4ZO3A

Aidc, a dizinc quorum-quenching lactonase, in complex with a product n-hexnoyl-l-homoserine
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
294
structure length
294
Chain Sequence
DDLSGFKKIKLGELELFILTDGYIHEENLISFAPRGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIPESFMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylhomoserine lactonase
publication title Structural and Biochemical Characterization of AidC, a Quorum-Quenching Lactonase with Atypical Selectivity.
pubmed doi rcsb
source organism Chryseobacterium sp. strb126
molecule tags Hydrolase
total genus 87
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4zo3A00
2BG7A 3BK1A 1HLKA 1X8GA 2ZO4A 2YNVA 2ZWRA 1JJEA 2FHXB 3MD7A 5ACTA 2BFZB 1WUPA 2HB9A 3ESHA 5AXRA 3VQZA 5ACVA 2DKFA 4FSBA 2P18A 3ZNBA 3IEMA 2BG6A 3PG4A 4UWPB 2I7XA 5K0WA 2GMNA 1MQOA 3RKJA 1WRAA 1ZNBA 2GCUA 5HIPA 4Z60A 4J5FA 2Y8AA 2WYMC 4U4LA 3ZWFA 2YNTB 2Q0JA 2Q9UA 1YCGA 5LMCA 4UWRB 4Z67A 4KEPA 2UYXA 5EVDA 4AWZA 5FQBA 1P9EA 4AD9A 2BTNA 5ACRA 2YCBA 2Y8BA 5A0TA 3FCZA 2BG8A 4HL1A 2GFJA 4HKYA 3IDZA 4NQ5A 5KILA 5LCAA 4XWWA 4C09A 1ZTCA 4J5HA 5A5ZA 4UA4A 1SMLA 2YNVB 4TYTA 1L9YA 4Z7RA 4C1FA 5FQAA 2BFLA 4TZ9A 2AZ4A 3SBLA 3LVZA 2AIOA 4UWSB 2I7TA 3I13A 5FQCA 2E7YA 1XTOA 4GYUA 4F6ZA 1YCHA 4D1WA 4RBSA 2WYLA 3A4YA 5B15A 4Z6XA 1DDKA 3P2UA 4XUKA 3L6NA 2XF4A 4ZO3A 3ADRA 3DHAA 4D1TA 2ZZIA 3PY6A 4UAMA 3F9OA 3S0ZA 3AF6A 5EWAA 4FR7A 4EYLA 4CHLA 4TZBA 2QDSA 4YSKA 2WHGA 3KL7A 1X8HA 2FU9A 2M5CA 2NZEA 2BIBA 2FK6A 2DOOA 5EV6A 5EV8A 2FM6A 4RL2A 4EYBA 1DXKA 1WUOA 2BG8B 5KIKA 2WYMA 4C1HA 1M2XA 3X30A 5LCFA 2FU8A 2Q0IA 2NXAA 4NQ6A 4D1VA 2Y87A 4JO0A 5ACUA 5EVBA 3SD9A 3VPEA 1QH5A 4KEQA 3JXPA 2BMIA 5K4NA 1VGNA 2OHJA 5AXOA 5ACXA 3DH8A 2BFKA 3KNRA 2H6AA 2BC2A 1JJTA 4D02A 2Q42A 3IOFA 2BGAA 1K07A 4XWTA 4NQ4A 2FU6A 4TZEA 3AJ3A 3DHCA 3SPUA 1YCFA 2NZFA 1E5DA 5B1UA 2OHIA 4NQ2A 3TP9A 4AWYB 4AX1B 1BMCA 5AHRA 1WW1A 2FHXA 3I15A 1JT1A 3FAIA 2BFZA 5EVKA 5LLDA 4EXYA 2QDTA 4EFZA 5LE1A 3BV6A 5A87A 4D1UA 5EH9A 5AYAA 4ZNBA 2WRSA 1KO3A 4TZFA 1KO2A 4FEKA 2BR6A 2QJSA 5ACPA 5HH4A 2XR1A 4LE6A 3R2UA 3IOGA 1BVTA 1VMEA 2VW8A 2P4ZA 5AEBA 4WD6A 4C1EA 3RKKA 5DPXA 2R2DA 2NYPA 5HH5A 4F6HA 1A7TA 5ACSA 3I11A 3Q6VA 3PY5A 2YNUA 2YZ3A 4YSLA 5K4MA 3IE2A 4PVOA 3AF5A 3H3EA 5HIOA 4C1GA 2FU7A 3IEKA 4V0HA 4TYFA 4HL2A 4B87A 5HISA 4H0DA 5LSCA 5EW0A 5K4KA 2YNWA 2GKLA 4DIKA 3IE0A 5AHOA 3ZR9A 1Y44A 3SFPA 4RAMA 1DD6A 4UWOB 4RM5A 4O98A 4RL0A 1A8TA 2BG2A 1XM8A 4RAWA 4UBQA 5ACWA 4P62A 4C1CA 2QINA 3X2ZA 3X2XA 3WXCA 3T3OA 3KNSA 4DILA 3IELA 2QEDA 3ZQ4A 5IQKA 2ZNBA 4EY2A 3I0VA 3G1PA 2P97A 4EYFA 4BZ3A 1QH3A 5ACQA 2P1EA 4C1DA 5B3RA 3T9MA 1ZKPA 1KR3A 4YSBA 1X8IA 1VJNA 4GYQA 4BP0A 4Z5YA 5LCHA 3QH8A 3I14A 2OHHA 1BC2A 3BC2A 4ZEJA 3SW3A 5HH6A 5LM6A 2A7MA 2I7VA 2GFKA 3BK2A 3DHBA 2YNTA 4EXSA 2CBNA 3RPCA 3IE1A 4GCWA 3SRXA 5HIQA 4AX0B 5EHTA 5A0VA 2M5DA 5LS3A 4ZO2A 4Z5ZA 3T3NA 4PVTA 3X2YA
chains in the Genus database with same CATH superfamily
2BG7A 3BK1A 1HLKA 1X8GA 2ZO4A 2YNVA 2ZWRA 1JJEA 2FHXB 3MD7A 5ACTA 2BFZB 1WUPA 2HB9A 3ESHA 5AXRA 3VQZA 5ACVA 2DKFA 4FSBA 2P18A 3ZNBA 3IEMA 2BG6A 3PG4A 4UWPB 2I7XA 5K0WA 2GMNA 1MQOA 3RKJA 1WRAA 1ZNBA 2GCUA 5HIPA 4Z60A 4J5FA 2Y8AA 2WYMC 4U4LA 3ZWFA 2YNTB 2Q0JA 2Q9UA 1YCGA 5LMCA 4UWRB 4Z67A 4KEPA 2UYXA 5EVDA 4AWZA 5FQBA 1P9EA 4AD9A 2BTNA 5ACRA 2YCBA 2Y8BA 5A0TA 3FCZA 2BG8A 4HL1A 2GFJA 4HKYA 3IDZA 4NQ5A 5KILA 5LCAA 4XWWA 4C09A 1ZTCA 4J5HA 5A5ZA 4UA4A 1SMLA 2YNVB 4TYTA 1L9YA 4Z7RA 4C1FA 5FQAA 2BFLA 4TZ9A 2AZ4A 3SBLA 3LVZA 2AIOA 4UWSB 2I7TA 3I13A 5FQCA 2E7YA 1XTOA 4GYUA 4F6ZA 1YCHA 4D1WA 4RBSA 2WYLA 3A4YA 5B15A 2CFZA 4Z6XA 1DDKA 3P2UA 4XUKA 3L6NA 2XF4A 4ZO3A 3ADRA 3DHAA 4D1TA 2ZZIA 3PY6A 4UAMA 3F9OA 3S0ZA 3AF6A 5EWAA 4FR7A 4EYLA 4CHLA 4TZBA 2QDSA 4YSKA 2WHGA 3KL7A 1X8HA 2FU9A 2M5CA 5A23A 2NZEA 2BIBA 2FK6A 2DOOA 5EV6A 5EV8A 2FM6A 4RL2A 4EYBA 1DXKA 1WUOA 2BG8B 5KIKA 2WYMA 4C1HA 1M2XA 3X30A 5LCFA 2FU8A 2Q0IA 2NXAA 4NQ6A 4D1VA 2Y87A 4JO0A 5ACUA 5EVBA 3SD9A 3VPEA 1QH5A 4KEQA 3JXPA 2BMIA 5K4NA 1VGNA 2OHJA 5AXOA 5ACXA 3DH8A 2BFKA 3KNRA 2H6AA 2BC2A 1JJTA 4D02A 2Q42A 3IOFA 2BGAA 1K07A 4XWTA 4NQ4A 2FU6A 4TZEA 3AJ3A 3DHCA 3SPUA 1YCFA 2NZFA 1E5DA 5B1UA 2OHIA 4NQ2A 4NURA 3TP9A 4AWYB 4AX1B 1BMCA 5AHRA 1WW1A 2FHXA 3I15A 1JT1A 3FAIA 2BFZA 5EVKA 5LLDA 4EXYA 2QDTA 4EFZA 5LE1A 3BV6A 5A87A 4D1UA 5EH9A 5AYAA 4ZNBA 2WRSA 1KO3A 4TZFA 1KO2A 4FEKA 4PDXA 2BR6A 2QJSA 5ACPA 5HH4A 2XR1A 4LE6A 3R2UA 4AV7A 3IOGA 1BVTA 5AJLA 1VMEA 2VW8A 2P4ZA 5AEBA 4WD6A 4C1EA 3RKKA 5DPXA 2R2DA 2NYPA 5HH5A 4F6HA 1A7TA 5ACSA 3I11A 3Q6VA 3PY5A 2YNUA 2YZ3A 4YSLA 5K4MA 3IE2A 2YHEA 4PVOA 3AF5A 3H3EA 2CG3A 5HIOA 4C1GA 2FU7A 3IEKA 4V0HA 4TYFA 4HL2A 4B87A 5HISA 4H0DA 5LSCA 5EW0A 5K4KA 2YNWA 2GKLA 4DIKA 3IE0A 5AHOA 3ZR9A 1Y44A 3SFPA 4RAMA 1DD6A 4UWOB 4RM5A 4O98A 4RL0A 1A8TA 2BG2A 1XM8A 4RAWA 4UBQA 5ACWA 4P62A 4C1CA 2QINA 3X2ZA 3X2XA 3WXCA 3T3OA 3KNSA 4DILA 2CFUA 3IELA 2QEDA 3ZQ4A 5IQKA 2ZNBA 4EY2A 3I0VA 3G1PA 2P97A 4EYFA 4BZ3A 1QH3A 5ACQA 2P1EA 4C1DA 5B3RA 3T9MA 1ZKPA 1KR3A 4YSBA 1X8IA 1VJNA 4GYQA 4BP0A 4Z5YA 5LCHA 3QH8A 3I14A 2OHHA 1BC2A 3BC2A 4ZEJA 5AIJA 3SW3A 5HH6A 5LM6A 2A7MA 2I7VA 2CG2A 2GFKA 4AXHA 3BK2A 3DHBA 2YNTA 4EXSA 2CBNA 3RPCA 3IE1A 4GCWA 3SRXA 5HIQA 4AX0B 5EHTA 5A0VA 2M5DA 5LS3A 4ZO2A 4Z5ZA 3T3NA 4PVTA 3X2YA
chains in the Genus database with same CATH topology
2BG7A 3BK1A 1HLKA 1X8GA 2ZO4A 2YNVA 2ZWRA 1JJEA 2FHXB 3MD7A 5ACTA 2BFZB 1WUPA 2HB9A 3ESHA 5AXRA 3VQZA 5ACVA 2DKFA 4FSBA 2P18A 3ZNBA 3IEMA 2BG6A 3PG4A 4UWPB 2I7XA 5K0WA 2GMNA 1MQOA 3RKJA 1WRAA 1ZNBA 2GCUA 5HIPA 4Z60A 4J5FA 2Y8AA 2WYMC 4U4LA 3ZWFA 2YNTB 2Q0JA 2Q9UA 1YCGA 5LMCA 4UWRB 4Z67A 4KEPA 2UYXA 5EVDA 4AWZA 5FQBA 1P9EA 4AD9A 2BTNA 5ACRA 2YCBA 2Y8BA 5A0TA 3FCZA 2BG8A 4HL1A 2GFJA 4HKYA 3IDZA 4NQ5A 5KILA 5LCAA 4XWWA 4C09A 1ZTCA 4J5HA 5A5ZA 4UA4A 1SMLA 2YNVB 4TYTA 1L9YA 4Z7RA 4C1FA 5FQAA 2BFLA 4TZ9A 2AZ4A 3SBLA 3LVZA 2AIOA 4UWSB 2I7TA 3I13A 5FQCA 2E7YA 1XTOA 4GYUA 4F6ZA 1YCHA 4D1WA 4RBSA 2WYLA 3A4YA 5B15A 4Z6XA 1DDKA 3P2UA 4XUKA 3L6NA 2XF4A 4ZO3A 3ADRA 3DHAA 4D1TA 2ZZIA 3PY6A 4UAMA 3F9OA 3S0ZA 3AF6A 5EWAA 4FR7A 4EYLA 4CHLA 4TZBA 2QDSA 4YSKA 2WHGA 3KL7A 1X8HA 2FU9A 2M5CA 2NZEA 2BIBA 2FK6A 2DOOA 5EV6A 5EV8A 2FM6A 4RL2A 4EYBA 1DXKA 1WUOA 2BG8B 5KIKA 2WYMA 4C1HA 1M2XA 3X30A 5LCFA 2FU8A 2Q0IA 2NXAA 4NQ6A 4D1VA 2Y87A 4JO0A 5ACUA 5EVBA 3SD9A 3VPEA 1QH5A 4KEQA 3JXPA 2BMIA 5K4NA 1VGNA 2OHJA 5AXOA 5ACXA 3DH8A 2BFKA 3KNRA 2H6AA 2BC2A 1JJTA 4D02A 2Q42A 3IOFA 2BGAA 1K07A 4XWTA 4NQ4A 2FU6A 4TZEA 3AJ3A 3DHCA 3SPUA 1YCFA 2NZFA 1E5DA 5B1UA 2OHIA 4NQ2A 3TP9A 4AWYB 4AX1B 1BMCA 5AHRA 1WW1A 2FHXA 3I15A 1JT1A 3FAIA 2BFZA 5EVKA 5LLDA 4EXYA 2QDTA 4EFZA 5LE1A 3BV6A 5A87A 4D1UA 5EH9A 5AYAA 4ZNBA 2WRSA 1KO3A 4TZFA 1KO2A 4FEKA 2BR6A 2QJSA 5ACPA 5HH4A 2XR1A 4LE6A 3R2UA 3IOGA 1BVTA 1VMEA 2VW8A 2P4ZA 5AEBA 4WD6A 4C1EA 3RKKA 5DPXA 2R2DA 2NYPA 5HH5A 4F6HA 1A7TA 5ACSA 3I11A 3Q6VA 3PY5A 2YNUA 2YZ3A 4YSLA 5K4MA 3IE2A 4PVOA 3AF5A 3H3EA 5HIOA 4C1GA 2FU7A 3IEKA 4V0HA 4TYFA 4HL2A 4B87A 5HISA 4H0DA 5LSCA 5EW0A 5K4KA 2YNWA 2GKLA 4DIKA 3IE0A 5AHOA 3ZR9A 1Y44A 3SFPA 4RAMA 1DD6A 4UWOB 4RM5A 4O98A 4RL0A 1A8TA 2BG2A 1XM8A 4RAWA 4UBQA 5ACWA 4P62A 4C1CA 2QINA 3X2ZA 3X2XA 3WXCA 3T3OA 3KNSA 4DILA 3IELA 2QEDA 3ZQ4A 5IQKA 2ZNBA 4EY2A 3I0VA 3G1PA 2P97A 4EYFA 4BZ3A 1QH3A 5ACQA 2P1EA 4C1DA 5B3RA 3T9MA 1ZKPA 1KR3A 4YSBA 1X8IA 1VJNA 4GYQA 4BP0A 4Z5YA 5LCHA 3QH8A 3I14A 2OHHA 1BC2A 3BC2A 4ZEJA 3SW3A 5HH6A 5LM6A 2A7MA 2I7VA 2GFKA 3BK2A 3DHBA 2YNTA 4EXSA 2CBNA 3RPCA 3IE1A 4GCWA 3SRXA 5HIQA 4AX0B 5EHTA 5A0VA 2M5DA 5LS3A 4ZO2A 4Z5ZA 3T3NA 4PVTA 3X2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG7 A;  3BK1 A;  1HLK A;  1X8G A;  2ZO4 A;  2YNV A;  2ZWR A;  1JJE A;  2FHX B;  3MD7 A;  5ACT A;  2BFZ B;  1WUP A;  2HB9 A;  3ESH A;  5AXR A;  3VQZ A;  5ACV A;  2DKF A;  4FSB A;  2P18 A;  3ZNB A;  3IEM A;  2BG6 A;  3PG4 A;  4UWP B;  2I7X A;  5K0W A;  2GMN A;  1MQO A;  3RKJ A;  1WRA A;  1ZNB A;  2GCU A;  5HIP A;  4Z60 A;  4J5F A;  2Y8A A;  2WYM C;  4U4L A;  3ZWF A;  2YNT B;  2Q0J A;  2Q9U A;  1YCG A;  5LMC A;  4UWR B;  4Z67 A;  4KEP A;  2UYX A;  5EVD A;  4AWZ A;  5FQB A;  1P9E A;  4AD9 A;  2BTN A;  5ACR A;  2YCB A;  2Y8B A;  5A0T A;  3FCZ A;  2BG8 A;  4HL1 A;  2GFJ A;  4HKY A;  3IDZ A;  4NQ5 A;  5KIL A;  5LCA A;  4XWW A;  4C09 A;  1ZTC A;  4J5H A;  5A5Z A;  4UA4 A;  1SML A;  2YNV B;  4TYT A;  1L9Y A;  4Z7R A;  4C1F A;  5FQA A;  2BFL A;  4TZ9 A;  2AZ4 A;  3SBL A;  3LVZ A;  2AIO A;  4UWS B;  2I7T A;  3I13 A;  5FQC A;  2E7Y A;  1XTO A;  4GYU A;  4F6Z A;  1YCH A;  4D1W A;  4RBS A;  2WYL A;  3A4Y A;  5B15 A;  4Z6X A;  1DDK A;  3P2U A;  4XUK A;  3L6N A;  2XF4 A;  4ZO3 A;  3ADR A;  3DHA A;  4D1T A;  2ZZI A;  3PY6 A;  4UAM A;  3F9O A;  3S0Z A;  3AF6 A;  5EWA A;  4FR7 A;  4EYL A;  4CHL A;  4TZB A;  2QDS A;  4YSK A;  2WHG A;  3KL7 A;  1X8H A;  2FU9 A;  2M5C A;  2NZE A;  2BIB A;  2FK6 A;  2DOO A;  5EV6 A;  5EV8 A;  2FM6 A;  4RL2 A;  4EYB A;  1DXK A;  1WUO A;  2BG8 B;  5KIK A;  2WYM A;  4C1H A;  1M2X A;  3X30 A;  5LCF A;  2FU8 A;  2Q0I A;  2NXA A;  4NQ6 A;  4D1V A;  2Y87 A;  4JO0 A;  5ACU A;  5EVB A;  3SD9 A;  3VPE A;  1QH5 A;  4KEQ A;  3JXP A;  2BMI A;  5K4N A;  1VGN A;  2OHJ A;  5AXO A;  5ACX A;  3DH8 A;  2BFK A;  3KNR A;  2H6A A;  2BC2 A;  1JJT A;  4D02 A;  2Q42 A;  3IOF A;  2BGA A;  1K07 A;  4XWT A;  4NQ4 A;  2FU6 A;  4TZE A;  3AJ3 A;  3DHC A;  3SPU A;  1YCF A;  2NZF A;  1E5D A;  5B1U A;  2OHI A;  4NQ2 A;  3TP9 A;  4AWY B;  4AX1 B;  1BMC A;  5AHR A;  1WW1 A;  2FHX A;  3I15 A;  1JT1 A;  3FAI A;  2BFZ A;  5EVK A;  5LLD A;  4EXY A;  2QDT A;  4EFZ A;  5LE1 A;  3BV6 A;  5A87 A;  4D1U A;  5EH9 A;  5AYA A;  4ZNB A;  2WRS A;  1KO3 A;  4TZF A;  1KO2 A;  4FEK A;  2BR6 A;  2QJS A;  5ACP A;  5HH4 A;  2XR1 A;  4LE6 A;  3R2U A;  3IOG A;  1BVT A;  1VME A;  2VW8 A;  2P4Z A;  5AEB A;  4WD6 A;  4C1E A;  3RKK A;  5DPX A;  2R2D A;  2NYP A;  5HH5 A;  4F6H A;  1A7T A;  5ACS A;  3I11 A;  3Q6V A;  3PY5 A;  2YNU A;  2YZ3 A;  4YSL A;  5K4M A;  3IE2 A;  4PVO A;  3AF5 A;  3H3E A;  5HIO A;  4C1G A;  2FU7 A;  3IEK A;  4V0H A;  4TYF A;  4HL2 A;  4B87 A;  5HIS A;  4H0D A;  5LSC A;  5EW0 A;  5K4K A;  2YNW A;  2GKL A;  4DIK A;  3IE0 A;  5AHO A;  3ZR9 A;  1Y44 A;  3SFP A;  4RAM A;  1DD6 A;  4UWO B;  4RM5 A;  4O98 A;  4RL0 A;  1A8T A;  2BG2 A;  1XM8 A;  4RAW A;  4UBQ A;  5ACW A;  4P62 A;  4C1C A;  2QIN A;  3X2Z A;  3X2X A;  3WXC A;  3T3O A;  3KNS A;  4DIL A;  3IEL A;  2QED A;  3ZQ4 A;  5IQK A;  2ZNB A;  4EY2 A;  3I0V A;  3G1P A;  2P97 A;  4EYF A;  4BZ3 A;  1QH3 A;  5ACQ A;  2P1E A;  4C1D A;  5B3R A;  3T9M A;  1ZKP A;  1KR3 A;  4YSB A;  1X8I A;  1VJN A;  4GYQ A;  4BP0 A;  4Z5Y A;  5LCH A;  3QH8 A;  3I14 A;  2OHH A;  1BC2 A;  3BC2 A;  4ZEJ A;  3SW3 A;  5HH6 A;  5LM6 A;  2A7M A;  2I7V A;  2GFK A;  3BK2 A;  3DHB A;  2YNT A;  4EXS A;  2CBN A;  3RPC A;  3IE1 A;  4GCW A;  3SRX A;  5HIQ A;  4AX0 B;  5EHT A;  5A0V A;  2M5D A;  5LS3 A;  4ZO2 A;  4Z5Z A;  3T3N A;  4PVT A;  3X2Y A; 
#chains in the Genus database with same CATH topology
 2BG7 A;  3BK1 A;  1HLK A;  1X8G A;  2ZO4 A;  2YNV A;  2ZWR A;  1JJE A;  2FHX B;  3MD7 A;  5ACT A;  2BFZ B;  1WUP A;  2HB9 A;  3ESH A;  5AXR A;  3VQZ A;  5ACV A;  2DKF A;  4FSB A;  2P18 A;  3ZNB A;  3IEM A;  2BG6 A;  3PG4 A;  4UWP B;  2I7X A;  5K0W A;  2GMN A;  1MQO A;  3RKJ A;  1WRA A;  1ZNB A;  2GCU A;  5HIP A;  4Z60 A;  4J5F A;  2Y8A A;  2WYM C;  4U4L A;  3ZWF A;  2YNT B;  2Q0J A;  2Q9U A;  1YCG A;  5LMC A;  4UWR B;  4Z67 A;  4KEP A;  2UYX A;  5EVD A;  4AWZ A;  5FQB A;  1P9E A;  4AD9 A;  2BTN A;  5ACR A;  2YCB A;  2Y8B A;  5A0T A;  3FCZ A;  2BG8 A;  4HL1 A;  2GFJ A;  4HKY A;  3IDZ A;  4NQ5 A;  5KIL A;  5LCA A;  4XWW A;  4C09 A;  1ZTC A;  4J5H A;  5A5Z A;  4UA4 A;  1SML A;  2YNV B;  4TYT A;  1L9Y A;  4Z7R A;  4C1F A;  5FQA A;  2BFL A;  4TZ9 A;  2AZ4 A;  3SBL A;  3LVZ A;  2AIO A;  4UWS B;  2I7T A;  3I13 A;  5FQC A;  2E7Y A;  1XTO A;  4GYU A;  4F6Z A;  1YCH A;  4D1W A;  4RBS A;  2WYL A;  3A4Y A;  5B15 A;  2CFZ A;  4Z6X A;  1DDK A;  3P2U A;  4XUK A;  3L6N A;  2XF4 A;  4ZO3 A;  3ADR A;  3DHA A;  4D1T A;  2ZZI A;  3PY6 A;  4UAM A;  3F9O A;  3S0Z A;  3AF6 A;  5EWA A;  4FR7 A;  4EYL A;  4CHL A;  4TZB A;  2QDS A;  4YSK A;  2WHG A;  3KL7 A;  1X8H A;  2FU9 A;  2M5C A;  5A23 A;  2NZE A;  2BIB A;  2FK6 A;  2DOO A;  5EV6 A;  5EV8 A;  2FM6 A;  4RL2 A;  4EYB A;  1DXK A;  1WUO A;  2BG8 B;  5KIK A;  2WYM A;  4C1H A;  1M2X A;  3X30 A;  5LCF A;  2FU8 A;  2Q0I A;  2NXA A;  4NQ6 A;  4D1V A;  2Y87 A;  4JO0 A;  5ACU A;  5EVB A;  3SD9 A;  3VPE A;  1QH5 A;  4KEQ A;  3JXP A;  2BMI A;  5K4N A;  1VGN A;  2OHJ A;  5AXO A;  5ACX A;  3DH8 A;  2BFK A;  3KNR A;  2H6A A;  2BC2 A;  1JJT A;  4D02 A;  2Q42 A;  3IOF A;  2BGA A;  1K07 A;  4XWT A;  4NQ4 A;  2FU6 A;  4TZE A;  3AJ3 A;  3DHC A;  3SPU A;  1YCF A;  2NZF A;  1E5D A;  5B1U A;  2OHI A;  4NQ2 A;  4NUR A;  3TP9 A;  4AWY B;  4AX1 B;  1BMC A;  5AHR A;  1WW1 A;  2FHX A;  3I15 A;  1JT1 A;  3FAI A;  2BFZ A;  5EVK A;  5LLD A;  4EXY A;  2QDT A;  4EFZ A;  5LE1 A;  3BV6 A;  5A87 A;  4D1U A;  5EH9 A;  5AYA A;  4ZNB A;  2WRS A;  1KO3 A;  4TZF A;  1KO2 A;  4FEK A;  4PDX A;  2BR6 A;  2QJS A;  5ACP A;  5HH4 A;  2XR1 A;  4LE6 A;  3R2U A;  4AV7 A;  3IOG A;  1BVT A;  5AJL A;  1VME A;  2VW8 A;  2P4Z A;  5AEB A;  4WD6 A;  4C1E A;  3RKK A;  5DPX A;  2R2D A;  2NYP A;  5HH5 A;  4F6H A;  1A7T A;  5ACS A;  3I11 A;  3Q6V A;  3PY5 A;  2YNU A;  2YZ3 A;  4YSL A;  5K4M A;  3IE2 A;  2YHE A;  4PVO A;  3AF5 A;  3H3E A;  2CG3 A;  5HIO A;  4C1G A;  2FU7 A;  3IEK A;  4V0H A;  4TYF A;  4HL2 A;  4B87 A;  5HIS A;  4H0D A;  5LSC A;  5EW0 A;  5K4K A;  2YNW A;  2GKL A;  4DIK A;  3IE0 A;  5AHO A;  3ZR9 A;  1Y44 A;  3SFP A;  4RAM A;  1DD6 A;  4UWO B;  4RM5 A;  4O98 A;  4RL0 A;  1A8T A;  2BG2 A;  1XM8 A;  4RAW A;  4UBQ A;  5ACW A;  4P62 A;  4C1C A;  2QIN A;  3X2Z A;  3X2X A;  3WXC A;  3T3O A;  3KNS A;  4DIL A;  2CFU A;  3IEL A;  2QED A;  3ZQ4 A;  5IQK A;  2ZNB A;  4EY2 A;  3I0V A;  3G1P A;  2P97 A;  4EYF A;  4BZ3 A;  1QH3 A;  5ACQ A;  2P1E A;  4C1D A;  5B3R A;  3T9M A;  1ZKP A;  1KR3 A;  4YSB A;  1X8I A;  1VJN A;  4GYQ A;  4BP0 A;  4Z5Y A;  5LCH A;  3QH8 A;  3I14 A;  2OHH A;  1BC2 A;  3BC2 A;  4ZEJ A;  5AIJ A;  3SW3 A;  5HH6 A;  5LM6 A;  2A7M A;  2I7V A;  2CG2 A;  2GFK A;  4AXH A;  3BK2 A;  3DHB A;  2YNT A;  4EXS A;  2CBN A;  3RPC A;  3IE1 A;  4GCW A;  3SRX A;  5HIQ A;  4AX0 B;  5EHT A;  5A0V A;  2M5D A;  5LS3 A;  4ZO2 A;  4Z5Z A;  3T3N A;  4PVT A;  3X2Y A; 
#chains in the Genus database with same CATH homology
 2BG7 A;  3BK1 A;  1HLK A;  1X8G A;  2ZO4 A;  2YNV A;  2ZWR A;  1JJE A;  2FHX B;  3MD7 A;  5ACT A;  2BFZ B;  1WUP A;  2HB9 A;  3ESH A;  5AXR A;  3VQZ A;  5ACV A;  2DKF A;  4FSB A;  2P18 A;  3ZNB A;  3IEM A;  2BG6 A;  3PG4 A;  4UWP B;  2I7X A;  5K0W A;  2GMN A;  1MQO A;  3RKJ A;  1WRA A;  1ZNB A;  2GCU A;  5HIP A;  4Z60 A;  4J5F A;  2Y8A A;  2WYM C;  4U4L A;  3ZWF A;  2YNT B;  2Q0J A;  2Q9U A;  1YCG A;  5LMC A;  4UWR B;  4Z67 A;  4KEP A;  2UYX A;  5EVD A;  4AWZ A;  5FQB A;  1P9E A;  4AD9 A;  2BTN A;  5ACR A;  2YCB A;  2Y8B A;  5A0T A;  3FCZ A;  2BG8 A;  4HL1 A;  2GFJ A;  4HKY A;  3IDZ A;  4NQ5 A;  5KIL A;  5LCA A;  4XWW A;  4C09 A;  1ZTC A;  4J5H A;  5A5Z A;  4UA4 A;  1SML A;  2YNV B;  4TYT A;  1L9Y A;  4Z7R A;  4C1F A;  5FQA A;  2BFL A;  4TZ9 A;  2AZ4 A;  3SBL A;  3LVZ A;  2AIO A;  4UWS B;  2I7T A;  3I13 A;  5FQC A;  2E7Y A;  1XTO A;  4GYU A;  4F6Z A;  1YCH A;  4D1W A;  4RBS A;  2WYL A;  3A4Y A;  5B15 A;  4Z6X A;  1DDK A;  3P2U A;  4XUK A;  3L6N A;  2XF4 A;  4ZO3 A;  3ADR A;  3DHA A;  4D1T A;  2ZZI A;  3PY6 A;  4UAM A;  3F9O A;  3S0Z A;  3AF6 A;  5EWA A;  4FR7 A;  4EYL A;  4CHL A;  4TZB A;  2QDS A;  4YSK A;  2WHG A;  3KL7 A;  1X8H A;  2FU9 A;  2M5C A;  2NZE A;  2BIB A;  2FK6 A;  2DOO A;  5EV6 A;  5EV8 A;  2FM6 A;  4RL2 A;  4EYB A;  1DXK A;  1WUO A;  2BG8 B;  5KIK A;  2WYM A;  4C1H A;  1M2X A;  3X30 A;  5LCF A;  2FU8 A;  2Q0I A;  2NXA A;  4NQ6 A;  4D1V A;  2Y87 A;  4JO0 A;  5ACU A;  5EVB A;  3SD9 A;  3VPE A;  1QH5 A;  4KEQ A;  3JXP A;  2BMI A;  5K4N A;  1VGN A;  2OHJ A;  5AXO A;  5ACX A;  3DH8 A;  2BFK A;  3KNR A;  2H6A A;  2BC2 A;  1JJT A;  4D02 A;  2Q42 A;  3IOF A;  2BGA A;  1K07 A;  4XWT A;  4NQ4 A;  2FU6 A;  4TZE A;  3AJ3 A;  3DHC A;  3SPU A;  1YCF A;  2NZF A;  1E5D A;  5B1U A;  2OHI A;  4NQ2 A;  3TP9 A;  4AWY B;  4AX1 B;  1BMC A;  5AHR A;  1WW1 A;  2FHX A;  3I15 A;  1JT1 A;  3FAI A;  2BFZ A;  5EVK A;  5LLD A;  4EXY A;  2QDT A;  4EFZ A;  5LE1 A;  3BV6 A;  5A87 A;  4D1U A;  5EH9 A;  5AYA A;  4ZNB A;  2WRS A;  1KO3 A;  4TZF A;  1KO2 A;  4FEK A;  2BR6 A;  2QJS A;  5ACP A;  5HH4 A;  2XR1 A;  4LE6 A;  3R2U A;  3IOG A;  1BVT A;  1VME A;  2VW8 A;  2P4Z A;  5AEB A;  4WD6 A;  4C1E A;  3RKK A;  5DPX A;  2R2D A;  2NYP A;  5HH5 A;  4F6H A;  1A7T A;  5ACS A;  3I11 A;  3Q6V A;  3PY5 A;  2YNU A;  2YZ3 A;  4YSL A;  5K4M A;  3IE2 A;  4PVO A;  3AF5 A;  3H3E A;  5HIO A;  4C1G A;  2FU7 A;  3IEK A;  4V0H A;  4TYF A;  4HL2 A;  4B87 A;  5HIS A;  4H0D A;  5LSC A;  5EW0 A;  5K4K A;  2YNW A;  2GKL A;  4DIK A;  3IE0 A;  5AHO A;  3ZR9 A;  1Y44 A;  3SFP A;  4RAM A;  1DD6 A;  4UWO B;  4RM5 A;  4O98 A;  4RL0 A;  1A8T A;  2BG2 A;  1XM8 A;  4RAW A;  4UBQ A;  5ACW A;  4P62 A;  4C1C A;  2QIN A;  3X2Z A;  3X2X A;  3WXC A;  3T3O A;  3KNS A;  4DIL A;  3IEL A;  2QED A;  3ZQ4 A;  5IQK A;  2ZNB A;  4EY2 A;  3I0V A;  3G1P A;  2P97 A;  4EYF A;  4BZ3 A;  1QH3 A;  5ACQ A;  2P1E A;  4C1D A;  5B3R A;  3T9M A;  1ZKP A;  1KR3 A;  4YSB A;  1X8I A;  1VJN A;  4GYQ A;  4BP0 A;  4Z5Y A;  5LCH A;  3QH8 A;  3I14 A;  2OHH A;  1BC2 A;  3BC2 A;  4ZEJ A;  3SW3 A;  5HH6 A;  5LM6 A;  2A7M A;  2I7V A;  2GFK A;  3BK2 A;  3DHB A;  2YNT A;  4EXS A;  2CBN A;  3RPC A;  3IE1 A;  4GCW A;  3SRX A;  5HIQ A;  4AX0 B;  5EHT A;  5A0V A;  2M5D A;  5LS3 A;  4ZO2 A;  4Z5Z A;  3T3N A;  4PVT A;  3X2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...