4ZOKA

Methylsulfonyl-containing inhibitor bound in the substrate capture site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
345
structure length
342
Chain Sequence
b'PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Inhibitor bound in the active site of Mycobacterium tuberculosis anthranilate phosphoribosyltransferase (AnPRT; trpD).
rcsb
source organism Mycobacterium tuberculosis h37ra
molecule tags Transferase/transferase inhibitor
total genus 113
structure length 342
sequence length 345
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4zokA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4zokA02
5C7SA 3QR9A 3H5QA 3R88A 5BO2A 4ZOJA 4X5AA 2DSJA 2WK6A 4EAFA 3GBRA 2TPTA 1GXBA 4IJ1A 1OTPA 4GTNA 5EY3A 4GA5A 4YI7A 2J0FA 2BPQA 1UOUA 3UU1A 4LHMA 4X59A 1ZXYA 4ZOFA 3R6CA 4N93A 1V8GA 2ELCA 4ZTVA 4OWQA 5C1RA 4OWMA 4X5BA 4GA6A 3QSAA 5BYTA 1KGZA 1ZYKA 3TWPA 1KHDA 4YEKA 4OWUA 5BO3A 4GKMA 4OWVA 4X5EA 4ZOKA 5C2LA 1AZYA 4N5VA 4X58A 4OWNA 4HKMA 3QQSA 4GA4A 4MUOA 4XR5A 1ZVWA 2WK5A 4X5DA 4EADA 4N8QA 4YYYA 4OWOA 4M0RA 1O17A 1BRWA 4X5CA 2GVQA 1VQUA 4OWSA 4X46A 5BNEA 4GIUA 3QS8A 5EP8A
chains in the Genus database with same CATH superfamily
5C7SA 3QR9A 4F3FC 3H5QA 3R88A 5BO2A 4ZOJA 4X5AA 2DSJA 2WK6A 4EAFA 3GBRA 2TPTA 1GXBA 4IJ1A 1OTPA 4GTNA 5EY3A 4GA5A 4YI7A 2J0FA 2BPQA 1RRZA 1UOUA 3UU1A 4LHMA 4X59A 1ZXYA 4ZOFA 3R6CA 4N93A 1V8GA 2ELCA 4ZTVA 4OWQA 5C1RA 4OWMA 4GA6A 4X5BA 3QSAA 5BYTA 1RF8B 1KGZA 1ZYKA 3TWPA 1KHDA 4YEKA 4OWUA 5BO3A 4GKMA 4OWVA 4X5EA 4ZOKA 5C2LA 1AZYA 4N5VA 4X58A 4OWNA 4HKMA 3QQSA 4GA4A 4MUOA 4XR5A 1ZVWA 2WK5A 4X5DA 4EADA 4N8QA 4YYYA 4OWOA 4M0RA 1O17A 1BRWA 4X5CA 2GVQA 1VQUA 4OWSA 4X46A 5BNEA 4GIUA 3QS8A 5EP8A
chains in the Genus database with same CATH topology
5C7SA 3QR9A 3H5QA 3R88A 5BO2A 4ZOJA 4X5AA 2DSJA 2WK6A 4EAFA 3GBRA 2TPTA 1GXBA 4IJ1A 1OTPA 4GTNA 5EY3A 4GA5A 4YI7A 2J0FA 2BPQA 1UOUA 3UU1A 4LHMA 4X59A 1ZXYA 4ZOFA 3R6CA 4N93A 1V8GA 2ELCA 4ZTVA 4OWQA 5C1RA 4OWMA 4X5BA 4GA6A 3QSAA 5BYTA 1KGZA 1ZYKA 3TWPA 1KHDA 4YEKA 4OWUA 5BO3A 4GKMA 4OWVA 4X5EA 4ZOKA 5C2LA 1AZYA 4N5VA 4X58A 4OWNA 4HKMA 3QQSA 4GA4A 4MUOA 4XR5A 1ZVWA 2WK5A 4X5DA 4EADA 4N8QA 4YYYA 4OWOA 4M0RA 1O17A 1BRWA 4X5CA 2GVQA 1VQUA 4OWSA 4X46A 5BNEA 4GIUA 3QS8A 5EP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C7S A;  3QR9 A;  3H5Q A;  3R88 A;  5BO2 A;  4ZOJ A;  4X5A A;  2DSJ A;  2WK6 A;  4EAF A;  3GBR A;  2TPT A;  1GXB A;  4IJ1 A;  1OTP A;  4GTN A;  5EY3 A;  4GA5 A;  4YI7 A;  2J0F A;  2BPQ A;  1UOU A;  3UU1 A;  4LHM A;  4X59 A;  1ZXY A;  4ZOF A;  3R6C A;  4N93 A;  1V8G A;  2ELC A;  4ZTV A;  4OWQ A;  5C1R A;  4OWM A;  4X5B A;  4GA6 A;  3QSA A;  5BYT A;  1KGZ A;  1ZYK A;  3TWP A;  1KHD A;  4YEK A;  4OWU A;  5BO3 A;  4GKM A;  4OWV A;  4X5E A;  4ZOK A;  5C2L A;  1AZY A;  4N5V A;  4X58 A;  4OWN A;  4HKM A;  3QQS A;  4GA4 A;  4MUO A;  4XR5 A;  1ZVW A;  2WK5 A;  4X5D A;  4EAD A;  4N8Q A;  4YYY A;  4OWO A;  4M0R A;  1O17 A;  1BRW A;  4X5C A;  2GVQ A;  1VQU A;  4OWS A;  4X46 A;  5BNE A;  4GIU A;  3QS8 A;  5EP8 A; 
#chains in the Genus database with same CATH topology
 5C7S A;  3QR9 A;  4F3F C;  3H5Q A;  3R88 A;  5BO2 A;  4ZOJ A;  4X5A A;  2DSJ A;  2WK6 A;  4EAF A;  3GBR A;  2TPT A;  1GXB A;  4IJ1 A;  1OTP A;  4GTN A;  5EY3 A;  4GA5 A;  4YI7 A;  2J0F A;  2BPQ A;  1RRZ A;  1UOU A;  3UU1 A;  4LHM A;  4X59 A;  1ZXY A;  4ZOF A;  3R6C A;  4N93 A;  1V8G A;  2ELC A;  4ZTV A;  4OWQ A;  5C1R A;  4OWM A;  4GA6 A;  4X5B A;  3QSA A;  5BYT A;  1RF8 B;  1KGZ A;  1ZYK A;  3TWP A;  1KHD A;  4YEK A;  4OWU A;  5BO3 A;  4GKM A;  4OWV A;  4X5E A;  4ZOK A;  5C2L A;  1AZY A;  4N5V A;  4X58 A;  4OWN A;  4HKM A;  3QQS A;  4GA4 A;  4MUO A;  4XR5 A;  1ZVW A;  2WK5 A;  4X5D A;  4EAD A;  4N8Q A;  4YYY A;  4OWO A;  4M0R A;  1O17 A;  1BRW A;  4X5C A;  2GVQ A;  1VQU A;  4OWS A;  4X46 A;  5BNE A;  4GIU A;  3QS8 A;  5EP8 A; 
#chains in the Genus database with same CATH homology
 5C7S A;  3QR9 A;  3H5Q A;  3R88 A;  5BO2 A;  4ZOJ A;  4X5A A;  2DSJ A;  2WK6 A;  4EAF A;  3GBR A;  2TPT A;  1GXB A;  4IJ1 A;  1OTP A;  4GTN A;  5EY3 A;  4GA5 A;  4YI7 A;  2J0F A;  2BPQ A;  1UOU A;  3UU1 A;  4LHM A;  4X59 A;  1ZXY A;  4ZOF A;  3R6C A;  4N93 A;  1V8G A;  2ELC A;  4ZTV A;  4OWQ A;  5C1R A;  4OWM A;  4X5B A;  4GA6 A;  3QSA A;  5BYT A;  1KGZ A;  1ZYK A;  3TWP A;  1KHD A;  4YEK A;  4OWU A;  5BO3 A;  4GKM A;  4OWV A;  4X5E A;  4ZOK A;  5C2L A;  1AZY A;  4N5V A;  4X58 A;  4OWN A;  4HKM A;  3QQS A;  4GA4 A;  4MUO A;  4XR5 A;  1ZVW A;  2WK5 A;  4X5D A;  4EAD A;  4N8Q A;  4YYY A;  4OWO A;  4M0R A;  1O17 A;  1BRW A;  4X5C A;  2GVQ A;  1VQU A;  4OWS A;  4X46 A;  5BNE A;  4GIU A;  3QS8 A;  5EP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...