4ZO4A

Dephospho-coa kinase from campylobacter jejuni.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
AMKNAFFVTASIACGKSTFIEIANSLGFKSISADKIAHKILDENALELEKIFSPFSLKNLLKKEKKIDRKILGEIVFNNKEAKKILENFTHPKIRAKILEQMQILDKENKAFFVEIPLFFESGAYENLGKVIVIYTPKELSLKRIMQRDKLSLEAAKARLDSQIDIEEKLKKADFIIKNTNSYADFRQECVKVIQEISKGNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Dephospho-CoA kinase from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni subsp. jejuni serotype o:2 (strain nctc 11168)
molecule tags Transferase
total genus 63
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4zo4A00
4ZKDA 1IHUA 5SZKB 4UNQA 1VCMA 1GSIA 4RY2A 4TMTA 2NO1A 1OKKA 3QY0A 1BYUA 1V43A 1Q20A 1YR6A 3LQQA 1ESMA 5CLQA 5GVRA 3TMKA 3M0EA 3KB2A 1AGRA 3OIUA 4DLVA 1NLYA 2ZI9A 3BFXA 3TRFA 1IOZA 3NC1C 2A5JA 4O2LA 3C15C 3R8FA 2W00A 4JJKA 2YYZA 3KQNA 2ZSDA 1OLOA 2XX3A 2D4HA 5AWFC 3EWAA 4LYJA 4F91B 2QE7D 4LPKA 3W8RA 4YXWA 1RC8A 2X2FA 4IXMA 5B2ZA 1XCPA 3OE7D 3SJZA 5JZVA 5J4KA 1NN1A 4NTZA 2BHRA 4GL2A 1HQCA 4G5RA 1ONBA 4FMBB 4G1UC 3HR7A 4TQ9A 1G41A 1BH2A 4TMKA 1SVOA 2GAOA 2QENA 2JGNA 5DNYB 1DG1G 1T0JB 5EP1A 2YZ2A 4Q4JA 1HYQA 1KIMA 4KFSA 1KGDA 4B3BA 1E96A 2ZETA 4DT1B 2XTMA 2FGKA 3LH5A 2KSQA 4NL4H 5C1BA 3DM5A 3T5GA 4PZYA 4LHXA 3AVTA 2N1BA 3WP1B 1UM8A 5EUQB 3CF2A 3NXSA 2FNAA 2IW3A 5A0FA 2DB3A 2VF7A 3W90A 1W36C 1Z29A 2QNRA 3LNCA 5KSZA 4HLCA 1RIFA 4WZBE 4DUGA 1NY6A 3D7MA 4CEHA 4HZUA 2QU8A 3R9WA 3EA0A 1FX0A 1OXXK 1JPNA 1ZYUA 4NHOA 2NOAA 4KAXA 2IL1A 4B3CA 3A1WA 4DLXA 1NVWQ 2W2VA 1JR6A 5CK4A 2ORWA 1XMJA 2IEZA 4MA4A 2F3RA 4BEBA 2GBLC 5HPYB 3QQ5A 3LW8A 1E2HA 2J59A 5CM9C 4AIIA 1XTIA 1S4QA 4F4IA 2R6GA 3N5CA 621PA 4MGIR 1MOZA 2IX3A 3KQLA 2VPPA 4RFSB 2ZRDA 2DFNA 4XOIA 3FFBA 4UJ3A 4RD2A 1F5NA 2ZR0A 3NC0C 1NIPA 2QN6A 3BXZA 1G64A 5AJYA 1XCMA 3RS5A 3MCAA 1ZIOA 3M6AA 3PUWA 3HU1A 1AGPA 3RS0A 2QE7A 5FBWB 2OCYC 5EP4A 4OHZA 1JEDA 3OE7A 4OHVA 3KQUA 5TARA 1I2MA 2D62A 1E69A 2ZYWX 5DI9A 4AK9A 4DHEA 3Q7PA 3MRSA 1OYYA 1NVUQ 4BUJA 1MO6A 2Q9AA 1GRNA 2JCSA 4TLAA 4KV9A 3VHXA 5AJVB 3L82B 1HT2E 4LPSA 4X8OA 3SN6A 4DVGA 2QTHA 3X1XA 4P32A 2H92A 3I1FA 3I4LA 1HE1C 4HUTA 5BWMA 1Z47A 4YC7A 2QEQA 4A0RA 1V5WA 2WWXA 4BFSA 4MKGA 2WWGA 1T3HA 3R9IA 4FD2A 2D7CA 3NBYC 1GKUB 1N6IA 4O3MA 1XMSA 4M9XA 4QC2A 4QKQA 1J70A 1W4BA 4AG5A 4PR0A 1GFIA 2OFWA 2W2TA 4NYMR 1KO4A 4PX9A 4YLGA 2JJ1A 1LB1B 3BIFA 4DEXA 3K0CC 2H57A 1VYVA 4GP7A 1WBDA 5KTYA 1UAAA 1ZNYA 3EPKA 1JR3D 5F9FA 1K6MA 1DAFA 4XWOA 5HE8A 1KK1A 5HCNA 3KFXA 2YWEA 4Q4JB 2F1JA 2JLYA 1N6RA 3FVQA 1ESNA 2FX3A 1II8A 1E9BA 4HAYA 5FUVA 2V6IA 3RSOA 2ZJBA 4JL5A 4MDEA 2VHCA 4XH9B 2VHTA 2WWHA 1Z2AA 2QP9X 2RCNA 2PJZA 5IRCD 2QM8A 2ZRBA 3THYA 2YOFA 3GJ5A 2BBSA 3ZZUA 5J47A 4GSYA 2RGNC 3DZ8A 1NVXQ 4GZMA 4OL0A 3QUSA 1ZW6A 3AVOA 2IHBA 3OAAD 1OV4A 3B1XA 3WMFA 1LTQA 1K5DA 4CEHB 4HZUB 3SZRA 4B76A 1NJFA 3CONA 1FFHA 1FX0B 3R20A 5AUPB 4IW3B 3I3SR 3QI2A 1DELA 4BFTA 4D4LA 1AQUA 4ESVA 2PEZA 4YONB 2CE2X 1GKYA 2HF8A 2ZM5A 3BB3A 1CLUA 2LKDA 4DCNA 1KMHA 1A1VA 1N5LA 2CCJA 1ZM4A 3QKTA 4LV6A 2IXFA 5J5CA 2RAPA 221PA 2BBWA 2Z4RA 1U0LA 4QBHA 1Q3TA 2ZJOA 3SHFA 2FPMA 5DH9A 4KSBA 2E1RA 3O47A 2ZUBA 4V02A 4HI0E 1IQPA 4DCSA 5C4MA 1WCV1 2V7QA 4HZIA 1UEIA 4TYNA 2DWOA 3C41J 1SQ5A 3KJEA 3PVSA 2GK7A 4RFVA 3QEOA 5EJEA 1R2QA 4LZZA 4C9BA 1M7BA 1P5ZB 2WPDD 4G3XA 1YZNA 4IOMA 2ODEA 3CNLA 5J40A 1LV7A 2NPFA 3BRWD 4UJ5A 1O87A 4XTCS 4Q7KA 5H70A 4D2IA 4LWZA 3ICEA 5CITA 3AUYA 4TYQA 3RRZA 3A1SA 2FMXA 2OE2A 4Y0VA 4PHHA 2WJHA 3MJRA 2GHIA 4ZCIA 2GXAA 4BASA 1JR3A 1YRBA 4TTQA 4A92A 1QG4A 4EPVA 2JLVA 1G4AE 2EWVA 1CJMA 1ZNWA 4DB2A 1PZNA 3LXXA 4GMDA 5JS8A 1D5CA 4Q66C 1N6LA 3K53A 4PSAA 1US8A 4LOAA 1U9IA 5TY0A 2OCPA 3T5DA 4WXRA 2YC2C 1FP7A 1KNQA 2YOGA 1F3OA 1XRJA 2ZAOA 4G0NA 2OCAA 3ADKA 2G1JA 3HR8A 2ZRMA 2H8KA 1N2CE 3AGPA 2O8DA 1YU9A 3B5JA 5JEEA 3R9XA 1NY5A 3OAAA 5FTJA 5JBQA 3DKPA 4WXPA 3RANA 1P62B 3CR7A 4Q1AA 3EC2A 3NHAA 1OPXA 4TTPA 5FI1B 4EPRA 5KU1A 1W7AA 3Q7QA 2H5EA 1RPZA 1KSJA 5FPHA 1JECA 2PLFA 1CF4A 3T15A 1E0AA 4GZLA 3BD9A 1IM2A 4BFZA 1T3SA 3ZJYA 3IEVA 2O8BA 2Q6TA 1GRQA 2GZAA 4JVNA 2ZUDA 3B7GA 5CDFA 1X8KA 1QHXA 1UEJA 4B3GA 3GLFA 1KNXA 5EXTA 1D6JA 2OESA 4NYJQ 3I5XA 3K0AA 2MSDB 4L9SA 3RS2A 4EFMA 2DBYA 1LY1A 3GJ6A 3W3ZB 4TMZA 3U5ZB 1UDXA 3QXJA 3AF3A 4GI7A 3THOA 5DIFA 1FMLA 5JWRA 4RKFA 1HQYE 3IO5A 1CULC 1KK2A 2R6FA 4NBSA 1JEEA 3THYB 4OQLA 3OHMA 1E4YA 1KHTA 2MMCA 2WPDA 3V9PA 4U00A 1VCNA 2OAQ1 4HAWA 3EZ6A 2ZRFA 4KLZA 2XOKA 4V0NA 2BOVA 2VA8A 5JSZA 5EE1A 1XNJA 4F7WA 1ZD8A 1II9A 1Z0JA 1HURA 2B7CA 4B48A 2GJAA 4FN5A 1D2NA 2G88A 2RB4A 4Q9LA 2HT6A 2VHUA 1T4GA 2YHSA 1DAIA 1WXQA 3IKJA 2VP4A 3CPHA 4LBZA 4LV8B 4NCIA 2ODWA 2QROA 5IHPA 4BLPA 1DG3A 1GILA 3SYKA 1OFUX 4B3XA 1MO4A 2FE4A 4A4DA 5BW8A 1KMHB 1W44A 4FI3C 5CDFE 4YDHB 3VR2A 1T3LA 1CJVC 4MRSA 4DWJA 3W8NA 1RKBA 3EPLA 2AXNA 1XTKA 3T61A 2QRZA 3QNUA 5LD2C 2G77B 1ELOA 1QVRA 2FV8A 3ADCA 2IYUA 4H1UA 1JPJA 2X2EA 1GTVA 3SE0A 2AKAB 2P65A 2DFKB 2VHQA 1U94A 2PX3A 2BJWA 2QMUA 1CRPA 1ZCBA 1ZVQA 1J7KA 1EFUA 2XITA 5BN5A 4C7OA 1IY1A 4MH0R 5DN6D 2HYIC 1G8GA 1NMYA 2P5TB 2J0QA 3EZ7A 2GXQA 2WJJA 2WOJA 2ZE8A 1TF7A 3DDCA 3MGCA 1G3QA 1RJ9A 3M1IA 4OHXA 5TB5A 2ZQ5A 3OEEA 2B21A 2IYLD 1ZU5A 4FXPA 1I4TD 4RZXA 1JXOA 3CNNA 4OK5A 3CX6A 2EYUA 3SFZA 2PCLA 1SVWA 4NCNA 3AP2A 1QHGA 3BH6A 4Q1CA 2ZITA 5F2EA 3VHLB 2W2XA 4LHYA 3U7HB 2ZYUX 5DI3A 1UJ2A 1K8RA 1TF2A 5ELXA 2OV2A 4Q4AB 4JLKA 1US8B 2QT1A 3EC1A 2DR3A 1E0KA 1OH7A 2FOLA 1A7JA 3IQWA 2RGDA 2B92A 4G5GA 4GMXA 4E03A 1IXSB 2KE5A 4I1VA 4FCWA 1T8TA 4PTLA 1XJQA 3B82A 1BMFD 3VR6A 2XAUA 1P73A 5ANRB 1E2EA 5AJZA 2FEOA 1ZP6A 2SHKA 5JJIA 2O8DB 4W9MC 1RYFA 4PC6A 2HCBA 5HKKA 1IXRC 5TXGA 1BO6A 4IEEA 1CIPA 1M34E 1W36D 2O5VA 2V54A 4YMWA 3QJYA 4EPYA 1OSNA 1E3MA 4HDCA 1ZC3A 2VSOA 4NH0A 4Z1MA 4AYXA 4BZPA 5H68A 4TZ0A 4NZYA 4QOSA 4A8JC 4JJZA 2A7QA 3RC8A 1PLLA 3LDAA 2O8BB 1NP6A 5JCPA 3NBZC 4DDTA 3MWKA 3LLUA 3QEJA 2GCPA 2CHGA 3LLMA 4P4SA 3OEHD 3T1QA 1Z5ZA 4TSFD 3UXMA 4Q5IA 3ADBA 2D7DA 3VU9A 3FHTA 4DJTA 2I1QA 4GT1A 1AM4D 2CHQA 3I8XA 3TAUA 3THWA 4RD0A 3K0AB 4QHTA 4Y0AA 2UKDA 1E0SA 1SXJC 1KO1A 2CE7A 1NN3A 4NE2A 3M4YA 1WRBA 2WBLC 3OF5A 1FNNA 4XD7D 3DHWC 1Z06A 1ZUNB 2AD1A 1GNQA 5E3HA 3NH9A 4FMCF 4XSGA 4DIEA 3EAQA 4YQFA 1UKEA 4ILEA 4A0HA 5A4JA 4XWAA 2OM2A 4B33A 3DPUA 3GPLA 5DN6A 4JLMA 4JSTA 5JSZB 2KBEA 1F2TA 1X8JA 3U44A 2P6RA 3UANA 3QXXA 1MV5A 4IFEA 2F6RA 4ACBA 3DMNA 2NZ8A 1ZM3A 2EVWX 1XCGB 3A8TA 4FIDA 4MYCA 4ZPXA 1R0ZA 1RRPA 2WWFA 5EP3A 3W6NA 2ZRAA 4M4SA 3SQXA 2HXYA 2YWHA 1UFQA 3AV0B 3CRMA 2IYTA 3RS7A 1A82A 2FPLA 3QVUA 4A2WA 1T8UA 2JJ8A 3AP3A 3K09C 2IEYA 3K9HA 4LC0A 3TR0A 1KJZA 4GOKA 3PV0A 4LUCA 3AVPA 5DE3A 4G5OA 3Q3JB 4RD1A 4RSGA 4D0NA 2JDIA 1BMFA 3BERA 2R65A 2ZRCA 3CWZA 1N6OA 4FMDF 4EKDA 4Q00A 4LRWA 1R4AA 3REGA 3QXCA 1G3MA 5JS7A 3TJZA 1GKIA 3PR1A 2LKCA 2XB4A 2A30A 3IHLA 2AHOA 4C7OB 4AKHA 2KJQA 4TT3D 4I81A 1S1CA 2IYVA 1WBBA 1JALA 3MSXA 1R0YA 2PT5A 3AEZA 1RJ9B 3C7KA 2ZTSA 3GEEA 3MLEA 5KOYA 1N5IA 4ERNA 1FUKA 2DFTA 5IK2A 2IS2A 4AKGA 1HTWA 1E9EA 3EASA 3FFAA 4HLUA 2ZE7A 4P4UA 1PLJA 2GEUA 1NL3A 1ZMXA 3DO6A 3QF7A 5FL7D 4TSFA 3A4LA 4GNKA 3D8BA 4CEJA 1X1SA 2J9RA 3GD7A 1OB5A 1AQYA 1GM5A 4TL8A 4BFXA 4G5SA 3NTUA 2JLRA 2GBLA 2QTVB 2QZ4A 3LVQE 5DI3B 4TYPA 1NVVQ 1GWNA 4M21A 1G5RA 2GVDC 4XD7A 2HDNB 4X8LA 2XJ9A 4D4MA 1CBUA 4A36A 1OXUA 4BFWA 1IY0A 1M7GA 1HE8B 3QBVA 2R6CA 1P75A 1XPRA 3DVLA 5FOSA 4BFYA 1HH4A 1W47A 3K9LA 4BLOA 2C04A 1QHHA 4POAA 3LXRA 4HUQA 2FSHA 2GJ8A 4JVLA 1S9DA 3AM1A 2BDTA 2B7BA 4C0LA 4AYWA 2O8FA 1CJKC 5FOTA 2QGNA 4NONA 2QG6A 3TSZA 5KSOA 3B78A 2GILA 3KKQA 5LBIA 2R6DA 2ATVA 3IIMA 3IGFA 3N2EA 4YMSA 3SYLA 3RC3A 2OLJA 2ZR9A 4D81A 4P4SB 5DYGA 3H1TA 1AKEA 3VU9B 2XJ4A 3MMPA 5L3VA 2WTUA 4AG6A 2VBCA 2WSSD 4HAZA 3THWB 3WRXC 1J2JA 4OQXA 3P32A 4B2LA 3X1YA 3K70B 2XSZD 4DIDA 3C16C 1DS6A 2YNMA 2D2EA 1KSFX 1QHNA 2W6JD 2GESA 3WXMA 4ON9A 2WM9B 3RHFA 3CM0A 2FWRA 2HLDA 2Q3FA 4BFVA 1P9WA 4TT3A 4EJSB 1U90A 5CLLA 4CW7A 3PQCA 4I1UA 3V4FA 3TIFA 4ESHA 1XTQA 5FTKA 4MYUA 1MRSA 4Z51A 3Q5DA 3MFYA 5KDLA 4O25A 2C5LA 1L8QA 1S3SA 4C0HA 4CGZA 5SZIA 4HAVA 1R0WA 1VIYA 4KYIB 3CWQA 2N46A 4US0R 3BGWA 2FGJA 3LQRA 4K46A 4V0LA 5FL7A 1NBMD 4A6XA 3K0CA 3VFDA 2ZSFA 2G9NA 2JLQA 1FOEB 4QGHA 4KBGA 2ZI5A 4FMDB 2FF7A 2OT3B 3TW4A 3PG5A 2P5SA 3X1ZA 1QG2A 1ZINA 5G3YA 4EUNA 2GJ9A 2D2FA 2YJTD 3CZQA 4C3ZA 2J41A 1R6BX 2R9VA 2C9YA 2NPIA 3BOSA 1HT1E 1KK0A 2BMDA 3FDIA 2REBA 1AIPA 1H8EA 2A2ZA 2ZRLA 4FW9A 1C4OA 1Z6XA 2CL7X 1WE2A 1OIXA 4NDZA 1TQDA 2DFLA 2PH1A 3UIEA 3GLIA 3NIBA 1CXZA 5DLQC 1NLZA 4JL8A 2CK3D 1Z6YA 2WWIA 5C18A 4PO9A 3GJXC 1A2KC 2JEOA 2GCNA 4ZI2A 4DKXA 4B71A 1DBSA 3A4NA 3RAPR 3HYRA 2IYSA 1ZU4A 1L4YA 4GP6A 1TNDA 1B0UA 2GXSA 2QAGA 4ABYA 3G82C 2IF2A 1R0XA 4DCTA 1GITA 2GXUA 2QY9A 4PC7A 3UWKA 1MABA 3RLFA 4KYUA 5FUWA 3JVVA 1LF0A 1VYTA 4II7A 1II0A 4OKSA 1TEVA 3TW8B 3W6OA 1PVOA 3O8BA 3SJCA 3WRYC 4MKHA 4URWR 1QHHB 1G7CA 3C5HA 1N5KA 1LW7A 5EUMA 1FL9A 4HUQB 4C30A 4MUAA 5HR5A 4ARZA 3AQ4A 2OFXA 5GJBA 2IYYA 1TTTA 4EPWA 1OT3A 3PJRA 2V55B 2O8FB 3PEVA 1Q1ZA 4HB0A 1OH8A 1VTKA 4TL9A 1XZPA 1NKTA 1L2TA 1L4UA 3AGQA 4TMWA 3L0IB 3ZS9A 1XJ0A 3TLXA 3I61A 2OG2A 3REFA 2OXRA 4HDQB 4LYFA 3K0FB 3G5UA 4IVPA 1LVGA 1QDEA 3K9GA 3CNOA 1XD8A 4NYIQ 1Q0UA 4GBMA 3QKRA 4D26A 3QF4A 3BFKA 3I92A 4R2IA 1KI9A 1DO0A 4KBFA 4CYMA 3HPRA 5UKDA 3X2SA 1CRQA 1G19A 2FPKA 3B13B 2IWHA 1Z0IA 3I62A 1W48A 1P61B 3RSLA 2XTZA 4S2EA 3QBTA 5JLJA 4V03A 3A58B 3FMPB 4QBFA 1JBKA 1WA5A 3EARA 4UNPA 5FL3A 3NEYA 2IXEA 2F1HA 4YDSA 3SU8A 4QM7A 1VPLA 1M1YE 1G6OA 1NI3A 3TKLA 3KXKA 1IXZA 5KSPA 2BCJQ 1P2TA 1PLKA 3GFOA 3L0SA 1NRJB 4B35A 3KQHA 5TMPA 4WOPA 4E22A 4BLQA 5HE9A 2WMNB 1VKJA 4HLQB 4KFRA 5E7JA 2C95A 3RRMA 2ZXUA 3BC1A 4A9AA 2Y8EA 4M1KA 3D31A 8OHMA 1KI1A 2C2HA 2OUKA 1GRRA 3ASZA 4DDWA 2Z0MA 2PJRA 5JWOA 4J0QA 4KI0A 1Z07A 4C0QC 5JFGA 2DPXA 4FWTA 2WJYA 1PV4A 1Z0DA 4TLBA 4GRAA 2EW1A 2I4IA 4C0BA 1WQ1R 1KDTA 3EG5A 4Q9KA 4HEJA 5FOWA 5KNDA 2BVNA 4NU0A 2DWPA 1IONA 1RVDA 1M2OB 2L0XA 2BBTA 5GJVC 1E1RD 1W0KD 2VO1A 1XMIA 2RGGA 4AD8A 1GNRA 2RGXA 1G9XA 2GTPA 3K0EA 4CT4B 1G6HA 1DOAA 4N0DA 2IS1A 3IBGA 3Q5EA 4PZLA 1GG2A 1W5TA 3RDPA 1G21E 1WDTA 4LDJA 1TMKA 1FTSA 3GFTA 1OW3B 2QAGB 3LRPA 3OIYA 4AI6A 1XJCA 1T5IA 4C2UA 4NPHA 4RZUA 5KDDA 3I73A 4LX0A 4C0KA 1W2GA 2V1XA 1CJUC 4KFTA 4BRWA 1PUIA 1U81A 1OFHA 1SXJD 1AS3A 2ZUCA 4PFSA 5FBVB 3TAHA 3ZLJA 1KYIA 2BKUA 1KO7A 4LY6A 4UQOA 1E2NA 3BK7A 3KX2A 4LBYA 1ZCAA 3SEAA 4TQUS 5BN4A 4DBLC 1XU4A 2CNWD 4DLTA 1VMAA 2B8WA 3FPAA 4ARZB 4N3NA 3SFVA 5D3QA 5LDDC 1TL7C 3QXSA 2JJ2D 4R7ZA 1DEKA 2CVFA 2IUTA 4XVRA 2OCBA 3AUXA 3SOPA 4JYBA 2FU5C 1Z22A 2JLSA 3EPJA 4EPXA 2ZI6A 5DISB 1P2SA 5AUNB 4JT2A 5JECA 3RWMB 3RWOA 2XXAA 4JBWA 4V0OA 5JHHB 2VHJA 4NCHA 3CRW1 4RD3A 1AJEA 2WHXA 4W7SA 1GDDA 5KO2A 5FPSA 3KKOA 1W0JD 1DPFA 2JLZA 4X8HA 1JAIA 3SHWA 1Z6GA 1BIFA 3RS3A 2E87A 2OHFA 3QKRB 3VKHA 3QF4B 4Q7LA 1RRCA 4TQAA 5HZKA 1JXMA 4PC2A 5JWHA 1E1QD 1S8FA 2AK3A 1Q1EA 3U2QA 3UATA 2A78A 1E1RA 4IKEA 2QMHA 4CRWB 1W0KA 3IO3A 2H7VA 1NJGA 3A4MA 4JKYA 1XP8A 4EFLA 1RE0A 1XZQA 2P2LA 1E9AA 4NCKA 3GLGA 4BFUA 3CUEF 1E94E 1R8QA 3B9QA 1HY3A 3IDQA 1EFTA 5FUYA 2HXSA 2OFOA 3CB4A 4UKDA 4R71A 1GVNB 1CJTC 2EFDB 4TLCA 3A37A 3AKCA 1IBRA 4EQ6A 2WKQA 1UDWA 1YQTA 2RMKA 4OHYA 2VSXA 1NNEA 3A36A 3VAAA 3IIKA 1EWQA 1G3UA 2F55A 2F1IA 3KUCA 3LX8A 2OBMA 4OK3A 4GDFA 4OI4A 4NP6A 3BBPA 4L4UA 2W58A 4S35A 4Q1BA 1W4RA 1FPMA 1ZNZA 4RKEA 1OB2A 3U7FB 2ZVQX 4K81B 2PMKA 1VG8A 2YWFA 3KFVA 1KAGA 3KXLA 2VP9A 2ZR7A 4KLNA 4RCZA 2PMDA 4BZQA 1W1WA 2CXXA 4PAQA 1JQJC 1KJWA 5LB4A 3ZYCA 1ZC4A 2J87A 2PBRA 1VYUA 4B6EA 3VR3A 2YKGA 2GK6A 3BH7A 4A82A 1UBEA 3BJIC 1YZLA 4KXFB 2VH5R 5CK5A 1X6VA 4HSEA 1BKDR 4L5BA 1DO2A 4US2R 4MRNA 1S9HA 3AF1A 2JIZD 2QSYA 3W6PA 3X1WA 4M1WA 1NSFA 4OQMA 1N6NA 3U3JA 4JZKA 2BEKA 1JR3E 1GIAA 3A1VA 1IN7A 3MUFA 1GOTA 4Q4LA 4URXR 2WMOB 3GJ4A 4PAMA 2QP3A 4RVCA 4A0FA 1II8B 1MRNA 4W5JA 3T06B 4YMVA 5FH9A 5LD2B 1H8HD 3VR5A 1W5SA 3OIVA 2BWJA 4XIGS 1ZUIA 2B8TA 4CT5A 2XZLA 1SVSA 2ERYA 3UG6A 4DCVA 1KY3A 3VTKA 1YVDA 1YZUA 2J3EA 3V00A 3U61B 4E5UA 3QENA 3EIQA 5KHOC 4OI1A 2DWQA 2F9LA 3LV8A 3WBKA 3GFPA 1AN0A 3FE2A 1U0HC 1XWIA 2FJUA 4LBVA 2ZSAA 5AJWA 2QMOA 1FZQA 2ZJZA 2VF8A 3GLHA 1T0HB 4LJ5A 3IIJA 5EXPA 4ZDIA 1OH5A 1OHHD 2J7KA 3QIAA 4MGYR 1MH1A 1X8LA 2ZS7A 4R98A 2ERXA 5IDVA 2IHYA 2QM7A 3OESA 1Q1BA 3IILA 1AS0A 1VIAA 1MO3A 1VDZA 2WOOA 1Q22A 2R8RA 4M22A 4I99A 4H9GA 2W6ID 4BZXA 3GLFE 1T91A 3AKDA 3UMSA 1A2BA 2RGCA 4LJAA 3U3OA 1FQKA 3LD9A 4R9UC 1Z0FA 3QPWA 3DEFA 1RW4A 4IFBA 5EE9A 1G8HA 2HUPA 3F3YA 2O0HA 4M8NE 2G1KA 2ZREA 2ORIA 5JRZA 5JCZA 5CYOA 3VQTA 2XEXA 1P6XA 4TZ6A 4QJ3A 2ZJAA 4ZIRA 5DGXA 2IWRA 3NBXX 5IF9A 1Y3AA 2RHDA 4LJ4A 5FFMA 5JJLA 2XNSA 1OE0A 2KB0A 4Q1FA 3GLHE 2ONKA 1ZM7A 2JIZA 5D3MA 1TUEA 3RRYA 4D6PA 3SBDA 1OF1A 1FP6A 3P4XA 4ACAA 1E2FA 2ZAMA 3TNFA 4DSTA 4LJYA 4B44A 2GCOA 3L0OA 1D2MA 4IVRA 4B43A 1OIWA 2HCJB 2O0JA 4EQ6B 1UBGA 4QFMA 1ETUA 4DEYA 2ODBA 2LCFA 2OBNA 5L3RA 1H8HA 2VLIA 3ZZ0A 2PZGA 2AXPA 2QUZA 1DAKA 4PQFA 5SZHB 1M6NA 2JAQA 1BS1A 3KJIA 2YWGA 2FA9A 3UMFA 2JLUA 3SS8A 5CIQA 3WY9A 3THXA 4OYHA 5JEDA 3ONWA 1CR0A 1XMVA 2REXB 3BB1A 2ZIAA 4HLDA 3PIRA 5FOVA 3CH5A 2J46A 3E5HA 1YR8A 3B8HA 1Z83A 3IPYA 2ECKA 1OHHA 1CR1A 3CRQA 2IYZA 3C14C 3T1OA 1E0JA 1IJFA 2I3BA 4IVQA 3DKVA 3SYNA 4MRRA 2ZRHA 3OIWA 5DO9A 4TLDA 1XB2A 3OFND 2AFHE 2P3SA 4QBGB 2P67A 4LK2A 2OAP1 4PPFA 2AL7A 1Z0AA 1AKYA 3GLFB 1OXVA 3MAAC 4JL6A 3MD0A 2P6UA 4LC1A 4BLSA 3KKMA 4BLTA 2RGAA 1G17A 2WWYA 1COWD 1F48A 1YZQA 4PSKA 1JAHA 3FB4A 1J99A 5EXXA 4QGAA 3ZQJA 5G53C 3KJGA 4MKFA 3PUXA 1S0UA 3CX7A 3EXAA 4UXJA 3PEWA 2O8EA 3RVBA 3F5FA 1E2LA 4Q9IA 4UNNA 1Z0KA 5CJ2A 3AVQA 1ZIPA 1Q12A 2EYQA 4U5XA 5AK0A 4Z8YA 4WW0A 3GLHB 1U9IC 2TMKA 3ECCA 2NO0A 2UZ3A 3U60B 1CEEA 1XTRA 3MJHA 1Z8FA 2QPTA 1QHSA 3VR4A 3IUYA 1QHIA 1YE8A 1N0VC 4M0LA 2WIBA 1GL7A 1ZNXA 3W5JA 2XNDD 3HU3A 4WA7A 4Q01A 1HEIA 1D9XA 3WNBA 3P1JA 5G3ZA 2WVJA 2GZHA 2QBYA 4JVMA 2GA8A 2IS4A 4QRHA 5GJCA 2Q21A 4QJ5A 4CZ2A 4F93B 1SVIA 3ETLA 4OJQA 3N70A 1KDOA 1Q21A 1DE0A 2JATA 1EK0A 3EA5A 4JLNA 4HB4A 2XTNA 5LPNA 4MYHA 1ZUHA 3H86A 1P7CA 2MMGA 1LF5A 2XB2A 4DLUA 4P3YA 5D3MB 2ZEJA 2FSGA 4JBXA 1HA3A 1BOFA 3OEHA 1LS1A 5IT5A 1XD2A 2GCOB 4URUR 4A2QA 5F98A 5J4YA 2QAJA 4NYJR 3T1TA 2ZSBA 3AB3A 4EIWA 4B3DA 1R7RA 2N42A 5E95A 3VNVA 3FKQA 3B1ZA 3WYFA 2CL0X 3TE6A 4PHTA 2IBMA 3BH0A 1E2GA 2BMJA 4GOXA 1C9KA 2PZEA 2R62A 3LAWA 2W0MA 5C4GB 3UPUA 2A3RA 3T35A 2NZJA 3ZVRA 2ZRIA 5KSYA 4PQYA 2X19A 4EPTA 5L3QA 1ZM2A 5EXSA 1Q1QA 1WP9A 2EFHB 2BV3A 4KVGA 3VMFA 1DAEA 4LYAA 1E9DA 1NF3A 2NIPA 2NO6A 4A0GA 2O8CA 2A5YB 2JA1A 3B1YA 1XEXA 421PA 1JJ7A 5G40A 3SJBA 2JLWA 4KITB 3Q72A 2ZRNA 3V4RA 5TDHA 1P60A 2Z6VA 3LFUA 1I4LD 4B2PA 4A15A 3WHLA 2ORVA 2RGBA 2NMVA 4M1MA 5FBQB 3C5CA 4P0TA 3VKGA 4EDHA 3SJAA 1E2JA 2IYRA 1KSHA 3U3KA 3TUZC 2GF9A 3Q8XB 3ZD7A 4OI0A 5C2JB 3AKEA 4W5HA 1U99A 2CBZA 1CS4C 1DVRA 1VG0B 1KO8A 5FOUA 4C0JA 4Z54A 5B57C 1Z2CA 2VRWA 3ZDQA 2A5GA 5DHFA 2AX4A 2O8EB 3FHCB 1KI7A 1N6PA 3L0PA 3LY5A 4PHFA 4M2LA 3ZZTA 4NYMQ 3GMTA 5JRJA 1FMJA 1Z6AA 3UMRA 4DLYA 4KCGA 3CKLA 4JSYA 4PPGA 1F2TB 3U44B 2ONJA 4Q03A 3B9PA 2JLXA 1U8YA 2V6JA 2CLCX 3ZIAD 1W4CA 3HPQA 821PA 4TWZA 1L7VC 3TUIC 4PAOA 3F8TA 3NDBB 2OEPA 4PPQA 4TMVA 2Z83A 2ZS8A 1KI8A 4B47A 2VP2A 2J7PD 2QQEA 3D6TB 4C4PA 2H18A 1WB9A 3WYGA 4DRZA 4TMXA 4CEIA 3WNDA 2QQ0A 2J0VA 3E1SA 3HU2A 4ASUD 1MKYA 2VIIA 1QBKC 2IUUA 2B6HA 5FTLA 1YZGA 3F0TA 3KL4A 3U7EB 3G0HA 5FOXA 2YV5A 4IDOA 3CF0A 4ZCLA 1XF9A 4LJ8A 2QBYB 4DUGD 4U7DA 4URVR 2Q9BA 2ZROA 2BJVA 4IOLA 1NMXA 1VCIA 5EE0A 4RZ2A 1XDBA 3KB1A 2PLRA 2VTKA 2BCGY 4HB3A 2EQBA 4LI0A 2V1UA 2RGNA 4D25A 3B60A 1W36B 2GAAA 3L2OB 3WP0A 3B2EA 4CIDA 1KDPA 2G3YA 3HYTA 2QL6A 4C0SA 2NO7A 4MGKR 3CRVA 4L9WA 1U2RA 4B2IA 1ZBDA 3EZFA 3HDTA 2BM1A 3KJHA 3ZGXA 3K70C 4JVSB 2AKYA 1OFTA 4ZO4A 521PA 2K5UA 2F43A 3CPEA 2Q3HA 2ZJ8A 4I1SA 1RFLA 4JYCA 4UXIA 3TVDA 4EAQA 4CEJB 2OXCA 1XD2B 2WSSA 4O2RA 4EJSC 3RYTC 2ZYVX 4FWIB 2XSZA 2PZFA 4RCYA 3A1TA 2W6JA 4Q48A 3H4MA 4JIMA 1KZGB 2FFAA 2DCUA 5FUXA 3VX3A 4IOJA 2ZRPA 2CJWA 1JB1A 1YZTA 1QVAA 3K1JA 3CRRA 3DOEA 1JJVA 3CLVA 2QSZA 3WNCA 2J0SA 4IDPA 5JMTA 5DYIA 1SVLA 1TU3A 1E9FA 3BE4A 4IXNA 2FZ4A 1N25A 4MRVA 5L3QB 4WAUA 4Q7JB 2C99A 3ZIAA 2X77A 4ZDKA 3AVWA 1KSGA 2O8CB 4LHVA 4IEIA 1XEXB 1X3SA 3GLIE 1O3YA 2EU8A 4CVNA 5KPJA 5BXQC 1NBMA 5LB2A 4M1TA 2H16A 3CIOA 4ZCMA 5L8VA 3TGPA 5E4FA 2J7PA 3AH8A 1YRAA 1F60A 1E79D 3BFVA 5E7MA 3Q85A 4Q9JA 3ZVNA 2QA5A 1W2HA 1YR9A 4ASUA 1KOFA 3NKVA 4RD4A 1FTNA 4OQNA 2PL3A 1P72A 2G0NA 3ZH9B 2IC5A 1N6HA 4AC9A 2GEDA 4Q02A 5B64A 1E32A 3WHKA 4L16A 1TPZA 5J4HA 5KUTA 4IDHA 4LGMA 2ZI3A 3SNHA 2Z43A 3ZD6A 3CZPA 5KPDA 4HYYA 2ZPTX 4IRUB 1FUUA 1PUJA 4HLUC 3EX7C 1BYIA 4P4TA 3EIHA 2JJ1D 5EZ6B 4DLRA 2R6AA 2A5DA 2KWIA 3AVYA 1A5TA 3B1VA 3QSYA 1ZAKA 4HATA 3OZXA 2CK3A 3L8ZA 1MR3F 1UPTA 4LJ7A 1U8ZA 2FFBA 2P6NA 4BRUA 4UXHA 4JMPA 4WBSA 4XJXA 2DY1A 1AZSC 2YVUA 3CX8A 4C0AC 6Q21A 1NBME 2ZYTX 3WBJA 1OXSC 1EG7A 1M8PA 1OXTA 3N2IA 3S1AA 4X8MA 1XX6A 4I4LA 4CEIB 2YINC 3QKUA 4GOJA 4UNSA 5F3WB 1KKMA 4DSUA 1NVVR 3KUDA 1TF5A 3NG1A 4QBIA 3U3MA 4YMUA 2ZE6A 2NO9A 2PCJA 4Q19A 1W49A 4BQSA 1FW6A 1B23P 1XD9A 2PX0A 3FMFA 1KMQA 1J90A 1RRFA 2VEDA 1J8MF 1UF9A 2AWOA 2FG5A 3QVVA 1YJ5A 4V0KA 4D0LB 3RABA 2C98A 3NH6A 3ADDA 4CF7A 3KDSE 1KJYA 2QT0A 2CCGA 2CEAA 3VX4A 5EZ5A 1U8AA 3TQCA 2NQ2C 4PSVA 4QHYA 1YKSA 3GLIB 3PEYA 4UNRA 2AWNA 4BLRA 1IY2A 3TSWA 1KAOA 3P4YA 1IN8A 2OLKA 1E2DA 1PJRA 4Q21A 1E79A 4EFNA 2F43B 1IN4A 4JLDA 1VCOA 4LBWA 4Q1DA 1T6NA 4JT4A 2CDNA 4B3FX 5EE3A 3IBYA 1E2IA 1S3GA 1HUQA 2V7QD 5TV2A 1XPUA 4LYHA 3LBIA 1NG1A 3LX5A 3LW7A 3W34A 1KTVA 1MABB 1M7HA 2OSBA 2CL6X 4P31A 1EXMA 3FKSD 1E2MA 2FN4A 4QJ4A 4ZV4A 3ZVMA 2R44A 5L3SA 3LWNA 1NLFA 3AP1A 1SGWA 2IYWA 3HP1A 3PUVA 2FZLA 4R2HA 3ND9A 3TBKA 3AVUA 1W4AA 2CJWB 1NSTA 4HDOB 1P2UA 1U0JA 4WZAE 2GWHA 3UKDA 2BC9A 1G5TA 2CHVA 3W9YA 1AK2A 5TVKA 2WJVA 4PANA 4ZDWA 1IN6A 3KQKA 1MT0A 2BM0A 4TL6A 4B75A 1S96A 3LVRE 1ZRHA 1SHKA 3H0KA 2WKRA 1IAQA 4RD6A 3T1VA 2ZI4A 2DHRA 3DZDA 2VP5A 3U3RA 3EWSA 2C03A 2I1VB 2GRJA 3KKNA 4M1SA 5CB6A 1NN0A 3JVUA 2Z4SA 3SQWA 3W3AA 1P4SA 1KI6A 4K8OA 5EQTA 4BE7B 4YMTA 1XFAA 4N1AA 1G3RA 4D4KA 1E99A 2X1VA 4TL7A 1VHLA 1XEWY 5F9HA 5HCIA 1UBCA 2AD5A 2FSIA 3X1DA 2HT1A 4DC9A 2H1LA 3ZVLA 3EW9A 121PA 1G8YA 2C9OA 4F4CA 1S1MA 3CF6R 3H2YA 1D2EA 1RRGA 1EX7A 2FSFA 2VL7A 3PENA 1G16A 4QXAA 3QOFA 1CTQA 4WVFA 2IA5A 4N0EA 3Q9LA 2Q3MA 4Q18A 1N3BA 2EFGA 1SVMA 2QAGC 4M1YA 2A9KA 5K8UA 2BMFA 1QF9A 2MSEB 1D9ZA 1Z28A 3KTAA 3QPUA 2XGJA 2GJKA 2AFIE 2REOA 2ZANA 4A8JA 1CKEA 2RHMA 4OHWA 1H65A 3DM9B 3DOFA 5KYKA 3S1AB 3UK6A 1N0UA 2V8OA 1GL6A 4ITRC 4QNRA 3TH5A 3FKSA 1UKYA 2W83A 2XOKD 4WZ6A 4AKEA 1SXJA 2C77A 1GUAA 2DYKA 2IUSA 1R8SA 4Q1EA 1G7RA 2IS6A 2CLSA 1SKYE 2ZRJA 2QTFA 1OIVA 3PFIA 3KKPA 5CJPA 3IHWA 4TYYA 1N5JA 4ZI3A 4MGZR 4MUBA 2WV9A 2CNWA 4BWYA 3WYAA 3NHBA 4H1VA 2WWWA 1X1RA 4XVUA 3FMIA 3QG5A 3TK1A 4L8GA 2JJ2A 4Q4AA 4DCUA 4DLSA 4BEJA 1GP2A 2Q9CA 2KI5A 1VHTA 2CVHA 1E9SA 5AR1A 2FFHA 1NKSA 2GZDA 3A1UA 4A6PA 1J8YF 5GADl 4KSCA 4DZZA 2XZPA 1R5NA 3GLGE 5FI0B 2EFCB 4FINA 3K09A 5FBRB 3SR0A 1EESA 1XEFA 1Z63A 1W0JA 1VECA 4XWKA 3U6BA 3NEJA 4Z8XA 5KNBA 1R5OA 5L3SB 4NYIR 2QPAA 3KZ1E 5JHGB 3PEUA 3FOZA 5EP2A 1SXJE 2QORA 3OEED 4ZDJA 1DAHA 3FTQA 1E1QA 4MDFA 2WIAA 1U98A 2D74A 4MQBA 3QG1A 2LWIA 4D80A 5AJXA 3T34A 1ZD1A 3K9NA 4IDQA 4Q4HA 4OI2A 2RH5A 2ANCA 1UADA 2YOHA 1G18A 3P20A 4Q9HA 1FNMA 3R7WA 4NCJA 3GQBA 3RRNA 4DB4A 2E9SA 2Q0HA 2C9CA 4NMMA 5GJWC 2J45A 1Z6TA 4TLEA 3O8CA 3E2IA 4PO1A 2XXAB 1KI6B 4HAUA 2UZIR 2G0TA 5AUQA 5P21A 5FPTA 1KO5A 1TUIA 1G3IA 5J4LA 2C78A 5FPKA 4AWXA 3PITA 4TN1A 1LFDB 1R10A 2V4ZA 2QP4A 5HKKD 2HEIA 4F4JA 1CR4A 1SKYB 4Q7MB 1P3JA 3CH4B 1AZTA 4Q47A 1K5GA 3QE0A 1G20E 4Z1MD 2EFEB 5KNCA 1C1YA 1ODFA 2ZU6A 3VNUA 3MWJA 1WF3A 5JI3E 5C46F 1P9RA 1KI2A 3VR1A 3JZAA 1G291 4RJLA 3I5YA 1YZKA 2VP0A 2AN9A 3IEUA 3WMEA 2GETA 5CB8A 1XTSA 3KTAB 4WIAA 1CP2A 5G41A 4OQFA 2EWWA 3AF0A 1T9HA 4JLAA 1LS6A 4MYTA 5E7IA 3K70D 2G6BA 3BS4A 1XBTA 4A8JB 1A4RA 1KY2A 2OO7A 1RYHA 2ZS9A 3GLGB 1KKLA 5AUOB 5HTKA 3QXHA 2HV8A 4A2PA 3SI7A 3WMGA 3PUYA 3SDZA 1E2KA 5FBLB 3R8CA 2HJVA 3ZS8A 1SVKA 5M04A 4MITA 4IOKA 2IF0A 1JQLB 2A5FA 4JKIA 1Z3IX 2VQSA 3GJ0A 1DTSA 1ZD9A 1NG9A 1T5LA 3AF4A 3PCRB 4C2TA 5EE5B 4I1OA 2O0KA 1SXJB 2OBLA 5H8WA 1UKZA 1SZPA 4PO8A 1XXHA 4KHZA 1CU1A 2GF0A 1D8TA 3U4QA 2FDCA 2QI9C 1UKVY 1E6CA 1I4DD 1EFRD 1ANKA 3UG7A 5HZHA 2ZRGA 4B74A 3AVVA 4IHQA 1NMZA 4U02A 2OZEA 4AURA 4HAXA 3PXGA 1KZ7B 5FTMA 1WMSA 4BPBA 4PHGA 4V0MA 5FR1A 2F1RA 2PT7A 2IK8A 2J0UA 4IDNA 2MSCB 1KDRA 5A5GA 1GL9B 4QM6A 1P2VA 1TQ4A 2JDID 2ZE5A 4XSHA 4OK6A 3JZMA 1EWRA 3B1WA 2RKOA 2FFQA 3L8YA 5CYPA 4E09A 2HF9A 3K0SA 3MWLA 3NBFA 2W6IA 1F2UA 4M1OA 5SZJA 2GEVA 5FPYA 3B85A 3RS4A 3A6PC 2ODNA 721PA 4F92B 4US1R 5BN3A 4E07A 5IK2D 1XXHE 2F9MA 3CR8A 4DDUA 4QNMA 4DDVA 4Q4HB 3J81k 2QMEA 2FEMA 1P9NA 1E2QA 2HJGA 2AR7A 2GKSA 2XZOA 2R2AA 4D0GA 2WKPA 3NVAA 3R7WB 4AYTA 1G5PA 2QGZA 2BBOA 3AF2A 3L43A 2NG1A 3K8YA 2D3WA 1F6BA 4DLZA 4V0ME 2BIFA 1TU4A 2BEJA 5BYKA 1ZJ6A 1AA9A 4D82A 1SULA 5K8TA 2ATXA 2J5XA 1HV8A 2GDJA 2W0SA 3QKSA 2WJIA 2GVZC 5BYJA 4EJSA 4M9QA 1X86B 3MG9A 3O8DA 3EZ9A 4M9SA 4URZR 1JNYA 3BB4A 2QRNA 1GAJA 4GPTA 1QHYA 1IJEA 4NKRA 3D3QA 2CMKA 3SC3A 1VG1A 4KVAA 3HJNA 3TSOA 1G8PA 3LO5A 3NDPA 1Q44A 1EFRA 2J1LA 4KODA 4HB2A 5B30A 3VKWA 4PQRA 3ICQB 3AKYA 4JLBA 1YR7A 3BAFA 4OBEA 3TVTA 4DXAA 3I8SA 4PZZA 1XEWX 4LHWA 2ZVPX 4ZIRB 2V3CC 4LSGA 3I32A 4JLJA 3C8UA 2AK2A 3TQFA 4JLVA 2P0EA 3BWDD 1N0WA 4BGDA 2C96A 2BMEA 3AVXA 4BECA 4LCBA 4B32A 1SHZA 3OFNA 4KO8A 1YHNA 4RZ3A 2ZSEA 2OILA 1EGAA 3HWSA 3DL0A 4KFUA 3RNLA 2ASEA 1JI0A 3GJ8A 3KXIA 1GZSA 2YC4C 3I72A 5CM8B 2HLDD 3H84A 2ZU0C 4PPNA 3EZ2A 4M53A 1G8FA 2WZQA 3CPJB 4LJ6A 1COWA 1EFHA 2IT1A 3LBHA 1XXHB 4LHZA 2FH5B 4JS0A 1Q3HA 3LBNA 4G5QA 5K8IA 1Y63A 5JJKA 1XPOA 3U4QB 3FHOA 1E2PA 4D4JA 5GVSA 5K8LA 4PC3A 4QGFA 1TADA 2NTYC 3U6KA 1KK3A 2WAXA 3THXB 4DSNA 5KDOA 1OFIA 3PUZA 4FCVA 5FR2A 2VP6A 5B58C 1OJLA 2BKEA 1DAGA 1TX4B 4PXAA 4AKIA 4LV5B 3CBQA 1Z08A 2NGRA 4MRPA 2HYDA 3CW2A 3GJ3A 4B34A 1XTJA 2J0UB 4DT1A 1G1MA 2IXGA 4MKIA 4KJZA 1EX6A 4B6FA 4AY2A 5DSZA 1OKKD 3TUJC 2Z5FA 4QGGA 2VYFA 3FYHA 1E9RA 1DARA 4G01B 1TAGA 3UWOA 2VSFA 2WSMA 3ZQ6A 1H8ED 1QZXA 2XNDA 1S2MA 1SKQA 1F2UB 2WICA 3U7GA 4JLOA 1TQ2A 1E4VA 3IPXA 4A1FA 1DAMA 2ZJ5A 3CO5A 4QL3A 2H17A 4QG7A 4KU4A 3EIEA 4LJ9A 1G7SA 3LA6A 5DHAA 2QPOA 5FTNA 2GJSA 3W5IA 2X8AA 4YXWD 3FWYA 5JI2E 2WJGA 1IN5A 4L15A 2ZJYA 5H1YA 1TEXA 2KBFA 4OJKA 1KI4A 2CCKA 2ZJ2A 3B6EA 3C4JA 4XTRA 1DADA 1AS2A 2ZI7A 1ZM9A 4FMCB 1FQJA 2C8VA 4PC1A 3T12A 4W5WA 1OYWA 2GNOA 2F7SA 1I2DA 2CLDX 3E70C 4O0MA 4URYR 4ZKEA 3K0FA 2F3TA 5CIWA 4DSOA 1Q57A 3BORA 3GJ7A 2ZRKA 3GEHA 3NWJA 1R5BA 1E98A 4RFSA 1OH6A 4JBYA 3ASYA 1CR2A 2PEYA 1GNPA 3GEIA 3QKSB 1NIJA 2V9PA 1N6KA 4F38A 4FCTA 3O8RA 4B73A 4DLWA 1EFCA 2G83A 4GFDA 3DMDA 3FGNA 4M9ZA 1RZ3A 1LNZA 3FMOB 2IYXA 1G4UR 3P27A 4P33A 4TYWA 1MO5A 3GCGA 4IJMA 5BQ5A 3TR5A 2WAYA 4QHSA 1TQ6A 2UVQA 3QPVA 1E9CA 1W46A 2JASA 2D06A 1M74A 1G7TA 3EPHA 1NN5A 3MWYW 5J4VA 2O52A 3P26A 3IQXA 1UBFA 3SBEA 4TTRA 2IYQA 3GP8A 1KI3A 3ND8A 4CDGA 1QRAA 2ANBA 2RGEA 4XVQA 1VG9B 4JLPA
chains in the Genus database with same CATH superfamily
1T9DA 3O7WA 2P2ZA 3ETGA 2X7JA 1EHYA 3HKDA 2QYSA 4MVJD 4XYBA 1JP7A 1ZD4A 2NO1A 1N7HA 1OKKA 3VV2A 1ITZA 5BR7A 1KU0A 1V43A 1X77A 1YR6A 2LIVA 3FYUB 3HMQA 5GM2A 5LXTF 4P0QB 1SQFA 2B2NA 2CDRA 3KB2A 1AGRA 3INYA 4FNOA 3OT4A 4KPYA 3EIFA 2WVAA 3E7DA 2GEBA 1IOZA 3AJRA 2PWPA 2HHHB 4O2LA 4PVCA 4JASB 2O8VA 3SC2A 3R8FA 1Y3HA 3V34A 4DEVA 1WCIA 3R7AA 2C2OA 3AHCA 2C2GA 3T9BA 4GGPA 4FKMA 1I0IA 2BZ0A 2R7KA 1WEHA 2D4HA 5BMVF 3EWAA 4LYJA 3ZBUA 3W8RA 4LPKA 4BVFA 3O0DA 2NXCA 1GNVA 1F51E 4IXMA 4Q1VA 3SJZA 4K40A 4KK3A 1U2PA 1I7LA 1V4VA 3DWIA 1PL8A 1K8ZB 2XT6A 1PCXA 2EX1A 3EOZA 1H4SA 1HQCA 4JUBA 4YXFA 1MF7A 2C8KA 3GC6A 5DWVA 3ITDA 5KOHA 2AQIA 3Q8KA 1QGZA 3BXGA 5E2BA 1G41A 1E3JA 4TMKA 2AJCA 5TJHA 2WHPB 1SVOA 2B8JA 3H9BA 1N2BA 3S2GA 3E9CA 2NSJA 2ZTMA 4HQLA 1Q84A 4YJ3B 2WZDA 5LL6P 1A5AB 2C1ZA 2WG0A 4JR1A 3TTSA 1MMFB 2HU7A 2WJPA 4XIYA 4Y9TA 3TJMA 4GC5A 1CQPA 3NOVA 1VPTA 3VH4A 2R68A 3K3PA 1WSAA 4D0RA 2GAIA 3E84A 1ISSA 2A0WA 3DM5A 5GONF 3T5GA 4DDHA 3AVTA 3WP1B 4GVLA 3MT9A 4H35A 3CF2A 3VAYA 3UK1A 2FNAA 3IAHA 5LKRA 4QOIA 2DB3A 5K01A 1W36C 4E5KA 3LNCA 4G1FA 5HTOA 2QD5A 4TXHA 5TQ2B 3TFOA 1IPFA 2ZB4A 3QE4A 3W0LB 4DADA 1X74A 1C8BA 4WZBE 5INTA 5JXIA 1A9TA 1FXWF 2OD9A 4HZUA 4K86A 2QU8A 1NF8A 4IVNA 3VUEA 4LF7B 1OXXK 1JPNA 4A5SA 2NVOA 3DOOA 2GFIA 3A1WA 4B3CA 2ISCA 1E5QA 3B5IA 4II3A 1KC3A 5CXUA 3LQ1A 1AG9A 2IEZA 1ZVMA 1ETHA 2RHHA 3K6KA 3ROTA 2B2XA 2GBLC 5FV4A 1CQWA 2H4WA 4D9NA 5DLDA 1JH8A 4BCDA 2E5LB 1BOOA 4CIVA 3IOYA 4AIIA 1S4QA 621PA 1GN9A 4N6NA 4YRDA 3PQ3A 1MOZA 3FPFA 4JXZA 2QHXA 4ISCA 1WV0A 1JG1A 3KLOA 4FE7A 1MJGA 4WV3A 1YJ8A 1D2CA 4C4YA 2C5AA 5IEJA 3JQ9A 2C0PA 1ULUA 2NUAB 4DARA 1RWWA 1T10A 3ZCSA 1EP1B 1XCMA 3L92A 2GBCA 4C06A 1VPEA 3EJ6A 4PF1A 2EARA 4C4TA 1EGHA 3PUWA 4O5OA 4UHHA 1JSLA 4ZU6X 4JYZA 1AGNA 1AGPA 1OREA 3EUAA 3HSYA 2B1JA 1B14A 4J03A 4Z9AA 4LSMA 3ZDAA 4CMIB 4UHDA 2F62A 4OHZA 5DBHX 3L7CA 2Z6AA 4O2BA 1I0ZA 3GVHA 1EJ0A 2D62A 2XLBA 2DR0A 1XZBA 3N74A 4AK9A 1Q16A 1Z8HA 1AHHA 4UVGA 1J09A 1O95D 1T9AA 2DVMA 5AICA 1OYYA 4U6SA 2RKWA 2XLCA 4HNHA 5FCDA 2IHUA 1KEPA 3KSZO 3AEKA 4N82A 3K73O 3HCPA 4DPLA 2UZ1B 4RE6A 3V8QA 3JYNA 3ZBTA 3KS9A 4RW0A 4Y1EA 4R1UA 1JIUA 3L8HA 1O97D 4P80A 3F98A 1SJ9A 2PLAA 1UZNA 4RYDA 3VUFA 5HUQA 3HKDB 1AX9A 1RI5A 4JNCA 3R0VA 4LPSA 3O1IC 3PQDA 1RYBA 1Q7CA 3ROPA 4P32A 3QOXA 1ORWA 1OVGA 4COOA 1R0SA 3OSUA 3EQZA 1I30A 2WYHA 4QSHA 4YC7A 2CJFA 1QOZA 3RVJA 1E66A 2WIGA 2WWGA 1T3HA 3MRTA 4MKGA 3R9IA 3SC2B 4BFSA 1GUDA 2RC6A 3QEKA 2DT8A 1WCIB 4IIEA 3SLRA 4Q24A 3AFGA 3WK9A 1MH9A 1N6IA 1HC7A 3X2FA 1QNLA 1KZ4A 3VI4B 1LRLA 5JNVA 3I83A 2QLJA 4Z86A 4QKQA 3SG0A 1W29A 2G9UA 1GARA 3IUBA 3SXPA 1XLWA 1RAGA 3H4TA 3EBOA 4XB6B 1MQ8B 2O9JA 4RK1A 4NYMR 4FI3F 1KO4A 4PX9A 4YLGA 4AO7A 2PUDA 4H59A 2X0JA 5C1PA 3ZTYA 2FG7C 4GP7A 1VYVA 1WBDA 5AW8A 1ZWKA 2X9VA 3EGOA 5KOHB 4PLVA 1ZNYA 1XSEA 3EPKA 1O4VA 3ISTA 2QLLA 3LUDA 5NLLA 5HE8A 2WY2D 1KK1A 3W4JA 1UQRA 3UKOA 5BRNA 1CWUA 5BSMA 2VA9A 4HAYA 3KZVA 3OJ0A 2ST1A 1IWBB 2VHTA 3OIGA 3ORYA 1Z2AA 2QP9X 4KXVA 3DEKA 4IX1A 1QGUA 1JHMA 2M1XA 3FPGA 3D4IA 3I2GA 3GJ5A 5J47A 4LXXA 3I9JA 5B4TA 4WMLA 4PFKA 4BVEA 2JFNA 5CDYA 3DZ8A 4GZMA 3QUSA 1ZW6A 1KAEA 3RREA 4RK6A 2IHBA 3OAAD 2O1WA 2O3UA 3WMFA 1LTQA 1RXIA 3OCWA 1UANA 4GUDA 4HZUB 3SZRA 3FN4A 3QBEA 1FFHA 4ZJUA 3R20A 4GD3Q 1F4PA 3HCCA 3HYCA 2B5OA 1TT5A 3I1IA 2PAFA 3I3SR 5FHRA 4BFTA 1TYEB 5K0SA 2F3QA 4YONB 2OHHA 4XUEA 1BWSA 1Y34E 4FZRA 3K71B 1N5LA 2XMCA 4E3WA 1JILA 1ZM4A 3QKTA 4NFSA 1WB5A 3OZEA 5J5CA 4RZHA 4AJEA 4M8IA 1JBEA 2GO1A 3IVAA 3MZ0A 2BBWA 3ANMA 5IARA 1KFKB 1Q3TA 5AI6A 2ZJOA 4OMDA 1INLA 4KSBA 3IB3A 2AN1A 4KO3S 4V02A 3CN9A 3L7LA 4DCSA 1QGOA 4HYTA 2V7QA 1N2CA 4M0PA 1UEIA 2H2AA 1KY4A 1ZO8A 2DWOA 3FPCA 4JEHA 4MQMA 4ZWNA 4B2IA 4B87A 4CQMA 3QEOA 4G4JA 3I1JA 1M6WA 1IM5A 1YZNA 4L22A 4MI3A 1E60A 3E9RA 5IUKC 3M4JA 5T67A 3CNLA 3ZWWA 2YMLA 3BRWD 1R0CA 1JVBA 4GQIA 3QLVA 4UJ5A 3ST7A 3MK31 3KG2A 4Q7KA 1PZMA 5H70A 3PPYA 4O2BB 4HWKA 1YF3A 1QUFA 2XNJA 1RAFA 3AUYA 4TYQA 4D97A 3RRZA 3A1SA 2OE2A 4Y0VA 4BMYA 4CKXA 4GG1A 1U3CA 4LOKA 3T4EA 3UWSA 3WKBA 1ORRA 4TTQA 3JQAA 3DYVA 4ND4A 3VGPA 4A92A 2JLVA 1LPOA 1CNMA 1M2KA 3AEKB 4REQA 4V0QA 1J25A 3LXXA 4KSYA 2YVAA 1DRVA 3CWCA 3BG5A 5HIJA 1US8A 1U9IA 3IDAA 7AT1A 3VPAA 1GCOA 2YC2C 1H6AA 4D9IA 2OHOA 2XCUA 1WZEA 4KGZA 2ZAOA 2OCAA 3ADKA 4M1ZA 5I7VA 4HUJA 5U4QA 4N3AA 5GOZA 4CF6A 3AEXA 2UU9B 3E03A 2QNIA 1RCFA 5B36A 4PG7A 3G2HA 3MWGA 1EB8A 4O29A 3AESA 4QYMA 1NY5A 1IBLB 1CF9A 1YCFA 1UZLA 1P62B 1QO0A 4OO3A 5KU1A 2VDWB 2EJBA 4HNVA 2H5EA 3E3NA 2R84A 4L8VA 2MINA 1JECA 3U3XA 1AMUA 1USIA 4O8ZA 1CF4A 2J3MA 3B6MA 4NBWA 3T15A 1E0AA 1R27A 3BD9A 5B7QA 1EHIA 4K9MA 4RFLA 4BFZA 4EJFA 1JIJA 1QB7A 4G65A 5K03A 2JI7A 2GZAA 5HS4A 2ZUDA 4XYEA 3B7GA 1QCDA 2PYDA 5T8KC 2Y9MB 3O83A 3U16A 1CF2O 1T2AA 2IV2X 2EW8A 4I5EA 3SVLA 3GLFA 2PD3A 2WAAA 3AIOA 3EYAA 4WERA 5EXTA 2IIQA 1Q95A 4NYJQ 4J0IA 1XDDA 3K0AA 4EFMA 2XXBA 1JU4A 5TJ9A 2DBYA 3A4IA 5FULA 2ZYIA 1XTUA 1Y7PA 2AJ8A 4TMZA 5LC1A 1HSZA 1Z17A 4HKTA 1LPNA 1UAYA 2BDUA 1DXQA 2HSZA 2M6RA 1FFAA 3GRFA 5DIFA 2R5FA 4IIXA 1QGUB 4G1MB 4RKFA 1DGQA 2FETA 2VH1A 2HSEA 2AW5A 3N7TA 4DPKA 2B36A 1D03A 2WPDA 2YUTA 6PFKA 2GD2A 5HJEA 4DA4A 3LECA 2ZRFA 2XGSA 1G38A 1MJFA 1R6AA 4BX3A 3JQDA 4DBVO 3DMPA 5KX5A 4RVNA 1X80A 1LNQA 1H4TA 3TZEA 4UOZA 1II9A 1HURA 5CNIA 4B48A 3ZV3A 4F6CA 1B1CA 2RB4A 4Q9LA 1J8VA 2HT6A 3F90A 3G8AA 2VTDA 1L5NA 1TT5B 2VNKA 2VP4A 4NCIA 4B83A 2QROA 2GRUA 2W9XA 5IHPA 3AUSA 4OA5A 5IFKA 2FUG6 1XZDA 3ET4A 3SYKA 3TN7A 3MEQA 1MO4A 1C3XA 3RJ5A 1GAXA 3AI1A 3HL0A 2FF5A 3ZBPA 1FE8A 1WVMA 2EL7A 3AJ8A 5EJ7A 2R7MA 2QR5A 2E0IA 5CDFE 4MUXA 4JXXA 1RMYA 3EPLA 1LBIA 4QUHA 1XTKA 1EDOA 3DEZA 1CZKA 1VL0A 1YMUA 5LWQA 4B7ZA 1PTJA 3TCXB 5HFAA 2DFKB 1CUSA 1N2CB 3B3FA 2WMYA 5BUCA 2QMUA 1CRPA 1ZCBA 2FMIA 2VPYA 4GOND 3M9WA 4E51A 3WB2A 1NNLA 2J0QA 2HNBA 4QECA 1H0HA 3DP7A 5TB5A 1Q3KA 1HTBA 4G0OA 1NLMA 1ZD5A 1SQSA 3OJWA 2IYLD 1ZU5A 2X8JB 4F96A 4FXPA 1NFRA 1WVIA 2JAWA 2WAMA 4MVXA 4E6PA 1N9KA 2R4QA 3X1MA 1EIZA 1LK0A 5F3DA 4B31A 1MD9A 3OM1A 4NCNA 3BH6A 5ALOA 1ESEA 1U2GC 1YS9A 2VR1A 1VM6A 1HNZB 4YCJA 1P4RA 1ZN7A 4Z7NB 3HUFA 4JY7A 3DZGA 4ZAVA 3DZKA 1VGQA 4REQB 4RIIA 2Q1XA 2O2JA 4AQ7A 2ZYUX 1UJ2A 2JZOA 3BULA 1ZIXA 3RTDA 5GZ1A 3DO8A 4RVSA 5JD6A 1US8B 2QT1A 3EC1A 2DR3A 1E0KA 3P9CA 4Y9RA 2FOLA 4LE0A 5AHOA 5LQUA 3Q3IA 4G67A 4G5GA 4PYJA 4ER7A 5C35A 5DM2A 1KXZA 2RK3A 4WFIA 1G6KA 5LCXA 4FCWA 5DIZA 1T8TA 5FLKA 1XJQA 5AW6A 3L02A 1P73A 4EYQA 1E2EA 1W35A 1D1SA 3IMKA 5AJZA 4BMNA 2FEOA 1ZP6A 3GDWA 2SHKA 4ZT6A 1RI3A 3OOJA 1H69A 2NV0A 3PEFA 1RYFA 2Y4NA 1WU7A 2HCBA 3AESB 4PC6A 1IXRC 2I2BA 3M5WA 4B79A 1BO6A 3BGIA 1CIPA 1DBIA 2YWCA 4RA9A 2V54A 4ZARA 3QJYA 3U5TA 3GBPA 5KYUA 2B0JA 2R8ZA 2MINB 2VSOA 4NZYA 2E37A 1NQVA 3CFYA 4A8JC 2A7QA 3JD3A 4CKWA 4LE1A 1USUA 3KQQA 1KERA 2FOXA 3W5CA 2XHZA 4MVJG 4NU5A 3AR6A 3HBFA 2GCPA 4IJWA 3IIIA 1WKBA 4IZHA 2E3JA 3Q3GE 4P4GA 4TSFD 1XU9A 2DH5A 3T1QA 2HQOA 3WAGA 3VJRA 4EHAA 3F73A 4GT1A 1PVVA 1ECJA 2CHQA 4BN5A 5IJ0A 3THWA 3K0AB 4ZV9A 4DMMA 1AKQA 1OQAA 3NT2A 1JVNA 3ID6C 4N9QA 3TZLA 2CE7A 1NN3A 3M4YA 2HB6A 1FNNA 2R5WA 2WP0A 2H65A 3ZI0A 1Z06A 2AD1A 1Q19A 2BFPA 1EDDA 3H19A 1EUYA 3N8KA 4FMCF 4DIEA 4GM0A 4J43A 2PX2A 4JEIA 4LFCB 5A4JA 4XWAA 4KUEA 4MEBA 4ZEOA 3UTDA 1FYEA 1T9KA 1WEKA 3GRUA 1K7SN 4JLMA 3ZX5A 4C43A 3HN6A 3WISA 5BSVA 3EVFA 2CMGA 3UANA 3HKCA 2JFVA 1ZMTA 1OR8A 3VJMA 3EDMA 2PM8A 4KDEA 4HAOA 2F6RA 2C4WA 1XCGB 4NLLA 1DO8A 5A1TA 2XMPA 1RRPA 2WWFA 3EVTA 3VPGA 3FHJA 3WGMA 2ZRAA 1CY0A 2CDBA 3PHBE 4FWBA 4E2WA 1D2AA 1LQTA 2XUJA 2I9PA 4F3NA 5JAPA 2JGDA 4A0QA 4JSRA 3ZWBA 2FPLA 4X5OA 4A2WA 1CVIA 5CFPA 2G8NA 4PLWA 1JKIA 2IEYA 4ZTBA 1OMOA 5AHWA 1H3EA 2YRXA 5DTRA 1VE9A 2QRLA 1ZCZA 4FUQA 3PTAA 1MEEA 5DE3A 1CFJA 3A2LA 5E2IA 1KH2A 4QTTB 3H8WA 4ZT5A 2OK7A 1XE3A 4D0NA 2YNMD 3MCWA 5IJ9A 2FXVA 1BMFA 1JXAA 4P7GA 3FTPA 1JDSA 1HSOA 2R65A 3TQOA 1K2VN 1ZLYA 2IHTA 2FOIA 3CWZA 3QLEA 3ZHYA 3REGA 2JKYA 3C3JA 1G3MA 4BMVA 1GKIA 2LKCA 2QX7A 1YVEI 2IX9A 1X15A 2ZJ1A 3IHLA 2HRBA 2NZVG 1EDZA 3B48A 1BHQ1 4TT3D 4WKOA 4F2PA 4L8FA 2IYVA 3N7AA 5TQJA 4OKNA 1QVVA 4KYVA 4Q93A 1TDJA 4FSHA 3AEZA 3DNMA 3DDHA 4DA8A 3RIXA 2FEKA 5EJ6A 4G84A 5KOYA 4X3OA 1N3YA 2IS2A 1I10A 1G1AA 3I05A 1RABA 2D4AA 3P19A 1HTWA 2VAMA 1CUEA 1N57A 3FFAA 3N53A 4FHZA 3LC0A 5L9AA 1PLJA 4WKCA 1RZRD 1KH3A 1KZ6A 3DO6A 4Y67A 5D3KA 1IEQA 1JT9A 2Y1GA 3E61A 3U81A 2AJTA 2EX0A 3E2MA 3A4LA 3HCAA 3AEYA 1N2HA 3M2TA 4GNKA 1WMAA 4NBRA 1X1SA 5JJCA 4ZVTA 3WA7A 1OB5A 3HBMA 4TL8A 3V1MA 3PVZA 4FFDA 1IZZA 4L3OA 4DYDA 1CVLA 3LVQE 3DKRA 5BQFA 4ZHQA 4U2CA 4NWIA 2YXPX 2WWRA 4RTJA 4XWTA 1G5RA 1KY5A 1REQA 1Q6ZA 2GVDC 4CM9D 2JI9A 5ADUS 1E8MA 1CBUA 2QJWA 1OXUA 1YZHA 2R66A 3LO8A 3NRJA 4BFWA 1V3TA 4C3VA 1U6JA 1NI4A 3JWJA 3TW8A 3CF4A 4P7KA 4MV9A 5HS6A 4BFYA 1PNOA 3FDZA 3R4VA 2EP5A 5HNKA 4TYMA 1QHHA 1UWCA 2GLUA 3OWHA 4POAA 2Z8XA 3GFVA 1HKHA 4RA9B 3I0MA 3LXRA 2FSHA 4RJ2A 3ZDBA 1CETA 5KYUB 8ATCA 1PZHA 3D5TA 3H1PA 1U11A 3NC4A 4GIBA 4C0LA 4LIPD 1Q83A 3KUUA 4DV2B 1NMSA 1CJKC 2X23A 2I9KA 4B3TB 2O8FA 2QGNA 4NONA 5CXQA 3P2EA 3VC3A 1ZXXA 1BX1A 3I2YX 4CKWB 4D5GA 5FV7A 4EY4A 1T5SA 3IIMA 4H27A 3NTXA 2PUTA 4YMSA 1XTTA 5DCUA 3SYLA 2OLJA 3CE6A 3A06A 2C7BA 4NENB 1DJNA 3PICA 5DYGA 3H1TA 3RUCA 3PT9A 4DVJA 5D5HA 1QPBA 1RQRA 2IOQA 4H15A 2D6FA 4PGHA 3MILA 1WM1A 5L3VA 4WBNF 2C3YA 2Q99A 2VBCA 3EBLA 5HRAA 4HAZA 4C1BA 5IJ0B 3THWB 3Q0TA 4JC4A 5YASA 3K9QO 3X1YA 4BX2A 4DIDA 3C16C 4EJ2A 1EUCA 4NESA 1OTXA 3L8FA 3AHHA 1KSFX 5FI3A 4F60A 1QHNA 3EGCA 5TQVA 2I7TA 2W98A 1CQJA 2Y4OA 4OUKX 4UVEA 3TE7A 3WXMA 4ON9A 2WM9B 1TAUA 3CM0A 3OHPA 3WJ7A 4EG8A 2FWRA 5D8DA 1UINA 2RHJA 5C8DA 4R81A 2AT1A 1EGMB 1U90A 2C42A 1U7OA 4BWFB 4WOBA 1YUBA 3W04A 3S99A 4E5DA 4B40A 3DC2A 3BMXA 1NP3A 4WCFA 1Q5PA 1MRSA 1NKVA 3GZNA 3PDUA 3ABQB 2C5LA 3EH1A 3HZRA 3MMXA 1GLGA 4ZC8A 3CWQA 1BAPA 4PZDA 4Q16A 4WNYA 1X1BA 2FGJA 3N2GA 5IDYA 2L42A 1F4VA 1NBMD 5FL7A 4A6XA 2ZYHA 5F4ZA 2XE7A 1QV6A 2ZSFA 4HFNA 3TL6A 3UBMA 3AI3A 4HBGA 1IHPA 2JGDB 1GQQA 4BNDA 3E5RA 4QGHA 3RSSA 3WIDA 3UB4A 1JBQA 4FMDB 3D6HA 5JBIA 1DWOA 1SUAA 2P6OA 4FS3A 3RUPA 4PYIA 4EJ0A 3BEDA 3E0QA 1DAPA 3UJCA 4LOJA 2OHGA 3GGDA 1EBUA 1JLRA 1F9AA 4JI2B 2WE8A 5HHTA 1N4DA 5IJ9B 2R9VA 3BOSA 3QVKA 2XUIA 4KV7A 5LZ9A 1R3UA 1MAUA 5JU6A 4YP5A 8MHTA 3G3EA 4ECEA 2HA6A 1C4OA 3E9QA 4WLVA 2MR5A 1WE2A 2Y77A 3IBSA 1TQDA 4NDZA 5CBKA 3TECE 2BDEA 3GLIA 3E2PA 3I2KA 4HF7A 3OLZA 1NBEA 2DLDA 1P9LA 3DMGA 1QIHA 3HP7A 3BMOA 2OV4A 3TXYA 1XP5A 1T2UA 1Z6YA 2ETVA 2WWIA 2ZKLA 3F4LA 3GJXC 4PO9A 4ZQGA 1XRNA 5A4DA 3NAMA 2GCNA 6YASA 5C31A 3J7TA 1DBSA 3D6AA 3I2JA 5EPOA 3RAPR 4G0WA 3I09A 3N39C 3F46A 2QRKA 4L2IA 4L3VA 4OAPA 1L4YA 2BMAA 1LX7A 2W93A 4GP6A 4KGXA 4O4IA 4D3FA 1TNDA 2GXSA 3VRHA 4J0KA 2IF2A 4YK7A 1T35A 4Y6GB 5DXFA 4DCTA 4ZHQB 1EP3B 2GXUA 2A4MA 2GPBA 2QY9A 2Y76A 3KUKA 2C2YA 3N87A 3NIGB 3NIDB 4HX5A 3CRZA 5DT2A 1REQB 2YIDA 4KH1A 3BWMA 4N6OA 3WIOA 3LX4A 2P4QA 3EDCA 1XZ8A 2PX5A 1VYTA 2E6KA 2JG3A 2HMTA 1TC1A 4II7A 3DNFA 4TWBA 2PKQP 4WEQA 1NI4B 2O6HA 1TEVA 3TW8B 1FXUA 1XGKA 1BZYA 4BP1A 5DRTA 3O8BA 3MJDA 3RTCA 3I30X 3WRYC 3FDZB 4AXBA 3ZGNA 1B76A 1YU6A 1QYRA 3AFMA 1PS8A 1QHHB 5K0GA 3MCTA 4IH4A 4BNVA 5CD1A 1SG0A 5EUMA 1PJQA 1N8KA 4ZCRA 2E4UA 5HR5A 4HRYA 1T1EA 4RDXA 2Y1CA 1CIJA 3CEHA 2C3UA 4Z3KA 3RVRA 2O8FB 1VTKA 1O4WA 1ESZA 1ZUD1 2GM9A 2UVPA 2WJ4A 3INTA 2R25B 1XZPA 3HA7A 2E21A 4QUBA 1MFPA 3HFJA 3L0IB 2HTEA 3ZS9A 1QUEA 4R0VA 1K8QA 5EJFA 4CLXA 1TZCA 3I61A 1NYQA 3MRXA 1H2FA 2E6UX 3FTNA 3G0DA 2GT1A 4HDQB 1SBHA 3A25A 4N0QA 4JH0A 1U7UA 2WFAA 2GZMA 3NYQA 3DCYA 1IWPB 1EUCB 1JMYA 1Q7GA 4AFNA 2UXBB 4U3JA 3M1YA 1CQJB 5ALGA 2FEWB 1FP1D 2YCLA 3F9RA 4GBMA 1LPBB 4HWRA 4NRDA 4ZAZA 3S2UA 3I92A 3HVJA 1F3LA 1ZH2A 3S29A 3GJYA 2ZQYA 4R2IA 1GYQA 3SHVA 1F7UA 1KI9A 2IJGX 3Q2OA 3HPRA 1HDEA 3X2SA 2FPKA 3JQEA 3R77A 1Z0IA 1F0NA 2QSJA 1YVUA 4Q4CA 4HADA 2YXEA 1EUZA 4F3YA 4WCFB 1E7MA 2FRDC 4BE4A 5BOSA 2AMJA 2O2EA 3FMPB 3KE9A 1NF2A 3DPSA 2YHUA 3NEYA 4FNAA 5LPNA 4QM7A 3RVLA 3WDSA 1OGIA 5J43A 1CEYA 1M1YE 3TKLA 1L7NA 1NUQA 1JDUA 3KXKA 3MTAA 4XIFA 2Q8PA 2XECA 3N2GB 1NRJB 2ZDHA 3FVVA 2VKQA 4JCCA 3WSTA 4WOPA 4BV8A 4BLQA 2QD2A 3B3QA 3DT8A 4BNDB 5E7JA 3TEFA 4KUHA 5ALJA 2FJ0A 1SD2A 5ICGA 2GB4A 4N18A 2Y8EA 8OHMA 3DLCA 1C1XA 2C2HA 2H29A 1JEQA 4LHEA 5EYPA 1DC8A 4DDWA 2Z0MA 1L0BA 3PFCA 3O38A 4WLEA 1BWPA 4P93A 5B4UA 1MX5A 1KRWA 5JFGA 2ID9A 1JG3A 2C5SA 1SOMA 4PLCA 4ND5A 2J3IA 4WCDA 4EKYA 1PV4A 4FDVA 5DM4A 2HQ1A 4TLBA 2FUEA 4GPEA 2JGMA 5KC9A 4N48A 4F6LA 1WQ1R 2QSUA 2EKPA 1ZD2P 3E0XA 3EG5A 1NI5A 3RYCA 1EVLA 4K28A 5KNDA 2E4AA 5KTSA 1IONA 3GFQA 1GZVA 2BBTA 2DBRA 1ONPA 2H0QA 2Q8NA 3BMOB 3BF8A 4OXKA 1MT3A 5JSQA 1XMIA 4B6JA 1HWYA 2RGGA 5BV2P 4BDTA 2WG2A 1GNRA 2G0AA 2PSHA 3PGXA 2C8JA 2RGXA 4FJ0A 2GTPA 5FYQA 3O21A 2XWSA 1DOAA 2VG8A 4UOQA 3IBGA 5TT0A 3CGGA 3D2LA 3PYLA 4L2IB 3KYDA 1GZ7A 5MHTA 1G21E 3FOBA 1HDGO 4LDJA 3GPCA 1TMKA 4O4IB 4EEZA 1FTSA 1NDHA 1OW3B 2IIVA 2ZPAA 1YXMA 1AXEA 1YE3A 3GFTA 3KT0A 3OIYA 4HC4A 4JT8A 1T5IA 2NU8B 3GLQA 4RKWA 2HPAA 4IIVA 4HG2A 3UHAA 1ZSNA 4OL9A 3WLOA 1UXOA 4PXYA 5GADl 4GWLA 1X0VA 2RFLA 4KFTA 1PUIA 1LRKA 1F4LA 1OFHA 5TS2A 4E15A 5IC4A 5IG2A 4DKJA 4BU1A 2IPXA 5JAIA 5FBVB 2N1MA 2E89A 1QR2A 1X39A 4JODA 1OLSA 1U8CB 3M81A 4LY6A 4U7JA 4YN3A 1JTFA 1UODA 3BWBA 3QFHA 3BK7A 2FSPA 2JHAA 1ZCAA 2OHIA 1UFRA 4TQUS 2A84A 1XCJA 4F11A 4WUVA 5BRAA 2PXXA 3QMWA 4DLTA 2A1IA 2A9VA 4GWKA 2V8BA 2P9ZA 2FFJA 3G5LA 3L7JA 1SCJA 2W22A 4HH0A 4N3NA 3TB4A 4BNYA 5JNTA 5D3QA 2QN9A 2BFEA 5IVKA 1EK5A 4R7ZA 1UBKS 2IUTA 4NK4A 3HA2A 1HZZA 2JK1A 2O07A 5C3MA 1M54A 4XYMA 3ZZMA 3AUXA 3TZCA 1M66A 5A62A 1RLIA 1YRWA 2ZFUA 4JYBA 1M2JA 2IELA 2B9EA 2ZI6A 2A0FA 4BGVA 3K2EA 3HK2A 3V8BA 3DDUA 1UBSB 4YEDA 5JHHB 1T5OA 1YL5A 2VHJA 3I6IA 1YFZA 3CRW1 4KW7A 4M8KA 4W7SA 1NBAA 1A9OA 2I6XA 3BMQA 4IQ8A 3SY8A 4DC0A 4E7PA 1W0JD 1DPFA 1Y81A 2PUJA 1D8AA 2RHCA 4P35A 4X6YA 4Y1FA 1Z6GA 3GMSA 2VJOA 4ND1A 4U3JB 9ABPA 2C4VA 2AF3C 3NT5A 3JYHA 1JIKA 3O3CA 3LDUA 2OHFA 2B83A 2V45A 5DSTA 3K9FC 2YBDA 1VLVA 3HYLA 4LTNA 4BVKA 3PE4A 1TCCA 3LPNA 4GNRA 4C87A 5HZKA 1JXMA 2XOXA 5DHUA 2BFFA 2HMWA 2XQVA 1BJTA 4MV3A 4N7MA 1MA0A 3EF0A 4P7JA 2JGLA 4ME6A 3C6MA 2AK3A 2B4KA 4RPIA 1Q1EA 5IKMA 3G0OA 4CLDA 1B0PA 3MYRA 4OAQA 1DRWA 1CERA 5BOSB 4ZEWA 1ZXBA 5CLHA 1VMDA 2IEIA 1L8XA 5BQOA 3IR7A 5LVAA 1PV2A 4X3PA 3AR5A 3QWAA 3L5KA 4RVDA 3A4MA 4RLHA 1ZKDA 2H4FA 5ECGC 4YUVA 5B3JA 5K0EA 4NCKA 2P2LA 4E1AA 2JH9A 1B42A 2D1QA 2DUMA 3H9CA 4R31A 3GLGA 4OHUA 3B9QA 3NS7A 1ZJWA 2RCYA 2R48A 3OKPA 2EV9A 2HXSA 4J0CA 4UKDA 2O7SA 4PIPA 3HCDA 4HVLA 4LE2A 5BV7A 2EFDB 1IHOA 2CD7A 4QZVA 2VK4A 1UDAA 4EQ6A 2PMFA 3FVRA 3P9ZA 2XAAA 1UT5A 2VSXA 1NNEA 1C1XB 5EYPB 1JEQB 1L9XA 1C0KA 2W7TA 3OLQA 2F55A 2WVHA 2FDRA 2PZAA 3BBPA 2VWQA 4L4UA 2R8OA 3VBEA 1E18A 3F6SA 1WAMA 1QR6A 3VDXA 1WHTA 3ILXA 4CDNA 2VBGA 1YR1A 2DLNA 2V5VA 1TM2A 2V9CA 2PMKA 3NTVA 4MXDA 4PRKA 1VG8A 2PQ0A 1L1RA 2Q2OA 2YWFA 2ZR7A 3G5TA 3KFVA 3HKBA 4QDZA 4BZQA 1U1IA 4XGNA 2GM4A 4KE8A 3RYCB 1E58A 1EVIA 1KJWA 5C52B 3C8DA 3WWPA 3L8CA 4B6EA 1R9JA 1HL7A 2YKGA 2GK6A 2JFZA 4KTVE 3JTMA 2WF6A 3ECAA 4C7JA 3G79A 1DU4A 1TZ2A 5D87A 1RAAA 5ALZA 2DTXA 4DJEC 4HSEA 3TRDA 5T5QA 4C7KA 1PSDA 2GNPA 3HDGA 5E9QA 2RE8A 2GPAA 1Y82A 4L5BA 5JNSA 2OWEA 2IH4A 1DDIA 1U0RA 1G2QA 1MA3A 2HF7A 2I22A 3AF1A 4NQZA 3V7UA 2OK8A 3X1WA 5LU8A 1R4NA 2BGGA 1A4IA 1N6NA 4BGEA 3RQIA 1JR3E 5EIWA 1VB3A 3KJFA 8ADHA 3MUFA 4KN5A 3KKKA 2OP0A 2WMOB 2I7CA 2Q5OA 3AFNA 4W63A 1MRNA 4YMVA 1Y4DE 4FNMA 3GCWA 4MMZB 1UJ6A 3A1DA 4WK6A 1U8EA 2P4SA 1L5GB 4RJJA 3OIVA 1JE0A 5HG0A 2WMDA 1IOWA 1KJ9A 5DGIA 1VGRA 3UG6A 4AUKA 1OLSB 1KY3A 3U31A 1RT9A 4WECA 1ST2A 3QENA 5KHOC 1D6MA 2FRVA 3LV8A 3WBKA 1Z6PA 3GFPA 5EJMA 3GT4A 2JS7A 1FU8A 1U0HC 2IZ6A 5A71A 2M6LA 3RLIA 3AI7A 1YQXA 4LBVA 2TSYB 1PDOA 2POQX 2QMOA 2BSQA 1JI3A 1THZA 1U2ZA 2BFEB 1I1QB 2O3TA 5EXPA 4AXXA 1RMTA 5I7RA 4XQ0A 3OE1A 5JQGA 1W30A 1P8JA 3ASVA 2NWQA 2X9NA 3IEKA 2ERXA 3HXTA 5IDVA 2I6GA 1NP7A 1EU1A 2IHYA 1Y3BE 2QM7A 3CZ5A 3C3WA 3H13A 4GLFA 4ZVPA 3EZNA 1THMA 3FDXA 1TYCA 4F4HA 5DTJA 5C7OO 1VDZA 3WGYA 1J0DA 1MORA 5FNVF 5ADVA 4LDRA 4YI5A 3NVKI 4HN4B 1AKNA 3BMQB 4M22A 1VJTA 2GN0A 4L5YA 3ZH2A 2PO5A 1U2TA 1UMCA 1ONSA 1K66A 1S2DA 1A2BA 2VT2A 2QU7A 4IMJB 3PLAE 3TTXA 1FQKA 2HRQA 3LD9A 5B6JA 4HDAA 4BATA 4Z4FA 3HJUA 1L5MA 4OUDA 1IVSA 3BCHA 1P33A 3EXEA 2D8AA 2ZUFA 2HUPA 4QUJA 1TTHA 4AIRA 3OT1A 4PBSA 1GZHB 1GPYA 3ESDA 3LIPA 4L57A 1BU8A 1EM6A 2EWMA 2ZWPA 3ON5A 1CUCA 3M6LA 2ZJ6A 1BFKA 1P7PA 3JQCA 3PRYA 4DDKA 2O7NA 4C04A 3ICCA 3VNQA 2RHDA 1CVRA 3EIUA 5JJLA 3K8ZA 2BKVA 2HIAA 2BH9A 4L5JA 4EM6A 1JLMA 1WLYA 1N5MA 2YRFA 1VPVA 4RGBA 2AQHA 2XZTA 1O6CA 1NRWA 2QTZA 5FIUA 1LWNA 1TUEA 4UBKA 5D1HA 5LP6C 1C3OA 4DNFA 5ABPA 4M0DA 3FPKA 1FP6A 4C07A 1E2FA 2ZAMA 3GMDA 3GRKA 3Q3CA 4IMIB 3TNFA 4LJYA 3SZLA 2XRZA 2XUAA 2GCOA 3MCZA 3VR4D 3WGZA 4YFYA 3O4RA 3F5DA 3ESAA 1NXPA 1OIWA 4IVRA 4BTEA 1OWMA 4EQ6B 4QFMA 4PX2A 1ETUA 2G71A 3WRXA 4XGKA 2IU4A 4Y9UA 1H8HA 2VLIA 4HDNA 3ENWA 3FZEA 1RYDA 3L7NA 4AZWA 2IFTA 1FFWA 3INGA 4J8PA 4PQFA 5SZHB 2E18A 3I12A 3AKZA 1YK1A 2WTBA 1WHTB 2YWGA 3KYIB 3DLHA 3L7MA 5CIQA 4HDMA 1F14A 4IIJB 2JHPA 4LYYA 2BI8A 3HKBB 3ONWA 4QO7A 2AYXA 4Z49A 1CR0A 5CAEA 2JGEA 2QX8A 2O3RA 1NPTO 2ZIAA 3KHTA 3NAGA 4QJBA 3ZJ4A 1HE3A 1GLNA 2J46A 2P40A 3E5HA 1QPGA 3B8HA 1Z83A 4AYTA 3IAEA 4HGYA 1D0VA 2WEKA 1RYYA 2X1LA 4NZZA 2C1EA 2GCEA 4EWLA 4JI6B 1E0JA 4G0XA 3T1OA 3W8EA 4YUZA 3EHDA 5D86A 3ZGLA 4M49A 3TOCA 3DKVA 4MRRA 2A9FA 4KB5A 3CE9A 4TLDA 4Y2RA 5DO9A 2E4YA 3OFND 2QXTA 2OQ2A 3DAPA 4HEQA 2P67A 1AKTA 4QBGB 1R4NB 1SCIA 2AL7A 2PX4A 3VU3A 1WSWA 4ZQIA 4JA2A 1JL3A 5JNLA 1F0KA 2VYNA 3P97A 2AI1A 3MD0A 5HBGA 3C98A 4DV7B 3DUFB 5I45A 3KKMA 1YI0A 2WWYA 2OYRA 3TKYA 1F48A 2OB2A 6AT1A 5DHPA 3TLZA 1BDIA 3FB4A 5EXXA 4GBJA 3H87A 1L4MA 1HFEL 4R7GA 1RCTE 1CJSA 4G2NA 3RVBA 1TA0A 5HJ7A 3EVAA 3KD3A 3LK6A 1VSUA 3R6TA 5CT6A 2BUCA 1Y8RB 5I4IA 5ITWA 2GWRA 4IDGA 1Z0KA 2VXYA 4QFDA 5K3FA 3GY0A 3HDYA 5CJ2A 2UUAB 3AVQA 3NUQA 3CXRA 4WW0A 3OURA