D9RD 4KI5D 4XPGH 5C0AE 5FGBA 4JO3H 1NC4D 1K3IA 4BSJA 3MLXL 3MA7B 4MNQA 2WUCH 4D8PB 3WFDL 3F7VA 5GJSL 1MCNA 3LSOB 5IBTH 4HS6B 5KVFL 1WF5A 3QIBB 2BSED 2F19L 2H45A 2OSLA 2I9LB 2EEBA 2QKIA 5F88B 1P69B 4AIXA 4PR5A 2YBRB 5C09E 1SY6H 5ICYA 5F7EH 2CO6B 1I7UA 3NZ8A 5EOTA 2V17L 1QLFA 3BGFB 4PTTB 4S1SL 5E2TH 2NY4B 5DRNB 4R7NB 1JGVH 3C5ZB 4WGWB 4GW4A 3RL1B 1MFDL 1DBKL 5TQ0H 3V0WL 3HMXA 1AKJD 3MJ8A 1P4LB 4YX2L 5ABDE 1MELA 3MOQA 4QXUH 4KVNH 5KOVC 3MRFA 2DL2A 2AJXH 5INDA 3LS4H 3RRQA 1VB9A 4KJWC 5ADOL 4ERSH 1ADQA 3QO1A 3DX7A 2NY6D 1HXMB 4ODBD 1AD9B 3S5LG 1R3HA 3F12A 4YHNA 1BX2B 5IHZB 5F1IB 3DUUB 5C0AB 3W2DH 2IQAB 1A5FL 1T4KA 1JTPA 5EZLA 3E3QC 3DV6B 4JRXE 4PJFE 2HJKB 5BS0A 3QG6B 5A1AA 1T0MB 2XZCL 4ZAKD 1TETL 2R2EA 2XZAH 2BSSB 2X4OA 1NANH 1KF9B 3BZFA 2XOTA 4KMLB 5MEQA 4CU8A 4NQDA 5CBEA 3L3JA 1JHLH 5SWSA 4DKDC 1JZ4A 1MVUB 1YEKL 5CEZE 1I3VA 5JIHA 1YEJH 2WINB 2VLLB 2LE9A 3TYGL 3GSQB 1QLRB 4L4TB 5KSVA 2ZCHH 3TPUB 1CU4L 5B8CB 4XBGB 4P23C 2BNQE 3IT8D 1A3LH 5LWYL 2WZPD 3LD8B 3HB3D 1QSEA 3MUHL 4LSPL 5HGDB 4FQ2H 3DBXB 2BHZA 3WIHL 2ZG2A 4FMFA 2PO6A 5FUCE 3AU1B 4S2SB 5I1HL 1VKXA 1S7UB 2OJZL 5E4IA 3S35H 1AO7A 1UVQB 3DSFH 3OKEA 4R0LB 1A7QH 1YN6A 4OLWH 3C2SA 4ZFZA 1WFNA 3IDGA 4XC3H 4ZO7A 5JOFB 1DQQB 4N1EA 2EH7H 1E4XH 5KVMC 2K9UA 4X4MA 5CEYB 1NFDE 4UNTA 1FDLH 3CZJA 3NBNA 4PJ7F 3T77B 4JKPH 1RD6A 4BFIA 3EBAA 2NY1B 4FQJH 4KI5C 4RBPK 2Q8AL 2IH1A 1JK8B 3QQ9C 4U1GB 2HJFA 2VAJA 3O11B 3FB6B 3FFDA 3QH3A 5KTEL 5IVNA 2VE6A 1T1XB 5HYJA 3H42L 4HKBB 3BPNB 4RFNC 5FF6A 1IM9D 4AM0B 4W6XB 3HRPA 4XPTL 5I74B 3CFKB 1U3JA 4KKLD 1S7QA 2ICCA 5DS8B 4P57B 2BNQB 1FNHA 4JKWA 1VACB 2P5EA 4WI5A 3QNYB 1P7QB 3SGJA 1EAPA 3U36B 4O4YL 1CFSA 3ZE2F 3V4UH 2NX5A 2P5WD 1AXTH 5GRYA 4WI6A 2YXFA 3ARRA 4JB9H 3DARA 4Z7WB 2GUOA 2Z92B 2EE6A 5BZWA 5F6IC 3SGDI 5HYQA 3MRPA 4WJ5B 3GBNH 1ZLUH 3G6AB 4WW1A 4GRMB 1JN6A 4Z7QE 3L3IA 5I1CH 5JXEC 4PJXB 1UH2A 4HQQL 1OGTB 3IDXH 2NY6C 4NN7B 1KPUA 3WKNA 5GGTA 1BZ7B 3P0VL 1M4KA 4O58L 4TRPH 5DUBA 5TDNA 1ZANH 2C4XA 2OP4H 1IT9H 1OP3K 4M8VA 3LMJH 4IRJA 1O7VA 5HBBA 4K7PL 5D1QB 1CE6B 1UENA 4HBQA 2YXMA 3WMSA 4YBLC 2IALA 4LCWD 4ZAKC 5SWQA 4KJYB 4QKXB 1DBJH 1M6OA 4LSRL 4H1LG 2P42B 3B6SA 4HUWB 2JF1A 3G5VB 3VGGA 3QSKB 5F7DA 5IB1B 1VHPA 2KQMA 3WXVL 1HINL 1PLGH 1BBJA 3BE1H 4DGVH 5CZVL 4YDVA 2A38A 3KPNA 1T20B 2D31B 1VADA 5MERA 4WW2F 1EO7A 1GGUA 3OR7B 4M48L 4RGMB 3MBXH 1JP5A 5BW7A 2FIKA 3HB3C 4YAQA 3QT2A 1MHCB 2YR3A 2XN9A 1BECA 1Q72H 3TGXA 1C08A 5DRZB 3ARZA 5IJKC 1Z9MA 1YPZF 3NTCH 4LCYB 4K7FA 3UBXI 3MLYL 4IRSD 1YNTA 3DVGA 5K33A 3H7BA 3X14B 1FFPB 3DMMC 3NFPB 2HFGH 3VFPA 2W1NA 1S9WB 4BSVA 5FYLL 2ADIB 3S5LA 3HAEG 1KIRA 1P6FA 4UZGA 3VWJD 4UINH 4L8CB 4OUUA 5BRZD 4F7EB 3OJDB 4ZUUB 2ZCKH 5JLZB 2VDMH 9CGTA 1H8OA 1ZHNA 5IG7A 3CH8A 1IGIH 1GGCL 4Z0BH 2FX8L 3S96B 3HNSL 1B0RA 3U0TA 1YA5A 5J13B 3OKOB 4MAYB 1NAMB 1L7IL 3GSVB 2F74A 4QHNB 4NQCA 4CGTA 5CWSA 3CVHL 4HT1L 1ERNA 2WWMD 3UJJL 3VXNB 1GC1C 1V05A 5F9WB 1D3CA 4FMKA 4PJDE 1KLGB 1X9QA 4MDJA 3NFSL 1RZ7H 5GS3A 3OKKB 3QDMD 4NBXB 2P47B 3UPRB 5C0CE 3D18A 3OB8A 1OGAE 2AEQL 1AGBA 4WCYL 3SGEH 1WAAF 4NQEE 4HJJL 4ONGH 5DI8B 4LNRA 5C9JB 3RA7L 3MFGB 5DWUL 5MENE 1RUPL 1CGUA 3GJEA 4L5FL 5E6ZA 4FQXA 3RIFK 4ETYA 4X6DA 5I71C 2PF6A 1FNGB 4L8DB 1YN7A 4HXAL 4WU7A 4WFHD 3U7YL 5EU6B 4QWWD 1DUZB 1HOCB 2OM5A 1UZ6F 1N8ZA 3I84A 4YIQB 1DZBA 4YUEH 3EYFB 5DQDL 4YHOL 2C9AA 2Y36L 2O5YH 1EHXA 3Q0HA 2X4UB 3BZ4A 2R69H 1WGOA 4FFZL 1CT8A 3GSXA 4X7TA 2Z4QB 4YGAB 4XT1C 1MCSA 2D9CA 5C71A 4CMMB 1LP9E 5F96H 1ACYL 4YDJB 5J1AB 4PGCA 3K1DA 5C0IA 2CRIA 3QEQA 5A2KH 1WEJH 4IOFD 5EU5B 2XKNB 3BISA 2QSVA 4HIJA 1WWCA 2Q3ZA 4I3SH 5EPMA 1T1ZB 4X9FA 3WN5B 5C0FA 2ADJB 5DJ8B 2VC2L 4OLEA 2I24N 5C0CB 1YMMB 5EIVA 4U1SB 3IJHB 4KHXH 4XCCH 2H26B 4QT5B 4Y4KD 2DWEA 2VERN 1H3GA 4D9LH 5L9DL 1MCPH 1F58L 5F7YC 1NMAL 4TTDD 4OZIE 3SE8H 3SO3C 4D9RE 3VGAC 5KW9H 3B2VL 3U2SB 2ZCLL 3RPIB 1KJ2H 3M17B 4XCEB 1P7HL 1QFWH 4TNWK 4AIZA 1NC2A 4I5BB 3L1OH 5IB2A 3FQWB 3QCVH 3T08A 2RR3A 4K71C 5FUOH 3W9EB 2YD7A 1WBYA 2V9TA 4IRSC 5LCVL 2R1WA 2BJML 2BC4B 1DSFH 1JPST 2R39A 2NMSA 5GQBA 4P23B 2AEPH 2A6JB 3G5XA 3T0EE 4OZGF 4M9OA 4S10A 4GQPH 4JREC 2F5BH 2XG4A 3KAAA 3VWJC 1CD9B 3KYMA 3ZE1E 4P48A 1A14H 3C9NB 3MLUL 5IT2L 1OWRM 1EJOL 3K2MC 4MHHG 1C5DB 5GRXG 3TT1H 4R2GB 3SDCD 2AK4E 1MCQA 2VDRH 3B8SA 1PD6A 4JKMA 5ESQB 4YEFA 4A6YH 1RK0A 3KPRD 2WBJD 2WWMC 1EERB 1NUDA 3H3PH 2AJ3B 3IYLW 2NY0D 3C8HA 5DHYA 3P11H 2Z31B 3TM6A 3O2DA 1NC4B 3FRPA 1Q94A 2VH5L 5FO7A 3BZDA 4M93C 4OZHF 4EDXB 1JBJA 3V52H 5HHPB 2CDFA 4OF6A 3FTGA 4WDIB 2EDKA 1OP9A 2IG2L 3PGDB 1TNMA 4TOYH 1AJ7H 5CUSH 4U2ZA 2FATL 3ROLB 2D2OA 3IGAB 3QP3A 1MRFH 4QWWC 2B5IB 3TBWB 1Z0MA 4PB0H 1E28B 1ZVSB 2I5YH 4HJ0D 2PW1A 5I8CA 5TPWH 2BHYA 1AR2A 3WFBL 1QP1A 3VRIA 1H15B 3VA2C 3HAEA 4L29A 1I8MA 1AKJB 1KEML 4YHYC 3SPVB 5F6IB 3DX6A 3L5WA 4EVNB 4OCNC 3MV7A 3M45A 5ECJE 4UT9L 1UFUA 2FB4H 2ADGA 4MXWH 3C2AH 4DW2H 2RB8A 4JFDA 5KS9E 2ICWJ 1PZUB 1X7QB 2F58L 1CLYL 4IOFC 4JVUA 2RFXB 4EDWH 3QQ4B 5C0EB 2VDPL 4RGNE 4FQCH 1E4JA 4KDTC 2X1QA 3KPMB 2OXHA 1U0QA 3B83A 4ODUB 4YBLB 4CDGC 1SBBA 4G80A 3VXSB 4TSBL 3DHMA 4Y4KC 4ZAKB 1KLUA 4OB5H 2VQTA 2B0SH 3U30C 4TTDC 1KIPA 4YHPA 2YA0A 3H0TB 5I1EL 3KLDA 3K46A 2O61A 4I0PD 3RL2B 1H3TA 2DM7A 5DJZA 4X5WA 2Q6WB 5CEZL 4AG4H 3PJSA 5GISH 2J6EA 3S36H 3W39B 1OT2A 4P4RB 1NBVH 4UUJB 3IU4L 3VXMA 4XC1H 2F8VA 2OTWA 3ARBB 1NMBH 3KS0H 4FXGB 2CJUL 2GT9B 4KXZI 1QSZA 1U8OB 2GFBA 4JO1L 1INEH 5E70A 5L7XH 1CXHA 4N0UA 2JCCB 4NN6B 2AJSH 2LAAA 3D48R 2OR7A 1G0XA 3EZJB 4YHKH 2P5WE 3VFVA 5M94B 1ITCA 1FPTH 4UOW1 4WFFD 3GI9H 5CMAB 5HI5D 3BKJL 2BXYA 1W0VA 4GKSA 3AMLA 5IB5A 4GSDH 4JY4B 3WIHA 3SDCC 5L88L 3RDTD 1C5BL 2P8PB 5DSCB 1PZ5B 1J0YA 2WBJC 4LSUH 4NM4H 4P2RA 3U9UA 1T7VA 4OAWB 2NY0C 1FH5H 2Q7YB 4OKVB 4E41B 2E5EA 4JHWL 1EXUB 3RWIB 4MA1B 4N9OB 1KELH 4WFEE 4X6FA 3RUGA 3DX8B 4R4BB 4LLUA 1J87A 1R3JA 4JY6B 4X6CA 5E9DA 1MRCL 2NQCA 4LCWE 2V7HA 4XMLL 4I8DA 2XNAA 2ICES 1NGXA 5I0ZA 3N06B 4UDTB 4GAYA 1T1WA 5IUSA 2ZJSH 1SEQL 4OM1H 1XF2A 1QHOA 4QHUB 4BFBD 1DQML 2VLKE 4HJ0C 2AEIT 2P5WB 3V5KA 1QNZH 4JQIL 5CIPB 1NCCH 3U4AA 5JW4N 5EU4A 3CXDH 1H3XA 3BUTA 4I9WD 5I71B 3MRKA 3EJZC 5K9KA 3SDXE 5FHBL 2KH2B 4ODWB 1MJ8L 3MRMB 1A2YB 2ZSVA 3LIZL 3X17A 1A64A 1HEZB 2JIXB 4HWNA 5JDSB 4J1UB 1Q38A 1ZKAA 3RNKA 3OF6A 4HCRL 1U8HB 1V7NL 5E8NA 4G8FB 3WJLA 1EX0A 1ZLUK 1FNSL 4OGXH 1CFVL 4XXDB 4DN4L 3ABZA 1DLHA 1RIHL 3K2UL 5FO8A 4ZQKB 1WFTA 2DS4A 2R23A 3ECBB 2AQ3A 1D5IH 3PNWA 2VXQH 1Z9SA 3QPQD 4J6RL 2BCKB 1D5BB 3ZKQD 4LCWB 2EICA 3BDBA 3WBDA 5BRZE 2R2BB 1KN2H 3O6KL 3C5JA 2GITB 1ZA3A 2IBZY 2J8UE 4Z0XA 1KG0A 2AVGA 1W8OA 1NAML 1LO2H 3A6CH 4PRPA 4PJ9A 1MLBB 1Z5LA 5FYJU 2R4RL 2F5AL 3HZVA 1HQRA 8FABB 1KPVB 3TN0A 1I1FB 1JTTA 5DMKA 1Q9LA 1U8LB 4FQIL 1DL7L 3HTLX 4Z78A 1UWEL 1G7MA 5CKAA 1QRNA 2H32H 3SE3A 1I3RA 3VRJA 1UZ8B 2D03H 3D3VD 4KRPD 5HDOA 1JGEB 5I1KL 2WP3O 5DEGB 3WLBB 1XGQA 1RFDH 4H88L 1T03H 4JQXC 5F7WC 3IDNA 4IRSB 4Y8DC 2YC1B 3TZVA 1UA6L 2UWEE 5HI5C 4PJCF 5K9QG 4Q2ZB 4O9HH 4E9LA 3EIFA 3O3EA 3JVGA 3KHOA 4WFHE 2G5BA 2MKLC 3RDTC 4JREB 5FK9B 1KTKE 5HGAA 3VWJB 3GSRA 5BRZB 2ZUSA 1SMOA 1P4IH 3F7PC 2F54B 1T1YA 1FE8L 4M61B 3BVNB 5FYKE 5ICXA 1MY7A 4OIBA 3ZZ1A 4HGWB 4NNYB 3T2PA 1HH6B 3LEYH 4ZOEA 2NY2D 4DQOH 1BQUA 4NQVA 3UZEA 3BPLB 1SJEB 5GGRA 3PHQB 4U6HB 4ONFL 4WI2A 3T1WA 3ARQA 4KK5D 1JFQL 2QJDA 3MTRA 5D7LB 4WNQA 5F72S 1LK3L 4NJ9L 5DGRA 1U8JB 1D9KC 4LLDB 4RZCB 3QDMB 1R24A 2VUYA 4YHMH 3IVKA 3CFIC 5IMLB 4G7VH 3CVHA 1HKLL 3HMWL 1MAJA 5DJ0A 1G6VK 3FZUC 4C56D 1RULL 3MMEB 5K9JH 5TE4L 3C6LB 2R0LL 2MNUA 4P3CL 5EZOH 3UTSA 2BNUB 5E5UB 2IANE 3ZSSA 4LP5A 4G5ZH 4ZUVA 1CL7I 4EKXA 1Q9WB 4ELKB 4M7KH 1BJ8A 4QXTB 5BMFL 4PG2A 4YQXH 4BSWA 3PL6D 5CSBA 5HYSA 1N6QL 3MUGA 1UT9A 4YHYB 4XBEL 2NY3D 2VDLH 1N3NB 1QOKA 4EIZC 4V1DA 4PRNB 4PJ8A 3VI4E 1AHWA 2BY0A 4YDKL 4DN3H 3QUYA 3STZB 2IQ9H 3MBEB 4WEMB 3ULVF 4PLOB 1S5IL 3OJVC 4V2CB 4ZXBD 2DYPD 3KDMA 5T33L 1FAKT 4DK6A 1RUKH 4XCNA 4AL8H 4M6ML 3TNNB 1Q9KB 2R29H 4XRCB 4Y4KB 3W82A 4OZHB 5KSBA 5D7KE 3KPRE 4PV9A 6FABL 4F9PA 5TH2B 2NTFA 1BHGA 1F3DJ 4NRZA 4Y19D 1FLRH 5CSZA 4KRPC 5DD0L 4APQC 1K9TA 1XGTA 2NY5C 5MEOA 3I3DA 5E99H 4GKZA 5CGYC 3CFDB 1Q9OB 4JPIA 3WYRA 1I4FA 2ZOLB 3AMKA 3RNQA 1Y18A 4NQTA 4JRYA 3OB0K 2CLVB 1P1ZB 2R4SH 2CLRB 5E6ID 4FTVB 2Y6SD 4HS6A 1CFBA 3IXTA 1MCWW 3HE6A 1LO0L 3QBTB 1FJ1B 5JHLL 2DM2A 5F88A 3W0WE 1H5BC 2YBRA 4KVCH 4WFGD 3O6LL 2V9QA 2EYSA 1RZKH 3WEXB 4Q97A 3QDJA 2CUMA 3K8KA 2E7LC 2FWOB 3D0VB 4PTTA 1QKZL 3VGEA 3C5SA 4DEPB 4RSVA 3C5ZA 2NY2C 1CXFA 4CDHA 1A6UL 3WL9B 3VXPB 4G6KL 4NQSB 2WIIB 4PG9B 1P4LA 4GMTH 4MDIB 4KK5C 2WBJB 3G6JA 5IFJA 4IDJL 1Q0YL 4PBXA 4AH2A 1UB6B 4ZFOB 2NY0B 4UT7H 4KZEL 4OZFH 1NGYB 1T7XA 3IDMB 4M9PA 3WUZA 5FM4A 3VG9B 4MXQD 3JWDC 1Q8MA 3CPLB 5I17A 3ARYA 2HVJB 3ELAT 5EIIB 4NWUL 1A1OA 3HE7D 4FNLL 5FB8B 5IHZA 4NWTL 1BF8A 1KCKA 4PJHE 3DUUA 3F7QA 5CJOL 5C0AA 5JXAH 1YECH 2E9BA 1RMFH 1FNFA 1KT2A 3I75A 1G9NL 2KPNA 2OXGA 5AG8A 1CGTA 5D7IB 4F15C 2HJKA 5D70H 2B4CH 1T0MA 4TSAL 1KXTB 4LPXA 3CSBA 2Y06L 3QQ3A 4M5ZH 25C8H 4TNVF 4LHUD 3G9AB 4L4VB 3KJ6L 5HPMB 1ND0A 4ZFGH 1ZWIA 4G42B 2SEBA 1QBAA 4OFDA 1SBSH 2QQLL 4ZD3L 3PL6C 1VFAB 3NN8A 5C09A 4M1DH 1EHNA 3BPCA 1NCDL 4ZS7L 3GSWB 4IHOA 5JHDD 1NKOA 1MVUA 5E7BA 1OM3H 3LPGA 3H9HB 4M43H 2QQNL 5DHVH 5EU3B 3BPOB 1KCRL 2IAMA 2XWBA 4MQTB 4O2FB 3T65A 4WFFE 5HI3D 4BZYA 2BRQA 1R5IA 1MJUH 1HILB 5AG9A 3TFKD 4ZXBC 4M62L 1UWGL 2XPGA 4WI3A 3TJEL 5CBAB 4HF5L 4LU5L 4QO1A 5DDHB 4R0LA 4OLVH 1XGRA 4H26B 3SE9H 1G1YA 2VUOA 5J57B 3VI3E 1BJMA 2IBBA 4Q9QH 5JOFA 1DQQA 5A3ID 2XTLA 4AEIH 1SJXA 4JRXA 2NYYD 4PJFA 3PV6B 4I0PB 2EEAA 4R8WL 4JJ5B 5GGQH 2G60H 1WZ1H 1OHQA 3T3MF 1GC1L 1S7RB 4MLIA 4JGUA 3RWFB 3NCYP 4QTIH 2QQKH 4YO0B 3DOSA 1KC5H 1ORSA 2W9EL 4K3DL 2XZZA 2YOCA 4KMTH 5BJTB 1NH6A 2MCPH 1FZMB 5EORH 5GGRY 4YFLI 5DJAB 5E6IC 1RIVL 4AM0A 5BXFB 2Y6SC 3TV3H 2OZ4L 1AE6H 3VDAA 4NRYA 5DS8A 2BNQA 4ONHB 5C6TH 5KVGL 2FDBP 2A74A 1ZHLA 1K2DA 4I9WE 4MXVE 4NKDB 1QSFD 3V4PH 4YWGL 2CH8A 5IFAH 1YEGH 1CS6A 3E6FB 4XNZB 3TCXA 1MJJB 1OT1A 3ZMRA 2B1AL 1JWUA 4N8VG 3MGTA 3FB5A 3RDTB 1I1CA 4B53A 5CINL 3J8F7 3IF1B 2WANA 2YD6A 3EW3B 1KTLA 4NC1C 2IBZX 5SWZD 2VL5B 1YEIL 2P48B 4ZPVA 4MSWB 2WP3T 3BT2L 4G9DB 4HKXA 4WJ5A 1NLDH 1NFDA 4C4KO 3WUWB 3WXWL 3KXFD 4MXQC 5HJ3A 3V6FB 5IQ7L 4RNRB 3P77B 5DYOB 4WHTA 4QYOB 3C8DA 3GRWL 3VFUA 3NCYS 1LE9B 1HXYB 3MYZA 2XFXB 3MLRL 1NCAL 4ETQB 3QHZH 2CK2A 2JKXA 1AIFA 2FYYB 1UJ3C 1LQSR 1UACL 1E4WL 1WQVT 2JB6B 2HG5A 4HUWA 2BVQB 3G5VA 5B38A 3IAGC 3LKSB 3DWTA 3RTQC 4AQOA 1QO3B 2HLAB 3CX5K 4LARH 3LN9A 1FGNH 1FBIL 4ZTOH 2GCYB 4Z76A 4PYHA 5C08D 3HPLB 2YUWA 4YXHL 4HUVB 4TUKH 3ALWA 1FFQA 1S9YA 3IAQA 5I76B 4XPBH 2DBLH 3KLHD 5HI3C 1I9EA 1OTTD 4K94L 1PG7X 5EO9A 2DLTA 3TFKC 4XPFH 4LASL 2ZUQB 3KPQB 1JF5A 4LMQI 5F9OL 4YHZH 3HZKB 1NFIB 3EDFA 3N85H 1MWAB 3HN3A 1X5GA 1RK1B 3PABB 2OL3B 1QFPA 1ZLVH 5C0RL 3V79C 3NIFE 1S5HA 1S9WA 1UADC 4GJTB 5A3IC 3U4BH 3PWUB 4DGYH 1ODAA 3FMGL 2JJWA 4M6OH 2NYYC 4LLYB 5DK3A 5IK3B 1T80A 4XTRD 4GG8A 1W8NA 4OCYL 4ZOBA 1OSPH 4L8CA 2AKRB 4ZUUA 1ZA6B 3H6JA 5JLZA 1YYLL 2E7CA 5HHXH 2VWEE 2MFNA 3UDWC 3QJFA 3T4AB 1MI5D 3VFMA 3S96A 3TO2B 2PN5A 3QXVA 5AUMA 5KJRH 3DRQB 3Q6FB 3QXTA 2VXTL 3TO4A 2B2XL 4ZNEE 3FHAA 3D3VB 1A6ZA 3GSVA 1HHHA 5C0BE 5C7XL 4JFPB 1MIML 3VXNA 2HRPL 1KCSL 3IKKA 4K9EH 3SGDH 4M1GH 1KLGA 2X4NB 1S7WA 3HI5H 5IVXB 3TPKA 5C3LD 3ARED 3RVWD 1T3FB 5I9QC 3NCJL 2C3GA 3R8QA 1FYHB 1R3IL 4XBPA 32C2B 5L2KE 3BKMH 3DTXA 5IR1A 1TXKA 3CDGA 5CFHA 4HIIA 1N59B 1SJHA 1MEXH 4HGKC 1H5BB 2X9YA 5JTWA 4ODHH 3E6HB 1D6VH 1C12B 2V7NA 3P0YH 4YDIH 4XP4L 2VABA 3EYFA 4KFZC 2HT4D 4JDTH 2X4RB 5I73C 3LPFA 2C3WA 3PHOB 2NW2A 3D1MC 3IKCA 3BKCL 2W38A 4PJ5E 1S7XA 5HY9B 4H0IA 4IMKC 4NKOB 1EGJA 1NCTA 2WUCL 4PJDA 2XKNA 5GGSA 4OT1H 3FT4A 3LQAC 3WNMA 1DQLL 1T1ZA 5IBTL 4C56B 4GRWF 2UVFA 4JDVA 1A6PA 5C0CA 4Z77A 1OGAA 3L5JA 4U1SA 3IJHA 2W65B 4Q58C 4NQEA 4Y19E 4Y16B 1SY6L 4HGMA 2QADD 5MENA 1MNUH 4HH9B 1JGVL 4NRXA 5ESVA 2XRAL 4B7LA 3RPIA 3PL6B 5I8KL 2Q86A 3KLHC 4QCIB 1OTTC 3FQWA 5IM7B 3BRFA 1B4JH 4Q74A 2H9GB 4MLSA 3I9GH 2AJXL 4XX1G 1CG9A 2LTQC 1P5VA 2NY3B 3LS4L 4EUPH 1YEFH 3LDBC 3R8BB 1I3GL 5A16A 3IETA 1HH9B 4P23A 4PJAE 2LU3A 3U79A 1LP9A 3NIGE 1Q1JL 5C86A 2ADFH 4PRHE 1P4BL 3H3KA 4DK3A 2DYPB 2CKBB 4JM2F 3ZDYE 1AR1D 4X98A 3P9MA 2OK0H 3HZMB 1I75A 1PEWA 1K8IB 4Z9KB 4NC1E 3BZEA 3MR9B 1C5DA 4Y1AD 3DIFB 2ZSWA 1YNLH 5GS0H 4Y19B 1XF5B 1IFHH 1A6WL 1BVLB 4DUWA 5HDQH 3BWAB 1IGFH 1JHLL 2APWA 5C1MB 4OZIA 3VGDA 1OVZA 3CCHA 1XR9B 1MUJA 3KLAB 4EZMA 3Q5YA 1AY1H 3R1GH 5JOEA 2A1WL 1T83C 3AREC 3RVWC 1RZFH 1LO5A 3MLTB 4GRLD 4QHLB 2ZCHL 1LK2A 4EDXA 1G7IA 3MGOA 4F58L 1ETZB 2F8XC 4FQ2L 5E6IB 3FT2B 1LDPH 3CGTA 5J4MA 3BIBX 4UTBH 2Z8RA 4LLMB 3S35L 1KFAL 3DSFL 2YZ1A 5IW6B 3T0EA 4JN2A 1GOFA 1A7PH 1E28A 5TDOB 3O9WD 4YDLC 5JHDE 3NCEB 2EH7L 2MJWA 3QDGD 1TJHL 3SY0A 3HCVA 2HT4C 3FO0L 2P45B 1CE1L 4WWID 3MYJA 4U31A 4I1NB 4P5TD 2M26A 2R0KL 2AK4A 2MOVA 5GHWH 3NZHH 5K93A 3MJ9H 3SE4C 5JXEA 4OSUL 4F9LC 1SYSB 1A3QA 2LFGA 1FZJB 1X7QA 3HE7B 4LGPB 2RFXA 3GMNB 4AYFA 2E9WA 2VITB 4WW2C 3KPPB 4QHKJ 2Y7QA 2N1KA 4K3HA 3GMPA 2KQNA 3A6BH 4ODUA 1K4DB 4Y2DD 5ISZD 4OM0H 2QQQA 2C3VB 5TF1L 4YFLF 4ZAKA 2Y23A 4GAGH 1NFKA 3SKMA 3BKYL 3X13A 1HKFA 2QADC 3QHTC 1M71B 1UJ3B 5FM5M 4KH2A 4MNQD 4LHUB 1T5XA 4P3DA 3GMLB 1A6TB 4AY0A 4JB9L 4XVJH 3RL2A 3VG0L 4C4KT 2GW5A 1CK0H 2XT1B 1OWWA 3JWOH 5GRJH 4NM8H 4U1JB 4RAUA 2CK0L 4ELMF 3TH4T 3VJ6B 5ITBL 5JHDB 3DGGB 2IBGA 3I2CH 1QPPA 3SQBA 3ALXA 3KWWB 4UUJA 4RQQB 2DTSA 1VGKB 3U48A 3CDCA 4U49A 3MV9D 1H0DA 5DJYB 3SBWC 3F7YA 3IDXL 3BH9B 4XI5D 4LLVB 5CKGA 2O26U 4H8WC 1V7ML 5EUOF 4JFHD 3D5OF 5F89B 4AIOA 1MCLA 4XH2B 4HC1L 4KDVA 5IJKA 3LMJL 4HK0A 1Y6NR 1AR1C 4RFOH 4S1RL 1MRDH 2V2WA 5KS9A 5J56B 4CMHB 2LABA 3EKCA 3WFEH 1ZGLB 1JF1A 4UIKH 1QBBA 1R5WA 1U8NA 3CLEH 3DMMA 4LVEA 4UQ2B 5ERWB 5SWZE 1BGXH 3IJSA 3CAFA 3QDHA 4ODSH 4U6YA 4E42A 5GS1C 1PZ5A 4CJ1A 3D9AH 2N7BA 3D85D 1XH3A 1A3RH 4U1KB 5KZCB 4DCQB 2B4CC 2PXYD 2FSEB 5JNYB 5IOPB 2GSIA 1J1PL 1PLGL 4DGVL 2Q7YA 4GXVH 2MQCA 2HMID 1A6VL 4B5EA 4GRLC 3DX8A 3LEVH 4YH6A 1F90L 1MCRA 2JJSC 1IM9A 4NQDD 3BP7A 2G9HA 5SWSD 1GZPB 4PTUA 5A43C 2IADB 1N5YH 4MA7H 3LHPH 2NR6C 2BK8A 4MCZB 1MCJA 5GGVL 2Y72A 1U8KB 2AEWA 1NJ9B 4JO4H 1GPOH 3DPBA 2OTUA 4G6JH 1IAKB 1QSFB 4KI1A 4QOKB 5I8EB 2HFGL 4XP5H 1GGYA 3O9WC 1PG7H 2P5WA 5GGSY 2YUZA 4MQXC 1QSED 5GGUA 3WHXB 3BI9X 3O6FA 4POZD 1UM6L 3KNBA 1ZLWH 5F3HA 5LG1A 4FOMA 3UTQB 2R1XB 5SWZB 1FORH 5DK0A 2PO6D 2VTFA 2VIRA 1J88A 2ZCKL 1WITA 1SVZA 4P5TC 4ODWA 3MRMA 1IGIL 1KGCD 2AJUH 2J3SA 3AFLA 1HEZA 4BQ8A 1MWAL 3KXFB 3X3GH 5JDSA 3N1PC 1ZGLM 3T04D 2OL3L 4PJ7E 1TFHA 3FB7B 3QULA 4NO3B 1CIDA 5JORB 3MCKB 3ZHKA 3FQTA 4U6VL 1SM3L 5AYUL 3ECBA 4NZUL 5JO5A 3QFJB 1FG2A 5F6HJ 3RAJL 4F37F 4Y2DC 2X4QB 4LCWA 1CR9H 2GJ6B 3RKPA 2R2BA 1X3DA 4KXZH 2VN4A 2ZKHH 2C1PB 1XFPA 4MJIB 4ONGL 3VXUE 5JA9A 4XNQA 3VFWB 3K81A 4TYUA 4XWGL 4UV7H 1WTLA 2NY5L 1KXQE 2VLKA 3RU8L 1KPVA 3OKDA 4MB4A 3ZE2E 4P3WA 5ELIA 1DR9A 4ZSOB 1U8LA 3INUH 2X4PB 1F6AA 2X70A 1G7HB 4YUEL 5C08B 1AI1H 1Y6MR 1MCWM 1UZ8A 3FJTA 4GBXA 4XI5C 4ZDHB 3SDXA 3REVB 2R69L 2G75A 1NUNB 3SQOH 5BZDB 1YYMH 4HWEL 3BIKB 3O0RH 2LTQB 1BOGB 2XZQH 2FECL 1HYSD 1VESA 1DANT 4IRSA 3LDBB 2YC1A 1UXWA 2JLLA 1W2KT 2VQUA 4X6EA 3HPJB 4N0YH 4Q2ZA 2NNAA 1JVKA 4BUGA 5FDWB 4R9HA 4IIQB 4D0CA 3MGAA 3IDJA 3VWJA 4IRJD 4AT6B 1KCUL 5BRZA 3V0AC 5E2WH 2ZG1A 2J8UA 1I1YB 2PXYC 1OAQH 3MOBL 4RWYH 4WWKC 4D9LL 3UZVB 4CVXA 1MI5B 2HMIC 3X12B 1T21B 3CX2A 4PJIE 1HH6A 4R96A 4U4BA 3JWDL 5DJDB 5EZIH 3SE8L 3TVMD 5KW9L 3PHQA 3HG1D 1NGQL 4R97B 1QFWL 2IF7A 5IHLB 3GUTB 4BQ6A 5F1KC 4LPWA 3LRSB 3LKPA 4XAKE 4ODVH 1I9JL 5CZXD 2ICEB 3QCVL 4G9FB 1U8JA 3TBVA 1FL6A 4F7PA 1OAXH 5FUOL 2A9NH 1YJDH 2AJZB 4JZJB 5AAWA 1DSFL 3ZKMC 2VLMD 1UB5A 1KULA 5K9OA 3T4YA 1UXSB 1J9CT 3CSYB 3MMEA 4POZC 2UWEA 1HWHB 3OAUH 5T5FL 3QEGH 3MX0A 3QWOA 5DUPH 2PO6C 3Q6GH 3MZTA 4I2XE 3HFML 4ZG1A 4AENB 1KB5B 8CGTA 5HHOE 2DQIH 3TP4A 3JV6B 1GGTA 2Z8WC 4YDLB 1BFSA 1UM4H 4HMEA 5T1MA 1KJMA 1FVEB 2BRRL 4QXTA 4UB0H 5C2BH 3BEWB 3ORJA 4Z95H 3WS3A 5HDBF 3VD3A 3NCFB 1FGVL 3ETBF 4LDLB 4GO6B 4U0RC 1N3NA 3GM8A 2UYLB 1V3JA 4FQHB 3WFZA 3FQXA 5HVGB 5GS0D 3RGVD 5EN2B 3L9RB 4NNXB 1GVIA 2O5ZH 3V7MA 1OF2A 3STZA 1CVSC 4NHCL 3SDAB 4PP2B 4N8CH 1J0JA 4PGEB 3V52L 4O02L 3AROA 2E27L 3D25A 1XIWA 4L3ED 4K9EC 4GKNA 4NQXA 4KDTA 2VAAB 1AJ7L 3WKMH 2VDNH 5E5RB 1XF4A 4P46A 5CJ8A 1M7IB 3IFOB 3CD4A 4ZO9A 3TNNA 1D5MB 1Q9KA 3OAYK 4KTEH 3FOLA 5F21B 4BA8A 4KTYA 3R0MA 2AI0L 3O3BA 1BD2E 2BSRA 2ORBL 2O5XL 2APVA 4JY5H 4K55A 1F42A 2Q8BH 1UZ6E 1PG7W 1SY6A 5FCSH 3KJ4B 1Q9OA 1HYSC 5DJCB 4U1IB 1T89C 1HHGA 4MXWL 3TIDB 1HIMH 4NPYB 4HUMB 2APXA 1F6FB 2OYPA 4OLYL 2XQBL 1S3KH 4EDWL 1C1EH 4YE4L 4JDZB 3FQRB 1KNOB 3SOBL 4WEBH 2DIJA 1YMHB 4TQEL 3VFNA 3QDGE 3T2NH 2BFVH 1WBZA 1C5CH 1YY9C 4MHHI 3PDGA 3D0VA 4MX7A 1MQKL 4Q7DA 4Y1AB 3THMH 5D2NC 1X4ZA 1M7DB 1RVFH 2JB5L 5GZND 3SDCA 3TVMC 5GS1B 2FZ3B 1SMAA 3ARXA 3DX9A 4KK6D 3VXPA 1RJLA 4NQSA 1ZHBB 2WIIA 4LF3B 4PG9A 2HFFA 2DQFB 3KPRA 4MDIA 1R5VA 4Z7VF 4AG4L 2WBJA 1TQCC 3D69A 4LPVA 5GISL 3S36L 5CZXC 5TFSL 1NBVL 1F4HA 1CL7H 2DBJA 1IZKA 4XCYB 5C70A 1RI8A 5BQ7B 2EO1A 1U95A 2HVJA 4LOUD 1HE7A 1J0ZA 5ISZE 1EFXB 4PB9H 5INCA 3I6KA 5BW7C 5ACMA 1NC2D 2ATPA 3OV6A 2CIKB 5IMMB 1MFBH 3T2QA 3KPSE 1CGSH 1XR8A 4YHKL 5D7JB 4NKIL 1WCBB 1FPTL 1T04A 2HFEB 4M03A 5JQHC 3RWEA 1B2WH 1N5AA 2ARJQ 3GJFH 4X6DF 5E2VH 2YMXL 2DMCA 3QYCA 1X5ZA 5HPMA 5L2JB 3MREB 4G42A 3QDGB 1XCTB 3W0WA 4NBZB 2FEDD 4IS6B 5LKNA 3C8KB 4Z18A 4MJ5A 3GBML 2DDQH 3MV9E 1AFVH 5JW4R 4NM4L 2PR4L 4P5TB 3VXOB 1T6VN 1FH5L 2X41A 3Q5TA 1EV2E 5GS0C 3RGVC 5DZLA 1ZTXH 4O2FA 3MJ6A 4OJFH 3OX8A 4CVWA 4P5KB 4X7DC 1IVLA 3IRZA 3EOBB 1UKTA 4JG1L 5CBAA 1T5WA 5DDHA 4GRWH 4OM1L 4QXGL 4FZ8L 4PJHA 1TJIH 5EOQH 4MNQB 1GZQA 4LCCA 1QNZL 1HSAA 1MCHA 1LO4L 43CAB 2WNGA 4EOWL 2A2QT 3TC9A 4BK4A 5B22A 4JG0H 1DQDH 2OSLB 1DVFD 1S7RA 1L9NA 2QKIB 4XZUA 4PR5B 4JPWH 4YO0A 5E24E 3NZ8B 2P44B 5JPMA 5EOTB 1QYGH 5IW1A 1CTOA 5JIIA 5GPRA 5BJTA 1FZMA 2J88H 2P8LB 1OB1A 2EDHA 3MJ8B 4LVNB 3WFCH 1FHGA 4JQXA 5A2IH 2J8HA 4OF3A 2YKLH 3MRFB 1II4E 2VXQL 1GGBH 1MIEL 5HVWA 5INDB 4YHIA 3MV7D 4MAUH 1CLOL 5I1AA 1KN2L 2E7BA 3AB0B 1IAIH 3DX7B 4JFDD 3X3FL 3F58H 4UTAL 4KV5F 1R3HB 5T5NG 3F12B 4YHNB 3RDTA 2NTSP 2HT2D 5E1HB 2Y07L 1R0AH 4KK6C 3IF1A 3AS2A 1U93B 1A0QL 4NO0A 4K8RH 1WK0A 2PXYB 2FD6H 5EZLB 5F7LB 3RZCD 4JFED 2EDFA 5BS0B 1RV6X 2NY7H 2X05A 4F80A 4OCXH 5D8JH 4AMKL 2X4OB 3DI3B 2D03L 4RNRA 4LOUC 4YEEA 3S3PA 4DGIH 5DYOA 3H9YA 2YD4A 4QYOA 5MEQB 3OXSA 5IWLA 3LQAL 4U1HA 4NQDB 5CBEB 1RFDL 3GO1H 5HHNA 3UJTH 5E03A 5SWSB 2RCSH 3FAXA 5AZ2L 1D9KA 5IP4A 2XFXA 3PG2A 3BMWA 4JPKL 1NMCC 5F9DC 3JZ7A 5KSVB 2KL6A 1BZ9B 4X4YA 4NP4L 1QSEB 3IS0X 3WIIH 4CN1A 1EFQA 2FEDC 3RWGA 1ZMYA 1IRAY 4EN3D 4TN9A 2PO6B 4PGDA 3STBA 2HLAA 4YZFE 2BVYA 1JZ2A 1M05A 1P6AB 1ZLWK 4JFYA 4U1MB 3KPOA 1AO7B 2ENYA 1YN6B 3CFBB 4X9GA 4ZFZB 3MRIA 3IDGB 4DQOL 2UZIH 4UDUA 4OCMC 4TUOB 5I76A 5E1AB 1F8TH 2PCPB 4U0RB 3JUZA 1TQBB 3KPQA 1ZV5A 3HZKA 4JVPA 2VSDA 4BFIB 2DI8A 4YHML 3D39D 2FJGB 5DZNA 2HJFB 1XGPA 3FFDB 3QH3B 1NAKH 3P4NA 4UAOB 3VRLE 4W81A 1VFBA 5HYJB 1CDUA 4LLYA 5E9DD 3LZFL 4ZPTA 3C60D 2AKRA 1BJ1J 4HZLA 2VKXA 1F4AA 3RKDD 1S7QB 3G5YA 1DVFC 4P4KD 3HG1E 2CXGA 5F9AC 4TNVK 1EAPB 1YQ2A 3O45A 4BELD 2FO4B 2X2YA 3Q6FA 5C0GA 2VLRD 1KSRA 5CGMA 4M7KL 3GHBL 1P7KB 3EYVA 3OJ2C 4YQXL 4APQA 4AK1A 4JFPA 5AEAA 2GUOB 4CW1B 3T2OA 4TNWF 4KUCD 4BQCA 3FO1A 4Z6AT 5BZWB 3ULUD 4E0RA 2VDLL 2UVEA 4D9QD 1FAIH 5HYQB 3MRPB 4PPTA 1LD9A 4WW1B 1FQ9C 1JHKH 3L3IB 4DN3L 4XGZA 1RUQH 3OF6D 1FYTE 32C2A 5DF0A 4WI4A 2P24A 1P9MA 4NCC2 3QNXA 5DUBB 2HT2C 5TDNB 2DWDB 5I6XC 3ZE0E 4XNYH 4IRJB 1RUKL 1CFQB 1H5BA 2R29L 3RZCC 2IALB 2MCG1 2VL4A 2FBOJ 4WUUD 2E7LA 3ZHLA 1E6JH 5D2NB 3MXVH 5I30L 3S37H 4MA8H 5DMYA 3TVMB 2VLJD 4YHLH 3BP5A 1YUHA 1G6RH 3MA9L 3HG1B 2WWKT 3B6SB 2ZPKH 5F7MC 4PJEE 1QBLL 4MJ6A 3RUGF 1TQCB 2GYSA 5F7DB 5FHAH 4X6CF 4ZNEA 2V5TA 1BBJB 3RVXD 4M5YL 4YDVB 4L3EE 2UY6A 5C0BA 4BYHA 2AXHA 1VADB 1KJ2A 5MERB 1QRND 1TJGH 5HHMB 4WUKH 2R4SL 1J1OL 5EO0B 4LVOB 3NABH 4FQ1L 2XN9B 4NFCA 4HIEA 4EN3C 5CJXC 2DLGA 4GH7B 2QV2A 4J3SA 4K7FB 5IBLD 5L2KA 3RQ3A 4KUCF 1YNTB 3DVGB 5AZEH 1QZ1A 3H7BB 5JMOC 4HH9A 4KY1H 1CZ8H 5ENWA 3S3SA 3VFPB 5F8RC 4G8IA 4JFQA 4BSVB 2FL5A 4IOIB 3S5LB 2AJVH 4N1HB 4C59B 4H8WL 5FOJA 1K5NA 1VEMA 5E8EA 5ALBH 1AQKH 4OUUB 3ZKXC 4UT7L 1U3HD 5DURD 1F2XK 1YEHH 5IG7B 4MD5A 5HGGS 4AEEA 3WNOA 3RGVB 4KQ4L 1OAUH 1B0RB 3U0TB 4A6YA 2YN5A 3VFOB 4HS8L 2B8OT 3TNMA 4NQCB 5JOPD 4PJ5A 5CWSB 5GRVL 4ZXBA 4L3EB 2DYPA 3C60C 1J0KA 3RKDC 1YJDC 4P9HH 4P4KC 2B4CL 2CUHA 3D18B 3MR9A 3CLFL 4M5ZL 1I8LC 1AGBB 5HHVH 2XV6B 3Q1SH 5TGBA 1IC4H 3ZDZE 1HQ4A 4ZFGL 4Y19A 1XF5A 3SKOA 1SBSL 4LNRB 3EFDL 4OBSA 4F7MB 3BWAA 3GJEB 4PV8A 3WNKA 4RFEB 3FQNA 4X6DB 5FGCB 3VFSA 3ULUC 3UTSD 4EQ3A 1GOHA 4WU7B 3S34H 1S7TB 2CRMA 4OD1L 2HVKA 3N0PB 4G7YL 2GSGA 3BZ4B 5E6IA 5E2UH 1CT8B 3GSXB 4X7TB 3HC4H 4N5UA 3L5XL 3GMMA 5CEXA 3UTZA 1QBMH 5IW6A 4OLVL 5LXGH 1N26A 5D5MF 4PRHA 5C0IB 3SJVD 2D4FA 3DYMA 5ETUA 5TE6H 4Q9QL 1J12A 2XI9A 3MACH 4AEIL 4KKBD 3OAZK 4AJ0A 1TTUA 4HIJB 3EYSL 4PS4L 5EPMB 5C0FB 3TYFA 2DQTL 2G60L 2A6KA 2J5LB 1WZ1L 3V2AR 3T8XA 3FONB 1XGYL 4OI7A 2DWEB 1KIUA 2QQKL 3RVXC 4XMPL 1KCLA 2VDQH 1OCWH 3GMRA 1SYSA 4J8RA 1FZJA 4KMTL 3QRFM 2EDTA 4WHYG 1X5YA 5D2LE 2MCPL 5EORL 2VITA 3I6GB 1NC2B 4XP6L 1AE6L 3O3DA 2FO1A 1MCEA 5IBLC 1FN4A 4HAGA 3V4PL 2OI9C 5IFAL 3BO8A 4ENEC 4JRYD 1PKQE 3VFGH 3G5XB 1H3UA 3GJFK 1X5FA 1FNAA 3QXDB 4NO5A 2K1MA 5IJVB 1TLKA 3RTQA 1MCOL 5JHDA 4GW5B 2DQJH 3T3PE 3KYMB 4BFEA 5CP3H 3RX5A 5J06A 1U3HC 4RQQA 3QDJD 1VGK