4ZOJA

Methylsulfanyl-containing inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
345
structure length
341
Chain Sequence
b'PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Inhibitor bound in the active site of Mycobacterium tuberculosis anthranilate phosphoribosyltransferase (AnPRT; trpD).
rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Transferase/transferase inhibitor
total genus 119
structure length 341
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4zojA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4zojA02
3R6CA 3R88A 1ZYKA 4ZOFA 2GVQA 3UU1A 4N5VA 1BRWA 3QS8A 4X5CA 1O17A 4YI7A 4N8QA 2WK5A 3H5QA 3QSAA 4N93A 4YEKA 4GKMA 4OWSA 5C1RA 2WK6A 4X5AA 4X59A 3TWPA 4IJ1A 4OWUA 2J0FA 4X58A 4X46A 4X5EA 2TPTA 1VQUA 5C7SA 2DSJA 4OWNA 4ZOJA 1V8GA 4OWVA 2BPQA 5BO2A 4XR5A 5BYTA 1KHDA 3GBRA 4ZTVA 4M0RA 4ZOKA 3QR9A 4GIUA 4LHMA 5EY3A 4GA6A 4OWMA 4MUOA 4X5BA 1ZXYA 5BO3A 1KGZA 1ZVWA 1UOUA 4EADA 4EAFA 1AZYA 5C2LA 4HKMA 5BNEA 4GA4A 4OWOA 4YYYA 1OTPA 3QQSA 2ELCA 4OWQA 5EP8A 4GTNA 1GXBA 4X5DA 4GA5A
chains in the Genus database with same CATH superfamily
3R6CA 3R88A 1ZYKA 4ZOFA 2GVQA 3UU1A 4N5VA 1RF8B 1BRWA 3QS8A 4X5CA 1O17A 4YI7A 4N8QA 2WK5A 3H5QA 3QSAA 4N93A 4YEKA 4GKMA 4OWSA 5C1RA 2WK6A 4X5AA 4F3FC 4X59A 3TWPA 4IJ1A 4OWUA 2J0FA 4X58A 4X46A 4X5EA 2TPTA 1VQUA 5C7SA 2DSJA 4OWNA 4ZOJA 1V8GA 4OWVA 2BPQA 5BO2A 1RRZA 4XR5A 5BYTA 1KHDA 3GBRA 4ZTVA 4M0RA 4ZOKA 3QR9A 4GIUA 4LHMA 4GA6A 5EY3A 4OWMA 4MUOA 4X5BA 1ZXYA 5BO3A 1KGZA 1ZVWA 1UOUA 4EADA 4EAFA 1AZYA 5C2LA 4HKMA 5BNEA 4GA4A 4OWOA 4YYYA 1OTPA 3QQSA 2ELCA 4OWQA 5EP8A 4GTNA 1GXBA 4X5DA 4GA5A
chains in the Genus database with same CATH topology
3R6CA 3R88A 1ZYKA 4ZOFA 2GVQA 3UU1A 4N5VA 1BRWA 3QS8A 4X5CA 1O17A 4YI7A 4N8QA 2WK5A 3H5QA 3QSAA 4N93A 4YEKA 4GKMA 4OWSA 5C1RA 2WK6A 4X5AA 4X59A 3TWPA 4IJ1A 4OWUA 2J0FA 4X58A 4X46A 4X5EA 2TPTA 1VQUA 5C7SA 2DSJA 4OWNA 4ZOJA 1V8GA 4OWVA 2BPQA 5BO2A 4XR5A 5BYTA 1KHDA 3GBRA 4ZTVA 4M0RA 4ZOKA 3QR9A 4GIUA 4LHMA 5EY3A 4GA6A 4OWMA 4MUOA 4X5BA 1ZXYA 5BO3A 1KGZA 1ZVWA 1UOUA 4EADA 4EAFA 1AZYA 5C2LA 4HKMA 5BNEA 4GA4A 4OWOA 4YYYA 1OTPA 3QQSA 2ELCA 4OWQA 5EP8A 4GTNA 1GXBA 4X5DA 4GA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6C A;  3R88 A;  1ZYK A;  4ZOF A;  2GVQ A;  3UU1 A;  4N5V A;  1BRW A;  3QS8 A;  4X5C A;  1O17 A;  4YI7 A;  4N8Q A;  2WK5 A;  3H5Q A;  3QSA A;  4N93 A;  4YEK A;  4GKM A;  4OWS A;  5C1R A;  2WK6 A;  4X5A A;  4X59 A;  3TWP A;  4IJ1 A;  4OWU A;  2J0F A;  4X58 A;  4X46 A;  4X5E A;  2TPT A;  1VQU A;  5C7S A;  2DSJ A;  4OWN A;  4ZOJ A;  1V8G A;  4OWV A;  2BPQ A;  5BO2 A;  4XR5 A;  5BYT A;  1KHD A;  3GBR A;  4ZTV A;  4M0R A;  4ZOK A;  3QR9 A;  4GIU A;  4LHM A;  5EY3 A;  4GA6 A;  4OWM A;  4MUO A;  4X5B A;  1ZXY A;  5BO3 A;  1KGZ A;  1ZVW A;  1UOU A;  4EAD A;  4EAF A;  1AZY A;  5C2L A;  4HKM A;  5BNE A;  4GA4 A;  4OWO A;  4YYY A;  1OTP A;  3QQS A;  2ELC A;  4OWQ A;  5EP8 A;  4GTN A;  1GXB A;  4X5D A;  4GA5 A; 
#chains in the Genus database with same CATH topology
 3R6C A;  3R88 A;  1ZYK A;  4ZOF A;  2GVQ A;  3UU1 A;  4N5V A;  1RF8 B;  1BRW A;  3QS8 A;  4X5C A;  1O17 A;  4YI7 A;  4N8Q A;  2WK5 A;  3H5Q A;  3QSA A;  4N93 A;  4YEK A;  4GKM A;  4OWS A;  5C1R A;  2WK6 A;  4X5A A;  4F3F C;  4X59 A;  3TWP A;  4IJ1 A;  4OWU A;  2J0F A;  4X58 A;  4X46 A;  4X5E A;  2TPT A;  1VQU A;  5C7S A;  2DSJ A;  4OWN A;  4ZOJ A;  1V8G A;  4OWV A;  2BPQ A;  5BO2 A;  1RRZ A;  4XR5 A;  5BYT A;  1KHD A;  3GBR A;  4ZTV A;  4M0R A;  4ZOK A;  3QR9 A;  4GIU A;  4LHM A;  4GA6 A;  5EY3 A;  4OWM A;  4MUO A;  4X5B A;  1ZXY A;  5BO3 A;  1KGZ A;  1ZVW A;  1UOU A;  4EAD A;  4EAF A;  1AZY A;  5C2L A;  4HKM A;  5BNE A;  4GA4 A;  4OWO A;  4YYY A;  1OTP A;  3QQS A;  2ELC A;  4OWQ A;  5EP8 A;  4GTN A;  1GXB A;  4X5D A;  4GA5 A; 
#chains in the Genus database with same CATH homology
 3R6C A;  3R88 A;  1ZYK A;  4ZOF A;  2GVQ A;  3UU1 A;  4N5V A;  1BRW A;  3QS8 A;  4X5C A;  1O17 A;  4YI7 A;  4N8Q A;  2WK5 A;  3H5Q A;  3QSA A;  4N93 A;  4YEK A;  4GKM A;  4OWS A;  5C1R A;  2WK6 A;  4X5A A;  4X59 A;  3TWP A;  4IJ1 A;  4OWU A;  2J0F A;  4X58 A;  4X46 A;  4X5E A;  2TPT A;  1VQU A;  5C7S A;  2DSJ A;  4OWN A;  4ZOJ A;  1V8G A;  4OWV A;  2BPQ A;  5BO2 A;  4XR5 A;  5BYT A;  1KHD A;  3GBR A;  4ZTV A;  4M0R A;  4ZOK A;  3QR9 A;  4GIU A;  4LHM A;  5EY3 A;  4GA6 A;  4OWM A;  4MUO A;  4X5B A;  1ZXY A;  5BO3 A;  1KGZ A;  1ZVW A;  1UOU A;  4EAD A;  4EAF A;  1AZY A;  5C2L A;  4HKM A;  5BNE A;  4GA4 A;  4OWO A;  4YYY A;  1OTP A;  3QQS A;  2ELC A;  4OWQ A;  5EP8 A;  4GTN A;  1GXB A;  4X5D A;  4GA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...