4ZO4A

Dephospho-coa kinase from campylobacter jejuni.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
202
structure length
202
Chain Sequence
AMKNAFFVTASIACGKSTFIEIANSLGFKSISADKIAHKILDENALELEKIFSPFSLKNLLKKEKKIDRKILGEIVFNNKEAKKILENFTHPKIRAKILEQMQILDKENKAFFVEIPLFFESGAYENLGKVIVIYTPKELSLKRIMQRDKLSLEAAKARLDSQIDIEEKLKKADFIIKNTNSYADFRQECVKVIQEISKGNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dephospho-CoA kinase from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni subsp. jejuni serotype o:2 (strain nctc 11168)
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
total genus 63
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4zo4A00
2GK6A 4PQYA 1W44A 1NKSA 2QY9A 1SQ5A 3C7KA 5L3RA 4AY2A 4B3BA 2C96A 4PC7A 2Q21A 4EFMA 4Q48A 3B9QA 2IL1A 2QAGA 4BLSA 3B13B 4NBSA 4KLNA 2VYFA 3U3KA 1UKVY 3UG7A 3GLHE 1F5NA 1NIJA 1NVWQ 2VQSA 1NMXA 3LW7A 4XOIA 4XWAA 1KZGB 4QJ4A 3GFTA 2CHVA 4NH0A 4JL5A 3UXMA 2YWHA 4LHZA 1GRRA 1OYWA 4TLEA 3PJRA 1XCMA 1LV7A 2DCUA 4GPTA 4MYTA 2R6AA 5EXTA 1ZIOA 4Y0VA 3PVSA 4A4DA 3E5HA 1N6PA 2OZEA 1R0WA 5JRJA 3TE6A 4QGGA 3NG1A 2ODNA 5JEDA 1KYIA 4DT1A 4HAVA 4RD3A 5JWRA 2ZJ2A 3PIRA 4NMMA 2ZSEA 2OILA 5F3WB 2GK7A 2YOHA 3CRW1 4JL6A 4TSFA 5KNBA 4LI0A 4LJ4A 3N2EA 4Q1CA 1O87A 2OXRA 3AH8A 1Q1ZA 4Q9IA 2ZE5A 1S3SA 2J7KA 3HPQA 2RGGA 1ZAKA 2FEOA 2IW3A 1NLZA 5JHGB 1ZUHA 4HATA 2P6RA 2RGXA 4UJ3A 1G17A 2XTMA 2XOKD 4A6XA 4MKIA 3NHAA 4HZUB 5AUQA 1II9A 1W2HA 3CPJB 3SNHA 2FFAA 4PC1A 1T3LA 3AP3A 4DLZA 3RABA 3RRNA 5EQTA 1JR3A 1NBMD 2JDID 1T3HA 1PLJA 2BCJQ 1ZBDA 1ZVQA 2EWWA 2OXCA 4B2PA 5IT5A 2O52A 1GTVA 3C16C 4K81B 2G1JA 2WSSD 2ZJZA 4Q7JB 4WIAA 4A82A 1AZTA 1P7CA 2QRZA 4HLUA 4A9AA 4X8HA 3TVTA 3V9PA 4KU4A 4I1SA 1VIYA 4ERNA 3ZVRA 1NVVR 1OH8A 1KO7A 4JVSB 3NBFA 3C14C 1GP2A 5FOXA 3X1XA 3LQRA 2WSMA 2EWVA 4NYJQ 4Q19A 3ECCA 4JBXA 2EVWX 1QHSA 3K0AA 3THWB 5HE8A 3GJ4A 4NDZA 1OFTA 5TV2A 4M1YA 4C0HA 1GL9B 1XEXB 2G88A 4NCKA 2ZR7A 2ZVPX 1KI1A 4S35A 2O8EA 3IKJA 1AK2A 1AIPA 2GEDA 3P20A 2VP6A 3VX3A 3TBKA 3VR4A 4IDNA 2YOFA 4IDHA 2HLDD 2AR7A 1F48A 3GJXC 3LVRE 2EFDB 2RKOA 4Q03A 4V0OA 3T1QA 4BFYA 4Y0AA 2QT0A 3DPUA 4M21A 1ZM7A 3UKDA 3FDIA 4PSKA 3MWYW 4PPGA 4M1KA 2WKRA 5CB6A 3G5UA 1N6OA 4HLDA 3HR8A 3ZYCA 2XB2A 1FTNA 2O8CA 5AJWA 1WDTA 2P5SA 1II0A 1UEIA 2JCSA 2PLRA 3CRQA 3FHCB 4RFVA 3IPYA 5KDLA 4DB4A 5CM9C 1CBUA 1OLOA 3GJ8A 4XVQA 4KCGA 4JLDA 3JZAA 5JJIA 2XJ4A 3TQCA 1E1RD 3K0CC 1E99A 4M1OA 5G3ZA 1E9BA 3CX7A 1QF9A 4DJTA 3U7EB 1G16A 3U6BA 1L7VC 4R98A 3ICQB 2Q3HA 2NO7A 2VP2A 3IHLA 5H1YA 3BBPA 3QBVA 1E9AA 1W47A 1I4TD 3DZ8A 4I81A 4D82A 1XCGB 2H1LA 2WWHA 4CEIB 2FX3A 3KTAA 4G5RA 4US0R 1KJZA 2V1UA 3FFBA 3RWOA 4MDEA 2YJTD 1G3MA 4WZAE 5UKDA 3Q5EA 1PLLA 1OF1A 2VP4A 1W4RA 4DLYA 1BH2A 2V4ZA 2NZ8A 4RSGA 1F2TB 4V03A 5AUOB 5C4MA 5BN4A 3RS0A 4C2TA 4RFSB 2ZRMA 5CLLA 3AKDA 3EIEA 3BFVA 3HYRA 5FTMA 1XXHA 3UG6A 2B8WA 4ASUD 4LJ7A 4X8MA 3A1TA 4LRWA 5FBRB 3K0CA 4JL8A 4XJXA 3AVQA 4NL4H 4AIIA 5JRZA 1DTSA 1P9WA 3KUCA 3LLMA 2PL3A 3SBEA 3KQNA 2QQEA 1W1WA 1EFRD 1WMSA 4P33A 1M7HA 3SFZA 2ZRJA 3QG5A 2PZEA 1QHHB 4ACBA 1RYHA 4QM6A 4RVCA 1ZC4A 2YC4C 3OEHD 4CEHB 4PO9A 2CBZA 2H18A 4H1VA 2HYDA 1FX0B 1P2UA 2EFHB 2RCNA 3KKPA 2BBSA 3QVUA 3VMFA 2IF2A 3OE7D 2GEUA 3QE0A 1IOZA 4EPTA 3CW2A 2IC5A 3QKUA 1VG9B 4KFRA 4IW3B 3TQFA 3GLGB 1U90A 3TAUA 1DAMA 1NL3A 1II8A 4NHOA 1RJ9B 5EE5B 4B74A 1GRQA 2PH1A 4LJ8A 1EK0A 1LB1B 4GFDA 2PCLA 3UMSA 3J81k 3TMKA 1KKMA 1SXJA 1W48A 1E2FA 2FOLA 4KVAA 3RS3A 4D4JA 5IRCD 4NE2A 2CNWD 4R9UC 2NTYC 4XWOA 4HI0E 2O0JA 2L0XA 1COWD 1CU1A 2QGZA 3F8TA 4AK9A 2FV8A 3LAWA 2GILA 1MABB 2REXB 4QL3A 2R6FA 1P6XA 4NYMQ 4IDPA 3AUYA 4WW0A 2IUTA 2BBWA 3FMPB 4LHWA 4WAUA 5K8LA 3B8HA 1KMQA 2RB4A 3RC3A 1SVSA 1TADA 1G3RA 1ESMA 1GWNA 1P61B 2ZTSA 5ANRB 3WRXC 4U5XA 1G18A 3TUZC 3NTUA 1DAIA 1KI6B 1VHTA 3EPKA 3U3MA 1TX4B 5CB8A 1W5TA 1WBBA 1RVDA 4C0BA 4DB2A 1T91A 2GXSA 3ASYA 2YVUA 1YR7A 3RSOA 2XAUA 2BMFA 3EZ7A 1W0KD 2B8TA 3NVAA 1OHHA 4AURA 5HPYB 2QPTA 2QMOA 1JJVA 2HT6A 5DE3A 4PPNA 3E2IA 2OLKA 1JEDA 4D0GA 1AS2A 1EFTA 2WWWA 3BIFA 4NKRA 2YC2C 1KO8A 2BMJA 5GVRA 3MRSA 2ZVQX 4FD2A 1BYIA 4LBZA 4PZZA 4V0LA 3GPLA 4NTZA 5BWMA 1ZUIA 4NCIA 1L4UA 4MRRA 1F2TA 4A8JC 4M1SA 4PC3A 3GFOA 2J46A 4WXPA 5EUQB 3WBKA 4JT4A 4GL2A 4HAXA 3L8ZA 4TQUS 3RRZA 4GI7A 2GVZC 3GLGE 3DVLA 4IDQA 3MFYA 1ZYUA 4KI0A 2XNDD 1XMJA 3QXJA 2WPDA 2G9NA 2ODEA 2ZEJA 4W7SA 4A8JB 3L0OA 2ZUDA 2OG2A 4LJYA 1M34E 2CEAA 5GJVC 1NRJB 5GJWC 2F9MA 5J5CA 4BRUA 4DZZA 3NDBB 2W00A 3MD0A 5JJKA 2Q6TA 3GEHA 2BWJA 1J8MF 5G53C 4C9BA 1N5KA 4B48A 5GVSA 1KSHA 3BXZA 4Q4HB 3ZD7A 1GFIA 1E94E 4DSUA 2VPPA 2Z4SA 1CJUC 3EA0A 4A0RA 3L82B 4GMDA 4A1FA 2O8DB 4PZYA 4A8JA 3ND8A 3SE0A 5IK2D 1P9NA 4US1R 2YYZA 3CRRA 3EAQA 1E9DA 3R20A 2AN9A 1FNNA 2IHBA 2V6JA 2V9PA 3ADDA 1JQJC 2YWEA 2OAP1 4Q4JB 3ZQ6A 2A7QA 5A0FA 3I32A 3FGNA 3QVVA 3IIKA 2DHRA 3Q7PA 4PANA 2J3EA 1E2JA 1Q44A 1XEWX 4ZI2A 8OHMA 4TYNA 4ZDJA 4GP6A 3KB2A 4RCYA 5DI3B 4OI0A 2FFHA 3NBZC 2DWQA 1OXSC 2CHQA 1R0YA 5JWOA 3B78A 1VTKA 4XVRA 1UBFA 2BC9A 3C8UA 1HURA 3GLHB 5K8TA 2J0SA 4QXAA 4PQFA 4M1WA 4TTRA 4DDTA 1XB2A 1ZC3A 4Q1FA 3GJ7A 2CCJA 1WP9A 4L9SA 1P72A 1R5OA 2HEIA 2ZITA 1BIFA 5EUMA 4GDFA 4W5JA 2BOVA 4MA4A 1KSGA 1PLKA 4AI6A 3SI7A 3B2EA 1NMZA 4DDVA 2FU5C 1OE0A 5FUWA 2J41A 3HR7A 2G0NA 2ZR0A 5LDDC 4EIWA 1OFIA 5FUVA 3I72A 1TQDA 4E03A 2ZSAA 4O25A 4TMKA 5CIQA 1IJEA 4GNKA 3OIWA 3SS8A 1DVRA 2V3CC 3D8BA 4C0QC 3QEOA 2BMDA 2ZREA 1LW7A 1G64A 1ZU4A 1QHNA 1OIWA 2MSDB 5HZHA 3GLFE 3A4NA 1G1MA 3H2YA 4JSTA 1PZNA 4NONA 3R7WA 3AQ4A 4G0NA 4F4CA 1TF5A 4ZI3A 2PX0A 1Z06A 3T5GA 4D0LB 3C5HA 1YRBA 1S9DA 1T4GA 5DO9A 1TUIA 4NPHA 1X8KA 3CKLA 3KJEA 4GOJA 4RZ3A 1QDEA 3AF1A 1XD2A 5DYIA 4F93B 5JS7A 1HT2E 5L3QB 3CM0A 2J0QA 2XB4A 1OKKA 1G6OA 3KJHA 1KAOA 2DFLA 4LHXA 4B2LA 2W83A 2VHCA 2P3SA 1XJCA 3KXLA 4XIGS 5LBIA 3TSOA 3U4QB 2D74A 3CR8A 4W9MC 1TU3A 2JLUA 4E5UA 1NG9A 2GCOA 3OE7A 4HAZA 2XXAA 4QOSA 4URYR 4Z8XA 4TT3D 3AVTA 2JEOA 2J7PD 4QKQA 121PA 1E2KA 1NKTA 4TYPA 2WTUA 4TZ0A 5DSZA 1RFLA 4N1AA 3QUSA 2I3BA 3CPEA 1ZD9A 2ZRKA 3V00A 1JR3E 2A5DA 1KY2A 1JPNA 1KKLA 3LD9A 3THYB 4PFSA 2QL6A 4LPSA 5SZJA 4TLBA 2TMKA 4BLQA 3ZD6A 2ZR9A 2REBA 4CEJB 1Z29A 3OEED 1KZ7B 3MLEA 2ZS9A 2HCBA 1S1CA 2EW1A 5KPJA 2V7QA 2WKQA 1YR8A 2IA5A 4LV8B 1KY3A 1N5LA 1ZCBA 3QOFA 4DXAA 2J0UB 4HLQB 3ZZ0A 1U9IC 1W2GA 4CRWB 3B82A 4M9QA 1U8YA 2BM0A 4PO8A 3JVUA 1WBDA 1XCPA 2GZAA 2QTHA 4DSTA 5B57C 4FMCB 2FGKA 1XTIA 3CWZA 2LKDA 4Q1DA 1X1RA 5CIWA 4D81A 2GEVA 5CYOA 2IYWA 1VYVA 3CRVA 4A15A 1UKYA 2VP0A 1H8EA 2JIZD 2WWFA 3BH6A 3OAAA 4JT2A 3FMOB 2F1RA 4HB2A 1DAHA 3KFVA 3O8RA 2YKGA 4CT5A 3K70B 221PA 3MGCA 1N3BA 1E79A 3MSXA 4OQMA 5FL3A 1DG1G 2ATXA 2Q3MA 1OKKD 2VO1A 4KFTA 5DISB 3I92A 1OV4A 2CCKA 3K70C 1FOEB 3DMNA 2FDCA 4QHSA 4PHGA 4DDWA 3TH5A 3AVYA 1E0KA 2WJHA 1XEFA 4K46A 4E07A 3OHMA 2RGCA 2IYZA 1Q1EA 3LH5A 3AP2A 1U0JA 3DKPA 2FFBA 1J99A 1NN1A 1NP6A 2XOKA 1GAJA 3VNVA 4PTLA 3RRYA 1QHHA 3ZGXA 3P27A 5A4JA 4EFNA 1MO4A 4K8OA 2LKCA 5FOUA 4YXWA 4BUJA 4F7WA 2NO0A 4BFSA 1YZQA 2V8OA 2QAGB 3IEVA 1BO6A 2ZRCA 5EZ6B 5DGXA 4TYYA 1E2QA 1P60A 1H8HA 1HE8B 2PT5A 3Q7QA 3A4MA 3MCAA 2AKYA 2FH5B 3IEUA 3QXCA 4BFUA 2O8CB 2XSZA 2C9YA 3VR6A 2BEKA 5B2ZA 1B23P 5C1BA 2BIFA 4TMZA 3TR5A 2QMUA 1B0UA 3TW8B 521PA 2ZSFA 5TDHA 1GKYA 3UK6A 3G0HA 4Z1MA 1KI4A 1E69A 5L3VA 3NKVA 5FOTA 5JS8A 5EP1A 1NI3A 4DDUA 1WXQA 2FPKA 3BRWD 1D2NA 4FWIB 1Q1BA 3BAFA 2Q3FA 3KQUA 1E2IA 1EWRA 3VR5A 1ETUA 4W5WA 2WJJA 1YZLA 2BM1A 4Q4AA 4Q9JA 2C95A 4BLOA 4DUGD 1AQYA 1X86B 3FOZA 1CLUA 4AWXA 1JEEA 2VHJA 3C5CA 4B2IA 1JALA 3W3AA 3PR1A 3LVQE 4Q7LA 1W36C 5G3YA 1X6VA 4KV9A 3K8YA 1Q22A 5K8UA 1DPFA 2RGAA 5FL7A 2F7SA 2PT7A 3EA5A 3DL0A 4NCJA 1A4RA 1HUQA 3NBXX 1Z0JA 2H57A 2IHYA 1Q20A 2C03A 1ZW6A 3NC1C 1E1RA 1RKBA 1HV8A 3CNNA 4JYBA 4DWJA 1LVGA 2CL7X 2QPOA 4O3MA 3HJNA 4PSAA 4TSFD 3BE4A 3RS2A 5IF9A 3SJZA 2OBNA 1H8HD 1P5ZB 1SVLA 3IPXA 3H0KA 4QGHA 3U5ZB 3BJIC 2OT3B 4DVGA 2QMEA 1KAGA 1G4AE 4OI1A 4B3DA 3GJ5A 5KU1A 2W6JD 2ZAOA 1TL7C 1SVMA 1EX7A 3U60B 1VG8A 2F6RA 3AF3A 4XD7D 4DC9A 1UBEA 2B21A 4J0QA 3A36A 2OUKA 5EXXA 2XTNA 3MWJA 2H92A 3AVXA 1NVUQ 1N2CE 2WICA 2ZJ5A 2G6BA 4FCWA 2QE7D 1AQUA 4EQ6B 3ZIAA 2XTZA 4OHVA 1VG0B 4NCHA 4DSNA 2BBOA 2GJ8A 4OL0A 1MOZA 1AZSC 1NSTA 1EXMA 4ARZA 3ASZA 5IK2A 4URZR 2QTVB 1AS3A 4WZBE 4LYHA 3GJ0A 1LS6A 4DUGA 1VYTA 2C9OA 4G01B 2G83A 5EXPA 5BYKA 2DFTA 3D7MA 4JJZA 2Z4RA 1PV4A 3I5YA 3ZVLA 4HLUC 4DBLC 4QRHA 2AD1A 4JSYA 4Q4HA 5KSOA 4LYAA 1OHHD 1HEIA 5L3SA 5DNYB 1E1QD 2H7VA 3W5JA 2Z5FA 4DIDA 2QAGC 1JPJA 4UJ5A 4QNMA 3RSLA 2HXYA 4YLGA 2GA8A 5AR1A 5KNCA 2GCPA 4IHQA 4UXHA 1NN3A 4I99A 4TMWA 2WJVA 1FQKA 4IRUB 5TY0A 2P5TB 3SZRA 3SYKA 3TIFA 2XZLA 2FSHA 1P62B 2HV8A 3K0SA 3HU2A 2WM9B 2E87A 4GBMA 4DCTA 5J4HA 2CL6X 4TTPA 3SBDA 4XTRA 4AG5A 1NLFA 2EQBA 3MWLA 4JLBA 2AFHE 1COWA 2YZ2A 3DMDA 4H1UA 1IN4A 4LPKA 3IGFA 3L0IB 1GKIA 3RLFA 1E0AA 2B6HA 2BKEA 2QE7A 3B1XA 3F5FA 1JJ7A 3UIEA 1A82A 1NVVQ 4Q21A 1Z2AA 4YMSA 2DR3A 1XTQA 1OB2A 2GAOA 2RHMA 4JKYA 5GJCA 1R5BA 3EPHA 4JZKA 1CR2A 5H8WA 2OCPA 1OFHA 4KXFB 2CCGA 2JA1A 3DOFA 1J90A 4CVNA 1FFHA 4PC2A 4OHWA 2VA8A 5DYGA 4KITB 2V55B 2HF9A 1W46A 2B7BA 5E7MA 1OYYA 1KIMA 4BASA 4CZ2A 4F4IA 1UFQA 3ONWA 3ETLA 1OJLA 2GZHA 5FI1B 3PEVA 3FWYA 5FR2A 1GNRA 1XTSA 4GSYA 3SQXA 2O8EB 3VKGA 1DS6A 2P6UA 2W6IA 4DEYA 1E2PA 2ZRGA 2PZGA 4ZDKA 1CR4A 4V02A 3VAAA 5HR5A 4QHTA 1DO2A 3HP1A 1F60A 5IDVA 3LXXA 5BW8A 4M22A 3GLHA 1VHLA 3GLGA 4BQSA 1YHNA 2OBLA 2YV5A 1NY5A 3L0SA 4LC1A 3VU9A 4B35A 1QHYA 2AX4A 2FN4A 2HF8A 5JCPA 1FW6A 3AF2A 3CNLA 2HUPA 3PUYA 4GRAA 2KE5A 1VYUA 1SHZA 2WSSA 3K9LA 3D31A 3ZS9A 4DLTA 3PQCA 3SYLA 1IXZA 4ABYA 4XH9B 4EPXA 3FPAA 1ZP6A 2W2TA 4LK2A 1JXMA 1EG7A 4D6PA 3I5XA 4Q4JA 4PAMA 1MV5A 3W34A 1JR6A 4FW9A 2RAPA 3WMGA 1IM2A 1CIPA 3TAHA 1YZTA 1EWQA 3GLIE 3Q8XB 2VF8A 4JLVA 4TYWA 3FHTA 3BS4A 4QM7A 1BS1A 2IS4A 1AKYA 5FTLA 4JLAA 3KKMA 5HKKA 3R7WB 1FP6A 2ORVA 4F4JA 2XSZD 4P4TA 5JBQA 5TXGA 3PENA 1BKDR 4Q00A 1E4YA 2R65A 4A2WA 2VSOA 1GG2A 5DHAA 2A5JA 4LJ9A 4Q66C 2C98A 2P2LA 3AM1A 2HDNB 3TNFA 1O3YA 1KGDA 4RKEA 4RZ2A 3SJAA 4BFWA 1ONBA 1XPRA 2VP5A 2IX3A 4RD4A 1EESA 2OLJA 2GCOB 2BHRA 4LGMA 3SN6A 1NJGA 1A2KC 2Y8EA 2IYVA 1TU4A 3QKSA 3SJBA 2BEJA 621PA 4ZDWA 4JLJA 4JLOA 3K53A 3CRMA 4OHXA 4TLCA 1DBSA 3IQWA 1E1QA 4HUQB 2OCBA 421PA 3TGPA 2C99A 1E2HA 3UWOA 4CEJA 1XD2B 3EPLA 1R2QA 4EPVA 3LBNA 2FWRA 1E32A 1SVOA 4LDJA 3U7GA 1FUKA 5FOWA 4BPBA 4YC7A 4EPWA 1QG4A 4I4LA 2XZOA 2PJRA 4LV6A 1JBKA 1OH6A 2GESA 2V7QD 1U81A 3LNCA 4FMCF 2CVHA 4BFVA 5JWHA 4YQFA 1PJRA 4ZCIA 5E7JA 5FBLB 3SEAA 4BLTA 3P32A 3EW9A 2F43A 2GBLA 1YQTA 3M1IA 4NYMR 5FBVB 4MUBA 5CK5A 5FTJA 3T61A 2XXAB 1OIVA 1E0SA 5AUPB 1JB1A 1RIFA 2ANCA 2MMGA 3KKNA 1ODFA 3WMFA 4EDHA 1GKUB 1EGAA 3R8FA 3QY0A 3VR1A 2ZI7A 1IN7A 4HZIA 1S9HA 3FMIA 1TTTA 2ODBA 2P6NA 2G77B 3EC2A 1IQPA 2AWOA 1Z0IA 3EPJA 3LFUA 5A5GA 1ZD8A 1ZIPA 3UMFA 4XVUA 2XITA 2PBRA 1KNQA 2WBLC 3DZDA 1C4OA 2FZLA 3GLIA 1M7BA 1G8PA 4YDHB 1KOFA 4HEJA 1AJEA 1IN6A 5EJEA 2RGNC 2C9CA 4MKFA 5D3MA 2BDTA 1ELOA 1E4VA 2QN6A 5B58C 3GLFB 2W58A 3QPVA 1W0JD 1G3IA 5BN3A 2QSYA 5AJXA 5KSZA 1KI9A 3KKOA 5FPHA 4D0NA 3T1TA 4EUNA 4I1UA 1Z47A 4Q47A 4B3GA 2C5LA 1XEXA 4L4UA 3OIYA 4MYUA 1D9XA 3T35A 2OCAA 4LBVA 4CDGA 3WXMA 3QQ5A 1KI3A 3W6OA 5KDOA 3RANA 1Q12A 4ZDIA 3ADCA 2V6IA 3U3RA 5F9FA 1DEKA 1XBTA 5JEEA 4OHYA 1TQ6A 3LWNA 3ND9A 4ACAA 1BYUA 3NEJA 4JVNA 5BYJA 3KKQA 4KHZA 3ZZUA 1W36B 5E4FA 5EXSA 1MO3A 1QBKC 3WNDA 2KWIA 4B34A 3RVBA 5L3QA 6Q21A 5DLQC 3BGWA 3GD7A 3MJHA 4A6PA 1W0KA 3QF7A 3EASA 5FBQB 3IBYA 4IXNA 3QKTA 2Q9CA 3W9YA 4EQ6A 4FI3C 2QEQA 1T5IA 2ZI3A 3AVUA 3CH5A 2VF7A 2VP9A 2CK3A 1XPOA 1Z08A 4ESVA 1NSFA 3RS4A 2PMKA 3B1WA 3IBGA 1Z6AA 2Z43A 1EFRA 1PUIA 4P4SA 1Q21A 3BB1A 4OJKA 5AJYA 4GT1A 2NO1A 4TT3A 1YRAA 5D3MB 3B7GA 4NYJR 2WVJA 3M0EA 4OK3A 2GF0A 3TR0A 3K1JA 3MMPA 4BECA 3BFXA 1RRPA 3IO3A 2NO9A 3V4FA 1G8FA 1AN0A 1T6NA 3BC1A 4KAXA 4MRNA 1ZCAA 3I8SA 1FP7A 2D3WA 4JIMA 1YJ5A 2A78A 1AKEA 2IT1A 4LX0A 2P67A 2KI5A 5D3QA 4AG6A 2RGBA 3LX5A 3REGA 2EU8A 2IXFA 2QZ4A 4UXJA 3TJZA 3WYFA 3EZFA 4TMXA 3QKRB 4TLDA 3CIOA 2XEXA 2YWGA 3PEWA 2NGRA 4ZV4A 1FQJA 4Q7KA 4R2IA 4U02A 1K6MA 2O8FA 1Z22A 1Y3AA 4IOLA 1CS4C 1BOFA 1CXZA 1UKEA 2JLZA 4IVRA 1R7RA 2X77A 1L4YA 4G1UC 3R9XA 5KPDA 2ZJAA 4NYIQ 3AVOA 2XGJA 1UJ2A 2BBTA 3DHWC 3CLVA 3N5CA 1E6CA 2BVNA 3T34A 4UNSA 3FVQA 4L15A 4HAWA 4BEJA 1IBRA 1RPZA 1F3OA 2QRNA 2GJSA 5H70A 2QU8A 2IS2A 4CW7A 2QM8A 4JYCA 1SGWA 2BJVA 821PA 1SKYE 3IQXA 2WJGA 4OI2A 3P1JA 2IXGA 3TSWA 4D4LA 4Q7MB 3NIBA 3AUXA 4LOAA 3GCGA 4KO8A 4R2HA 3CH4B 2HLDA 1K5GA 4PXAA 2VHQA 4EJSC 1LFDB 3OESA 2JGNA 1C1YA 1Q0UA 2ZUBA 1OFUX 2J7PA 2E1RA 2ZJOA 2RMKA 2C77A 3A1WA 2WIAA 3SQWA 5TB5A 2VTKA 4JLKA 4LSGA 2KBFA 2QUZA 3ZVMA 3LY5A 3C41J 5EE9A 3B1ZA 4X8LA 3GP8A 3VKHA 4MKHA 1YZKA 4PC6A 4JJKA 1DAEA 3NHBA 4QJ3A 4XWKA 1P2SA 4B6EA 4M8NE 2GRJA 1Q1QA 1T0HB 1M1YE 3AV0B 3FB4A 1W36D 2PLFA 2JDIA 2HJGA 1D6JA 1WF3A 4PHHA 1W7AA 2F1JA 5SZKB 3X1DA 4PPFA 4WBSA 3I8XA 1SXJD 4L8GA 4ESHA 3CF0A 1D2MA 3X1ZA 2W0MA 2X19A 1KO5A 2GZDA 4DLUA 2PCJA 2QMHA 4MGKR 4LYFA 1GIAA 2FNAA 2IEYA 2P65A 3PITA 4GOXA 2VHTA 1R6BX 2IYQA 1CTQA 4URVR 4IFEA 4DCSA 3O8BA 2WWYA 1GL7A 3OZXA 5EZ5A 2ZROA 1XTRA 2CK3D 2DWPA 2R8RA 1KK2A 2BMEA 1OXXK 1VCIA 3IILA 4POAA 4PPQA 4OK5A 3W3ZB 4BRWA 4Q1EA 2FF7A 1P2VA 3F3YA 1MRNA 3UMRA 1J70A 2ZRNA 3QKRA 4HUTA 4FWTA 3FTQA 1DG3A 1IHUA 3RHFA 5B30A 4UQOA 3F0TA 1F2UA 1DE0A 1I4LD 4JMPA 1AM4D 4WXRA 1UBCA 4HYYA 5JI2E 4EFLA 1UAAA 3EWAA 1LS1A 4D4MA 3U61B 5DI3A 1NY6A 1RW4A 3OEHA 3BOSA 4EKDA 1QRAA 5DIFA 3W8RA 1N6KA 1GDDA 5C18A 1V43A 4B43A 2ZSBA 3AVWA 1II8B 2J1LA 4C3ZA 1P4SA 1QVAA 2QA5A 3WYGA 1SHKA 3WYAA 721PA 4BZXA 1U8ZA 2WAYA 2H5EA 1AS0A 1ZRHA 3QNUA 5SZHB 3U7HB 1KI2A 5JLJA 4AKGA 1Q3TA 5JFGA 3D3QA 3EIQA 1HT1E 1U2RA 3ADBA 1G5PA 3B5JA 3QIAA 2QSZA 2MMCA 2PEYA 3T15A 4DCVA 1XZPA 2AHOA 2KBEA 2ZANA 4P32A 3CZPA 3LRPA 4U00A 4O2LA 2VSXA 1OXUA 4URUR 5CDFE 3O8CA 5F9HA 3K9HA 4IOMA 3A6PC 2CLSA 1KDOA 1E9CA 1XNJA 2QTFA 1U99A 1Y63A 2W6ID 4TTQA 1VECA 5HTKA 3THYA 1R0XA 3C4JA 5BN5A 1G7RA 1E0JA 2CE7A 3THXB 1IY0A 3R9IA 3TK1A 4LJ6A 2R6GA 2FJUA 1HA3A 4QBGB 1H8ED 2JIZA 4RKFA 2IWHA 4URWR 3EWSA 3G82C 4V0KA 4B71A 1VCOA 1YR9A 5J4LA 3AGQA 4AYTA 5KUTA 5JI3E 4EJSB 2CJWA 2AFIE 3FE2A 3TLXA 4LV5B 3CNOA 1G5RA 3UATA 4M9SA 1KK3A 1AGRA 1N6RA 2FPMA 4MITA 5KHOC 4MGIR 3ZS8A 4QC2A 3NWJA 4PHFA 1L8QA 3KJGA 2GXUA 3H86A 3PFIA 2Q0HA 4MRSA 1QHIA 2NZJA 1UBGA 4TQ9A 2WOJA 1FMJA 3E1SA 5L8VA 1XD9A 3M6AA 4ITRC 2F1IA 3BWDD 4BEBA 4MKGA 3OEEA 2FSGA 5EE0A 2W0SA 3HDTA 1DAFA 1XX6A 1Z6YA 1QVRA 2F3RA 1CP2A 2CL0X 3AF4A 1ZNZA 1VMAA 4MRVA 2A3RA 3QXSA 1EFCA 2RGDA 2HT1A 3T1OA 3NBYC 2WMNB 5M04A 1P73A 3WHKA 2J59A 5CK4A 2I1VB 1DAKA 1NG1A 3L43A 1U98A 1CRPA 3QBTA 3U6KA 2VL7A 5DHFA 1KO4A 2ZETA 2ZIAA 4M1TA 3I61A 2A9KA 2GVDC 3EC1A 4A0HA 1UADA 3L8YA 1YZGA 3K0FA 5FPSA 1NMYA 3GQBA 1E9RA 4LZZA 4DLSA 2IF0A 1FZQA 3DO6A 3GEIA 3K09A 5JMTA 3KXKA 1KTVA 2QT1A 1JAIA 3ADKA 4DCUA 2GWHA 3CONA 2VBCA 1N0VC 3A37A 3JVVA 3LQQA 1DO0A 1FL9A 3OIVA 5FUYA 4LY6A 3Q85A 3MWKA 4C0AC 4FMDB 4PO1A 3T1VA 3VU9B 3B85A 1ZNWA 4DHEA 1FNMA 1GNQA 1ZNXA 1J7KA 2UKDA 2DB3A 2J45A 1X8JA 2JLQA 4HDCA 2ECKA 4JBYA 2FSIA 2ANBA 2GDJA 1OT3A 1ZMXA 1SXJE 3MJRA 5ELXA 4IVPA 1X1SA 3U3OA 1Z0FA 1WB9A 5HCNA 3BFKA 1GRNA 3NXSA 3CO5A 3ZQJA 3PCRB 1Z63A 2W6JA 4Q1BA 4QNRA 1I2MA 4V0ME 2ZI6A 4ZIRA 1SKYB 5FTKA 4RD6A 4HLCA 4KLZA 1TAGA 2G1KA 3THXA 3NH9A 2ZI9A 4KVGA 4ZPXA 1J2JA 1HH4A 1KSFX 1G5TA 3VTKA 2D62A 3GLIB 1XPUA 3NH6A 4A36A 5KDDA 4LHYA 1ZM9A 3I1FA 1DOAA 1M74A 3A8TA 2CLCX 2A5FA 4FIDA 4YMWA 1XEWY 3X2SA 3VFDA 4DEXA 1WA5A 1YE8A 2LWIA 2JLRA 1P75A 1MH1A 4A92A 3A1VA 3VQTA 2N42A 1US8A 4DKXA 2ZPTX 4N0EA 5E7IA 4B3CA 3N2IA 1JNYA 4D80A 3LW8A 5AJVB 1RRGA 1IAQA 4HZUA 4Z1MD 4C7OA 4B44A 1FX0A 2WIBA 5J4KA 1M8PA 4JVMA 1KI6A 4TQAA 3WRYC 5DN6A 4B47A 5CYPA 4OYHA 1ESNA 3OFND 1XWIA 2W2VA 2JJ2A 2Z83A 3QEJA 4C0KA 2C78A 3PUWA 3MUFA 4OQLA 3U4QA 3B60A 3Q3JB 4IOKA 3BERA 1XMVA 1RC8A 1NN0A 2JLWA 2DPXA 1XRJA 3SOPA 4B76A 2NG1A 1OXTA 1GVNB 1MO5A 2ZM5A 4D25A 2GKSA 4AKEA 2FSFA 2ZRAA 5C2JB 3SHFA 1SXJB 4GZMA 1I4DD 2D2FA 1D2EA 4N0DA 2XX3A 1DELA 1GM5A 4Q9HA 1Z3IX 1A7JA 2IUSA 3AGPA 3AKEA 4V0MA 1NBME 3CUEF 3DKVA 5LB4A 2OAQ1 1Q57A 1HYQA 1D9ZA 1F6BA 5JJLA 1KJWA 4RCZA 2IK8A 1TMKA 4TL9A 4KFSA 2HCJB 1VG1A 1G20E 3LO5A 1T8TA 2WZQA 4XSHA 4QHYA 5AJZA 3OF5A 4M0LA 3WNCA 1XF9A 5GJBA 3L0PA 1XD8A 5LD2B 2C2HA 3CF2A 1WCV1 5AWFC 2ZXUA 3VR2A 1N25A 3PG5A 2Z6VA 2VRWA 4PHTA 4Q4AB 2ZI5A 3REFA 3OAAD 2WWIA 4QFMA 1XXHB 2WWXA 2R9VA 2OFXA 4TMVA 4MDFA 1CRQA 2B7CA 1E2LA 1E98A 4JVLA 2NMVA 1QHGA 2DYKA 1GSIA 3KB1A 2AD5A 4ZO4A 3R8CA 5KTYA 4LHVA 1ZM3A 2OE2A 4MRPA 5FUXA 1Z28A 3DDCA 4M4SA 4IXMA 3SC3A 1N5IA 2ZSDA 3X1YA 4MUAA 2E9SA 2HJVA 4ZIRB 1VPLA 4B75A 1SVKA 2HYIC 4G5GA 1YZUA 4RD0A 1Z6TA 1XZQA 4Q9LA 4DIEA 2OEPA 4DLVA 1R0ZA 3DEFA 2G0TA 3KTAB 1E2MA 5H68A 4TYQA 1OH7A 3THOA 4B3XA 2IXEA 2QROA 3FYHA 1ZM4A 2J0VA 5EP2A 3IO5A 2QGNA 1VCNA 2QNRA 3ZJYA 1G9XA 2ZI4A 2F3TA 4IVQA 4UNNA 3K0EA 1G7CA 2J9RA 4ZCLA 3SFVA 2H8KA 1TQ2A 4CGZA 2EFEB 2I1QA 2EYQA 1RJ9A 3QF4A 3O47A 3SYNA 2JJ1D 2OBMA 1F2UB 2QP9X 1LY1A 1OB5A 4C7OB 2CVFA 4D4KA 2GNOA 3PEUA 2JLXA 5EP3A 3EIHA 4ZCMA 2WAXA 1E2EA 2ZE8A 4YXWD 5K8IA 2OSBA 1TEVA 3RRMA 5CLQA 3NEYA 4N3NA 5DI9A 4GMXA 4C0JA 4L9WA 3PUZA 4GZLA 3TRFA 1KMHB 3QXXA 1S4QA 1CJKC 2QM7A 3AB3A 4NU0A 4G5OA 2BKUA 4RZXA 1A1VA 4YMVA 2D4HA 4JKIA 4OQXA 3ZH9B 4KBFA 1HY3A 5C46F 1T3SA 3RNLA 3OFNA 3QSYA 4PQRA 2AK3A 1NLYA 1WE2A 2O8BB 1NVXQ 1YVDA 2IYRA 1OIXA 4P31A 3VR3A 2FPLA 1GZSA 3V4RA 3FKSD 4L5BA 1UDXA 2BV3A 4Z54A 2ODWA 3M4YA 1R5NA 4F38A 1G41A 1S8FA 3NC0C 3HPRA 5E95A 5JSZB 4UNRA 3KFXA 2DY1A 2AK2A 4Q02A 5IHPA 2WV9A 3HYTA 1ZUNB 1XTJA 2X1VA 1VIAA 3LA6A 2XZPA 3AKCA 1HTWA 2ZRIA 1TPZA 3U2QA 5KNDA 2ZU0C 2J5XA 4TL7A 4XTCS 5LB2A 1G7SA 3QXHA 3TW4A 1M7GA 1RRCA 1DADA 4LWZA 1CJVC 1ZU5A 2A2ZA 2R6DA 1JAHA 1M6NA 2UVQA 2VEDA 3B1VA 4II7A 3B1YA 2ORIA 2ZS7A 5KSYA 4O2RA 4OKSA 5HZKA 2R44A 2GJKA 1N6LA 2DBYA 4AC9A 3BK7A 5HE9A 1KMHA 1N0UA 2WKPA 3SU8A 4R71A 1MT0A 1FTSA 3DM5A 4US2R 1CKEA 2RGNA 3HU1A 3KX2A 2R62A 2O8DA 1ZNYA 1PUJA 1I2DA 2G3YA 2R2AA 2YHSA 4S2EA 1E9FA 5CJPA 1ZINA 1CJTC 4IDOA 3KJIA 4F92B 1G8YA 3FKQA 4RZUA 3HU3A 2ATVA 4KYUA 3IHWA 3EZ2A 2IYXA 5AUNB 5G41A 2FA9A 1A2BA 1IONA 3QF4B 1KI7A 2CJWB 3IDQA 2LCFA 4FN5A 3NDPA 3K0FB 4Q5IA 1SXJC 4CT4B 4DSOA 1SKQA 2W2XA 4IFBA 1E2GA 5G40A 1E79D 1D8TA 3SHWA 2JLVA 1JECA 2Q9BA 3C15C 1IXSB 2ZRDA 3CBQA 1KI8A 2VHUA 1CULC 2QBYB 2AWNA 4I1VA 3MAAC 3VHXA 4CF7A 3KQKA 2X8AA 1UPTA 1YU9A 1E96A 2KSQA 4G3XA 1TEXA 1E2NA 1G4UR 2EFCB 3PUVA 5CJ2A 4BFZA 1YKSA 3RWMB 3W5IA 2QORA 4TL6A 3IIMA 2VSFA 2XNSA 5EP4A 4B33A 5FH9A 1KK0A 4PX9A 2SHKA 2J87A 3BB4A 2CHGA 3CX8A 3RS5A 1T8UA 1JR3D 1NBMA 1Z0AA 4M2LA 1GNPA 3QPUA 3AF0A 1CJMA 1NN5A 2QP4A 1SZPA 1CR0A 1IY1A 2MSEB 1GOTA 2YNMA 3GJ6A 1W4BA 3U3JA 3ZIAD 4EJSA 1XMIA 2KB0A 4BE7B 4B6FA 3CZQA 5CM8B 4BFTA 1G7TA 1D5CA 1N6IA 3P26A 4Z8YA 2Q9AA 4ZKDA 3U44B 1QG2A 2R6CA 2FEMA 4FXPA 4G5SA 3VHLB 4XD7A 3ICEA 3KUDA 2ZRLA 3A1UA 3WHLA 5KO2A 3AVVA 1RE0A 3LDAA 4HAYA 1Z2CA 2ZJ8A 3D6TB 3EZ9A 3K70D 4JLNA 2N1BA 2O0KA 2CDNA 1DAGA 3QJYA 1WRBA 2IBMA 3N70A 4EPYA 4QBFA 2VLIA 2EYUA 4QG7A 2CXXA 4R7ZA 4BFXA 1US8B 1N5JA 4LC0A 4LCBA 4XSGA 2JJ8A 2QAJA 2ERXA 1KJYA 4HUQA 3P4XA 2WJYA 4HAUA 1U0HC 3KDSE 2X2EA 1XP8A 1XJQA 5CITA 3U44A 4EPRA 2D7DA 4AKHA 1G8HA 1MKYA 3FKSA 4AD8A 5J4YA 2NO6A 1P2TA 1NJFA 3U7FB 4EAQA 2OV2A 3AKYA 4RY2A 2NPFA 1G6HA 4RD1A 2H17A 3DM9B 1N6HA 4Z51A 4P0TA 5JECA 4B3FX 3K0AB 3THWA 4C4PA 4IOJA 2O5VA 3H84A 4LBWA 4M9XA 3W8NA 1G19A 3W6PA 4U7DA 1HE1C 1WQ1R 3Q5DA 1A5TA 1HQYE 3Q72A 4KSCA 1MRSA 2PZFA 1KO1A 2ZJBA 4KJZA 3W6NA 4OQFA 4JBWA 5EE3A 3I62A 4BGDA 1P9RA 5FBWB 4V0NA 1Z6GA 1R10A 2WPDD 2GETA 2XNDA 4NCNA 1ANKA 3FHOA 1L2TA 1KSJA 5HCIA 2F43B 3W90A 4O0MA 3TKLA 5FTNA 1Z0KA 2J0UA 3RAPR 1G3QA 3VKWA 1Z07A 4YDSA 2NQ2C 2IWRA 1E9SA 1OSNA 2ZRPA 3FMFA 1OXVA 2GXAA 4C2UA 2F9LA 3BH7A 3OIUA 1PVOA 5FPKA 4TL8A 1TF7A 3AP1A 4FINA 4AYWA 1UM8A 4DT1B 2PX3A 3LXRA 5J4VA 4AYXA 3PXGA 2H16A 4C0SA 1EFUA 3RC8A 1H65A 1Z6XA 4OK6A 3VX4A 4QBIA 2C04A 2REOA 5C4GB 4NP6A 3RDPA 1JXOA 1AGPA 1U94A 4LJAA 5KOYA 3UWKA 3KZ1E 5J47A 4MGYR 4WZ6A 1NNEA 2YINC 2ZYTX 4M9ZA 1ZM2A 2ERYA 2BJWA 1GITA 4BZPA 2WHXA 2QG6A 5EE1A 2VH5R 3LV8A 1GILA 4ASUA 4P3YA 4PAOA 1X3SA 2GF9A 3EARA 3WBJA 2ZE7A 1BMFA 2FMXA 3GLFA 1AA9A 4OBEA 1LF5A 4TLAA 3X1WA 2ZYVX 1IY2A 4QJ5A 1ZD1A 4YONB 2ONJA 2GHIA 3TVDA 1GL6A 4KYIB 4D26A 2OESA 2X2FA 3UANA 1S96A 4DLRA 4MYHA 3CPHA 2D06A 5J40A 3VNUA 2OHFA 4HDOB 2GCNA 4KBGA 3K9NA 2CNWA 1S2MA 3Q9LA 5FFMA 5LD2C 4RD2A 1K5DA 3TUIC 1C9KA 1X8LA 4Q01A 2QENA 3LLUA 3B9PA 1IJFA 1CR1A 2CLDX 2YWFA 1W5SA 5BXQC 1XMSA 1TUEA 2ZRFA 3JZMA 4MQBA 1XU4A 4PZLA 4FCTA 4A2PA 5AK0A 1KNXA 3MG9A 2D7CA 2IYYA 4QGFA 4OQNA 4HDQB 3WP0A 3L2OB 2QP3A 1R4AA 5F2EA 1IN5A 5E3HA 5SZIA 1KK1A 3SDZA 3B6EA 2AXNA 2YOGA 3T5DA 3IIJA 1W4AA 5L3SB 3LBIA 4WOPA 2JAQA 3CB4A 1OH5A 5KYKA 2IYTA 4LUCA 1G21E 2OFWA 4PR0A 4OJQA 4H9GA 2FZ4A 1S0UA 1T0JB 2NPIA 1E2DA 3QG1A 2ZRHA 4M53A 3O8DA 2OCYC 4P4SB 1J8YF 3IUYA 4ON9A 1TQ4A 3ZLJA 4F91B 2IS1A 3UPUA 1LTQA 1Z83A 4C0LA 3KL4A 1MR3F 4NZYA 3BD9A 1KDRA 1FMLA 2HXSA 2A5GA 4Q4LA 4UKDA 2F55A 3GMTA 1MABA 1MO6A 4I1OA 2PEZA 4A0GA 4D2IA 2GXQA 2GJ9A 1UKZA 5TARA 1LF0A 3BH0A 1U9IA 1ZJ6A 4URXR 5BQ5A 2OM2A 4L16A 1JI0A 4CEIA 1W4CA 4GOKA 4B73A 4MH0R 2FFQA 4BLRA 2XJ9A 4E22A 1UDWA 4A2QA 1JQLB 1SVWA 2IS6A 3K09C 3QPWA 2EFGA 1RRFA 1S1MA 2ZU6A 4ILEA 1T9HA 2ZUCA 1FUUA 1YR6A 4TMTA 3ZDQA 1KDPA 1W0JA 2ORWA 3CWQA 1QZXA 2AXPA 4RFSA 3RS7A 4WA7A 2GAAA 3P4YA 2VIIA 1P3JA 4UXIA 4OHZA 2RHDA 2WJIA 4BLPA 3RYTC 1VKJA 2ZYUX 5FOSA 3S1AB 1TF2A 2JLYA 1EX6A 1VCMA 1SVIA 2JLSA 1G3UA 4QGAA 1E3MA 2GJAA 1IXRC 1U0LA 3QI2A 2IEZA 2D2EA 4CIDA 1RZ3A 2PJZA 4ZKEA 4UNQA 2ZE6A 2ZYWX 1K8RA 1XXHE 3EZ6A 4W5HA 3ZVNA 1S3GA 2IYSA 3EG5A 4JS0A 4TN1A 2BCGY 2P0EA 3EXAA 4CEHA 5JZVA 3GFPA 2KJQA 4JLMA 3PEYA 2O8BA 4FCVA 3KXIA 4LYJA 3CF6R 2MSCB 5CDFA 2IYLD 4HB0A 2JJ2D 3GEEA 1FPMA 4DCNA 3BB3A 2F1HA 3HWSA 3WY9A 1XFAA 3KQHA 1Z5ZA 1NF3A 5FL7D 2AKAB 5FOVA 3WNBA 5DN6D 2RGEA 4X8OA 4KFUA 2FE4A 2B92A 5FR1A 4LBYA 2N46A 2DFKB 2FG5A 4HB3A 3TUJC 5JCZA 4A0FA 4YMUA 3WP1B 2PMDA 3PV0A 3CR7A 1N0WA 4G5QA 1RYFA 3R9WA 4MGZR 3I3SR 2GBLC 4NYIR 4JLPA 3QKSB 4PSVA 1QHXA 3I4LA 4FMBB 4KODA 4DLWA 1KHTA 5JHHB 2UZIR 2WWGA 1OPXA 2CE2X 1N6NA 4GP7A 1Z8FA 5FPYA 2ZS8A 1E9EA 4LJ5A 2IYUA 1G8GA 1XTKA 4C30A 2AL7A 4ARZB 2V54A 1KDTA 2WMOB 2ASEA 3TSZA 3CX6A 4DLXA 1T5LA 1V5WA 2ZJYA 2JASA 4Q1AA 2ZRBA 4WVFA 2O8FB 2C8VA 4IEEA 4P4UA 1SULA 4AKIA 4KSBA 4Q9KA 3PUXA 3S1AA 2OFOA 2GTPA 1DARA 4BWYA 2UZ3A 1Q3HA 4HSEA 3KQLA 1TNDA 2Z0MA 3SR0A 1CEEA 2ZAMA 4Q18A 3A4LA 2IUUA 3H1TA 1UF9A 1VDZA 1CF4A 5JSZA 2NOAA 3SJCA 4CYMA 1G291 4YMTA 2QQ0A 1U8AA 2ONKA 4MYCA 3DOEA 3FFAA 3LBHA 4IKEA 1BMFD 4QBHA 1IN8A 1XJ0A 3K9GA 2O0HA 4PAQA 2A5YB 1XDBA 1NIPA 1M2OB 4FMDF 2WOOA 2DWOA 1W49A 3QENA 1YZNA 5F98A 3ZZTA 4B32A 1EFHA 2JATA 5FPTA 4E09A 5HKKD 3A1SA 2K5UA 3WMEA 5TMPA 4TWZA 2CMKA 3E70C 4IEIA 5FI0B 5GADl 3AVPA 5P21A 2QPAA 3T12A 2QBYA 3H4MA 2NIPA 5B64A 4M1MA 3A58B 2A30A 1GUAA 2V1XA 2QI9C 4RJLA 4BZQA 5TVKA 3EX7C 4OI4A 2JJ1A 1UEJA 4DRZA 1OW3B 4HB4A 2DFNA 3AEZA 3T06B 2FGJA 3GJ3A 2ZQ5A 1HQCA 2OO7A 1Z0DA 3BORA 4TZ6A 1LNZA 2RH5A 3I73A 5KSPA 5DH9A 1R8QA 4IJMA 1R8SA 5LPNA 2I4IA 4UNPA 3LX8A
chains in the Genus database with same CATH superfamily
2XNHA 3OCVA 1SB9A 1JIUA 1I4EB 2Q4BA 1E6MA 5C7LO 1W44A 1GQOA 1YTUA 3KM0A 2G7MC 4G8CA 2PANA 4KH1A 1NLMA 2FW6A 5L6LB 1PHRA 1V47A 5KQMA 2PGXA 3E82A 3FN4A 2CMGA 2IL1A 4D46A 3ZDCA 1DEXA 3B13B 4JWKA 3UHAA 2LW7A 4RNDB 1EUDA 1W29A 2X42A 4NBSA 2YN0A 4KLNA 5JVDA 3EVCA 3FFTA 3WE7A 1UKVY 5JPCA 1U0BB 3FDXA 4KFCA 1LK5A 1DC6A 1NVWQ 4CF4A 3JD4A 1NMXA 1VE3A 3L7DA 4XWAA 2C2MA 4MROA 4GS5A 3SXUA 2CHVA 4ZJZA 2IXBA 3UXMA 2NU7A 2I1WA 4QECA 4HY3A 4OXYA 1DBVO 1XCMA 1LV7A 3BL5A 3BPSA 2R6AA 1XLVA 1ZIOA 2P8JA 4YYEA 5J2UB 2IEAA 3E5HA 2ZBPA 1MV8A 1LPNA 3BE8A 1JWBB 5DXJA 5AW1A 3BWEA 3H8VA 2Q1YA 2ZJ2A 3ETGA 4Q16A 3FDZB 3KVYA 1IZ0A 1BD3A 1YVUA 2DU8A 2BZGA 2I0FA 3KCQA 3NB0A 3O4GA 4ME6A 1WTAA 3R7DA 4TSFA 5EESA 2RKWA 4LY3A 1RABA 5AT1A 1NQXA 3V8RA 5F3DA 3GZJA 4Q9IA 1S3SA 5HKOA 2AMYA 1LPMA 3BZBA 3HNPA 4O6VA 5JHGB 2BKXA 2RGXA 5AH0A 5BORA 3O9MA 4G4JA 3RQSA 1PR4A 1G17A 2NZYA 5CB0A 1CZUA 3LPLA 3FCYA 1DFGA 2GFIA 3MAJA 3NHAA 1GYQA 4LGVA 1W2HA 5AUQA 4XX0A 1CUGA 2Z3ZA 3NHKA 4Y2TA 2OQIA 2QJRA 5CLHA 3ZX5A 4F2HA 1U2PA 5I01A 3ZQUA 1NR5A 4GZ5A 1N2OA 2JDID 4DIFA 1NDHA 2QQ5A 4LKRA 1PLJA 2XLBA 3IOBA 1JLHA 1ZBDA 1DV1A 1GD1O 1X1BA 1ZVQA 2EWWA 2GCIA 4J1NA 4ARCA 2O52A 5FWXB 5A5DA 1FE8A 1JQ3A 4LJKA 4A82A 2ACKA 5DIZA 4GR5A 1JE1A 2G5PA 4X8HA 3TVTA 3V9PA 4N47A 4B09A 1L1EA 3M7IA 1K7FB 3LKBA 4C7VA 4ZVTA 3LYHA 1NVVR 1SA0B 2H4YA 2ZKLA 1Z2DA 3IP3A 3AJDA 3X1XA 1A95A 1G60A 1I2ZA 3LQRA 3KQYA 4UBKA 5FEMA 3ECCA 1PNTA 3E23A 3KDAA 3IMFA 3M1AA 3P5SA 5C81A 1DTWA 2AG1A 5TV2A 4PWZA 4RKWA 4NCKA 3M5PA 5JBNA 2AXEA 1UKCA 3EQ7A 2XGSA 2VR1A 1AK2A 1NU6A 2C97A 1XVLA 1Z4MA 2QN9A 3FWKA 4IDHA 4TTJA 1ZRSA 2AR7A 1UWVA 5CBPB 2ORYA 3ECAA 3NZEA 4DQDA 3LVRE 1JFSA 2EFDB 5H82A 4ZCRA 3T1QA 4Y0AA 1V45E 2TECE 3AX6A 3SIWA 2OECA 1FDIA 1OWNA 4M1KA 5AI0A 1B6GA 4L4RA 5JD3A 1E5LA 5L95A 4UDOA 3O4IA 1KAMA 4OTZA 3H8JA 1GQSA 3NWBA 1ZK1A 2A1IA 2WFZA 3CCFA 2O8CA 1WDTA 5L9AA 1VPVA 3EOBI 1U7HA 2PX8A 3GLSA 1U0TA 4U9HS 3X3HA 3L3BA 5BQFA 5HJ7A 1ABBA 2BGWA 2ADFA 3FF1A 2I6GA 4WNYA 4WOCA 2ZQZA 4Y2VA 2PLRA 3FHCB 1X7GA 5AM5A 4RTLA 3PC3A 1U2TA 5KDLA 4BQNA 5EGNA 1OLOA 4O3FA 1OXMA 3LF2A 1DQNA 4YPOA 3IBSA 5EZQA 2EX0A 3ZCQA 4C07A 3MK31 3CUSA 2DPMA 3G0DA 4GX0A 4ILKA 4P9NA 3WAKA 3OPYB 5BVGA 3K0CC 4OFWA 4KR9A 2X0NA 1HC7A 4HYTA 1E99A 1V1MA 5G3ZA 4UHBA 1NRIA 3HMKA 4LRSB 3U6BA 1L7VC 2JGIA 2H1IA 4K6FA 4HPXB 2NO7A 4MW6A 2AVDA 1UQRA 2HLNA 2VP2A 5H1YA 3QBVA 1C81A 1CYDA 1E9AA 1VSUA 3DZ8A 4FS8A 2NTJA 1XCGB 2W37A 4I81A 3NOXA 4NIMA 3RSHA 2Z6QA 4G5RA 3H97A 1BDJA 3RWOA 4PGGA 3Q8MA 5EMLA 1FLVA 1J33A 2HDWA 3PXDA 5KHLB 1W4RA 2O8VA 5T7BA 1TA4A 4RSMA 4D1YA 2V4ZA 1A04A 1MX5A 2F48A 2OAEA 1F2TB 4RSGA 5AUOB 4NJMB 5C4MA 5BN4A 1R3UA 2ZQYA 3AIKA 1RMQA 2R2GA 5C8XA 4QYSA 3ANTA 1VKHA 1P80A 1TFUA 2QMYA 3OETA 3CEMA 2IITA 2WC1A 4EG6A 2C0PA 4COOA 1JFVA 2NT4A 3DR3A 4XJXA 1QFSA 2ZSIA 3GK3A 1QYIA 4OFBA 3Q6IA 4PLYA 4R68A 1DJOA 3VPHA 5JRZA 4HNRA 4HTFB 4H77A 4B3SB 2BGRA 3L8EA 2OO5A 2QQEA 3OX1A 3JQ7B 1JTVA 1VIMA 1TA0A 3BICA 4I2NA 4P33A 4AF6A 4OMCA 5ECWA 4DDMA 1SD1A 4PG6A 4EMUA 1CNFA 1QHHB 1Z5NA 2I03A 4M1ZA 4CG0A 4AULA 1ZC4A 3OEHD 4F60A 3HRHA 3T3DA 4ECEA 2FPIA 3N6XA 1UZLA 2P11A 4PO9A 4UHDA 1WDWB 3PHBE 3WQHA 1ODJA 4H1VA 5DNVA 3BWBA 4ZOLB 3CEHA 1C3LA 3QW4B 2HYDA 3KKPA 4N6GA 3HFSA 3UAXA 1GAWA 3VMFA 2UYQA 4MZDA 4R40A 1PJTA 3R4VA 4HAOA 2GEUA 3QE0A 2HC9A 2MYTA 3AHHA 2ZB3A 4PQEA 4NBLA 1FVOA 1M2KA 2P9ZA 1VG9B 3D5TA 3H17A 3MS4A 1V5GA 5JZBA 5LKRA 1AQIA 1ECJA 3RD5A 4ALJA 1N32B 5LLSA 2WTXA 3JASA 3BMCA 4EARA 3L8HA 3TPFA 3PLAE 2Q6LA 4IQGA 3G2PA 2PH1A 3QLUA 4LJ8A 1O57A 2XWPA 4MI1A 3SIRA 3UQZA 1B8NA 4FSHA 4JHLA 1KWKA 2C0QA 1KKMA 1NE7A 4KOAA 4D4JA 3RS3A 5MFZA 3HL0A 4ZVSA 3N8DA 2UUCB 2WU3A 2FYTA 2NTYC 3LLSA 2WT9A 1JLRA 2GARA 2FXVA 4LKOA 4AWAA 2OV1A 1QCYA 2QGZA 1FYVA 4AK9A 1B1CA 1HZJA 2FV8A 3LAWA 4FBLA 5DXFA 4DANA 1UFKA 3BAZA 3G1WA 4WW0A 1C7EA 4DADA 3P2EA 1U04A 2BBWA 3FMPB 3NPAA 4BQQA 4EY6A 1NBAA 2HWWA 4WAUA 4H7PA 2JKVA 5D3ZA 3QK7A 3PXEA 4FFLA 1SVSA 3QP9A 1M8KA 2VOJA 3NATA 2WYUA 3F5MA 4IM7A 1P1JA 4J0CA 4OXNA 1QQTA 1VRVA 3QQPA 3SZGA 3D8SA 4BB9A 4DE5A 4OU5A 4W1SA 2P2ZA 2BR4A 2GXSA 2YVUA 4IFIA 4YASA 4F2PA 1PCXA 3JX9A 4M0MA 2OC9A 4RMGA 4INOA 2XAUA 4I4TA 4H59A 1YMQA 2PFKA 5DSXA 2QPTA 1WS6A 1CQIB 5AOVA 4RK6A 4XGQA 1NRWA 2J30A 3SAJA 3ESCA 1RT9A 2DBZA 4G1MB 1UBUS 4ZJYA 4RADA 1A9OA 2WWWA 2FPUA 5I45A 1U4NA 3HB7A 1CEYA 5BN3B 4KR0A 2BMJA 2QV0A 3BCUA 3MRSA 4LBZA 1XZLA 3HUTA 1OAAA 5ALLA 2WNHA 4NTZA 1YFLA 3DC7A 3D6MA 1QQBA 1F2TA 4PC3A 3GFOA 2J46A 4WXPA 1UXIA 3AILA 2PGNA 5KOHA 4FEEA 3L8ZA 1MB3A 4QDZA 3GJSA 4TQUS 4IDAA 1TO1E 4FC7A 3RRZA 2HCRA 3GUVA 2QRMA 4RWEA 4IDQA 5TQ0B 1V37A 2H29A 4BVJA 5BV7A 3QXJA 5IMBA 4Q6WA 2G9NA 4AJ4A 1Z12A 2J9YB 2JA2A 2ODEA 2YJGA 1FQWA 2ZEJA 3O93A 4W7SA 1U7OA 1Z7EA 4AMVA 2CMDA 1XT6A 2FLVA 5TMEA 3OX4A 3KT6A 1IE3A 2Y6UA 4CG1A 3A14A 3ZNPA 3NDBB 2FZ5A 2QXYA 5AO9A 2GT1A 4OLFA 3I04M 4HMQA 5BYBA 4FHZA 4JBNA 1MTZA 3ZDXB 4KHPB 3O9VA 1KSHA 1LQ2A 4Q4HB 4ZANA 3T5MA 5K0TA 5J2TB 3JWPA 3RUPA 4ZAWA 4FFSA 1CJUC 3BDIA 1W30A 3GJZA 4O4JB 1C9DB 2JBWA 3L82B 3L8DA 4A0RA 2BFBB 1P39A 2R96A 3G9UA 4IZIA 3MQFA 5AYVA 2NLOA 5HBRA 5JY1A 2O2DA 3FR8A 2YYZA 3CRRA 4B5KA 4QYXA 3R20A 2O59A 1Z5GA 4DG9A 4ZZ3A 2V6JA 1KFEB 2BKVA 3G8DA 3T7TA 4W4TA 2YWEA 4Z9XA 4DPMA 3PBKA 4ALMA 3H1GA 4HVCA 1WPGA 5D7NA 5IUNC 1X7YB 4B40A 3NM5A 1PSZA 2E48A 5IC6A 3IIKA 1TVKB 2DHRA 1IMOA 3DE0X 1P33A 3QOWA 4J7CA 4QGBA 1I5EA 1P31A 4OYRA 1B41A 1E2JA 4LOHA 4D43A 5K0GA 4ZI2A 1E2BA 1NBIA 3QX3A 5H81A 4YMGA 4GP6A 3KB2A 4D3FA 5KYVA 5DI3B 4DBVO 1JMVA 3UOAB 2GBIA 3JV7A 1R0YA 2QTNA 3ZTYA 3OQIB 4RXTA 6PFKA 2VF2A 1VTKA 4P7FA 3GLHB 4F4DA 2D1QA 2PX6A 4J94A 5JCJD 4NZZA 2APJA 1PYOA 4M1WA 4TTRA 3RGWS 3LY9A 3MGBA 3R1IA 1QJCA 3WXBA 4KIFA 4PG4A 4NY1A 5F1OA 4Q1FA 3BWYA 1K7CA 3C6YA 3GJ7A 2GCGA 2CUNA 2JIDA 3DLTA 4F0JA 1BIFA 4JT8A 3T52A 1V8OA 2O4CA 5AKYA 1P4JA 2HK8A 4DL9A 1CUDA 5FO1A 4J90A 4MA4A 3SI7A 2NU8B 3SZUA 5LOVA 4BJ5A 4DDVA 2IPMA 5LDDC 2J41A 1RKXA 3TBHA 3I72A 3HH8A 2MSWA 3SS8A 2YWRA 1GDTA 3WJ7A 2G36A 2VXOA 3QV2A 3EGIA 2O2EA 5HZHA 5M2QA 3VUEA 3A4NA 2HU8A 1AHIA 5SY6A 4JSTA 4R9SA 3R7WA 4RHEA 3GNSA 2DLNA 4R4JA 1PTKA 3DVSX 4F4CA 1JH9A 3FNHA 1J39A 4MWDA 4ROSA 3OECA 4UHFA 1RPNA 1YRBA 1T4GA 4DC1A 5DO9A 3W5HA 1TUIA 5J43A 3NW9A 2GN8A 3O0TA 4BNLA 4NPHA 3KJEA 5GM1A 5IUKC 3TB6A 1N8KA 3M89A 5DYIA 5JS7A 2YV4A 4JOBA 3HBNA 2XHZA 3VPSA 3KJHA 2DFLA 1WNTA 1FFEA 2W83A 2VHCA 3KXLA 4XIGS 4AY3A 5LBIA 1USWA 5IJAA 4YV7A 1FDVA 3CR8A 2WVAA 5CIYA 1QXSA 4G0OA 2GZ1A 2JLUA 3KJZA 1EQAA 1DBIA 2GCOA 3OE7A 2XXAA 1SXGA 2P91A 4QOSA 4Z8XA 4YV0A 3UT5A 1OT5A 1ZVJA 2J7PD 121PA 4JASB 1E2KA 1LDNA 2C3OA 1MX1A 1O95D 2B99A 3AZOA 4JX9A 1VYHA 1U11A 2WTUA 3JQFA 4TZ0A 1RFLA 3UAOA 2ROQA 2I2FA 2I3BA 3IERA 4J91A 3E05A 3VOBA 1KJQA 4GC9A 1JPNA 2QLTA 3WVNA 3LD9A 1RI1A 1FP4B 1L7AA 4PFSA 4S05A 2DFDA 3KHTA 5DM2A 1GEEA 3TZBA 3K96A 4BNDB 4KUGA 4BLQA 3CLRC 3IKVA 2AOUA 1Z29A 3BHMA 3EUEA 3OEED 5ALUA 1ZHOA 2ZS9A 4H6VA 4N65A 3CVJA 1TECE 2HCBA 4MP8A 5KNDD 1QSGA 3SPXA 3WADA 3CLSC 1L3CA 1WB6A 2WKQA 3PK0A 1F14A 1YR8A 4KLAA 1NVFA 1PFYA 3DDWA 3OLQA 3DOHA 1EHCA 4F6RA 1WVGA 1WETA 2NNWB 2B3DA 4M6WA 3ZZ0A 1U9IC 2IKQA 2EJVA 4BTVA 1Z4OA 2BM0A 4PO8A 5K0EA 2B2CA 3K16A 4DSTA 4AQYB 5B57C 4FMCB 1J9ZA 2RBKA 2YVQA 4BNHA 2FGKA 2ES4A 3KETA 3OQMA 3CWZA 4FVTA 4PBRA 2LKDA 4Q1DA 1HDOA 3FNFA 3PDIA 4DV1B 4D81A 1RWQA 2GEVA 1WMBA 3IR7A 4G84A 3UGTA 2IYWA 1JG7A 4A15A 1CQZA 1SR8A 2EP7A 3ZWAA 4LNHA 5H83A 3EXG1 3OAAA 3NX4A 4YUXA 3PNVA 1KFJB 4ND5A 2HTEA 1T4CB 2HBYA 2TS1A 3V3KA 1DAHA 3AU9A 3BEDA 5IC5A 4YAGA 4CT5A 2GYWA 3MGCA 1QUEA 1N3BA 2Y0PA 2ECQA 4OQMA 4R2XA 5G2OA 3ZCPA 1DEOA 2Q3MA 3G5MA 2VO1A 2W2KA 1RQ7A 4M86A 1JLSA 4UASA 2V8BA 1R6XA 2WUDA 3E4DA 5HKAA 2VJQA 3F7OA 4U7FA 4HF7A 4TUYB 1E0KA 4F1WA 2Q6IA 3EYWA 3OT5A 4ENPA 4YUVA 2FXIA 5BV0A 3OHMA 3EK2A 3BD6A 1T26A 3FAKA 4QFCA 1SUIA 2IU4A 3NONA 4UM9B 1ZH4A 3VR4H 2QSJA 4XLLA 3M2TA 4FZ5A 5BO5A 5E8RA 2UU9B 3RU7A 3NR2A 1FFBA 3RRYA 1L8AA 4NBVA 4KQIA 3UAGA 3PYXA 4K8OA 2H2FA 2LKCA 2VQDA 5HJ2A 2X9NA 2QVBA 1JEAA 1OLUA 3M8KA 1C9NA 4E33A 2CWDA 1A4UA 5EZ6B 3LFTA 1J0DA 2JEZA 3GRUA 4YAFA 1HE8B 2J3DA 2PT5A 3A4MA 1EM6A 4LCEA 3IQEA 3TOZA 1I1OA 4YP6A 4PZPA 3UF0A 4E0BA 1D4FA 2NSJA 2O2ZA 2XSZA 2AN3A 4RH3A 2A9PA 5ERYA 5B2ZA 4MCHA 1C9YA 2QJOA 3HV0A 3SBOA 6GPBA 2Z9DA 1EAYA 1BCRB 3CUVA 3FWPA 1B0UA 1W76A 1XLTC 2R47A 5JADA 2AXQA 5J2UA 1XZ8A 4DOMA 5K8VA 5TDHA 3T5CA 3TDMA 2LIPA 1U7DA 2UVPB 4PIMA 4R1UA 3I0ZA 3UK6A 1O5IA 4E2XA 4J16C 5KJFA 1LQTA 3NKVA 4IINA 1TAHA 3C48A 4CIYA 2H5IA 3EXEA 4BXOB 1FYXA 5HCUA 1U8UA 4FWIB 2BFNA 3M49A 1WX1A 2FOXA 2FHSA 3BIOA 4TV8A 1P5JA 1ETUA 1YQEA 2HFKA 2XCLA 4W5WA 2HGZA 1NXPA 2O1SA 1I51A 3RRFA 2G1PA 4MB6A 3GGPA 4Q4AA 4K0KB 3RADC 5KNLA 1DX4A 5DM0A 5I5EA 2J3IA 4AWXA 4ZMSA 4I9UA 3FOZA 1F0KA 4XWGA 4X7PA 4ZOLA 3FROA 5G3YA 1IEWA 3COZA 3TTUA 1V48A 2I4LA 5FL7A 2F7SA 4NCJA 3DAPA 2V74B 5K0NA 2JEYA 5TMBA 1HUQA 4EHJA 2I2WA 3EIWA 3I53A 1V9SA 1ZW6A 2F3SA 3HSKA 5T3YA 4OGWA 3FMGA 4MQUA 1L5RA 1XA0A 4JYBA 4L5YA 1A8HA 5FKJA 1T9CA 1E6KA 1NATA 5DGCA 3A9UA 3PTZA 3RS2A 4LOLA 1JVNA 5FXMA 2OBNA 3E3AA 1SVLA 2Y1CA 4I5GA 4V39A 2OT3B 5I9LA 5KYYB 4IUYA 1G4AE 1N78A 4B3DA 3AV3A 5KU1A 5J59A 1HDZA 3CJRA 5KNBH 3COVA 3SIXA 1EX7A 2W98A 3U60B 4A8HA 2VJYA 1ZONA 2HIMA 5ITSA 2DPYA 3A11A 4XD7D 1TE2A 4KE9A 1YB2A 1UBEA 2VXBA 3H87A 1RAEA 2XR1A 1Y8ZA 3PHLA 5ALZA 1NVUQ 2WICA 4XE5A 2W48A 4ZA2A 2ZB7A 4FCWA 1XV5A 2VYNA 2XCTB 5I6DA 1E1LA 2J5BA 3L7CA 1F9AA 4JUFA 4CQMB 4DSNA 3EW7A 2HSZA 4OQQA 2VP3A 4AUEA 4ARZA 1USGA 4P7JA 2IXAA 3LQ1A 1TCVA 3RH0A 3B2QA 1NWCA 3PWTA 4DUGA 5DCYA 3P7MA 4P93A 5IM4A 5HYVA 2DFTA 2GX6A 4FFBA 2H2WA 3D7MA 2Z4RA 5K2MA 5KBYA 1PV4A 1WKCA 4M83A 3UK0A 4PSCA 2W6QA 5KX5F 3ZVLA 4DBLC 1WUTA 1GGFA 1X94A 4HN2A 4MVXA 4WJZA 2PMWB 5KNCD 4JQYA 1HO3A 3T94A 5KSOA 3THRA 4LYAA 2AB0A 3CT6A 4P5EA 5FAXA 4QFBA 5L3SA 5DNYB 1E1QD 1KOJA 3CZMA 5JR3A 2H7VA 1T5SA 1Y37A 2E4AA 1UBOS 2QAGC 4I9HA 4UE6A 3PPXA 3RB8A 4BKUA 4KO4S 4W9RA 4KOEC 3RSLA 4RTRA 1XTBA 4IIYA 5HA5A 1YJCA 1M0TA 3SG0A 2VDLB 1SCUA 1V1MB 3LPMA 4FGJA 1NN3A 4F86A 3VNRA 1DIAA 1RDFA 4RA6B 1FQKA 4G2TA 3SZRA 4ZVPA 3SYKA 2V9CA 3UHOA 1E89A 1P62B 2HV8A 3K0SA 4F4FA 2W4MA 5JS1A 1MD9A 1FYFA 2HRZA 2Q7DA 1X15A 4QSMA 1BXGB 3I1JA 1ML3A 4YUWA 3HDJA 4TTPA 5GZ3A 3OLXA 3ZBTA 1NONA 3R0QA 2DCMA 4OQYA 1NLFA 2PS1A 2VNAA 3O2JA 3PNYA 4WMLA 3WDLA 5A4DA 1FMTA 5BOSB 4BO1A 5BNWA 3EPPA 1SCUB 1GKIA 1MC1A 4NPCA 2OUIA 1IPHA 2CUKA 3B1XA 2QE7A 3B6MA 4M7RA 4RHUA 1ZL0A 5IN5A 5IYZB 2ZDQA 3MXOA 2B34A 3IJRA 3UIEA 4OLHA 4YMSA 1HYBA 1XZBA 1VE5A 2WU0A 3PFCA 1GYRA 3H75A 3PNPA 3I9V6 1YOVA 3AG6A 3JATA 3C7CB 1BU5A 3W9SA 3ETHA 3ML1A 1MU0A 3J7TA 1OWPA 3IT2A 1FFHA 4CVNA 5FJIA 1IQRA 3Q0EA 3FI9A 2IYPA 4Z2AA 3IP5A 5JNVA 2ASVA 2Q4TA 1OYYA 4CZ2A 4F4IA 1EGVB 4D8VA 4JNKA 4WX2B 3WLQA 1I94B 1J1IA 4PRZA 5LYYA 4AN1A 1OJLA 1VXRA 1U2EA 1EVYA 2RHRA 3GT0A 3SQXA 3PKZA 3VKGA 2P6UA 2XZTA 1FBTA 3AFGA 2W6IA 1E2PA 1ODSA 1HQDA 3JW8A 1CR4A 2VF5X 5EXDA 3ZOZA 5HR5A 3F1LA 4X0EA 3O2NA 2EERA 3HP1A 4WK2B 3T7AA 1HTTA 1N0IA 2NVWA 2CXSA 4G24A 4M22A 3GLHA 1U7UA 3Q3EA 1YHNA 4C05A 4BMXA 3LLCA 4LC1A 1YV9A 4XQ9A 2VNIA 1CEXA 1M0SA 1V8FA 1PTJC 2JH3A 1OZ0A 2JFOA 2PVPA 3AF2A 3FBWA 2HUPA 1KFBB 3J81A 2KE5A 3HO1A 1VGQA 1B7GO 4MUFA 5JAZA 3D31A 3FCCA 3GXOA 2CNBA 5LQKA 2YICA 3F46A 1PZXA 3R3XA 4EPXA 1VI5A 1YGPA 2W2TA 5CNIA 3LUKA 4AKTA 4R54A 1L5YA 2XA9A 4ZZIA 2W5UA 3H2IA 3GPDG 3OZTA 5GV7A 4D6PA 4ZEVA 2ZUEA 3QMWA 3B3QA 4RKQA 3ZE6A 4F21A 1OLSA 3DB2A 2AJCA 2WD8A 4X61A 3T7JA 1ZD2P 4FW9A 5C8YF 5J63A 1JR6A 1CIPA 3DC2A 5ADHA 1YR1A 4JLVA 4BHTA 1TK3A 1Y42X 4CMCA 3FHTA 1H1TA 1UMBB 3QE3A 2YJ4A 3TOVA 5KS2A 4DJDC 5FTLA 1EWVA 1FP6A 1T8SA 2ORVA 3R7WB 2H1HA 3CIFA 3I37X 3HNOA 4Q00A 2D5CA 1E4YA 1YS2X 3JQFC 1R1DA 3NQ41 4O08A 4UREA 3NHPA 5J5AA 2V5AA 3DE7X 1UODA 3KJXA 3W9BA 1FYWA 1MOPA 5CEJA 5DHAA 4IIUA 6AT1A 1N8TA 3QLTA 3EVEA 3IMGA 2P2LA 1B6RA 1RWPA 1XR3A 3O3CA 4MQEA 1Z4LA 1KMIY 4F72A 2UYCA 3FSGA 4RH0A 3VOAA 5F77A 1ULAA 2OGSA 1TKBA 2QK4A 3P9KA 3TRDA 1BW9A 2WJ3A 1QQAA 3GEBA 4L3OA 3I3OA 4AF8A 1JFTA 4IMRA 1AF7A 1PGQA 4BVKA 3UENA 3OY7A 2GCOB 1FMFA 1WUKS 5JALA 2XGMA 1G21A 3SX4A 3ZCRA 5LOVB 3SN6A 1E3QA 2XGGA 4D5EA 2Y8EA 4BEWA 2NZUG 3QKSA 3SJBA 2RGYA 4KQWA 3J7AC 1KYXA 2REQA 1FSFA 2BEJA 4ZDWA 4FYMA 4CV1A 2GNPA 2PR7A 2QR2A 1YB7A 1KHHA 4NV0A 4QYTA 3U7QB 5ICEA 4DV4B 4FEYA 3A0RB 4CUZA 1J20A 3OP1A 1RAIA 3GA7A 4HUQB 2OCBA 5JQGF 2C61A 3TGPA 1E2HA 1N7IA 5B55A 4Q12A 4ZRDA 5DBEX 2MR5A 3EPLA 3UT0A 4GYKA 3HI6A 4EPVA 1RYEA 1RZRA 4M8SA 4ADSG 3O8LA 5HM6A 2VJOA 1PW5A 2Q29A 4J0JA 4CMBA 3U7GA 1FUKA 4BPBA 1QG4A 4UUMA 2J9FA 3PE3A 4FUTA 5A5FA 4UFNA 1EVLA 3HY3A 2GESA 1GEGA 2HA2A 2JI8A 1CPYA 1U81A 4PGAA 4Y7CA 4DC0A 4FNAA 1P0PA 4WWHA 5B1DA 4XYLA 1O2DA 2IPNA 3L1VA 3SEAA 1TOAA 4OSOA 3CUWA 1KH3A 3EW9A 3U3ZA 4JITA 2ZUUA 1YQTA 3GH3A 4HP8A 3HL4A 4NYMR 4OH7A 1N4DA 4PFKA 2PXHA 3ZNOA 4YT8A 2Q4RA 1OIVA 1E0SA 4AN4A 5JMOA 4I1IA 2ANCA 3WMFA 3B6ZA 4EO4A 2PUGA 1NUUA 3BTVA 3M1YA 1LH0A 2W2OA 4B7AA 4YJ2A 2ETXA 3ESAA 5KHOC 1FJGB 5LP6A 2OHOA 1JEYA 1ZN9A 1K3TA 2G77B 2P6NA 1IQPA 3EC2A 4FDLA 1V3TA 1BA2A 4WVLA 3UAZA 3WLKX 3WAJA 3EPJA 3C5WP 4MRMB 2LVBA 1V1RB 2O3SA 3EC7A 3WYDA 1ZD8A 2O1WA 1I7DA 1Y8QB 1ZIPA 3UMFA 1WM1A 2XITA 1IUOA 2Z2KA 4XVUA 3DZDA 2I5PO 1B8PA 2EF0A 1C4OA 4PONA 4TUYA 3WAGA 1T1JA 5EJ9A 4YAEA 4LCJA 4K9MA 1EXNA 2I78A 3X0DA 1VLZA 5EJEA 1JA9A 1L5WA 2B9EA 4YJ2B 3GFQA 2VDKB 5SYMA 2BDTA 3WNVA 4OBBA 1XEAA 4KKXB 4RENA 1JHMA 2OG1A 1G3IA 1V11A 1E1DA 1GG5A 3IOEA 1W73A 1FLAA 1TDJA 2G9QA 3UMBA 3U1BA 1X1CA 4KNYA 5BN3A 3PJGA 4GKKB 3AR5A 3EDYA 5KSZA 1N2JA 4R1MA 1UAGA 3A7DA 2IRWA 2PMBA 3G2LA 3OCCA 3MJSA 1GGNA 3Q9UA 3EH2A 3Q7SA 4YUYA 1IB0A 4EUEA 1UWCA 3ZHSA 5HGJA 1UBLS 4EELA 2OCAA 3L4JA 4JWTA 4D5GA 2J3KA 3R7NA 4ANFA 5BR7A 3KHUA 4QAJA 4AJ9A 5K6AC 5BXYA 2FOIA 1P5RA 3C8DA 3G23A 3IEPA 4M89A 4WNIA 2WG2A 1DEKA 3HWRA 1XDWA 3I64A 3ZI7A 3ND9A 4ACAA 4AF7A 5ED4A 3NEJA 3C3AA 3WWZA 1JR4A 4EG0A 2ZBVA 1QBKC 2XVYA 1TUBA 4KXQA 4UU1A 4UAGA 2I4OA 3W9UA 3ROKA 3RVBA 4QA9A 1PBTA 1JAZA 1L6RA 1Q15A 1F06A 4P7KA 5DLQC 1MEEA 4MIYA 1H2RS 3VHQA 1GJRA 3M6UA 3IA7A 1W0KA 3GVXA 4LHSA 2YMPA 4MAMA 3IBYA 4PS1A 3IAS1 3QEMB 1JIKA 1OROA 3W5VA 3QKTA 4EQ6A 2ZI3A 1T5IA 3GB9A 3A9WA 3CH5A 2PLNA 2VF7A 4WXMA 3M5WA 4Y98A 3RTAA 2HSDA 1XPOA 4W7HA 1Z08A 4WFIA 3RS4A 1N9ZA 1WSWA 1KJJA 2XBUA 1CF9A 1F0YA 2XMZA 3FDJA 1VHWA 2P2NA 4HNQA 1E7SA 1MAAA 5IEBA 3I01A 4J29A 3VH1A 2ODQA 4TT3A 1LZKA 4NYJR 2WVJA 4OK3A 1HSZA 4RL4A 4N18A 4C4SA 3IVMA 1Q7BA 1RRPA 2NO9A 3A9SA 3IO3A 1T6NA 1K08A 2Q1WA 3NPMA 2IV3A 3BMNA 4EB3A 4NMXB 3EQ9A 4QDTA 3BF7A 2Q7OE 2D3WA 1V41E 2LTAA 1AKEA 1Z75A 3KVVA 3KQVA 2IT1A 1IZYA 3GVCA 3I6IA 1SURA 3WYCA 2P67A 4U39A 4E5KA 3L6EA 2C9DA 4LJRA 4U2CA 2C58A 3P8ZA 2QZ4A 4UXJA 3WYFA 3AINA 4RJJA 3UVEA 4H0NA 4TTSA 1SC3A 1LSSA 3FGOA 1TXGA 1JU3A 2XEXA 3V4OA 3ZHRA 2IKSA 1KJ8A 5LP6B 4RKRA 1B6TA 2UZ4A 4U1RA 3ISVA 2CD7A 1NXVA 5TIIA 1OU4A 3TOXA 1CUUA 3HB0A 4D96A 1P4HA 1K6MA 3FNGA 5T3UA 1Z22A 3BQMB 1WP4A 1Y3AA 4QSHA 3WL3A 1BOFA 1UKEA 4A6DA 2JLZA 3RVLA 3IXMA 3V1YA 1FFGA 2PMFA 1P77A 4PNEA 5JNSA 1BDIA 1VMKA 2NU8A 4TXMA 3D7LA 3A32A 4HN9A 3ZWKA 4NYIQ 2P6OA 3ORRA 3OTIA 3KR1A 1RJDA 3AVOA 3N7UA 5HIAA 5LIRA 4D74A 1SHLA 1Y7PA 2MSKA 5BPHA 1NP7A 5IYZA 4DR7B 3C4VA 3QUBA 5JUWA 4TS9A 3UMGA 3T34A 1Z6PA 3T7DA 1JFLA 1M33A 4L15A 4UNSA 1DX6A 1WZEA 1IBRA 3W6UA 2CLOB 3Q0TA 1CY7A 1SQFA 4FDMA 5EQJB 2QRNA 2GJSA 1BVYF 1KFCB 3SD7A 4DLPA 5IN4A 3SZMA 1LDGA 2EBHX 4ZAYA 2YX1A 4J2OA 4BMYA 4M76B 4JI2B 3OM1A 4NZPA 2MTBA 3BXFA 4KKVA 1F6DA 3L07A 3EF0A 5IVDA 3NIBA 3AUXA 4R2HA 4B8ZA 3AR3A 4P1ZA 4PXAA 4GXRA 2EKPA 3OESA 1ESDA 2ACVA 2QL9A 3EBOA 3UO8B 3WK8A 4HN4B 1WMAA 3JVEA 2RMKA 2PTGA 1I01A 2HJSA 4QPZA 3CLKA 2PKYX 3BMOB 3QE4A 4JN6B 4UTXA 4HTFA 4JLKA 3ZVMA 1O6BA 4FGSA 5MFPA 1HYHA 1ZNQO 3BEOA 1SCQA 4X8LA 4XFDA 3GP8A 5DFAA 4AZ0B 3D4IA 3VKHA 1Z68A 3EEFA 1W34A 4MCIA 3EGOA 2R87A 3PDCA 5I4BA 1N1EA 1CP3A 2YHIA 1P2SA 4B6EA 4L0CA 4X7RA 4M8NE 3T7IA 4DA4A 5JCXA 4QU0A 2GRJA 2FQ1A 3OICA 3C7TA 3FB4A 3U7RA 1W36D 2X9QA 1ZICA 1WF3A 2RHTA 2A9QA 3BMXA 3PD7A 3TR6A 5SZKB 3F73A 4CQNA 3A3PA 4I6EA 2JAHA 8AT1A 4L8GA 4C6RA 1CDOA 1RM3A 2X8LA 3CF0A 4PYQA 4CR8A 2ZM6B 2XT9A 2N9UA 3L84A 3P2MA 4DLUA 3PCXA 4P53A 3A9RA 4BE9A 4N3AA 4LYFA 1GIAA 3PI6A 3JQRA 2IEYA 3PITA 4YPVA 4B3HA 4U7GA 4EHAA 5EIBC 3TLGA 1WUHS 1R6BX 2IYQA 4ARUA 2EJTA 5L53A 4DCSA 1FDTA 2P9JA 3OT1A 1QYRA 2WWYA 3A4VA 3UUGA 2ZROA 3IDSA 4HS4A 3TX6A 2HH9A 1KK2A 2Q0QA 1OXXK 2R8PA 3AZPA 4KGXA 4POAA 2FWMX 3W3ZB 4E6EA 4YRIA 1HE5A 2FF7A 3K4HA 3KQTA 3KR2A 4M0UA 5TPZD 2PUAA 1BJRE 3F3YA 2ZBUA 2J32A 1ZY2A 4MQLA 3AEYA 4NU5A 5DMHA 4DV5B 2H08A 4ZC1A 1J4AA 1AM4D 3LSTA 1UBCA 5TX7A 1XU7A 1BVHA 4G63A 5A7FA 3QE2A 3QGMA 1UAAA 5DI3A 4FOPA 1ONOA 1RW4A 2ZJ0A 3IQGX 1AKRA 1V6AA 3D02A 4C4YA 4FYKA 5A6SB 2M6LA 1UBRS 1P19A 2VJDA 3O75A 5DIFA 2YJZA 1GZ7A 1T2DA 1UC4B 1WG8A 2NACA 2PT9A 4WFJA 4YPFA 1TJ5A 2ZSBA 5JCJA 2ZIEA 1LI7A 2J1LA 4RF2A 4TWIA 3V3TA 4C3ZA 3BL6A 3WYGA 4EL0A 4G5HA 3B5IA 3L92A 5IAKA 3ZXXA 2NYAA 4X1KA 1HG1A 2CMFA 1GA1A 3SZOA 2JFVA 4BZXA 4B31A 1Z7GA 2BHTA 2WAYA 3HJRA 2WKWA 1K27A 1ZRHA 3U7QA 1CUHA 3M34A 3RJ5A 3UK1A 4F56A 4G0UA 1TPYA 5AK3A 1H42A 2PUHA 2QW1A 2VPTA 4N41A 2XBLA 3EIQA 1ZPDA 3CCBA 1LX6A 3PDHA 1ENOA 4EB8A 1HT1E 2BFCB 5F1YA 1MENA 1Y0BA 2AS0A 3ZLVA 4XYMA 3BJRA 4Q3AA 2AHOA 3VMMA 4URUR 2P5YA 3CZPA 2EEPA 1GV1A 2J4FA 4U00A 2GPTA 1VL5A 3K9HA 4L51A 2DTXA 5ITZA 5ILOA 2XQVA 2QTFA 3DXZA 1XNJA 2P9HA 3PYLA 2FWPA 3E9DA 2J4DA 5FLYA 3H2GA 1R0XA 4RLSA 3C4JA 2PWPA 5AKGA 4AP9A 5DGIA 5BN5A 5GINE 4O4IF 1HT3A 4OGLA 3AT1A 3DEYX 1YTLA 2JKYA 2B2NA 2QUBA 1H2WA 2MR6A 3RTDA 4RHTA 5REQB 3TK1A 9MHTA 1HA3A 3R7AA 1H8ED 3KZKA 5EJ6A 1O7JA 2IWHA 1C0PA 4XX0B 4B71A 5LQRA 2Q3LA 2W90A 4YRFA 3B52X 3CZ5A 1YR9A 1WJGA 2IOYA 2Q41A 1DKRA 3AGQA 1GPYA 4M0KA 1C9MA 1J0CA 3TLXA 3CNOA 1IULA 2OBXA 4OD0A 1O08A 1O6FA 3C74A 4KXUA 4M9SA 1XDUA 4DQLA 2FWBA 2FPMA 1Z0SA 1BHSA 2FTKE 3H4VA 2BGJA 1R6DA 1XJ5A 3NWJA 3OF2A 2OCGA 4QC2A 4YJHB 2A9VA 3H5IA 3KJGA 4QQNA 3PFIA