4ZONA

Structure of ftmox1 with fumitremorgen b complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
285
structure length
285
Chain Sequence
KPQLQRLAADADVDRMCRLLEEDGAFILKGLLPFDVVESFNRELDVQMAIPPPKGERLLADKYPPHFKYVPNVATTCPTFRNTVLINPVIHAICEAYFQRTGDYWLSAAFLREIESGMPAQPFHRDDATHPLMHYQPLEAPPVSLSVIFPLTEFTEENGATEVILGSHRWTEVGTPERDQAVLATMDPGDVLIVRQRVVHAGGGNRTTAGKPRRVVLAYFNSVQLTPFETYRTMPREMVESMTVLGQRMLGWRTMKPSDPNIVGINLIDDKRLENVLQLKAADSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Verruculogen synthase
publication title Endoperoxide formation by an alpha-ketoglutarate-dependent mononuclear non-haem iron enzyme.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 87
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 1.14.11.38: Verruculogen synthase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4zonA00
2FCVA 5DAPA 5LA9A 3GJBA 4BQWA 4BQXA 5L9VA 5IAVA 4XCBA 4Q5OA 5ERLA 4KBZA 4Y5TA 5LATA 2Y34A 3NNJA 2HBUA 5DAWA 2Y33A 5EPAA 5M0TA 5A3UA 2JIGA 5L9BA 3KT1A 4UWDA 3EMRA 3ITQA 4NAOA 5LBFA 4NHYA 5EP9A 4ZONA 3BVCA 2HBTA 3NNFA 2RDSA 2OPWA 3OBZA 3MGUA 3GZEA 3NNLA 2RG4A 3NNMA 4NHMA 4Y5SA 3OUHA 5DAQA 5HV4A 4XCAA 5C5UA 4J25A 2V4AA 4MHUA 5IATA 4BQYA 3PL0A 4JZRA 3HQUA 4XACA 4IW3A 5C5TA 5IAXA 2JIJA 2FCUA 5LBCA 2G19A 5LB6A 4NMIA 5LASA 2RDRA 4ZPIA 3OUIA 3W20A 3W21A 3OUJA 2RDQA 5L9RA 4XC9A 4NHXA 2RDNA 5HV0A 5DAXA 4MHRA 2FCTA 4NHKA 4XABA 3GJAA 4NHLA 5EQUA 2G1MA 2A1XA 5LBEA 5LBBA 3KT7A 4XAAA 5DAVA 3HQRA 3KT4A 3DKQA
chains in the Genus database with same CATH superfamily
5BNOB 1HKDA 2W1UA 3JUUA 3HR9A 4CCOA 4QHBA 1RIRA 3WT3A 4CXWA 5AC92 3PU8A 1RUG3 1UAIA 2PHWA 3IIAA 1US3A 1QHDA 2HEVF 4XETA 3WHUA 3ABZA 3IZOA 4XJ9A 1UIJA 1J58A 2BWCA 2C4XA 4OMDA 1IPSA 5IFPA 4W8JA 5F39A 4LO7A 2ZGLA 3O1OA 1Z0HA 4HKOA 3KHCA 2JDZA 4XBNA 4RS5B 2Y34A 4Q8LA 2FDIA 2JG8C 4XQWA 5I91A 3Q8FA 4LK7A 1VMHA 2QVSB 1DQ1A 2VUJA 3RZKA 1R1A1 5FY7A 4DPNA 1ULOA 1NOVA 1VB2A 3KT1A 1OLMA 1RYYA 5C70A 3PUAA 2JD9A 2CAVA 3H42B 1PO23 3BODA 3MIHA 4UW4A 5C3SA 2DDUA 3D82A 1H6YA 5T5LA 5FLHA 1O5UA 5FPXA 5FO9B 4NROA 2V4VA 3O1VA 5FZBA 3E5UA 5KBFA 1VPHA 1ZBE3 4XXAA 5JI9A 4DRVA 4F83A 2ZZQA 2A3XA 1J3QA 3MPPG 3M3CA 1GZ9A 4QQ2A 1GOFA 3VDBA 1MEC1 1XRUA 2DTWA 4Y20B 1O3RA 2ADDA 2HWD2 2VMIA 4BQ2A 2AEZA 3APBA 4INDA 1JUIA 3AVRA 5DAQA 3LE0A 4XCAA 3IDBB 5ABJB 4NJ4A 3MO4A 3PUSA 2ZZJA 5SV5A 4IEYA 3JCIA 5IK8A 2W95A 1MEC3 4NVPA 4MZUA 3V0BB 4IESA 4RN5A 5LEKA 3I3MA 3MIGA 4BQYA 4M3CB 4JDMA 4H2AA 2XWBB 4DUXA 2D6LX 1YNAA 3M3IA 4MYEA 4I2OA 3PUQA 1OD5A 3CJIA 5K0UA 4CDWB 1WD4A 3I2GA 3SC7X 3HQXA 3BN6A 1O7FA 1MS8A 2VR4A 2IVJA 2X09A 1BJQA 3I7DA 2CAUA 3LSDA 2G19A 3ZSEA 5C3PA 3H1YA 2JECA 2Y26A 4QQPA 4EN6B 3VHRA 1DGRA 2LTNA 4KL1A 1QJEA 2PELA 5DUUA 4E2GA 2UU8A 4A41A 3WW2A 4V2VA 1POV0 1YJKA 1TVGA 1GUIA 1M06G 3VL8A 1GYKA 1WLTA 5GZCA 1K5JA 4N53A 2PXJA 2VTXJ 3AM2A 4NHXA 1RVF1 3QACA 1W8ZA 3THTA 3FBYA 4AEDA 2XJQA 3ZMNA 2OUJA 2O8QA 2WZR3 1SQ4A 1IQAA 5C7GA 1VBA3 4RQPA 1PIV2 4YM0A 5I0UA 4CDUB 2UY9A 5GZFA 2EIBA 3X29B 2QDNA 4CCDA 5JPMB 1VIWB 5FZFA 1EP0A 4Y1ZA 3T3YA 5L7OA 1JZ2A 3NV3A 1RVF3 2PN5A 3KT4A 4HLTA 3S5AA 3LGRA 3M7AA 2WNUC 2RJ2A 4YYOA 1G8WA 4XFHA 1FI2A 3GM8A 3MF6A 2WSVA 3U1XA 2D98A 1DQ4A 2C6SA 4B4RA 4K1YA 1SBEA 3KQ4B 1TNRA 2QQWA 2VMDA 5LA1A 3O1TA 2HWC2 4TSVA 4QPGA 1I5ZA 1S2BA 4YSFA 4W4ZA 4OHYA 1IG0A 1WMFA 2UY8A 2ZABA 4IE0A 2GSYA 4IV3B 4HONA 4CA9A 2VCCA 2N7GA 1V70A 4XFAA 5GZEA 5FOJB 2H6BA 3WP5A 2IFWA 2BOIA 3AX4A 4IEWA 5FZLA 1PZ9A 1E5SA 4JQRA 3HWJA 4PDWA 3DUIA 5HCAA 2BGOA 4JDNA 3ZYBA 4DZGA 4AHZA 3ACFA 4I02A 5FQ0A 4UF0B 1RXGA 4D0QA 4NWWA 4Z2WA 2R1DA 2UURA 3TNQA 1RTVA 4CZSA 2HWD1 1F8VA 2Q30A 3DL3A 3OTFA 4XFGA 2X5IB 5LRRA 1S0BA 3H1WA 2OVUA 4BJ0A 1W3XA 4MGTA 3MDPA 4FTBA 1NE6A 3MHZA 5A7WB 1RUH3 3P3PA 1JXNA 3B7MA 2JWPA 4LBJA 1NLRA 3GDBA 2BPA2 1VR3A 2PHFA 2HH9A 3LDKA 3CF6E 1VBB2 5FZDA 1H0BA 2GC0A 4HN0A 3K77A 1AUYA 4FOYA 1UXXX 4JHZA 4W6WA 2BEOA 2W87A 1K42A 4MOAA 5FOBB 1XNCA 5H9SA 1CX4A 1Q8OA 2B8MA 2PAKA 1Y4WA 5E8AA 2QQIA 2QCSB 5DMYA 3UT0A 2FZ1A 3AFKA 4KH9A 1D4M2 4EV0A 2D97A 1AF9A 1PMHX 2EF6A 1H8TB 3I59A 3POSA 3BYWA 4LTAA 2DCJA 2GC3A 1LHVA 4HSJA 3KQRA 2IFRA 4BOWA 1GNZA 4Q29A 2WO7A 4DINB 1JZ3A 5D8AC 3IPVB 4BQ1A 2VOWA 4UFMA 3R4UA 4ISRA 4QM8A 1MQTC 2BBAA 5DUWA 5FY8A 2HWF1 1MZ5A 3M3EA 5FZ8A 4IV1A 1V6IA 3S0MA 3FLTA 1AR63 4A42A 3BPZA 1OLME 4A44A 5GJ6A 3JBG2 5T55A 1ND3A 3WQBA 1K5MB 1PIV1 4RHV2 4EWAA 1E5IA 4XC9A 2WFPA 5EXOA 4FI9A 4BXSV 2P4EA 2Y60A 3D5OA 1YFYA 1ZA7A 3VBSB 3TEWA 4GH4B 1KDMA 4I0WB 1YC61 2HWF3 5A6XA 3WP3A 1TE1B 4CDXA 4CEWC 1C28A 2F17A 3VUOA 1X8EA 3USSA 4OULA 4Y33A 1AHSA 1AL0G 3CLPA 4GALA 5LBBA 2FMDA 4PF1A 3PTRB 3WW3A 3ETQA 3WNNA 1QGLA 4G4FA 5DAVA 4OI4A 5DQ0A 4YW1A 3RQ0A 3WF0A 3ZXDA 2TBVA 3WDVA 2HWC1 1SFPA 4KGQA 4YZ1A 3EQEA 3GJBA 4BQWA 1DYOA 1DG6A 5IHRA 2JKXA 5L9VA 1XSQA 3SEPA 1PGSA 5BUVA 1A8MA 1XQNA 2J42A 1HRI2 1BBT2 5BNNC 1LJ7A 1H9WA 3WDUA 1CAUB 3V64A 3VD4A 4HANA 3E6CC 3CHXA 2HWC3 5ANQA 2YU1A 3ZXEA 5F3CA 2BVBA 3OEAA 5FBZA 4UFLA 5A1AA 5FRAA 2NN8A 4YZ3A 2BP6A 5FZCA 5LATA 2J1UA 4M3CF 3TEZA 3VDCA 4DUVA 3DV8A 4I3GA 5FZIA 4DFSA 4LO8A 3JB8A 1ZYBA 3Q9OA 5C8CB 4OUEA 4QPIC 4UT5A 5FMCA 2ZJCA 5CFCA 5LEJA 2GNTA 1RMU2 3HIFA 4LBKA 4YVWB 4HXCA 1PK6C 4M0HA 3ZFEC 2ZACA 2XJSA 3BTAA 2D3SA 2ZHMA 2D5FA 4DXTA 3RYPA 2IWGB 2FDHA 2WNVB 4UI9L 2D43A 1QXRA 4Z8BA 2VUDA 4FOWA 1XE7A 2ZAAA 2ZEZA 1VBB1 2JDKA 1HQNA 2XKOA 1GWKA 3ALQA 4Y4YA 1ZX5A 4E27A 5CG8A 5FZEA 4LUKA 1KD7A 3ZXKA 5I0DA 2PFWA 4AI1A 2VGDA 1POV1 2PQQA 3W59A 5DDJ1 1DLLA 1UMIA 3FHAA 3FFZA 2C9KA 2RS32 4B1LA 1MZ6A 2GH8A 4XUNA 1W05A 5T5JA 2E7QA 4BCUA 2PQSA 3KF3A 4COZA 5FYYA 3UESA 2WWSA 5LY1A 5C5UA 3C7FA 1UY0A 2RVAA 3WUCA 2DCZA 4XOGA 1C1FA 3NAPC 1W6PA 3I54A 4HMZA 4LBQB 3UGHA 1POV3 5A7PA 3K48A 4LA3A 1NX9A 4Q4X2 5DDJ3 2DVAA 2DUPA 4IEVA 4WM7B 1RITA 2A73B 1OF3A 3DKWA 3AMQA 3MICA 3VBOA 4ZKTB 3IB3A 5F2SA 4A2UA 1GWLA 1O91A 1UMHA 1W90A 1ZBA3 4YW6A 5C5TA 3JBG1 4FPOB 5J96B 4RHV1 3M4FA 4TYSA 3VDDA 2W5FA 1BEV2 3A21A 4I30A 5J1XA 4PIZA 3UETA 2Q0AA 2VAUA 5J36A 2PHTA 1OSGA 1DIWA 1X36A 2CL2A 3DF0A 2SLIA 4ZPIA 3AZXA 1SDWA 4MO3M 2ZA9A 5F5AA 4OI1A 2VTFA 1YFXA 3UK9A 1WD3A 4RGGA 2C26A 3P6BA 2DU1A 4RHV3 4F7ZA 2R043 3MEPA 1IS5A 2WC2A 4Z82A 4D7YA 3LOBA 4MADA 5GALA 2ZGSA 4OFGA 4N53C 3KWVA 5FP9A 1TG7A 2AACA 3J7HA 2QE3A 2DTYA 3QCWA 2VMFA 4LO4B 1AJKA 2OIIA 2P17A 5FYCA 1ENXA 3PVNA 3DYMA 4AEJA 2ZEWA 1HRI1 1BBT1 4TLGA 2Y0OA 1OH3A 1V6MA 1DF0A 1H2NA 4TXWA 5BNPC 1HLCA 4MXWA 1G9FA 1Z7S2 2XL9A 1W6QA 5LA9A 5GM0A 4CU8A 2XLAA 5A3WA 4QPYA 4S2HA 3U78A 5ACA2 2OPKA 5JXGA 2Q8EA 3V0AB 4ZS3A 3O1SA 4XMAA 1O4YA 5IAVA 4N43A 4JDOA 4XILA 1QIQA 1I9RA 4Q5OA 1W0NA 4PT6A 3FUQA 4Q2FA 4BMBA 3VDAA 1RMU1 2YBPA 4QPGC 5HCBA 3RGBA 2W68A 3SLIA 1ACCA 1LOGA 1VRH3 4LOTA 2ATFA 4QQOA 2QBXA 3MUZ1 1CONA 3I3BA 5CNAA 3MBWA 5FYTA 5IVJA 1EV12 4DB5A 1XE8A 3AMHA 2NMNA 4YGEA 1PVXA 1REFA 4BU2A 4PDWC 1LEDA 3ITQA 4NAOA 5LBFA 3QH6A 4QQLA 4D6RA 5JZGA 1FT9A 1YCIA 1DGWA 4C91A 3NWKA 4QX8A 5B4XA 3WF2A 5EP9A 1LHUA 2RS31 2ZEXA 4IETA 4R4XA 1RUF2 1T2XA 1S0DA 2XWJB 4QGLA 5IK7A 3WDTA 1YO8A 5GLZA 5FYIA 2DYCA 4YNIA 1Q8VA 1SCRA 1SLCA 2VPVA 1COV3 2JG8A 2Y38A 5EJ3A 5F9TA 3K4ZA 3L2YA 1LB2A 3AK0A 2WS92 3OGJA 2RG4A 2P6HA 1KITA 4Q4X1 4W65A 2P1BA 2FDFA 2RS33 2YFUA 4JGZB 3TEYA 1CAXA 1ZZBA 5BPXA 3AKPA 3POYA 3BI3A 3J8F2 2BJSA 5AVPA 3ZN6A 2YDEA 5FY5A 2JDYA 4JCKA 1PNGA 4R9BA 2P3YA 4UXAA 4LPLA 1V6KA 4FPLA 4GZ9A 4P9IA 1BEV1 3NJZA 4H14A 1XU2A 3MFCA 3OYWA 5FZAA 1ZM1A 2VECA 4Q4X3 4R9CA 1W28A 1WMDA 3GCWA 1CQ9A 1UX6A 1H9PA 1W6OB 4LKEA 4CU6A 2HWB3 1DCSA 1CPMA 5EFUA 5FIXA 4Y24A 2OUHA 2PHLA 4AR2A 5FZMA 4QT6A 1GKBA 2FHRA 2XKPA 4MV2A 5FZHA 1GU3A 4FP3A 5LB6A 4E4ZA 1OVPA 2GMPA 4FT8A 3VBRC 4P14A 4N90A 5C9AC 1UZYA 4L0PA 1DU3D 3HBZA 1S55A 3OY8A 4V1PA 3WQ0A 1YQ8A 2WYFA 2XH6A 2VD7A 1YIPA 1LU2A 4LBNA 1W8TA 3WP6A 5JR2A 3POJA 3ILNA 4XDPA 4AI0A 1W9YA 1KJRA 2WABA 1R083 3HT2A 1AR93 2XVLA 3FHIB 2D3RA 1LOEA 4HVRA 1Z7S1 1HQLA 3PURA 1ST8A 2VJXA 3SCFA 2W94A 3KCXA 4CUCA 5A3OA 5A3MA 4BPZA 2G1MA 5ACA1 1RUC2 2ZAHA 3WHTA 5DUXA 4CEYB 4E2QA 4K3UA 1B35B 4CXYA 2V72A 1NAEA 4NIAA 4AOCA 3M8LA 1QJZA 1RJ8A 2GP5A 1VBC2 5T50A 1Z7S3 4HVOA 4MLOA 3KVBA 3H8RA 3ZYPA 4EN7B 1HIXA 2CTVA 2ZX3A 4DMIA 5F7UA 1AR82 2D6OX 5L73A 5A1FA 3POIA 4MXVA 5BXXA 1JZ7A 2Q1FA 2C24A 1EV11 1RUD2 5J48A 4QHZA 4BK4A 1GQHA 1K12A 2VU9A 3LPFA 1PZ8A 3IIIA 4NRMA 4U2AA 2K2SA 3M2MA 3ROUA 4DXSA 5APAA 5JDBA 3P3NA 4AGRA 3THPA 3BTZA 1DHKB 1WZXA 3U0ZA 4LLFA 3KCYA 3ES4A 5D21A 2WNUA 3RVHA 3K46A 5KHIA 1EV13 3WNXA 2FZ2A 1RUF1 2ZX4A 1XNTA 5FWEA 3EMRA 4XHXA 4Y1VA 5F3GA 2XONA 4CP1A 1WCQA 2C9AA 1RUG2 1JI6A 3VBHB 5CFCC 3NRUA 1LR5A 3ILRA 1ULCA 3EBRA 3KGZA 5FXWA 1HRV3 2WS91 1XNAA 3ZSKA 2VZVA 3ZXAC 2QQJA 2D6KA 4LK6A 5J3UA 3HNMA 1QU0A 1UOFA 1RINA 4AVSA 3J8F1 2QQVA 5F2WA 2IXLA 4FFHA 4NRPA 5BNQA 2BERA 4E8CA 3KS7A 2QQOA 1Y9MA 4YM1A 5CZKA 3HBKA 1ND2B 4NHMA 1AVBA 3N9PA 3LPGA 3AP9A 3IDEA 2GN3A 4CEWB 4CPBA 1XYPA 3J8F3 3VL9A 3HJRA 5IWFA 2DF7A 4EN9B 1PO22 1N3OA 1N3QA 2J1SA 3EJKA 3N7JA 3PMEA 3BKZA 5A32B 3KZ4C 4FPFA 3PUHA 3D0SA 4XXPA 1GZWA 4EJRA 1ZBE2 1F9KA 2D5HA 4I0AA 1TEIA 2ARCA 4K9SA 5CEHA 1POQA 3ST7A 3VBOC 4UFKA 4CCKA 4HETA 1R1ZA 2VMEA 2VZPA 3E6BA 3ZSJA 1Q8QA 1GSLA 4Z1VA 4K8RB 1WCUA 4YPJA 4P5HA 4JX0A 1YXWA 3JU9A 4YWAA 3ZIWA 4B29A 1OA3A 4UBGA 3W5MA 2WT2A 1ULFA 1V6NA 1L7LA 1W9TA 1HV0A 4BA6A 1NUKA 4P9XA 2ERFA 3T08A 1IPJA 1XE0A 2OZ6A 2DCTA 2W0XA 1RUC1 3ZPOA 5JCTA 2XVKA 3AZWA 4DRRA 3J7NA 4XFBA 4XJ8A 4WVMA 4LUMA 4ZXEA 4A3XA 4HVQA 3ZYGA 3RZHA 3S57A 2QTWB 2J1VA 4MHRA 4P5YA 1JYXA 2X29A 2O0OA 1OLRA 1VBC1 3IAQA 2XQRA 5H9QA 1WKYA 2JG9A 3I2IA 4IDZA 3SCHA 1GOHA 3GJAA 3WR0A 2Q1ZB 4LBOA 2VVDA 3WG4A 1LRHA 1X82A 3CDZB 1AR81 1RUC3 5FO8B 2R0HA 2GH2A 1MQTA 4Y1UA 4AVTA 5CG9A 5D1IA 1RUD1 2E53A 2AREA 4XF1A 3OGGA 4B1MA 1VBC3 3LZZA 2XUMA 4L97A 2UWCA 1QWRA 4CRQA 1AYM3 3H9AA 2GP3A 1QJU3 1WBLA 4IEOA 1FV2A 3W9AA 5FZ7A 4XQDA 2OA2A 3A22A 3N3HA 5CKMA 5FFOC 5LZ6A 3U4XA 4QMAA 4N43C 4XTPA 3FBMA 1RUD3 2WA3A 2WZR2 4XBLA 4SBVA 2RR13 4LLOA 4XIOA 2ZXQA 1VBA2 4CP2A 2Q4SA 1XB9A 3IBMA 3WV6A 1RUG1 1YI9A 1OA2A 1S0FA 3JQWA 3AL6A 5EPAA 5M0TA 5DPNA 1HN1A 2MHFA 4OUSA 4XMIA 5FZ1A 1MZEA 2JENA 3ZFGC 4PQQA 3I2HA 4AHYA 2L9LA 4FAGA 2W1QA 2DVDA 3EO6A 1DQ6A 3CJIB 2WR9A 5K0UB 5BNNA 4BWOA 4PIXA 2AUYA 1WA4A 2VCMA 4K20A 1RUI2 3GHMA 3U07A 1WW4A 3WDXA 2VQUA 2YC0A 3BVCA 5JZGC 2W91A 2JX9A 4RFT0 5F6LB 3T09A 2YV8A 2WQ8A 4FCAA 3HNYM 1VBE3 4EN8B 5FZ4A 2B9UA 1PO21 2XOMA 4RFRB 4O65A 1HJGA 5C4WC 4MGIE 3NNLA 3WINE 2LM3A 3GBWA 4CDQB 4QPIA 3C7GA 4N53B 5F32A 2YBSA 3ZFEA 1PK6A 2AYHA 1NLQA 1ZBE1 1L7RA 4JKLA 1JS9A 3ZDSA 4WV8A 2ZMNA 4AEDB 5J09A 2CWMA 1YFUA 2VNGA 2B39A 3VKNA 4RQPB 3A0NA 5FK8A 1VAVA 2WFF3 4GA9A 5DG1A 5ISLA 2PA7A 4LBQD 5L7OB 1XXNA 4AHWA 1R64A 2RM23 3C7EA 4XACA 5FP7A 4CCCA 1MVEA 5L19A 4LORA 3JD71 4LA2A 5B2GB 1RUH2 3U4SA 3DPRC 1FYUA 3FFQA 1WMEA 3N7LA 5FYMA 4QKDA 4Q0QA 3HN1A 5G04L 1QY4A 5J7MA 1LENA 1NQJA 4Q4Y2 2BYVE 1K3IA 1YEWA 2GDFA 1GR3A 1UCXA 1TMF2 5CFDA 3I2OA 1QJY3 3PDQA 3JD73 4QPGB 3AKQA 3H3UA 5IYYA 3NAPA 1VB4A 2BNMA 2ZOEB 3E1F1 2Y6HA 4TTGA 3TNPB 4N9IA 3H0OA 3LD8A 3IMNA 2IC1A 1X33A 1AYN3 1UY2A 2BZDA 3T2OA 1UF2C 4R52A 2RS12 3C2UA 4KWLA 3MW2A 2WJSA 3B93A 3TOJA 4NHLA 3WLUA 4PDWB 1ZZCA 1LOFC 1GOGA 4BH9A 3KM5A 1C5HA 2VXJA 2BDRA 2A6ZA 5FQ0B 3ECQA 2ES3A 4WVVA 2RS51 5DAPA 2FMYA 4LE4A 1IGOA 1CIYA 4BQ3A 2WZR1 4EWDA 4EQVA 1AR62 2UYBA 2HEWF 2ARBA 2D7FA 1RHI3 1QXPA 1VBA1 1W06A 2GZWA 4YW3A 4BQ4A 3U75A 2XJPA 3MV01 4AEMA 3BTYA 1KFUL 2F4PA 1VP6A 2RS53 2HWF2 5EZWA 1NQDA 4XDOA 5FY1A 5GZDA 3SH5A 5FY4A 1QOOA 2J1RA 1SLLA 4AQ2A 1PHMA 5JSRA 3WNMA 1W2NA 4NN0A 5BNPA 5I8YA 4JTNA 1RUI1 4TWTA 1ENSA 4R9DA 5FMDA 1YJLA 1MS9A 2HWE2 2WKKA 1JUHA 4QHOA 3TBDA 5KHKA 3VKLA 3WF1A 5A1LA 3B69A 1ASJ3 3RYRA 1LOAA 4HG6B 4YG6A 2ET1A 3I59B 2VBPA 4AVAA 2JDNA 2A5ZA 2CHHA 5A80A 4BQ5A 1QXJA 2XLGA 4CCLA 1C3HA 1RUI3 4LIUA 4RD7A 4XF9A 4DS0A 2HYXA 1SPPA 3FLRA 4YGCA 5A7QA 5HI0A 2VE1A 4OHZA 3KD4A 4GMP0 5FY0A 1FATA 3A23A 3SHRA 4XJUA 3WDYA 4IEQA 4IV1B 1NT0A 1EY2A 2LROA 3USUA 1NZCA 3H8UA 3QLQA 3I49A 4FSJA 3UL2A 4CVUA 1ND3B 5GZGA 2A6VA 2VG9A 3RWKX 2NP0A 1W2UA 3NSTA 1SG3A 3OD4A 2ZKNA 4EWEA 4ASMB 5JI7A 2MNGA 2P3JA 4FOQA 4QKFA 1RUNA 5T54A 1CR7A 4QB6A 1UU5A 1JZ5A 3D0JA 2PTMA 4J25A 4C0HA 4A7YA 2A70A 1RUH1 2V4AA 1QMJA 3DYPA 3DGTA 5DXDA 2Q8DA 4CDXB 3WG3A 4DEVA 5FWJA 5IATA 3Q8EA 4YW4A 1BCXA 1YLLA 2VO5A 1WW6A 3IAPA 4FPYA 4YGDA 5FDBA 3AKTA 2XBO3 5FZOB 4NE9A 4Q4Y1 1V0AA 3PNAA 3GF6A 1TMF1 2VZQA 3K2OA 3PLQA 2GNMA 5FP3A 4AI3A 1J59A 5FPBA 4HL0A 4M4PA 1REDA 5AFEA 2EIEA 1FMD3 2FQPA 4HFSA 1AXZA 3K4DA 4HOOA 1OFSA 3PHMA 3NKTA 5J98B 1VAMA 4C1XA 2W1SA 1L7QA 4FPJA 4Q4Y3 5KC5A 2RS11 5E16A 3ZMOA 5JAXA 5EIYB 1TMF3 3T1MA 5F1RA 1SZBA 1HXS3 3NO8A 2A6WA 2RDQA 5L9RA 4ZHNA 4H7LA 2DV9A 2RJLA 1O59A 1G7YA 5DDJ2 5T3NA 2A3YA 5HV0A 2XGXA 3RI8A 2FCTA 1GWMA 3O0XA 4LHLA 1CAVA 2WNOA 5T5PA 4BIOA 5FYSA 1O8SA 1AR61 1OBNA 1W2TA 1ZBA2 2RS13 4AWDA 4OI0A 2DFCA 2IXHA 2JDUA 3AZZA 3FC0A 4B7EA 4Y3OA 5CFCB 3J7MA 2JG9C 4Y4RA 1DDLA 4XAAA 4QXKA 2A3WA 1CGPA 3VBRA 3LKJA 1JTZX 3VBFC 4ZY9A 5C9AA 1S0IA 5FK7A 1FNYA 2VNRA 1ZZ9A 4NIGA 1BZWA 2Q8CA 1OFNA 1IZ3A 5CA6A 1NA1B 1GQGA 1X7NA 1AXYA 2Y0IA 2WBKA 2R042 5JXJA 4GQ7A 2D6PA 2ZGTA 4D7SA 1QEXA 4GAZA 3ZYJB 1RUE3 5A6QA 1XNBA 3WNLA 2HWE1 3B02A 4HN1A 5F5CA 5FV3A 1UMZA 3K75B 3J26N 1T6BX 4QQHA 3WQ1A 2RMU3 1G9CA 1RUJ1 3LA3A 4XEZA 4KWUA 2RE9A 1JU3A 3N4MA 3AP7A 1CX1A 3LEIA 2HKXA 1N1TA 3BIEA 4LITA 1W6PB 3OCPA 2PAMA 3I3DA 3B94A 2RHPA 2HWE3 3D4KA 3ZKYA 2W46A 1RB8G 5F5QA 4D8MA 3OGRA 1NKGA 1UYXA 5T5OA 4XFIA 1RUJ3 1S2KA 3CMGA 3HEIA 2QNKA 5FZ3A 1F35A 1FX5A 3VDDB 2KR2A 3OBRA 4P02B 2G9FA 3WF3A 3DXTA 2V5YA 1H2KA 2OPWA 4HK8A 1FNZA 3C7OA 4CCNA 1OT5A 1XYOA 3NV1A 1VRH2 3H8XA 4QDQA 1WLWA 4HBNA 1B09A 4ARXA 2OXBA 3NV2A 1NCQA 1KDKA 5B4NA 3A4UA 2YGMA 4RR3C 1UOBA 4QX0A 2DVFA 3WW4A 3CU7A 5CVRA 4NO4A 3PIJA 3KHBA 3M70A 2H0BA 5L36A 3AVSA 1UYYA 1YUDA 3T2PA 5KXCA 2J1AA 4NUBA 3S30A 3PL0A 2MEV3 1GFF2 1US2A 4QPWA 5HXMA 3AJZA 4FPKA 3PVBB 4ISQA 1UYZA 5DG2A 2CV6A 2JDHA 4GJYA 5FBJA 4WM8A 4WVZA 1UNBA 3T0BA 5FZ9A 1QDOA 5A70A 3LFMA 4MXWB 2OX0A 2EAAA 2CGNA 1COV2 3HMYA 1W6QB 2FCUA 2CU5A 1DGLA 1JOBA 2VVEA 3KCCA 4GWJA 3VD7A 4XFCA 1OQDA 2BTVC 2W9XA 5K7PA 1C8NA 2JXAA 3WQ7A 4KNCA 2VM9A 5F3IA 2KXLA 3P1IA 5IVYA 3POGA 1W39A 1AJOA 1DGRN 1VLNA 2QQUA 4N43B 4LNVA 1OKOA 3W21A 1IOAA 1OA4A 1QH7A 3U11A 4OCTA 4EROA 2VOTA 1ZBA1 1JN2P 1W8WA 2OQ7A 3FL7A 3MIEA 2Z4FA 4LBMA 2AEYA 4YZ5A 5CFDC 1G9DA 2EXKA 2E63A 2ID4A 3IMMA 2WAOA 2BVVA 1OQ1A 3TAYA 3I2FA 2RDNA 1VE0A 5FKBA 5EV7A 4JAAA 1W0PA 1G9AA 3HNBM 4E9KA 1MZFA 5A7SA 2HWB2 1DQ5A 5A3PA 1A8DA 1JOPA 3T30A 4DY3A 3I3QA 4ZU5A 3VBSA 2EAKA 1HB4A 1N3PA 3OPZA 5TSWA 2R041 2YFZA 2E33A 2WRAA 4QU2A 4FAHA 5IVEA 2WL1A 1QQP3 3PUIA 3O0WA 4MH0E 4MGKE 3PJQA 2WT1A 4D6SA 1OH4A 2ADEA 4LOSA 2VBBA 1UY1A 4BQXA 1LGBA 1CJDA 3VBUC 2VULA 4K7JA 1XPWA 2NMOA 2I45A 3LDBA 1WWYA 1N47A 1N1SA 1R082 3ORJA 4RA0A 1AR92 2JG8B 5BNOC 1Q8SA 3VLBB 5FMOL 3WY6A 4YFWA 2AC1A 3A0KA 1OMIA 1U5YA 2VH9A 1CAXB 3FZ3A 3NNJA 3BOWA 3NJXA 3ZN6B 2OT7A 3B9IA 4GMP3 1GQPA 1H2MA 4KU7A 5CB7A 5DN2A 4QDRA 4XF3A 2JIGA 3RWNA 3R0RA 1J83A 4IEZA 1QDCA 1AX2A 3CNAA 4XJZA 1OF4A 4CSWA 3OYWB 4RS5C 1PVC3 5LA2A 2LUWA 2VNOA 4XQ4A 3NMBA 1VRH1 4JRAA 4XUTA 1HB2A 3JXSA 1R092 2EVXA 4YARA 4C1WA 3VHPA 1YQ6A 3RJ2X 2W1WA 1XOYA 1K45A 3E97A 3NKGA 4OVEA 1CZTA 3KV6A 2JICA 5FMOS 4AQSA 2WNVA 4K1ZA 1OLQA 4YFZA 2WO2A 4HSLA 4I01A 3ZOIA 2GNDA 3MGUA 3OY8B 1UYPA 4JC1A 2ZEYA 3CKHA 4N7UA 3ACHA 4B3NA 1HDKA 1S2EA 3SNMA 3ZFGA 1YIFA 5EJ1B 1OUSA 1LHOA 3BALA 4QXHA 2UWAA 1XC6A 2A75A 3DN7A 3MUY1 3VZKA 1LEMA 4AFMA 3AB0A 3AKRA 2JEMA 2W39A 2D6MA 4XZPA 5IT6A 5IUQA 2BUKA 3T2TA 1W04A 1COV1 3SH3A 4AG4A 2BV4A 2GC2A 3TEXA 2YMZA 3DEMA 1HRV2 4IEXA 1QH6A 1W9WA 2P3IA 1LGCA 3EYPA 3M1HA 1WW7A 2HYKA 5ABJC 3ZN5A 2XB6C 3POFA 1GV9A 4D69A 2Z69A 1FPN2 3J9SA 2JDAA 5JOXA 1JMUB 2E31A 4QKNA 5C4WA 1OI6A 3NJVA 5JOZA 2ORZA 4E2SA 4YW2A 4XE9A 5KHJA 4AE2A 5FY9A 1E5RA 3I2JA 3DECA 3H1MA 4NPLA 4ATEA 1JHJA 1A6CA 4CDWC 1HV1A 1ULEA 5FYUA 3OUIA 1D2SA 4IGOA 4P9GA 2OKXA 1BXHA 2HWB1 4FQZA 2V5DA 1OPOA 2EICA 2ZGQA 2B42B 1EPWA 4E4SA 4EN0A 1GNYA 1PX3A 1UN1A 2AGSA 2J7MA 1V9U3 1I6XA 2DFBA 1UX7A 1WBFA 3HN3A 1RUOA 4WZFA 2VXRA 3MW3A 2JJ6A 2WNUB 2CSGA 2WT0A 3DPRA 4QXBA 4RSUA 5EQUA 2GN7A 1JZ6A 3D3AA 4F3JA 2PYTA 2IXCA 1R081 5KXBA 1I3HA 1AR91 3MIFA 1GLHA 1W6NA 3CEWA 3DKQA 4Y1XA 4WVWA 3H8OA 1JW6A 4CDUC 1UU4A 2DVBA 2W92A 4QX2A 5E6HA 1UD1A 1H8VA 1ZVFA 4W6XA 3ETPA 1ZRDA 1EPZA 2WWJA 3N9LA 1SDDB 4LHKA 4XHBA 3POWA 5JVVA 1UW8A 2VOVA 1AL23 2VTXA 1GP4A 4JGYA 5LY2A 2VUAA 3T1LA 5A7OA 2WWUA 1LOFA 1SCSA 3SQOA 1PGL2 4EZHA 1DYPA 4I3PA 3ZSMA 4AFDA 1UWWA 5DAWA 3JB4C 2E6VA 2XPJA 1R091 2ORXA 2BU9A 2O1QA 2D6NA 1BVP1 5A3UA 4NIDA 2GC1A 2HLEA 2R072 1DZQA 4GB32 4QD2A 5FPUA 4QX1A 3FX3A 1KGYA 1UKRA 1S0CA 1I5PA 4FP2A 1GZWB 4IV3C 1DQ2A 1AYM2 4ZS2A 2QQMA 3T2QA 3ELNA 1QJU2 2VVFA 5JSOA 1JOJA 4PLNA 3UYJA 4UOJA 5IK4A 1CAWA 1R093 4M4RA 1DYKA 1UL9A 2X10A 3TB0A 2HBTA 1YWKA 4J6GA 5A3LA 4LKSA 4UAPA 3HT1A 1JODA 1O4TA 2RR12 3E6DA 2WQ4A 3FLPA 1UOJA 2P5BA 5FPZA 4WZCA 3ME2A 1VJ2A 3THDA 1J84A 2X5IC 1HRV1 3NNMA 2E7AA 4BDVB 2PLV3 1OQEA 1N1VA 4GD4A 3NJYA 4OZOA 4LKDA 1NCQC 5F6KA 1WUVA 1DLCA 4WVMB 1FPN1 3ZFFA 5JSPA 2YU2A 4MGQA 5DABA 4MX3A 5LK7B 2YPDA 1Y7BA 3JZVA 1LGNA 4XPVA 1W99A 2WLQA 3VHNA 1ZRRA 2AENA 4KI5M 4CUBA 2JG9B 1BMV2 1W0OA 2VMHA 5IVFA 4LIVA 5HXVA 4K6BA 4IE6A 3OD0A 5D8AB 3GZAA 3EHKA 2OZJA 4A3ZA 1P8JA 5JMCA 1KEXA 5IJRA 1MQTB 2PHUA 3ACGA 1FPN3 1VBE2 4LHSA 1H1AA 4WM8C 1NCRA 1QKQA 1Y9GA 3A7QA 4AFBA 2QQLA 4RGAA 1EAH3 3DXUA 4FFFA 4OHVA 1ZZ7A 1TME2 4IGPA 2R063 4R8HA 4TLFA 1S0EA 1H8TC 1LOBA 2RDRA 3GCXA 1GBGA 1Q8PA 1O3SA 1JYCA 2R1BA 5I93A 1WCDJ 1HQWA 1FOD3 3AMNA 1BLZA 4UW3A 3P5BA 1OKQA 2WN3A 2YC2A 3RZMA 1PO13 5DZEA 4Z2AA 2B45X 2WFF2 5A33A 3EXUA 1OPMA 2GALA 1QNYA 4KU8A 5DAXA 5BYNA 1H1IA 2XLFA 2RM22 2ZGPA 5AVAA 1BK0A 3NQHA 4CCJA 4LBLA 5KHHA 3AXEA 1K5MC 3RZZA 3AP5A 2PHXA 1VBD3 3LOIA 3ZN4A 3VD9A 3ON7A 1T6GC 4OUMA 3T4HB 4FVVA 3VBSC 4CP0A 5JPNB 4GH4C 5BNNB 1KS4A 3N9QA 5FYVA 4BK5A 4COUA 1FXZA 2YC4A 2D44A 2YBKA 1QJY2 1OOPA 3QOPA 3JD72 5E89A 5JMOA 1O3QA 2JB8A 1PGL1 1WLDA 3ZIXA 4YVSA 3FWEA 3TYJA 4IE4A 2WDBA 4IGQA 4Q1RA 1SMVA 2ZBJA 4PI2A 1UQXA 5K9YA 3MZHA 5EYYA 3B00A 2ZGOA 1AYN2 2R071 1AR73 1GMMA 1W3VA 2WNEA 4GB31 5ERLA 4QPIB 4IE5A 4Q0UA 3LF7A 3T4VA 3Q8AA 5DZFA 3GHNA 3ZFEB 1PK6B 2ZCWA 1AYM1 2NPIA 3CIHA 3ZXFA 4D94A 1QJU1 4PJYA 2QJVA 1DZRA 4GJZA 4JHTA 5FMBA 3VBFA 3BU7A 1YI7A 4XJWA 1MVQA 3JQXA 1TNFA 1XU1A 1BQPA 1OXCA 2E9QA 2YZ4A 3F2ZA 2TNFA 2R073 4GB33 4Q4W1 3RSJA 2DUOA 2RR11 4D3WA 1RHI2 2DU0A 4LEJA 1PX4A 1PNFA 1ENQA 1CZVA 2H6CA 2OQ6A 5C3QA 5CADA 1S1AA 4Y22A 5C8CC 2B46X 4NHYA 5FPVA 2Y6JA 1V6OA 3FJSA 1O6UA 2ZGRA 3OGSA 4YVWC 3VBHA 4B4QA 4CUAA 2RS52 4LKFA 4ORFA 2YGLA 3SKVA 2GMEA 5KR7A 3OOXA 3AFGA 4Q4W3 4JKMA 5FLJA 4AK3A 2WQZC 1W03A 1G86A 5C3RA 2VZTA 1BYHA 2WNVC 2WUHA 4AI2A 5A6YA 5CFDB 1BHGA 3BPSA 4Q0SA 3GZEA 5C8WA 5CAZA 2TEPA 1JHNA 4QX5A 4URAA 3LSEA 4XDQA 3NAPB 4NIHA 5CKQA 3AP4A 2W2IA 2XL7A 1STMA 3TRSB 1QJX3 3ENRA 4E8DA 4LR4A 2QZ3A 2C0ZA 3LIGA 1ASJ2 2ZGUA 1JBCA 3VZOA 4META 1VBE1 1NYWA 2QQKA 4BM8A 2JDMA 1LTEA 4BIFA 2Z79A 1D2QA 2HJIA 1ZRFA 2HEYF 3B01A 4YRDA 1CIWA 1TME1 1W9SA 2WA4A 3OF1A 3RFRA 1LCLA 2ZGKA 4JKKA 2P2KA 1OD3A 4IW3A 1HB1A 5A32A 5FP8A 2R0FA 3UNPA 1IS3A 2QZ2A 4P9YA 3SEEA 5F37A 4AI8A 3BUCA 2WFF1 1PMJX 5LASA 1TME3 3TN93 1PGW2 3KV4A 4RR3A 2TUNA 4CP9A 4FTSA 3SITA 2VC9A 4YG0A 2RM21 5C71A 5EWSA 1MR5A 3KF5A 4NAMA 3LA2A 4Q0PA 1W6MA 4XFFA 2A6YA 5FKCA 1APNA 3ZO0B 4I0BA 4Q8KA 2KA3A 1UPIA 3CZJA 5FXZA 3WG1A 1IQDC 2ARAA 3UJQA 1LHNA 2VOKA 1CZSA 1OURA 4H55A 3QH7A 2XBO2 3UKNA 4CCMA 1KRIA 2NQYA 4EE2A 3AL5A 4NR1A 5BNPB 4NOTA 4IL7A 5CU1A 1QJY1 3OSDA 2OS2A 4P00B 1ULPA 2KM2A 4OZXA 4GXLA 5LBEA 1FMD2 3R4SA 2P3KA 1AYN1 3W5NA 1RL3A 5CKNA 2ZX2A 1UO9A 3T0DA 3DYOA 4COWA 1HXS2 1SPPB 1VMFA 2FDJA 1M4WA 2JDPA 3GZUC 3IWZA 5FUPA 1HX6A 3ASIA 3M3QA 4Y5Z0 2J1EA 5FREA 2R6QA 3PMSA 3K51A 4UFIA 3ZX7A 5JXHA 1CVNA 1NLSA 3USUB 3VKOA 4QX7A 1R1A3 2DCKA 3ZYIB 4HPKA 2Q5TA 1LESA 3CQOA 4JGYC 1RHI1 4Y5TA 2AZ5A 2VZUA 4JRLA 2J22A 4PIYA 1GZCA 4JTOA 3T0AA 2AH2A 3EB7A 1J3PA 4AYUA 1CPNA 4MGZE 3VN4A 2IUWA 4LHNA 2VZRA 4OHWA 3VBUA 4UWDA 5A7NA 4X6RB 2W52A 4ZZ5A 1MPXA 4QB2A 4SLIA 5CBLA 1MS0A 3LDRA 1F2NA 4QDSA 4N9HA 2YB7A 4FPHA 5JIUA 5BNOA 1LOCA 2QDRA 1BK1A 5BV6A 1Y3TA 4FQ4A 4M0NA 4Q27A 4ZONA 5FUNA 3MYXA 3G6JB 4AQTA 1RUE2 2ENRA 2BQPA 4NPRA 4O9GA 3AMMA 1UZ0A 4ZXKA 3SH4A 1ODMA 1ASJ1 4L9BA 4KG8A 5FTTC 2PMWB 2RMU2 1IS4A 2XDVA 1WCSA 1GZTA 4HKWA 3OGVA 3K3NA 3N9MA 5ANNA 3WX5A 1D4VB 1UXZA 2Y6GA 2CDPA 4W6YA 1XYNA 3KV9A 5H9PA 3KV5A 1H4HA 1ULGA 3B9CA 4P9WA 2JB4A 3J4UH 4YZ4A 3S7IA 4RS5A 1MS5A 1TZOA 3UJOA 3AZYA 5DZGA 1REEA 2LALA 4CDQA 3RMXA 1JU4A 1CAVB 4FPEA 3O12A 3ZFFC 1RUJ2 1ZNPA 4WBBA 1JZ4A 4URTA 4JGZC 4XAEA 4ASLA 5FYBA 5C33A 1PGW1 3O14A 2Y6KA 3E5QA 3WVJA 3VBRB 4BHPA 4JQTA 4D7TA 3OEBA 5C9AB 2OW4A 5AC91 2D40A 4C8DA 1UY3A 1WW5A 1F4AA 2JIJA 1F4HA 5GKAC 5JOWA 1NE4A 3RZLA 4FPCA 4AZZA 5IVVA 1WLCA 4OLLA 1J1LA 1NCRC 4N7IA 1ULDA 4PI0A 2Z2SB 2P37A 2CGPA 1E57A 2Y6FA 4FTEA 2XBO1 2VZ1A 1AXKA 2XUEA 3J7LA 3V56A 4BLJA 5K8SA 4YM3A 3BGAA 4PBPA 2Z42A 1IHMA 4HZFA 4Y20A 5FZ0A 5AC93 5IVCA 2ET7A 3U37A 4XYXA 3ZDVA 3ZXGA 4AW7A 1C1LA 1O4ZA 3PU3A 4Y26A 4X8NA 5FXXA 1FMD1 1C8M2 5ABJA 2MEV2 4XF4A 4XVHA 3SMHA 4NIIA 2ZKLA 4H3WA 1HB3A 4A45A 3V0BA 4XABA 1HN0A 4YW5A 2PHRA 1UZZA 1HXS1 4LQRA 4M3CA 2V09A 1ALYA 2A1XA 3VKMA 4XJAA 5FR3A 5GLUA 3GYDA 4XUOA 5FLIA 4CDWA 3F95A 2VUCA 3VB9A 3I4IA 3S6PA 2FCVA 4H7MA 3UGGA 1EUUA 5JLVA 3LEKA 2D3PA 4FFGA 2NYYA 2C5DA 2VBDA 4I09A 4JVAA 3ZYRA 1GP5A 5A6ZA 5HPOA 1LHWA 4CEYC 1UY4A 1OOPC 1WA6X 2WIIB 4XCBA 1B35C 3W58A 1IPKA 3U10A 4YVSC 3RG0A 1UIKA 5HCFA 3LIHA 3WG2A 5HBAA 1G9BA 1ODNA 2XVGA 3LB9A 5FZKA 3AYDA 1NCQB 3GALA 2UWBA 4HKLA 4ZU7A 3OJBA 3FHQA 4X8PA 2WYSA 2CY6A 1PZ7A 5IW0A 1SBFA 3ZYFA 4ZU4A 2HWD3 1QQP2 5FYHA 1VALA 4CPBD 4IXLA 4MSVA 3SISA 4CDUA 1RUE1 2K9ZA 4YZ2A 2QFEA 2VZSA 4KMQA 1XNKA 3PJYA 4FXKB 4WM8B 2RMU1 3HD8B 4LULA 4ES9A 1SLBA 2F6BA 1X9TA 2ARXA 2P34A 4ARYA 4DNYA 1SBDA 5FYZA 4LO6B 5FXVA 2DURA 3N36A 2RDSA 1QOSA 3PVOA 5FAXA 4NPMA 1Q5OA 3PIGA 5FZGA 3VBHC 4COYA 1JH5A 4DQAA 3AP6A 5KWRA 3BIWE 2WO3A 5LA0A 2GAUA 2XR4A 4EZ4A 4QX3A 3UV9A 3IDCB 3VV1A 5FP4A 4R9AA 4O61A 3VZLA 4K40A 2R30A 4IV3A 4QGMA 4GWNA 2ZMLA 4P9LA 1PVC2 1BKZA 2XHNA 4PLOA 3ZXLA 3ZR5A 1E5HA 3O0VA 4LMFA 3VBOB 4AAPA 1ND2C 3KSCA 3RZGA 3MIBA 2EA7A 3AXDA 4AVCA 1ZRIA 3MF9A 3HQUA 1S0JA 1W2AX 1LKNA 5G05L 2VCAA 4S2FA 4UF0A 1GNHA 1NXD1 3IT8A 3ZPYA 1PIV3 5LWBA 3AJYA 2XXZA 5FZOA 1F15A 3BCWA 2X5IA 3I8TA 4MUVA 4PCRA 5KHGA 4KWKA 1U5ZA 1C8M1 2MEV1 3DCQA 3MPBA 3WP4A 5A7WA 2WZ8A 4HK9A 5GLWA 3OB8A 4A6SA 3Q8BA 5LW9A 1C57A 5I0RA 2C1FA 1RGSA 1UPSA 1RXFA 2B5HA 5HCHA 2VZ3A 3NNGA 4UYBA 4OHXA 2XJRA 4KG0A 4RGKA 1C8M3 1U5IA 2RV9A 5I0SA 3GZTB 1KS5A 4J1WA 4DOUA 1JYTA 3ILFA 4AVVA 2QQPA 1NG0A 4AL9A 1L3JA 3LEMA 2XG3A 2JE7A 4UFJA 4BE3A 4FXGB 3G7DA 4KGGA 2WINB 5EYXA 2X8KA 4UBHA 1U5XA 1H8TA 3HQRA 2NLRA 3PVEA 4FOVA 1QJFA 4UFHA 4L92A 3SKJE 2RJKA 4OYUA 2ZX0A 3IPVA 2LW8A 4D6QA 1SACA 3L2HA 1Q43A 3H7JA 3UGFA 1WMXA 1NA1A 1QQP1 4OMCA 1H6XA 3MI8A 5CIRA 4AFCA 4BLIA 2Q8OA 4XIKA 1K5MA 1V9U2 2X53S 2ZMKA 3ZFGB 2EALA 3IM0A 2VY0A 4KBBA 2Y8KA 4F8AA 2ZHKA 3ZKUA 2HBUA 4L11A 2ILMA 3IKWA 5KC6A 3O1RA 4GH4A 3AZVA 2YY1A 1S0GA 1SLTA 1VBB3 2Y6LA 1Y9QA 1D4M1 3POBA 1U0AA 2E51A 3FMGA 5JZGB 3BU0A 1IKPA 4TN7A 2UYAA 4B8EA 3WNOA 3ES1A 4PF5A 1OHFA 4PLMA 3WNKA 5I8SA 1A34A 1D7PM 4GMP1 3IDAA 4NRQA 4W50A 1VAKA 1UZVA 3GGLA 4Y1YA 5C4WB 3RPQA 5LRSA 3ZSLA 4UW6A 1KQRA 3ZM8A 4CYDA 1AL22 3NVCA 1D4M3 3KB5A 4YW7A 4A6OA 2WN2A 2DBIA 1YRZA 2QUOA 5LK5A 3SCGA 2V73A 3CJIC 5K0UC 1PVC1 5FPAA 3THCA 5IVBA 2QKDA 3MLKA 1Y43B 4M3CE 2Z5WA 1CAUA 5FZ6A 4UW5A 2ETEA 5FCCA 1RC6A 3LEGA 4L8QA 3OUHA 3CBNA 2E32A 2YUEA 3RJRA 1ENRA 2I07B 3FUOA 1VMJA 1JZ8A 5SV8A 3D8CA 4Q0VA 4QAWA 3N7MA 3VHOA 2G4IA 2JKBA 3JBG3 1O8PA 4GIQA 1ONAA 5C8CA 4FO9A 4MHUA 2NM1A 3H7YA 3B5LB 1S4CA 2YROA 4M00A 3DPRB 2B9VA 4XBQA 4CDQC 4FBFA 4YVWA 4JZRA 4CTEA 1ZRCA 1DP0A 2BOJA 3VD5A 2F4LA 3BOPA 1GP6A 4XF0A 4Z92B 5IK5A 1QOTA 2PHDA 4AEDC 2EIGA 4ZZ8A 1DFQA 3N9OA 1W6NB 3U14A 5IAXA 4KWJA 1WGPA 1GICA 2ZPXA 1MS3A 4RQPC 3LQCA 3WF4A 5LBCA 4GWIA 4BMEA 2CDOA 5JIAA 5L7OC 2VQTA 5E88A 2D93A 2PLV2 4YLZA 2MPFA 2FD8A 1DGWX 2XJVA 1DBNA 1H2LA 3R4DB 3W20A 4QGNA 4QU1A 1BVVA 3I2KA 4AVBA 2YYOA 1KFXL 3WUDA 3QD6A 3ATGA 3GXUA 1J3RA 4JGYB 3AYEA 2VW0A 1YQCA 2X05A 2SBAA 1H4GA 1HRI3 1BBT3 2A7AA 1LULA 2W3JA 4MGYE 2JE9A 3OBTA 1A78A 2NZ9A 1W8NA 4OQ8A 3BB6A 4LBQA 2R7EB 1DQ0A 3RRDA 3OG2A 4WM7A 3CJXA 1EAH2 3GBGA 1O3TA 2R062 4DXRA 2ZGMA 3WZ1A 3WD5A 1IKQA 2VL4A 4G9SB 2W47A 3MFAA 3RS6A 1C5IA 4LE3A 4LO5B 1N1YA 1CAWB 2GNBA 1V9U1 2VZOA 2CWSA 3WCRA 1RMU3 1FOD2 5T52A 4RYDA 3M3OA 3L9JT 1YQ5A 5EJZB 2VQ0A 3WOGA 5I8TA 1PO12 3RZJA 4CU7A 2H0VA 1MS1A 3I3EA 5D2AA 2XJUA 2J1TA 4IE7A 1PM4A 4Z07A 3RDIA 1XNDA 4NWVA 5JOYA 1CN1A 2DWRA 1CJPA 1W8FA 1G6NA 2E7TA 4KBZA 4QKBA 2WZPP 4ET7A 1VBD2 4S2DA 3H3ZA 2WZEA 4AFAA 3AYCA 5FO7B 3ZFFB 2Y33A 3O1UA 4HT1T 4C0BA 2EXHA 1CWPA 3N9NA 1KXGA 1OVSA 3C8XA 2DCYA 4FPGA 3KLSA 1AX0A 1A3KA 2EIDA 4L2NA 1XBFA 4J1XA 1AL21 5L9BA 4ES8A 1LECA 2VNVA 3H50A 4OQ9A 2VMCA 1LODA 1KJLA 1UOGA 2BW8A 2ZS6B 4QWNA 3NV4A 1URXA 4B4PA 5F5IA 4AI9A 3VD3A 1NCRB 1NZIA 4AEKA 1PMIA 4AXOA 1AR72 3KVAA 2B7YA 3O5SA 4O7XA 3V0AA 4TZDA 3HOBA 2OYZA 5FJKA 4XURA 5AFBA 1CESA 4P9JA 1DZTA 1W8OA 3AMPA 3AC0A 1BEV3 3URFA 5KXDA 5H9RA 3UKTA 4DIQA 2I74A 4C90A 2ZX1A 3WNPA 3HPNA 1V6JA 4XUPA 5FUIA 2JE8A 2CGOA 4A7ZA 3PTYA 5HV4A 2WLPA 1NY72 2G9ZA 1XSRA 2QQNA 5A33B 5EHDA 3ZR6A 4IV1C 3C3VA 3MIDA 4IQPA 1W9FA 2B4KA 1IG3A 1SHWB 3O1MA 1ND3C 2I2SA 2O14A 4IUGA 3S7EA 4DUWA 4V2WA 3WEZA 4DXZA 2PLV1 1BMV1 3N35A 2YPJA 5A3NA 1AZDA 2GMMA 2VW2A 3MV11 1QNWA 4GKYA 1V6LA 3OPWA 4Q4W2 3V65A 3VZNA 5A3TA 5BY5A 5F8PA 3K4AA 4KQ7A 4CDXC 5K4LA 3SXWA 5J37A 3NW4A 1MACA 1W8HA 1X50A 1YFWA 2ZGNA 3GNEA 1UKGA 4Q4V2 2VQAA 3R6SA 2ZHNA 4B7KA 1OOPB 2JD4A 4NMIA 4YVSB 4CUGA 2BGPA 2KD7A 3BTXA 1QJX2 2BRTA 1EUTA 2CYFA 2IXJA 3OUJA 4OI2A 1D0GA 2LRPA 4ONUA 1SLAA 5FPLA 3RYKA 2R49A 4CCEA 2BNNA 2BBVA 3B3QE 5ACA3 2ZTNA 5JUVA 1YYNA 4JGZA 3AKSA 3HAGA 3O7OA 2XQXA 1EAH1 1X9PA 1J1TA 2DVGA 2R061 3S5QA 2BNOA 3AYAA 4P08A 3VBFB 1Z78A 3RNSA 1UU6A 4COVA 3FN9A 4NHKA 4PQ9A 1FOD1 2E26A 2G9GA 4PBOA 4LXLA 3VGIA 5JXIA 4MGSA 1QF3A 5DUVA 5JR7B 3VKFC 4AAXA 1PO11 3MLJA 4AGVA 3MLLA 3TWIA 1FV3A 1V00A 1W6OA 3E5XA 3TN92 1YQ2A 4Y22B 4YGBA 4IERA 4E4DX 2O8OA 4L99A 4Q26A 4BXFA 2CNAA 5I0TA 3NL1A 3POEA 1ZA4A 1X8MA 1JYIA 1VBD1 2GU9A 3ZYHA 3WSOA 3R05A 3LA7A 3D6EA 2A6XA 4XTMA 3Q8CA 3H3LA 2ZHLA 4PHZA 4YG3A 1RUF3 3CO2A 5JWPA 2XMLA 3KGLA 1HJFA 1NA1C 4XZUG 4O9EA 1NXMA 4EYUA 1F5FA 1OUXA 1JYNA 2XHKA 1HW5A 4LJHA 1O5LA 1F5JA 2VW1A 2DBNA 3ACLA 4XW3A 3C7HA 2WS93 4RL7A 2IXKA 3WW1A 1U12A 4GKXA 2VMGA 1AR71 3INAA 2FDGA 4MG2A 4CEYA 4DEQA 2DUQA 4CE8A 1W2OA 2VOXA 1I1EA 3ACIA 2R32A 1B35A 4ASKA 5CYYA 2R16A 1FAYA 2W08A 1SFNA 4CXXA 1ZZ8A 4BISA 4AF9A 1R1A2 1H1MA 5C3OA 3LCPA 3NNFA 3RMYA 1WCKA 3MW4A 3LFIA 1NY71 2WSUA 5KXEA 4RR3B 4CP9B 2BFUL 4XUQA 3OBZA 1SEFA 1D0HA 3QBQA 1AX1A 4Q1PA 3VDDC 1W6MB 4Y5SA 1SLIA 1SFYA 4AQ6A 4A7KA 1EYBA 4DY5A 3RI9A 2K0GA 4QB1A 1F31A 1GANA 2YG0A 5E1RA 2FBEA 3CZUA 1C4RA 4FFIA 3VZJA 4Q4V1 4N8MA 1MEC2 3WXPA 3OBAA 1TQ5A 1H30A 3VZMA 2XJTA 4IEPA 3ZLIA 4AHXA 5IFTA 2AR6A 3N7KA 4G3YC 5GLVA 3K3OA 3FE5A 5F3EA 1ZREA 4ATFA 2P6CA 1QJX1 4YM2A 2Q1MA 4LT5A 3ZVXA 4AGGA 3O1PA 2VCBA 1PM7A 2BFUS 3I2DA 5D8AA 1XJAA 1IS6A 2EXJA 4IEUA 4M01A 4Q4V3 2WO1A 4R4ZA 5LCWL 1ZZ6A 2LS6A 2YHJA 4QXCA 5GLTA 3UKVA 4DO0A 1OC1A 3GBFA 3HVDA 4JV4A 4K21A 5FJHA 1LAJA 1JYVA 2IXIA 4BZ4A 4MVTA 3OPTA 4BB3A 2WAAA 3WDWA 2FDKA 1MS4A 1ND2A 1Q56A 4HPKB 2IZWA 4A4AA 4K8FA 1JYWA 1AR83 1LU1A 3ZXJA 2IVIB 2YXSA 3WCSA 5CISA 4CEWA 2K46A 3TN91 4E4HA 4GULA 1Q3EA 2BWAA 3LWCA 1CD3G 2A71A 2EXIA 4QM9A 4U36A 4X6QB 2PAEA 4CU9A 1VRBA 3KMHA 4S2GA 3LAGA 1UZWA 3I97A 3VBUB 4BYYA 1YHFA 1RJ7A 1W8UA 3KT7A 1RVF2 4GWMA 2BGCA 1LNSA 2Y64A 5C6CA 4WM7C 3CL1A 4ITCA 3IN9A
chains in the Genus database with same CATH topology
2FCVA 5DAPA 5LA9A 3GJBA 4BQWA 4BQXA 5L9VA 5IAVA 4XCBA 4Q5OA 5ERLA 4KBZA 4Y5TA 5LATA 2Y34A 3NNJA 2HBUA 5DAWA 2Y33A 5EPAA 5M0TA 5A3UA 2JIGA 5L9BA 3KT1A 4UWDA 3EMRA 3ITQA 4NAOA 5LBFA 4NHYA 5EP9A 4ZONA 3BVCA 2HBTA 3NNFA 2RDSA 2OPWA 3OBZA 3MGUA 3GZEA 3NNLA 2RG4A 3NNMA 4NHMA 4Y5SA 3OUHA 5DAQA 5HV4A 4XCAA 5C5UA 4J25A 2V4AA 4MHUA 5IATA 4BQYA 3PL0A 4JZRA 3HQUA 4XACA 4IW3A 5C5TA 5IAXA 2JIJA 2FCUA 5LBCA 2G19A 5LB6A 4NMIA 5LASA 2RDRA 4ZPIA 3OUIA 3W20A 3W21A 3OUJA 2RDQA 5L9RA 4XC9A 4NHXA 2RDNA 5HV0A 5DAXA 4MHRA 2FCTA 4NHKA 4XABA 3GJAA 4NHLA 5EQUA 2G1MA 2A1XA 5LBEA 5LBBA 3KT7A 4XAAA 5DAVA 3HQRA 3KT4A 3DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCV A;  5DAP A;  5LA9 A;  3GJB A;  4BQW A;  4BQX A;  5L9V A;  5IAV A;  4XCB A;  4Q5O A;  5ERL A;  4KBZ A;  4Y5T A;  5LAT A;  2Y34 A;  3NNJ A;  2HBU A;  5DAW A;  2Y33 A;  5EPA A;  5M0T A;  5A3U A;  2JIG A;  5L9B A;  3KT1 A;  4UWD A;  3EMR A;  3ITQ A;  4NAO A;  5LBF A;  4NHY A;  5EP9 A;  4ZON A;  3BVC A;  2HBT A;  3NNF A;  2RDS A;  2OPW A;  3OBZ A;  3MGU A;  3GZE A;  3NNL A;  2RG4 A;  3NNM A;  4NHM A;  4Y5S A;  3OUH A;  5DAQ A;  5HV4 A;  4XCA A;  5C5U A;  4J25 A;  2V4A A;  4MHU A;  5IAT A;  4BQY A;  3PL0 A;  4JZR A;  3HQU A;  4XAC A;  4IW3 A;  5C5T A;  5IAX A;  2JIJ A;  2FCU A;  5LBC A;  2G19 A;  5LB6 A;  4NMI A;  5LAS A;  2RDR A;  4ZPI A;  3OUI A;  3W20 A;  3W21 A;  3OUJ A;  2RDQ A;  5L9R A;  4XC9 A;  4NHX A;  2RDN A;  5HV0 A;  5DAX A;  4MHR A;  2FCT A;  4NHK A;  4XAB A;  3GJA A;  4NHL A;  5EQU A;  2G1M A;  2A1X A;  5LBE A;  5LBB A;  3KT7 A;  4XAA A;  5DAV A;  3HQR A;  3KT4 A;  3DKQ A; 
#chains in the Genus database with same CATH topology
 5BNO B;  1HKD A;  2W1U A;  3JUU A;  3HR9 A;  4CCO A;  4QHB A;  1RIR A;  3WT3 A;  4CXW A;  5AC9 2;  3PU8 A;  1RUG 3;  1UAI A;  2PHW A;  3IIA A;  1US3 A;  1QHD A;  2HEV F;  4XET A;  3WHU A;  3ABZ A;  3IZO A;  4XJ9 A;  1UIJ A;  1J58 A;  2BWC A;  2C4X A;  4OMD A;  1IPS A;  5IFP A;  4W8J A;  5F39 A;  4LO7 A;  2ZGL A;  3O1O A;  1Z0H A;  4HKO A;  3KHC A;  2JDZ A;  4XBN A;  4RS5 B;  2Y34 A;  4Q8L A;  2FDI A;  2JG8 C;  4XQW A;  5I91 A;  3Q8F A;  4LK7 A;  1VMH A;  2QVS B;  1DQ1 A;  2VUJ A;  3RZK A;  1R1A 1;  5FY7 A;  4DPN A;  1ULO A;  1NOV A;  1VB2 A;  3KT1 A;  1OLM A;  1RYY A;  5C70 A;  3PUA A;  2JD9 A;  2CAV A;  3H42 B;  1PO2 3;  3BOD A;  3MIH A;  4UW4 A;  5C3S A;  2DDU A;  3D82 A;  1H6Y A;  5T5L A;  5FLH A;  1O5U A;  5FPX A;  5FO9 B;  4NRO A;  2V4V A;  3O1V A;  5FZB A;  3E5U A;  5KBF A;  1VPH A;  1ZBE 3;  4XXA A;  5JI9 A;  4DRV A;  4F83 A;  2ZZQ A;  2A3X A;  1J3Q A;  3MPP G;  3M3C A;  1GZ9 A;  4QQ2 A;  1GOF A;  3VDB A;  1MEC 1;  1XRU A;  2DTW A;  4Y20 B;  1O3R A;  2ADD A;  2HWD 2;  2VMI A;  4BQ2 A;  2AEZ A;  3APB A;  4IND A;  1JUI A;  3AVR A;  5DAQ A;  3LE0 A;  4XCA A;  3IDB B;  5ABJ B;  4NJ4 A;  3MO4 A;  3PUS A;  2ZZJ A;  5SV5 A;  4IEY A;  3JCI A;  5IK8 A;  2W95 A;  1MEC 3;  4NVP A;  4MZU A;  3V0B B;  4IES A;  4RN5 A;  5LEK A;  3I3M A;  3MIG A;  4BQY A;  4M3C B;  4JDM A;  4H2A A;  2XWB B;  4DUX A;  2D6L X;  1YNA A;  3M3I A;  4MYE A;  4I2O A;  3PUQ A;  1OD5 A;  3CJI A;  5K0U A;  4CDW B;  1WD4 A;  3I2G A;  3SC7 X;  3HQX A;  3BN6 A;  1O7F A;  1MS8 A;  2VR4 A;  2IVJ A;  2X09 A;  1BJQ A;  3I7D A;  2CAU A;  3LSD A;  2G19 A;  3ZSE A;  5C3P A;  3H1Y A;  2JEC A;  2Y26 A;  4QQP A;  4EN6 B;  3VHR A;  1DGR A;  2LTN A;  4KL1 A;  1QJE A;  2PEL A;  5DUU A;  4E2G A;  2UU8 A;  4A41 A;  3WW2 A;  4V2V A;  1POV 0;  1YJK A;  1TVG A;  1GUI A;  1M06 G;  3VL8 A;  1GYK A;  1WLT A;  5GZC A;  1K5J A;  4N53 A;  2PXJ A;  2VTX J;  3AM2 A;  4NHX A;  1RVF 1;  3QAC A;  1W8Z A;  3THT A;  3FBY A;  4AED A;  2XJQ A;  3ZMN A;  2OUJ A;  2O8Q A;  2WZR 3;  1SQ4 A;  1IQA A;  5C7G A;  1VBA 3;  4RQP A;  1PIV 2;  4YM0 A;  5I0U A;  4CDU B;  2UY9 A;  5GZF A;  2EIB A;  3X29 B;  2QDN A;  4CCD A;  5JPM B;  1VIW B;  5FZF A;  1EP0 A;  4Y1Z A;  3T3Y A;  5L7O A;  1JZ2 A;  3NV3 A;  1RVF 3;  2PN5 A;  3KT4 A;  4HLT A;  3S5A A;  3LGR A;  3M7A A;  2WNU C;  2RJ2 A;  4YYO A;  1G8W A;  4XFH A;  1FI2 A;  3GM8 A;  3MF6 A;  2WSV A;  3U1X A;  2D98 A;  1DQ4 A;  2C6S A;  4B4R A;  4K1Y A;  1SBE A;  3KQ4 B;  1TNR A;  2QQW A;  2VMD A;  5LA1 A;  3O1T A;  2HWC 2;  4TSV A;  4QPG A;  1I5Z A;  1S2B A;  4YSF A;  4W4Z A;  4OHY A;  1IG0 A;  1WMF A;  2UY8 A;  2ZAB A;  4IE0 A;  2GSY A;  4IV3 B;  4HON A;  4CA9 A;  2VCC A;  2N7G A;  1V70 A;  4XFA A;  5GZE A;  5FOJ B;  2H6B A;  3WP5 A;  2IFW A;  2BOI A;  3AX4 A;  4IEW A;  5FZL A;  1PZ9 A;  1E5S A;  4JQR A;  3HWJ A;  4PDW A;  3DUI A;  5HCA A;  2BGO A;  4JDN A;  3ZYB A;  4DZG A;  4AHZ A;  3ACF A;  4I02 A;  5FQ0 A;  4UF0 B;  1RXG A;  4D0Q A;  4NWW A;  4Z2W A;  2R1D A;  2UUR A;  3TNQ A;  1RTV A;  4CZS A;  2HWD 1;  1F8V A;  2Q30 A;  3DL3 A;  3OTF A;  4XFG A;  2X5I B;  5LRR A;  1S0B A;  3H1W A;  2OVU A;  4BJ0 A;  1W3X A;  4MGT A;  3MDP A;  4FTB A;  1NE6 A;  3MHZ A;  5A7W B;  1RUH 3;  3P3P A;  1JXN A;  3B7M A;  2JWP A;  4LBJ A;  1NLR A;  3GDB A;  2BPA 2;  1VR3 A;  2PHF A;  2HH9 A;  3LDK A;  3CF6 E;  1VBB 2;  5FZD A;  1H0B A;  2GC0 A;  4HN0 A;  3K77 A;  1AUY A;  4FOY A;  1UXX X;  4JHZ A;  4W6W A;  2BEO A;  2W87 A;  1K42 A;  4MOA A;  5FOB B;  1XNC A;  5H9S A;  1CX4 A;  1Q8O A;  2B8M A;  2PAK A;  1Y4W A;  5E8A A;  2QQI A;  2QCS B;  5DMY A;  3UT0 A;  2FZ1 A;  3AFK A;  4KH9 A;  1D4M 2;  4EV0 A;  2D97 A;  1AF9 A;  1PMH X;  2EF6 A;  1H8T B;  3I59 A;  3POS A;  3BYW A;  4LTA A;  2DCJ A;  2GC3 A;  1LHV A;  4HSJ A;  3KQR A;  2IFR A;  4BOW A;  1GNZ A;  4Q29 A;  2WO7 A;  4DIN B;  1JZ3 A;  5D8A C;  3IPV B;  4BQ1 A;  2VOW A;  4UFM A;  3R4U A;  4ISR A;  4QM8 A;  1MQT C;  2BBA A;  5DUW A;  5FY8 A;  2HWF 1;  1MZ5 A;  3M3E A;  5FZ8 A;  4IV1 A;  1V6I A;  3S0M A;  3FLT A;  1AR6 3;  4A42 A;  3BPZ A;  1OLM E;  4A44 A;  5GJ6 A;  3JBG 2;  5T55 A;  1ND3 A;  3WQB A;  1K5M B;  1PIV 1;  4RHV 2;  4EWA A;  1E5I A;  4XC9 A;  2WFP A;  5EXO A;  4FI9 A;  4BXS V;  2P4E A;  2Y60 A;  3D5O A;  1YFY A;  1ZA7 A;  3VBS B;  3TEW A;  4GH4 B;  1KDM A;  4I0W B;  1YC6 1;  2HWF 3;  5A6X A;  3WP3 A;  1TE1 B;  4CDX A;  4CEW C;  1C28 A;  2F17 A;  3VUO A;  1X8E A;  3USS A;  4OUL A;  4Y33 A;  1AHS A;  1AL0 G;  3CLP A;  4GAL A;  5LBB A;  2FMD A;  4PF1 A;  3PTR B;  3WW3 A;  3ETQ A;  3WNN A;  1QGL A;  4G4F A;  5DAV A;  4OI4 A;  5DQ0 A;  4YW1 A;  3RQ0 A;  3WF0 A;  3ZXD A;  2TBV A;  3WDV A;  2HWC 1;  1SFP A;  4KGQ A;  4YZ1 A;  3EQE A;  3GJB A;  4BQW A;  1DYO A;  1DG6 A;  5IHR A;  2JKX A;  5L9V A;  1XSQ A;  3SEP A;  1PGS A;  5BUV A;  1A8M A;  1XQN A;  2J42 A;  1HRI 2;  1BBT 2;  5BNN C;  1LJ7 A;  1H9W A;  3WDU A;  1CAU B;  3V64 A;  3VD4 A;  4HAN A;  3E6C C;  3CHX A;  2HWC 3;  5ANQ A;  2YU1 A;  3ZXE A;  5F3C A;  2BVB A;  3OEA A;  5FBZ A;  4UFL A;  5A1A A;  5FRA A;  2NN8 A;  4YZ3 A;  2BP6 A;  5FZC A;  5LAT A;  2J1U A;  4M3C F;  3TEZ A;  3VDC A;  4DUV A;  3DV8 A;  4I3G A;  5FZI A;  4DFS A;  4LO8 A;  3JB8 A;  1ZYB A;  3Q9O A;  5C8C B;  4OUE A;  4QPI C;  4UT5 A;  5FMC A;  2ZJC A;  5CFC A;  5LEJ A;  2GNT A;  1RMU 2;  3HIF A;  4LBK A;  4YVW B;  4HXC A;  1PK6 C;  4M0H A;  3ZFE C;  2ZAC A;  2XJS A;  3BTA A;  2D3S A;  2ZHM A;  2D5F A;  4DXT A;  3RYP A;  2IWG B;  2FDH A;  2WNV B;  4UI9 L;  2D43 A;  1QXR A;  4Z8B A;  2VUD A;  4FOW A;  1XE7 A;  2ZAA A;  2ZEZ A;  1VBB 1;  2JDK A;  1HQN A;  2XKO A;  1GWK A;  3ALQ A;  4Y4Y A;  1ZX5 A;  4E27 A;  5CG8 A;  5FZE A;  4LUK A;  1KD7 A;  3ZXK A;  5I0D A;  2PFW A;  4AI1 A;  2VGD A;  1POV 1;  2PQQ A;  3W59 A;  5DDJ 1;  1DLL A;  1UMI A;  3FHA A;  3FFZ A;  2C9K A;  2RS3 2;  4B1L A;  1MZ6 A;  2GH8 A;  4XUN A;  1W05 A;  5T5J A;  2E7Q A;  4BCU A;  2PQS A;  3KF3 A;  4COZ A;  5FYY A;  3UES A;  2WWS A;  5LY1 A;  5C5U A;  3C7F A;  1UY0 A;  2RVA A;  3WUC A;  2DCZ A;  4XOG A;  1C1F A;  3NAP C;  1W6P A;  3I54 A;  4HMZ A;  4LBQ B;  3UGH A;  1POV 3;  5A7P A;  3K48 A;  4LA3 A;  1NX9 A;  4Q4X 2;  5DDJ 3;  2DVA A;  2DUP A;  4IEV A;  4WM7 B;  1RIT A;  2A73 B;  1OF3 A;  3DKW A;  3AMQ A;  3MIC A;  3VBO A;  4ZKT B;  3IB3 A;  5F2S A;  4A2U A;  1GWL A;  1O91 A;  1UMH A;  1W90 A;  1ZBA 3;  4YW6 A;  5C5T A;  3JBG 1;  4FPO B;  5J96 B;  4RHV 1;  3M4F A;  4TYS A;  3VDD A;  2W5F A;  1BEV 2;  3A21 A;  4I30 A;  5J1X A;  4PIZ A;  3UET A;  2Q0A A;  2VAU A;  5J36 A;  2PHT A;  1OSG A;  1DIW A;  1X36 A;  2CL2 A;  3DF0 A;  2SLI A;  4ZPI A;  3AZX A;  1SDW A;  4MO3 M;  2ZA9 A;  5F5A A;  4OI1 A;  2VTF A;  1YFX A;  3UK9 A;  1WD3 A;  4RGG A;  2C26 A;  3P6B A;  2DU1 A;  4RHV 3;  4F7Z A;  2R04 3;  3MEP A;  1IS5 A;  2WC2 A;  4Z82 A;  4D7Y A;  3LOB A;  4MAD A;  5GAL A;  2ZGS A;  4OFG A;  4N53 C;  3KWV A;  5FP9 A;  1TG7 A;  2AAC A;  3J7H A;  2QE3 A;  2DTY A;  3QCW A;  2VMF A;  4LO4 B;  1AJK A;  2OII A;  2P17 A;  5FYC A;  1ENX A;  3PVN A;  3DYM A;  4AEJ A;  2ZEW A;  1HRI 1;  1BBT 1;  4TLG A;  2Y0O A;  1OH3 A;  1V6M A;  1DF0 A;  1H2N A;  4TXW A;  5BNP C;  1HLC A;  4MXW A;  1G9F A;  1Z7S 2;  2XL9 A;  1W6Q A;  5LA9 A;  5GM0 A;  4CU8 A;  2XLA A;  5A3W A;  4QPY A;  4S2H A;  3U78 A;  5ACA 2;  2OPK A;  5JXG A;  2Q8E A;  3V0A B;  4ZS3 A;  3O1S A;  4XMA A;  1O4Y A;  5IAV A;  4N43 A;  4JDO A;  4XIL A;  1QIQ A;  1I9R A;  4Q5O A;  1W0N A;  4PT6 A;  3FUQ A;  4Q2F A;  4BMB A;  3VDA A;  1RMU 1;  2YBP A;  4QPG C;  5HCB A;  3RGB A;  2W68 A;  3SLI A;  1ACC A;  1LOG A;  1VRH 3;  4LOT A;  2ATF A;  4QQO A;  2QBX A;  3MUZ 1;  1CON A;  3I3B A;  5CNA A;  3MBW A;  5FYT A;  5IVJ A;  1EV1 2;  4DB5 A;  1XE8 A;  3AMH A;  2NMN A;  4YGE A;  1PVX A;  1REF A;  4BU2 A;  4PDW C;  1LED A;  3ITQ A;  4NAO A;  5LBF A;  3QH6 A;  4QQL A;  4D6R A;  5JZG A;  1FT9 A;  1YCI A;  1DGW A;  4C91 A;  3NWK A;  4QX8 A;  5B4X A;  3WF2 A;  5EP9 A;  1LHU A;  2RS3 1;  2ZEX A;  4IET A;  4R4X A;  1RUF 2;  1T2X A;  1S0D A;  2XWJ B;  4QGL A;  5IK7 A;  3WDT A;  1YO8 A;  5GLZ A;  5FYI A;  2DYC A;  4YNI A;  1Q8V A;  1SCR A;  1SLC A;  2VPV A;  1COV 3;  2JG8 A;  2Y38 A;  5EJ3 A;  5F9T A;  3K4Z A;  3L2Y A;  1LB2 A;  3AK0 A;  2WS9 2;  3OGJ A;  2RG4 A;  2P6H A;  1KIT A;  4Q4X 1;  4W65 A;  2P1B A;  2FDF A;  2RS3 3;  2YFU A;  4JGZ B;  3TEY A;  1CAX A;  1ZZB A;  5BPX A;  3AKP A;  3POY A;  3BI3 A;  3J8F 2;  2BJS A;  5AVP A;  3ZN6 A;  2YDE A;  5FY5 A;  2JDY A;  4JCK A;  1PNG A;  4R9B A;  2P3Y A;  4UXA A;  4LPL A;  1V6K A;  4FPL A;  4GZ9 A;  4P9I A;  1BEV 1;  3NJZ A;  4H14 A;  1XU2 A;  3MFC A;  3OYW A;  5FZA A;  1ZM1 A;  2VEC A;  4Q4X 3;  4R9C A;  1W28 A;  1WMD A;  3GCW A;  1CQ9 A;  1UX6 A;  1H9P A;  1W6O B;  4LKE A;  4CU6 A;  2HWB 3;  1DCS A;  1CPM A;  5EFU A;  5FIX A;  4Y24 A;  2OUH A;  2PHL A;  4AR2 A;  5FZM A;  4QT6 A;  1GKB A;  2FHR A;  2XKP A;  4MV2 A;  5FZH A;  1GU3 A;  4FP3 A;  5LB6 A;  4E4Z A;  1OVP A;  2GMP A;  4FT8 A;  3VBR C;  4P14 A;  4N90 A;  5C9A C;  1UZY A;  4L0P A;  1DU3 D;  3HBZ A;  1S55 A;  3OY8 A;  4V1P A;  3WQ0 A;  1YQ8 A;  2WYF A;  2XH6 A;  2VD7 A;  1YIP A;  1LU2 A;  4LBN A;  1W8T A;  3WP6 A;  5JR2 A;  3POJ A;  3ILN A;  4XDP A;  4AI0 A;  1W9Y A;  1KJR A;  2WAB A;  1R08 3;  3HT2 A;  1AR9 3;  2XVL A;  3FHI B;  2D3R A;  1LOE A;  4HVR A;  1Z7S 1;  1HQL A;  3PUR A;  1ST8 A;  2VJX A;  3SCF A;  2W94 A;  3KCX A;  4CUC A;  5A3O A;  5A3M A;  4BPZ A;  2G1M A;  5ACA 1;  1RUC 2;  2ZAH A;  3WHT A;  5DUX A;  4CEY B;  4E2Q A;  4K3U A;  1B35 B;  4CXY A;  2V72 A;  1NAE A;  4NIA A;  4AOC A;  3M8L A;  1QJZ A;  1RJ8 A;  2GP5 A;  1VBC 2;  5T50 A;  1Z7S 3;  4HVO A;  4MLO A;  3KVB A;  3H8R A;  3ZYP A;  4EN7 B;  1HIX A;  2CTV A;  2ZX3 A;  4DMI A;  5F7U A;  1AR8 2;  2D6O X;  5L73 A;  5A1F A;  3POI A;  4MXV A;  5BXX A;  1JZ7 A;  2Q1F A;  2C24 A;  1EV1 1;  1RUD 2;  5J48 A;  4QHZ A;  4BK4 A;  1GQH A;  1K12 A;  2VU9 A;  3LPF A;  1PZ8 A;  3III A;  4NRM A;  4U2A A;  2K2S A;  3M2M A;  3ROU A;  4DXS A;  5APA A;  5JDB A;  3P3N A;  4AGR A;  3THP A;  3BTZ A;  1DHK B;  1WZX A;  3U0Z A;  4LLF A;  3KCY A;  3ES4 A;  5D21 A;  2WNU A;  3RVH A;  3K46 A;  5KHI A;  1EV1 3;  3WNX A;  2FZ2 A;  1RUF 1;  2ZX4 A;  1XNT A;  5FWE A;  3EMR A;  4XHX A;  4Y1V A;  5F3G A;  2XON A;  4CP1 A;  1WCQ A;  2C9A A;  1RUG 2;  1JI6 A;  3VBH B;  5CFC C;  3NRU A;  1LR5 A;  3ILR A;  1ULC A;  3EBR A;  3KGZ A;  5FXW A;  1HRV 3;  2WS9 1;  1XNA A;  3ZSK A;  2VZV A;  3ZXA C;  2QQJ A;  2D6K A;  4LK6 A;  5J3U A;  3HNM A;  1QU0 A;  1UOF A;  1RIN A;  4AVS A;  3J8F 1;  2QQV A;  5F2W A;  2IXL A;  4FFH A;  4NRP A;  5BNQ A;  2BER A;  4E8C A;  3KS7 A;  2QQO A;  1Y9M A;  4YM1 A;  5CZK A;  3HBK A;  1ND2 B;  4NHM A;  1AVB A;  3N9P A;  3LPG A;  3AP9 A;  3IDE A;  2GN3 A;  4CEW B;  4CPB A;  1XYP A;  3J8F 3;  3VL9 A;  3HJR A;  5IWF A;  2DF7 A;  4EN9 B;  1PO2 2;  1N3O A;  1N3Q A;  2J1S A;  3EJK A;  3N7J A;  3PME A;  3BKZ A;  5A32 B;  3KZ4 C;  4FPF A;  3PUH A;  3D0S A;  4XXP A;  1GZW A;  4EJR A;  1ZBE 2;  1F9K A;  2D5H A;  4I0A A;  1TEI A;  2ARC A;  4K9S A;  5CEH A;  1POQ A;  3ST7 A;  3VBO C;  4UFK A;  4CCK A;  4HET A;  1R1Z A;  2VME A;  2VZP A;  3E6B A;  3ZSJ A;  1Q8Q A;  1GSL A;  4Z1V A;  4K8R B;  1WCU A;  4YPJ A;  4P5H A;  4JX0 A;  1YXW A;  3JU9 A;  4YWA A;  3ZIW A;  4B29 A;  1OA3 A;  4UBG A;  3W5M A;  2WT2 A;  1ULF A;  1V6N A;  1L7L A;  1W9T A;  1HV0 A;  4BA6 A;  1NUK A;  4P9X A;  2ERF A;  3T08 A;  1IPJ A;  1XE0 A;  2OZ6 A;  2DCT A;  2W0X A;  1RUC 1;  3ZPO A;  5JCT A;  2XVK A;  3AZW A;  4DRR A;  3J7N A;  4XFB A;  4XJ8 A;  4WVM A;  4LUM A;  4ZXE A;  4A3X A;  4HVQ A;  3ZYG A;  3RZH A;  3S57 A;  2QTW B;  2J1V A;  4MHR A;  4P5Y A;  1JYX A;  2X29 A;  2O0O A;  1OLR A;  1VBC 1;  3IAQ A;  2XQR A;  5H9Q A;  1WKY A;  2JG9 A;  3I2I A;  4IDZ A;  3SCH A;  1GOH A;  3GJA A;  3WR0 A;  2Q1Z B;  4LBO A;  2VVD A;  3WG4 A;  1LRH A;  1X82 A;  3CDZ B;  1AR8 1;  1RUC 3;  5FO8 B;  2R0H A;  2GH2 A;  1MQT A;  4Y1U A;  4AVT A;  5CG9 A;  5D1I A;  1RUD 1;  2E53 A;  2ARE A;  4XF1 A;  3OGG A;  4B1M A;  1VBC 3;  3LZZ A;  2XUM A;  4L97 A;  2UWC A;  1QWR A;  4CRQ A;  1AYM 3;  3H9A A;  2GP3 A;  1QJU 3;  1WBL A;  4IEO A;  1FV2 A;  3W9A A;  5FZ7 A;  4XQD A;  2OA2 A;  3A22 A;  3N3H A;  5CKM A;  5FFO C;  5LZ6 A;  3U4X A;  4QMA A;  4N43 C;  4XTP A;  3FBM A;  1RUD 3;  2WA3 A;  2WZR 2;  4XBL A;  4SBV A;  2RR1 3;  4LLO A;  4XIO A;  2ZXQ A;  1VBA 2;  4CP2 A;  2Q4S A;  1XB9 A;  3IBM A;  3WV6 A;  1RUG 1;  1YI9 A;  1OA2 A;  1S0F A;  3JQW A;  3AL6 A;  5EPA A;  5M0T A;  5DPN A;  1HN1 A;  2MHF A;  4OUS A;  4XMI A;  5FZ1 A;  1MZE A;  2JEN A;  3ZFG C;  4PQQ A;  3I2H A;  4AHY A;  2L9L A;  4FAG A;  2W1Q A;  2DVD A;  3EO6 A;  1DQ6 A;  3CJI B;  2WR9 A;  5K0U B;  5BNN A;  4BWO A;  4PIX A;  2AUY A;  1WA4 A;  2VCM A;  4K20 A;  1RUI 2;  3GHM A;  3U07 A;  1WW4 A;  3WDX A;  2VQU A;  2YC0 A;  3BVC A;  5JZG C;  2W91 A;  2JX9 A;  4RFT 0;  5F6L B;  3T09 A;  2YV8 A;  2WQ8 A;  4FCA A;  3HNY M;  1VBE 3;  4EN8 B;  5FZ4 A;  2B9U A;  1PO2 1;  2XOM A;  4RFR B;  4O65 A;  1HJG A;  5C4W C;  4MGI E;  3NNL A;  3WIN E;  2LM3 A;  3GBW A;  4CDQ B;  4QPI A;  3C7G A;  4N53 B;  5F32 A;  2YBS A;  3ZFE A;  1PK6 A;  2AYH A;  1NLQ A;  1ZBE 1;  1L7R A;  4JKL A;  1JS9 A;  3ZDS A;  4WV8 A;  2ZMN A;  4AED B;  5J09 A;  2CWM A;  1YFU A;  2VNG A;  2B39 A;  3VKN A;  4RQP B;  3A0N A;  5FK8 A;  1VAV A;  2WFF 3;  4GA9 A;  5DG1 A;  5ISL A;  2PA7 A;  4LBQ D;  5L7O B;  1XXN A;  4AHW A;  1R64 A;  2RM2 3;  3C7E A;  4XAC A;  5FP7 A;  4CCC A;  1MVE A;  5L19 A;  4LOR A;  3JD7 1;  4LA2 A;  5B2G B;  1RUH 2;  3U4S A;  3DPR C;  1FYU A;  3FFQ A;  1WME A;  3N7L A;  5FYM A;  4QKD A;  4Q0Q A;  3HN1 A;  5G04 L;  1QY4 A;  5J7M A;  1LEN A;  1NQJ A;  4Q4Y 2;  2BYV E;  1K3I A;  1YEW A;  2GDF A;  1GR3 A;  1UCX A;  1TMF 2;  5CFD A;  3I2O A;  1QJY 3;  3PDQ A;  3JD7 3;  4QPG B;  3AKQ A;  3H3U A;  5IYY A;  3NAP A;  1VB4 A;  2BNM A;  2ZOE B;  3E1F 1;  2Y6H A;  4TTG A;  3TNP B;  4N9I A;  3H0O A;  3LD8 A;  3IMN A;  2IC1 A;  1X33 A;  1AYN 3;  1UY2 A;  2BZD A;  3T2O A;  1UF2 C;  4R52 A;  2RS1 2;  3C2U A;  4KWL A;  3MW2 A;  2WJS A;  3B93 A;  3TOJ A;  4NHL A;  3WLU A;  4PDW B;  1ZZC A;  1LOF C;  1GOG A;  4BH9 A;  3KM5 A;  1C5H A;  2VXJ A;  2BDR A;  2A6Z A;  5FQ0 B;  3ECQ A;  2ES3 A;  4WVV A;  2RS5 1;  5DAP A;  2FMY A;  4LE4 A;  1IGO A;  1CIY A;  4BQ3 A;  2WZR 1;  4EWD A;  4EQV A;  1AR6 2;  2UYB A;  2HEW F;  2ARB A;  2D7F A;  1RHI 3;  1QXP A;  1VBA 1;  1W06 A;  2GZW A;  4YW3 A;  4BQ4 A;  3U75 A;  2XJP A;  3MV0 1;  4AEM A;  3BTY A;  1KFU L;  2F4P A;  1VP6 A;  2RS5 3;  2HWF 2;  5EZW A;  1NQD A;  4XDO A;  5FY1 A;  5GZD A;  3SH5 A;  5FY4 A;  1QOO A;  2J1R A;  1SLL A;  4AQ2 A;  1PHM A;  5JSR A;  3WNM A;  1W2N A;  4NN0 A;  5BNP A;  5I8Y A;  4JTN A;  1RUI 1;  4TWT A;  1ENS A;  4R9D A;  5FMD A;  1YJL A;  1MS9 A;  2HWE 2;  2WKK A;  1JUH A;  4QHO A;  3TBD A;  5KHK A;  3VKL A;  3WF1 A;  5A1L A;  3B69 A;  1ASJ 3;  3RYR A;  1LOA A;  4HG6 B;  4YG6 A;  2ET1 A;  3I59 B;  2VBP A;  4AVA A;  2JDN A;  2A5Z A;  2CHH A;  5A80 A;  4BQ5 A;  1QXJ A;  2XLG A;  4CCL A;  1C3H A;  1RUI 3;  4LIU A;  4RD7 A;  4XF9 A;  4DS0 A;  2HYX A;  1SPP A;  3FLR A;  4YGC A;  5A7Q A;  5HI0 A;  2VE1 A;  4OHZ A;  3KD4 A;  4GMP 0;  5FY0 A;  1FAT A;  3A23 A;  3SHR A;  4XJU A;  3WDY A;  4IEQ A;  4IV1 B;  1NT0 A;  1EY2 A;  2LRO A;  3USU A;  1NZC A;  3H8U A;  3QLQ A;  3I49 A;  4FSJ A;  3UL2 A;  4CVU A;  1ND3 B;  5GZG A;  2A6V A;  2VG9 A;  3RWK X;  2NP0 A;  1W2U A;  3NST A;  1SG3 A;  3OD4 A;  2ZKN A;  4EWE A;  4ASM B;  5JI7 A;  2MNG A;  2P3J A;  4FOQ A;  4QKF A;  1RUN A;  5T54 A;  1CR7 A;  4QB6 A;  1UU5 A;  1JZ5 A;  3D0J A;  2PTM A;  4J25 A;  4C0H A;  4A7Y A;  2A70 A;  1RUH 1;  2V4A A;  1QMJ A;  3DYP A;  3DGT A;  5DXD A;  2Q8D A;  4CDX B;  3WG3 A;  4DEV A;  5FWJ A;  5IAT A;  3Q8E A;  4YW4 A;  1BCX A;  1YLL A;  2VO5 A;  1WW6 A;  3IAP A;  4FPY A;  4YGD A;  5FDB A;  3AKT A;  2XBO 3;  5FZO B;  4NE9 A;  4Q4Y 1;  1V0A A;  3PNA A;  3GF6 A;  1TMF 1;  2VZQ A;  3K2O A;  3PLQ A;  2GNM A;  5FP3 A;  4AI3 A;  1J59 A;  5FPB A;  4HL0 A;  4M4P A;  1RED A;  5AFE A;  2EIE A;  1FMD 3;  2FQP A;  4HFS A;  1AXZ A;  3K4D A;  4HOO A;  1OFS A;  3PHM A;  3NKT A;  5J98 B;  1VAM A;  4C1X A;  2W1S A;  1L7Q A;  4FPJ A;  4Q4Y 3;  5KC5 A;  2RS1 1;  5E16 A;  3ZMO A;  5JAX A;  5EIY B;  1TMF 3;  3T1M A;  5F1R A;  1SZB A;  1HXS 3;  3NO8 A;  2A6W A;  2RDQ A;  5L9R A;  4ZHN A;  4H7L A;  2DV9 A;  2RJL A;  1O59 A;  1G7Y A;  5DDJ 2;  5T3N A;  2A3Y A;  5HV0 A;  2XGX A;  3RI8 A;  2FCT A;  1GWM A;  3O0X A;  4LHL A;  1CAV A;  2WNO A;  5T5P A;  4BIO A;  5FYS A;  1O8S A;  1AR6 1;  1OBN A;  1W2T A;  1ZBA 2;  2RS1 3;  4AWD A;  4OI0 A;  2DFC A;  2IXH A;  2JDU A;  3AZZ A;  3FC0 A;  4B7E A;  4Y3O A;  5CFC B;  3J7M A;  2JG9 C;  4Y4R A;  1DDL A;  4XAA A;  4QXK A;  2A3W A;  1CGP A;  3VBR A;  3LKJ A;  1JTZ X;  3VBF C;  4ZY9 A;  5C9A A;  1S0I A;  5FK7 A;  1FNY A;  2VNR A;  1ZZ9 A;  4NIG A;  1BZW A;  2Q8C A;  1OFN A;  1IZ3 A;  5CA6 A;  1NA1 B;  1GQG A;  1X7N A;  1AXY A;  2Y0I A;  2WBK A;  2R04 2;  5JXJ A;  4GQ7 A;  2D6P A;  2ZGT A;  4D7S A;  1QEX A;  4GAZ A;  3ZYJ B;  1RUE 3;  5A6Q A;  1XNB A;  3WNL A;  2HWE 1;  3B02 A;  4HN1 A;  5F5C A;  5FV3 A;  1UMZ A;  3K75 B;  3J26 N;  1T6B X;  4QQH A;  3WQ1 A;  2RMU 3;  1G9C A;  1RUJ 1;  3LA3 A;  4XEZ A;  4KWU A;  2RE9 A;  1JU3 A;  3N4M A;  3AP7 A;  1CX1 A;  3LEI A;  2HKX A;  1N1T A;  3BIE A;  4LIT A;  1W6P B;  3OCP A;  2PAM A;  3I3D A;  3B94 A;  2RHP A;  2HWE 3;  3D4K A;  3ZKY A;  2W46 A;  1RB8 G;  5F5Q A;  4D8M A;  3OGR A;  1NKG A;  1UYX A;  5T5O A;  4XFI A;  1RUJ 3;  1S2K A;  3CMG A;  3HEI A;  2QNK A;  5FZ3 A;  1F35 A;  1FX5 A;  3VDD B;  2KR2 A;  3OBR A;  4P02 B;  2G9F A;  3WF3 A;  3DXT A;  2V5Y A;  1H2K A;  2OPW A;  4HK8 A;  1FNZ A;  3C7O A;  4CCN A;  1OT5 A;  1XYO A;  3NV1 A;  1VRH 2;  3H8X A;  4QDQ A;  1WLW A;  4HBN A;  1B09 A;  4ARX A;  2OXB A;  3NV2 A;  1NCQ A;  1KDK A;  5B4N A;  3A4U A;  2YGM A;  4RR3 C;  1UOB A;  4QX0 A;  2DVF A;  3WW4 A;  3CU7 A;  5CVR A;  4NO4 A;  3PIJ A;  3KHB A;  3M70 A;  2H0B A;  5L36 A;  3AVS A;  1UYY A;  1YUD A;  3T2P A;  5KXC A;  2J1A A;  4NUB A;  3S30 A;  3PL0 A;  2MEV 3;  1GFF 2;  1US2 A;  4QPW A;  5HXM A;  3AJZ A;  4FPK A;  3PVB B;  4ISQ A;  1UYZ A;  5DG2 A;  2CV6 A;  2JDH A;  4GJY A;  5FBJ A;  4WM8 A;  4WVZ A;  1UNB A;  3T0B A;  5FZ9 A;  1QDO A;  5A70 A;  3LFM A;  4MXW B;  2OX0 A;  2EAA A;  2CGN A;  1COV 2;  3HMY A;  1W6Q B;  2FCU A;  2CU5 A;  1DGL A;  1JOB A;  2VVE A;  3KCC A;  4GWJ A;  3VD7 A;  4XFC A;  1OQD A;  2BTV C;  2W9X A;  5K7P A;  1C8N A;  2JXA A;  3WQ7 A;  4KNC A;  2VM9 A;  5F3I A;  2KXL A;  3P1I A;  5IVY A;  3POG A;  1W39 A;  1AJO A;  1DGR N;  1VLN A;  2QQU A;  4N43 B;  4LNV A;  1OKO A;  3W21 A;  1IOA A;  1OA4 A;  1QH7 A;  3U11 A;  4OCT A;  4ERO A;  2VOT A;  1ZBA 1;  1JN2 P;  1W8W A;  2OQ7 A;  3FL7 A;  3MIE A;  2Z4F A;  4LBM A;  2AEY A;  4YZ5 A;  5CFD C;  1G9D A;  2EXK A;  2E63 A;  2ID4 A;  3IMM A;  2WAO A;  2BVV A;  1OQ1 A;  3TAY A;  3I2F A;  2RDN A;  1VE0 A;  5FKB A;  5EV7 A;  4JAA A;  1W0P A;  1G9A A;  3HNB M;  4E9K A;  1MZF A;  5A7S A;  2HWB 2;  1DQ5 A;  5A3P A;  1A8D A;  1JOP A;  3T30 A;  4DY3 A;  3I3Q A;  4ZU5 A;  3VBS A;  2EAK A;  1HB4 A;  1N3P A;  3OPZ A;  5TSW A;  2R04 1;  2YFZ A;  2E33 A;  2WRA A;  4QU2 A;  4FAH A;  5IVE A;  2WL1 A;  1QQP 3;  3PUI A;  3O0W A;  4MH0 E;  4MGK E;  3PJQ A;  2WT1 A;  4D6S A;  1OH4 A;  2ADE A;  4LOS A;  2VBB A;  1UY1 A;  4BQX A;  1LGB A;  1CJD A;  3VBU C;  2VUL A;  4K7J A;  1XPW A;  2NMO A;  2I45 A;  3LDB A;  1WWY A;  1N47 A;  1N1S A;  1R08 2;  3ORJ A;  4RA0 A;  1AR9 2;  2JG8 B;  5BNO C;  1Q8S A;  3VLB B;  5FMO L;  3WY6 A;  4YFW A;  2AC1 A;  3A0K A;  1OMI A;  1U5Y A;  2VH9 A;  1CAX B;  3FZ3 A;  3NNJ A;  3BOW A;  3NJX A;  3ZN6 B;  2OT7 A;  3B9I A;  4GMP 3;  1GQP A;  1H2M A;  4KU7 A;  5CB7 A;  5DN2 A;  4QDR A;  4XF3 A;  2JIG A;  3RWN A;  3R0R A;  1J83 A;  4IEZ A;  1QDC A;  1AX2 A;  3CNA A;  4XJZ A;  1OF4 A;  4CSW A;  3OYW B;  4RS5 C;  1PVC 3;  5LA2 A;  2LUW A;  2VNO A;  4XQ4 A;  3NMB A;  1VRH 1;  4JRA A;  4XUT A;  1HB2 A;  3JXS A;  1R09 2;  2EVX A;  4YAR A;  4C1W A;  3VHP A;  1YQ6 A;  3RJ2 X;  2W1W A;  1XOY A;  1K45 A;  3E97 A;  3NKG A;  4OVE A;  1CZT A;  3KV6 A;  2JIC A;  5FMO S;  4AQS A;  2WNV A;  4K1Z A;  1OLQ A;  4YFZ A;  2WO2 A;  4HSL A;  4I01 A;  3ZOI A;  2GND A;  3MGU A;  3OY8 B;  1UYP A;  4JC1 A;  2ZEY A;  3CKH A;  4N7U A;  3ACH A;  4B3N A;  1HDK A;  1S2E A;  3SNM A;  3ZFG A;  1YIF A;  5EJ1 B;  1OUS A;  1LHO A;  3BAL A;  4QXH A;  2UWA A;  1XC6 A;  2A75 A;  3DN7 A;  3MUY 1;  3VZK A;  1LEM A;  4AFM A;  3AB0 A;  3AKR A;  2JEM A;  2W39 A;  2D6M A;  4XZP A;  5IT6 A;  5IUQ A;  2BUK A;  3T2T A;  1W04 A;  1COV 1;  3SH3 A;  4AG4 A;  2BV4 A;  2GC2 A;  3TEX A;  2YMZ A;  3DEM A;  1HRV 2;  4IEX A;  1QH6 A;  1W9W A;  2P3I A;  1LGC A;  3EYP A;  3M1H A;  1WW7 A;  2HYK A;  5ABJ C;  3ZN5 A;  2XB6 C;  3POF A;  1GV9 A;  4D69 A;  2Z69 A;  1FPN 2;  3J9S A;  2JDA A;  5JOX A;  1JMU B;  2E31 A;  4QKN A;  5C4W A;  1OI6 A;  3NJV A;  5JOZ A;  2ORZ A;  4E2S A;  4YW2 A;  4XE9 A;  5KHJ A;  4AE2 A;  5FY9 A;  1E5R A;  3I2J A;  3DEC A;  3H1M A;  4NPL A;  4ATE A;  1JHJ A;  1A6C A;  4CDW C;  1HV1 A;  1ULE A;  5FYU A;  3OUI A;  1D2S A;  4IGO A;  4P9G A;  2OKX A;  1BXH A;  2HWB 1;  4FQZ A;  2V5D A;  1OPO A;  2EIC A;  2ZGQ A;  2B42 B;  1EPW A;  4E4S A;  4EN0 A;  1GNY A;  1PX3 A;  1UN1 A;  2AGS A;  2J7M A;  1V9U 3;  1I6X A;  2DFB A;  1UX7 A;  1WBF A;  3HN3 A;  1RUO A;  4WZF A;  2VXR A;  3MW3 A;  2JJ6 A;  2WNU B;  2CSG A;  2WT0 A;  3DPR A;  4QXB A;  4RSU A;  5EQU A;  2GN7 A;  1JZ6 A;  3D3A A;  4F3J A;  2PYT A;  2IXC A;  1R08 1;  5KXB A;  1I3H A;  1AR9 1;  3MIF A;  1GLH A;  1W6N A;  3CEW A;  3DKQ A;  4Y1X A;  4WVW A;  3H8O A;  1JW6 A;  4CDU C;  1UU4 A;  2DVB A;  2W92 A;  4QX2 A;  5E6H A;  1UD1 A;  1H8V A;  1ZVF A;  4W6X A;  3ETP A;  1ZRD A;  1EPZ A;  2WWJ A;  3N9L A;  1SDD B;  4LHK A;  4XHB A;  3POW A;  5JVV A;  1UW8 A;  2VOV A;  1AL2 3;  2VTX A;  1GP4 A;  4JGY A;  5LY2 A;  2VUA A;  3T1L A;  5A7O A;  2WWU A;  1LOF A;  1SCS A;  3SQO A;  1PGL 2;  4EZH A;  1DYP A;  4I3P A;  3ZSM A;  4AFD A;  1UWW A;  5DAW A;  3JB4 C;  2E6V A;  2XPJ A;  1R09 1;  2ORX A;  2BU9 A;  2O1Q A;  2D6N A;  1BVP 1;  5A3U A;  4NID A;  2GC1 A;  2HLE A;  2R07 2;  1DZQ A;  4GB3 2;  4QD2 A;  5FPU A;  4QX1 A;  3FX3 A;  1KGY A;  1UKR A;  1S0C A;  1I5P A;  4FP2 A;  1GZW B;  4IV3 C;  1DQ2 A;  1AYM 2;  4ZS2 A;  2QQM A;  3T2Q A;  3ELN A;  1QJU 2;  2VVF A;  5JSO A;  1JOJ A;  4PLN A;  3UYJ A;  4UOJ A;  5IK4 A;  1CAW A;  1R09 3;  4M4R A;  1DYK A;  1UL9 A;  2X10 A;  3TB0 A;  2HBT A;  1YWK A;  4J6G A;  5A3L A;  4LKS A;  4UAP A;  3HT1 A;  1JOD A;  1O4T A;  2RR1 2;  3E6D A;  2WQ4 A;  3FLP A;  1UOJ A;  2P5B A;  5FPZ A;  4WZC A;  3ME2 A;  1VJ2 A;  3THD A;  1J84 A;  2X5I C;  1HRV 1;  3NNM A;  2E7A A;  4BDV B;  2PLV 3;  1OQE A;  1N1V A;  4GD4 A;  3NJY A;  4OZO A;  4LKD A;  1NCQ C;  5F6K A;  1WUV A;  1DLC A;  4WVM B;  1FPN 1;  3ZFF A;  5JSP A;  2YU2 A;  4MGQ A;  5DAB A;  4MX3 A;  5LK7 B;  2YPD A;  1Y7B A;  3JZV A;  1LGN A;  4XPV A;  1W99 A;  2WLQ A;  3VHN A;  1ZRR A;  2AEN A;  4KI5 M;  4CUB A;  2JG9 B;  1BMV 2;  1W0O A;  2VMH A;  5IVF A;  4LIV A;  5HXV A;  4K6B A;  4IE6 A;  3OD0 A;  5D8A B;  3GZA A;  3EHK A;  2OZJ A;  4A3Z A;  1P8J A;  5JMC A;  1KEX A;  5IJR A;  1MQT B;  2PHU A;  3ACG A;  1FPN 3;  1VBE 2;  4LHS A;  1H1A A;  4WM8 C;  1NCR A;  1QKQ A;  1Y9G A;  3A7Q A;  4AFB A;  2QQL A;  4RGA A;  1EAH 3;  3DXU A;  4FFF A;  4OHV A;  1ZZ7 A;  1TME 2;  4IGP A;  2R06 3;  4R8H A;  4TLF A;  1S0E A;  1H8T C;  1LOB A;  2RDR A;  3GCX A;  1GBG A;  1Q8P A;  1O3S A;  1JYC A;  2R1B A;  5I93 A;  1WCD J;  1HQW A;  1FOD 3;  3AMN A;  1BLZ A;  4UW3 A;  3P5B A;  1OKQ A;  2WN3 A;  2YC2 A;  3RZM A;  1PO1 3;  5DZE A;  4Z2A A;  2B45 X;  2WFF 2;  5A33 A;  3EXU A;  1OPM A;  2GAL A;  1QNY A;  4KU8 A;  5DAX A;  5BYN A;  1H1I A;  2XLF A;  2RM2 2;  2ZGP A;  5AVA A;  1BK0 A;  3NQH A;  4CCJ A;  4LBL A;  5KHH A;  3AXE A;  1K5M C;  3RZZ A;  3AP5 A;  2PHX A;  1VBD 3;  3LOI A;  3ZN4 A;  3VD9 A;  3ON7 A;  1T6G C;  4OUM A;  3T4H B;  4FVV A;  3VBS C;  4CP0 A;  5JPN B;  4GH4 C;  5BNN B;  1KS4 A;  3N9Q A;  5FYV A;  4BK5 A;  4COU A;  1FXZ A;  2YC4 A;  2D44 A;  2YBK A;  1QJY 2;  1OOP A;  3QOP A;  3JD7 2;  5E89 A;  5JMO A;  1O3Q A;  2JB8 A;  1PGL 1;  1WLD A;  3ZIX A;  4YVS A;  3FWE A;  3TYJ A;  4IE4 A;  2WDB A;  4IGQ A;  4Q1R A;  1SMV A;  2ZBJ A;  4PI2 A;  1UQX A;  5K9Y A;  3MZH A;  5EYY A;  3B00 A;  2ZGO A;  1AYN 2;  2R07 1;  1AR7 3;  1GMM A;  1W3V A;  2WNE A;  4GB3 1;  5ERL A;  4QPI B;  4IE5 A;  4Q0U A;  3LF7 A;  3T4V A;  3Q8A A;  5DZF A;  3GHN A;  3ZFE B;  1PK6 B;  2ZCW A;  1AYM 1;  2NPI A;  3CIH A;  3ZXF A;  4D94 A;  1QJU 1;  4PJY A;  2QJV A;  1DZR A;  4GJZ A;  4JHT A;  5FMB A;  3VBF A;  3BU7 A;  1YI7 A;  4XJW A;  1MVQ A;  3JQX A;  1TNF A;  1XU1 A;  1BQP A;  1OXC A;  2E9Q A;  2YZ4 A;  3F2Z A;  2TNF A;  2R07 3;  4GB3 3;  4Q4W 1;  3RSJ A;  2DUO A;  2RR1 1;  4D3W A;  1RHI 2;  2DU0 A;  4LEJ A;  1PX4 A;  1PNF A;  1ENQ A;  1CZV A;  2H6C A;  2OQ6 A;  5C3Q A;  5CAD A;  1S1A A;  4Y22 A;  5C8C C;  2B46 X;  4NHY A;  5FPV A;  2Y6J A;  1V6O A;  3FJS A;  1O6U A;  2ZGR A;  3OGS A;  4YVW C;  3VBH A;  4B4Q A;  4CUA A;  2RS5 2;  4LKF A;  4ORF A;  2YGL A;  3SKV A;  2GME A;  5KR7 A;  3OOX A;  3AFG A;  4Q4W 3;  4JKM A;  5FLJ A;  4AK3 A;  2WQZ C;  1W03 A;  1G86 A;  5C3R A;  2VZT A;  1BYH A;  2WNV C;  2WUH A;  4AI2 A;  5A6Y A;  5CFD B;  1BHG A;  3BPS A;  4Q0S A;  3GZE A;  5C8W A;  5CAZ A;  2TEP A;  1JHN A;  4QX5 A;  4URA A;  3LSE A;  4XDQ A;  3NAP B;  4NIH A;  5CKQ A;  3AP4 A;  2W2I A;  2XL7 A;  1STM A;  3TRS B;  1QJX 3;  3ENR A;  4E8D A;  4LR4 A;  2QZ3 A;  2C0Z A;  3LIG A;  1ASJ 2;  2ZGU A;  1JBC A;  3VZO A;  4MET A;  1VBE 1;  1NYW A;  2QQK A;  4BM8 A;  2JDM A;  1LTE A;  4BIF A;  2Z79 A;  1D2Q A;  2HJI A;  1ZRF A;  2HEY F;  3B01 A;  4YRD A;  1CIW A;  1TME 1;  1W9S A;  2WA4 A;  3OF1 A;  3RFR A;  1LCL A;  2ZGK A;  4JKK A;  2P2K A;  1OD3 A;  4IW3 A;  1HB1 A;  5A32 A;  5FP8 A;  2R0F A;  3UNP A;  1IS3 A;  2QZ2 A;  4P9Y A;  3SEE A;  5F37 A;  4AI8 A;  3BUC A;  2WFF 1;  1PMJ X;  5LAS A;  1TME 3;  3TN9 3;  1PGW 2;  3KV4 A;  4RR3 A;  2TUN A;  4CP9 A;  4FTS A;  3SIT A;  2VC9 A;  4YG0 A;  2RM2 1;  5C71 A;  5EWS A;  1MR5 A;  3KF5 A;  4NAM A;  3LA2 A;  4Q0P A;  1W6M A;  4XFF A;  2A6Y A;  5FKC A;  1APN A;  3ZO0 B;  4I0B A;  4Q8K A;  2KA3 A;  1UPI A;  3CZJ A;  5FXZ A;  3WG1 A;  1IQD C;  2ARA A;  3UJQ A;  1LHN A;  2VOK A;  1CZS A;  1OUR A;  4H55 A;  3QH7 A;  2XBO 2;  3UKN A;  4CCM A;  1KRI A;  2NQY A;  4EE2 A;  3AL5 A;  4NR1 A;  5BNP B;  4NOT A;  4IL7 A;  5CU1 A;  1QJY 1;  3OSD A;  2OS2 A;  4P00 B;  1ULP A;  2KM2 A;  4OZX A;  4GXL A;  5LBE A;  1FMD 2;  3R4S A;  2P3K A;  1AYN 1;  3W5N A;  1RL3 A;  5CKN A;  2ZX2 A;  1UO9 A;  3T0D A;  3DYO A;  4COW A;  1HXS 2;  1SPP B;  1VMF A;  2FDJ A;  1M4W A;  2JDP A;  3GZU C;  3IWZ A;  5FUP A;  1HX6 A;  3ASI A;  3M3Q A;  4Y5Z 0;  2J1E A;  5FRE A;  2R6Q A;  3PMS A;  3K51 A;  4UFI A;  3ZX7 A;  5JXH A;  1CVN A;  1NLS A;  3USU B;  3VKO A;  4QX7 A;  1R1A 3;  2DCK A;  3ZYI B;  4HPK A;  2Q5T A;  1LES A;  3CQO A;  4JGY C;  1RHI 1;  4Y5T A;  2AZ5 A;  2VZU A;  4JRL A;  2J22 A;  4PIY A;  1GZC A;  4JTO A;  3T0A A;  2AH2 A;  3EB7 A;  1J3P A;  4AYU A;  1CPN A;  4MGZ E;  3VN4 A;  2IUW A;  4LHN A;  2VZR A;  4OHW A;  3VBU A;  4UWD A;  5A7N A;  4X6R B;  2W52 A;  4ZZ5 A;  1MPX A;  4QB2 A;  4SLI A;  5CBL A;  1MS0 A;  3LDR A;  1F2N A;  4QDS A;  4N9H A;  2YB7 A;  4FPH A;  5JIU A;  5BNO A;  1LOC A;  2QDR A;  1BK1 A;  5BV6 A;  1Y3T A;  4FQ4 A;  4M0N A;  4Q27 A;  4ZON A;  5FUN A;  3MYX A;  3G6J B;  4AQT A;  1RUE 2;  2ENR A;  2BQP A;  4NPR A;  4O9G A;  3AMM A;  1UZ0 A;  4ZXK A;  3SH4 A;  1ODM A;  1ASJ 1;  4L9B A;  4KG8 A;  5FTT C;  2PMW B;  2RMU 2;  1IS4 A;  2XDV A;  1WCS A;  1GZT A;  4HKW A;  3OGV A;  3K3N A;  3N9M A;  5ANN A;  3WX5 A;  1D4V B;  1UXZ A;  2Y6G A;  2CDP A;  4W6Y A;  1XYN A;  3KV9 A;  5H9P A;  3KV5 A;  1H4H A;  1ULG A;  3B9C A;  4P9W A;  2JB4 A;  3J4U H;  4YZ4 A;  3S7I A;  4RS5 A;  1MS5 A;  1TZO A;  3UJO A;  3AZY A;  5DZG A;  1REE A;  2LAL A;  4CDQ A;  3RMX A;  1JU4 A;  1CAV B;  4FPE A;  3O12 A;  3ZFF C;  1RUJ 2;  1ZNP A;  4WBB A;  1JZ4 A;  4URT A;  4JGZ C;  4XAE A;  4ASL A;  5FYB A;  5C33 A;  1PGW 1;  3O14 A;  2Y6K A;  3E5Q A;  3WVJ A;  3VBR B;  4BHP A;  4JQT A;  4D7T A;  3OEB A;  5C9A B;  2OW4 A;  5AC9 1;  2D40 A;  4C8D A;  1UY3 A;  1WW5 A;  1F4A A;  2JIJ A;  1F4H A;  5GKA C;  5JOW A;  1NE4 A;  3RZL A;  4FPC A;  4AZZ A;  5IVV A;  1WLC A;  4OLL A;  1J1L A;  1NCR C;  4N7I A;  1ULD A;  4PI0 A;  2Z2S B;  2P37 A;  2CGP A;  1E57 A;  2Y6F A;  4FTE A;  2XBO 1;  2VZ1 A;  1AXK A;  2XUE A;  3J7L A;  3V56 A;  4BLJ A;  5K8S A;  4YM3 A;  3BGA A;  4PBP A;  2Z42 A;  1IHM A;  4HZF A;  4Y20 A;  5FZ0 A;  5AC9 3;  5IVC A;  2ET7 A;  3U37 A;  4XYX A;  3ZDV A;  3ZXG A;  4AW7 A;  1C1L A;  1O4Z A;  3PU3 A;  4Y26 A;  4X8N A;  5FXX A;  1FMD 1;  1C8M 2;  5ABJ A;  2MEV 2;  4XF4 A;  4XVH A;  3SMH A;  4NII A;  2ZKL A;  4H3W A;  1HB3 A;  4A45 A;  3V0B A;  4XAB A;  1HN0 A;  4YW5 A;  2PHR A;  1UZZ A;  1HXS 1;  4LQR A;  4M3C A;  2V09 A;  1ALY A;  2A1X A;  3VKM A;  4XJA A;  5FR3 A;  5GLU A;  3GYD A;  4XUO A;  5FLI A;  4CDW A;  3F95 A;  2VUC A;  3VB9 A;  3I4I A;  3S6P A;  2FCV A;  4H7M A;  3UGG A;  1EUU A;  5JLV A;  3LEK A;  2D3P A;  4FFG A;  2NYY A;  2C5D A;  2VBD A;  4I09 A;  4JVA A;  3ZYR A;  1GP5 A;  5A6Z A;  5HPO A;  1LHW A;  4CEY C;  1UY4 A;  1OOP C;  1WA6 X;  2WII B;  4XCB A;  1B35 C;  3W58 A;  1IPK A;  3U10 A;  4YVS C;  3RG0 A;  1UIK A;  5HCF A;  3LIH A;  3WG2 A;  5HBA A;  1G9B A;  1ODN A;  2XVG A;  3LB9 A;  5FZK A;  3AYD A;  1NCQ B;  3GAL A;  2UWB A;  4HKL A;  4ZU7 A;  3OJB A;  3FHQ A;  4X8P A;  2WYS A;  2CY6 A;  1PZ7 A;  5IW0 A;  1SBF A;  3ZYF A;  4ZU4 A;  2HWD 3;  1QQP 2;  5FYH A;  1VAL A;  4CPB D;  4IXL A;  4MSV A;  3SIS A;  4CDU A;  1RUE 1;  2K9Z A;  4YZ2 A;  2QFE A;  2VZS A;  4KMQ A;  1XNK A;  3PJY A;  4FXK B;  4WM8 B;  2RMU 1;  3HD8 B;  4LUL A;  4ES9 A;  1SLB A;  2F6B A;  1X9T A;  2ARX A;  2P34 A;  4ARY A;  4DNY A;  1SBD A;  5FYZ A;  4LO6 B;  5FXV A;  2DUR A;  3N36 A;  2RDS A;  1QOS A;  3PVO A;  5FAX A;  4NPM A;  1Q5O A;  3PIG A;  5FZG A;  3VBH C;  4COY A;  1JH5 A;  4DQA A;  3AP6 A;  5KWR A;  3BIW E;  2WO3 A;  5LA0 A;  2GAU A;  2XR4 A;  4EZ4 A;  4QX3 A;  3UV9 A;  3IDC B;  3VV1 A;  5FP4 A;  4R9A A;  4O61 A;  3VZL A;  4K40 A;  2R30 A;  4IV3 A;  4QGM A;  4GWN A;  2ZML A;  4P9L A;  1PVC 2;  1BKZ A;  2XHN A;  4PLO A;  3ZXL A;  3ZR5 A;  1E5H A;  3O0V A;  4LMF A;  3VBO B;  4AAP A;  1ND2 C;  3KSC A;  3RZG A;  3MIB A;  2EA7 A;  3AXD A;  4AVC A;  1ZRI A;  3MF9 A;  3HQU A;  1S0J A;  1W2A X;  1LKN A;  5G05 L;  2VCA A;  4S2F A;  4UF0 A;  1GNH A;  1NXD 1;  3IT8 A;  3ZPY A;  1PIV 3;  5LWB A;  3AJY A;  2XXZ A;  5FZO A;  1F15 A;  3BCW A;  2X5I A;  3I8T A;  4MUV A;  4PCR A;  5KHG A;  4KWK A;  1U5Z A;  1C8M 1;  2MEV 1;  3DCQ A;  3MPB A;  3WP4 A;  5A7W A;  2WZ8 A;  4HK9 A;  5GLW A;  3OB8 A;  4A6S A;  3Q8B A;  5LW9 A;  1C57 A;  5I0R A;  2C1F A;  1RGS A;  1UPS A;  1RXF A;  2B5H A;  5HCH A;  2VZ3 A;  3NNG A;  4UYB A;  4OHX A;  2XJR A;  4KG0 A;  4RGK A;  1C8M 3;  1U5I A;  2RV9 A;  5I0S A;  3GZT B;  1KS5 A;  4J1W A;  4DOU A;  1JYT A;  3ILF A;  4AVV A;  2QQP A;  1NG0 A;  4AL9 A;  1L3J A;  3LEM A;  2XG3 A;  2JE7 A;  4UFJ A;  4BE3 A;  4FXG B;  3G7D A;  4KGG A;  2WIN B;  5EYX A;  2X8K A;  4UBH A;  1U5X A;  1H8T A;  3HQR A;  2NLR A;  3PVE A;  4FOV A;  1QJF A;  4UFH A;  4L92 A;  3SKJ E;  2RJK A;  4OYU A;  2ZX0 A;  3IPV A;  2LW8 A;  4D6Q A;  1SAC A;  3L2H A;  1Q43 A;  3H7J A;  3UGF A;  1WMX A;  1NA1 A;  1QQP 1;  4OMC A;  1H6X A;  3MI8 A;  5CIR A;  4AFC A;  4BLI A;  2Q8O A;  4XIK A;  1K5M A;  1V9U 2;  2X53 S;  2ZMK A;  3ZFG B;  2EAL A;  3IM0 A;  2VY0 A;  4KBB A;  2Y8K A;  4F8A A;  2ZHK A;  3ZKU A;  2HBU A;  4L11 A;  2ILM A;  3IKW A;  5KC6 A;  3O1R A;  4GH4 A;  3AZV A;  2YY1 A;  1S0G A;  1SLT A;  1VBB 3;  2Y6L A;  1Y9Q A;  1D4M 1;  3POB A;  1U0A A;  2E51 A;  3FMG A;  5JZG B;  3BU0 A;  1IKP A;  4TN7 A;  2UYA A;  4B8E A;  3WNO A;  3ES1 A;  4PF5 A;  1OHF A;  4PLM A;  3WNK A;  5I8S A;  1A34 A;  1D7P M;  4GMP 1;  3IDA A;  4NRQ A;  4W50 A;  1VAK A;  1UZV A;  3GGL A;  4Y1Y A;  5C4W B;  3RPQ A;  5LRS A;  3ZSL A;  4UW6 A;  1KQR A;  3ZM8 A;  4CYD A;  1AL2 2;  3NVC A;  1D4M 3;  3KB5 A;  4YW7 A;  4A6O A;  2WN2 A;  2DBI A;  1YRZ A;  2QUO A;  5LK5 A;  3SCG A;  2V73 A;  3CJI C;  5K0U C;  1PVC 1;  5FPA A;  3THC A;  5IVB A;  2QKD A;  3MLK A;  1Y43 B;  4M3C E;  2Z5W A;  1CAU A;  5FZ6 A;  4UW5 A;  2ETE A;  5FCC A;  1RC6 A;  3LEG A;  4L8Q A;  3OUH A;  3CBN A;  2E32 A;  2YUE A;  3RJR A;  1ENR A;  2I07 B;  3FUO A;  1VMJ A;  1JZ8 A;  5SV8 A;  3D8C A;  4Q0V A;  4QAW A;  3N7M A;  3VHO A;  2G4I A;  2JKB A;  3JBG 3;  1O8P A;  4GIQ A;  1ONA A;  5C8C A;  4FO9 A;  4MHU A;  2NM1 A;  3H7Y A;  3B5L B;  1S4C A;  2YRO A;  4M00 A;  3DPR B;  2B9V A;  4XBQ A;  4CDQ C;  4FBF A;  4YVW A;  4JZR A;  4CTE A;  1ZRC A;  1DP0 A;  2BOJ A;  3VD5 A;  2F4L A;  3BOP A;  1GP6 A;  4XF0 A;  4Z92 B;  5IK5 A;  1QOT A;  2PHD A;  4AED C;  2EIG A;  4ZZ8 A;  1DFQ A;  3N9O A;  1W6N B;  3U14 A;  5IAX A;  4KWJ A;  1WGP A;  1GIC A;  2ZPX A;  1MS3 A;  4RQP C;  3LQC A;  3WF4 A;  5LBC A;  4GWI A;  4BME A;  2CDO A;  5JIA A;  5L7O C;  2VQT A;  5E88 A;  2D93 A;  2PLV 2;  4YLZ A;  2MPF A;  2FD8 A;  1DGW X;  2XJV A;  1DBN A;  1H2L A;  3R4D B;  3W20 A;  4QGN A;  4QU1 A;  1BVV A;  3I2K A;  4AVB A;  2YYO A;  1KFX L;  3WUD A;  3QD6 A;  3ATG A;  3GXU A;  1J3R A;  4JGY B;  3AYE A;  2VW0 A;  1YQC A;  2X05 A;  2SBA A;  1H4G A;  1HRI 3;  1BBT 3;  2A7A A;  1LUL A;  2W3J A;  4MGY E;  2JE9 A;  3OBT A;  1A78 A;  2NZ9 A;  1W8N A;  4OQ8 A;  3BB6 A;  4LBQ A;  2R7E B;  1DQ0 A;  3RRD A;  3OG2 A;  4WM7 A;  3CJX A;  1EAH 2;  3GBG A;  1O3T A;  2R06 2;  4DXR A;  2ZGM A;  3WZ1 A;  3WD5 A;  1IKQ A;  2VL4 A;  4G9S B;  2W47 A;  3MFA A;  3RS6 A;  1C5I A;  4LE3 A;  4LO5 B;  1N1Y A;  1CAW B;  2GNB A;  1V9U 1;  2VZO A;  2CWS A;  3WCR A;  1RMU 3;  1FOD 2;  5T52 A;  4RYD A;  3M3O A;  3L9J T;  1YQ5 A;  5EJZ B;  2VQ0 A;  3WOG A;  5I8T A;  1PO1 2;  3RZJ A;  4CU7 A;  2H0V A;  1MS1 A;  3I3E A;  5D2A A;  2XJU A;  2J1T A;  4IE7 A;  1PM4 A;  4Z07 A;  3RDI A;  1XND A;  4NWV A;  5JOY A;  1CN1 A;  2DWR A;  1CJP A;  1W8F A;  1G6N A;  2E7T A;  4KBZ A;  4QKB A;  2WZP P;  4ET7 A;  1VBD 2;  4S2D A;  3H3Z A;  2WZE A;  4AFA A;  3AYC A;  5FO7 B;  3ZFF B;  2Y33 A;  3O1U A;  4HT1 T;  4C0B A;  2EXH A;  1CWP A;  3N9N A;  1KXG A;  1OVS A;  3C8X A;  2DCY A;  4FPG A;  3KLS A;  1AX0 A;  1A3K A;  2EID A;  4L2N A;  1XBF A;  4J1X A;  1AL2 1;  5L9B A;  4ES8 A;  1LEC A;  2VNV A;  3H50 A;  4OQ9 A;  2VMC A;  1LOD A;  1KJL A;  1UOG A;  2BW8 A;  2ZS6 B;  4QWN A;  3NV4 A;  1URX A;  4B4P A;  5F5I A;  4AI9 A;  3VD3 A;  1NCR B;  1NZI A;  4AEK A;  1PMI A;  4AXO A;  1AR7 2;  3KVA A;  2B7Y A;  3O5S A;  4O7X A;  3V0A A;  4TZD A;  3HOB A;  2OYZ A;  5FJK A;  4XUR A;  5AFB A;  1CES A;  4P9J A;  1DZT A;  1W8O A;  3AMP A;  3AC0 A;  1BEV 3;  3URF A;  5KXD A;  5H9R A;  3UKT A;  4DIQ A;  2I74 A;  4C90 A;  2ZX1 A;  3WNP A;  3HPN A;  1V6J A;  4XUP A;  5FUI A;  2JE8 A;  2CGO A;  4A7Z A;  3PTY A;  5HV4 A;  2WLP A;  1NY7 2;  2G9Z A;  1XSR A;  2QQN A;  5A33 B;  5EHD A;  3ZR6 A;  4IV1 C;  3C3V A;  3MID A;  4IQP A;  1W9F A;  2B4K A;  1IG3 A;  1SHW B;  3O1M A;  1ND3 C;  2I2S A;  2O14 A;  4IUG A;  3S7E A;  4DUW A;  4V2W A;  3WEZ A;  4DXZ A;  2PLV 1;  1BMV 1;  3N35 A;  2YPJ A;  5A3N A;  1AZD A;  2GMM A;  2VW2 A;  3MV1 1;  1QNW A;  4GKY A;  1V6L A;  3OPW A;  4Q4W 2;  3V65 A;  3VZN A;  5A3T A;  5BY5 A;  5F8P A;  3K4A A;  4KQ7 A;  4CDX C;  5K4L A;  3SXW A;  5J37 A;  3NW4 A;  1MAC A;  1W8H A;  1X50 A;  1YFW A;  2ZGN A;  3GNE A;  1UKG A;  4Q4V 2;  2VQA A;  3R6S A;  2ZHN A;  4B7K A;  1OOP B;  2JD4 A;  4NMI A;  4YVS B;  4CUG A;  2BGP A;  2KD7 A;  3BTX A;  1QJX 2;  2BRT A;  1EUT A;  2CYF A;  2IXJ A;  3OUJ A;  4OI2 A;  1D0G A;  2LRP A;  4ONU A;  1SLA A;  5FPL A;  3RYK A;  2R49 A;  4CCE A;  2BNN A;  2BBV A;  3B3Q E;  5ACA 3;  2ZTN A;  5JUV A;  1YYN A;  4JGZ A;  3AKS A;  3HAG A;  3O7O A;  2XQX A;  1EAH 1;  1X9P A;  1J1T A;  2DVG A;  2R06 1;  3S5Q A;  2BNO A;  3AYA A;  4P08 A;  3VBF B;  1Z78 A;  3RNS A;  1UU6 A;  4COV A;  3FN9 A;  4NHK A;  4PQ9 A;  1FOD 1;  2E26 A;  2G9G A;  4PBO A;  4LXL A;  3VGI A;  5JXI A;  4MGS A;  1QF3 A;  5DUV A;  5JR7 B;  3VKF C;  4AAX A;  1PO1 1;  3MLJ A;  4AGV A;  3MLL A;  3TWI A;  1FV3 A;  1V00 A;  1W6O A;  3E5X A;  3TN9 2;  1YQ2 A;  4Y22 B;  4YGB A;  4IER A;  4E4D X;  2O8O A;  4L99 A;  4Q26 A;  4BXF A;  2CNA A;  5I0T A;  3NL1 A;  3POE A;  1ZA4 A;  1X8M A;  1JYI A;  1VBD 1;  2GU9 A;  3ZYH A;  3WSO A;  3R05 A;  3LA7 A;  3D6E A;  2A6X A;  4XTM A;  3Q8C A;  3H3L A;  2ZHL A;  4PHZ A;  4YG3 A;  1RUF 3;  3CO2 A;  5JWP A;  2XML A;  3KGL A;  1HJF A;  1NA1 C;  4XZU G;  4O9E A;  1NXM A;  4EYU A;  1F5F A;  1OUX A;  1JYN A;  2XHK A;  1HW5 A;  4LJH A;  1O5L A;  1F5J A;  2VW1 A;  2DBN A;  3ACL A;  4XW3 A;  3C7H A;  2WS9 3;  4RL7 A;  2IXK A;  3WW1 A;  1U12 A;  4GKX A;  2VMG A;  1AR7 1;  3INA A;  2FDG A;  4MG2 A;  4CEY A;  4DEQ A;  2DUQ A;  4CE8 A;  1W2O A;  2VOX A;  1I1E A;  3ACI A;  2R32 A;  1B35 A;  4ASK A;  5CYY A;  2R16 A;  1FAY A;  2W08 A;  1SFN A;  4CXX A;  1ZZ8 A;  4BIS A;  4AF9 A;  1R1A 2;  1H1M A;  5C3O A;  3LCP A;  3NNF A;  3RMY A;  1WCK A;  3MW4 A;  3LFI A;  1NY7 1;  2WSU A;  5KXE A;  4RR3 B;  4CP9 B;  2BFU L;  4XUQ A;  3OBZ A;  1SEF A;  1D0H A;  3QBQ A;  1AX1 A;  4Q1P A;  3VDD C;  1W6M B;  4Y5S A;  1SLI A;  1SFY A;  4AQ6 A;  4A7K A;  1EYB A;  4DY5 A;  3RI9 A;  2K0G A;  4QB1 A;  1F31 A;  1GAN A;  2YG0 A;  5E1R A;  2FBE A;  3CZU A;  1C4R A;  4FFI A;  3VZJ A;  4Q4V 1;  4N8M A;  1MEC 2;  3WXP A;  3OBA A;  1TQ5 A;  1H30 A;  3VZM A;  2XJT A;  4IEP A;  3ZLI A;  4AHX A;  5IFT A;  2AR6 A;  3N7K A;  4G3Y C;  5GLV A;  3K3O A;  3FE5 A;  5F3E A;  1ZRE A;  4ATF A;  2P6C A;  1QJX 1;  4YM2 A;  2Q1M A;  4LT5 A;  3ZVX A;  4AGG A;  3O1P A;  2VCB A;  1PM7 A;  2BFU S;  3I2D A;  5D8A A;  1XJA A;  1IS6 A;  2EXJ A;  4IEU A;  4M01 A;  4Q4V 3;  2WO1 A;  4R4Z A;  5LCW L;  1ZZ6 A;  2LS6 A;  2YHJ A;  4QXC A;  5GLT A;  3UKV A;  4DO0 A;  1OC1 A;  3GBF A;  3HVD A;  4JV4 A;  4K21 A;  5FJH A;  1LAJ A;  1JYV A;  2IXI A;  4BZ4 A;  4MVT A;  3OPT A;  4BB3 A;  2WAA A;  3WDW A;  2FDK A;  1MS4 A;  1ND2 A;  1Q56 A;  4HPK B;  2IZW A;  4A4A A;  4K8F A;  1JYW A;  1AR8 3;  1LU1 A;  3ZXJ A;  2IVI B;  2YXS A;  3WCS A;  5CIS A;  4CEW A;  2K46 A;  3TN9 1;  4E4H A;  4GUL A;  1Q3E A;  2BWA A;  3LWC A;  1CD3 G;  2A71 A;  2EXI A;  4QM9 A;  4U36 A;  4X6Q B;  2PAE A;  4CU9 A;  1VRB A;  3KMH A;  4S2G A;  3LAG A;  1UZW A;  3I97 A;  3VBU B;  4BYY A;  1YHF A;  1RJ7 A;  1W8U A;  3KT7 A;  1RVF 2;  4GWM A;  2BGC A;  1LNS A;  2Y64 A;  5C6C A;  4WM7 C;  3CL1 A;  4ITC A;  3IN9 A; 
#chains in the Genus database with same CATH homology
 2FCV A;  5DAP A;  5LA9 A;  3GJB A;  4BQW A;  4BQX A;  5L9V A;  5IAV A;  4XCB A;  4Q5O A;  5ERL A;  4KBZ A;  4Y5T A;  5LAT A;  2Y34 A;  3NNJ A;  2HBU A;  5DAW A;  2Y33 A;  5EPA A;  5M0T A;  5A3U A;  2JIG A;  5L9B A;  3KT1 A;  4UWD A;  3EMR A;  3ITQ A;  4NAO A;  5LBF A;  4NHY A;  5EP9 A;  4ZON A;  3BVC A;  2HBT A;  3NNF A;  2RDS A;  2OPW A;  3OBZ A;  3MGU A;  3GZE A;  3NNL A;  2RG4 A;  3NNM A;  4NHM A;  4Y5S A;  3OUH A;  5DAQ A;  5HV4 A;  4XCA A;  5C5U A;  4J25 A;  2V4A A;  4MHU A;  5IAT A;  4BQY A;  3PL0 A;  4JZR A;  3HQU A;  4XAC A;  4IW3 A;  5C5T A;  5IAX A;  2JIJ A;  2FCU A;  5LBC A;  2G19 A;  5LB6 A;  4NMI A;  5LAS A;  2RDR A;  4ZPI A;  3OUI A;  3W20 A;  3W21 A;  3OUJ A;  2RDQ A;  5L9R A;  4XC9 A;  4NHX A;  2RDN A;  5HV0 A;  5DAX A;  4MHR A;  2FCT A;  4NHK A;  4XAB A;  3GJA A;  4NHL A;  5EQU A;  2G1M A;  2A1X A;  5LBE A;  5LBB A;  3KT7 A;  4XAA A;  5DAV A;  3HQR A;  3KT4 A;  3DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...