4ZONA

Structure of ftmox1 with fumitremorgen b complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
285
structure length
285
Chain Sequence
b'KPQLQRLAADADVDRMCRLLEEDGAFILKGLLPFDVVESFNRELDVQMAIPPPKGERLLADKYPPHFKYVPNVATTCPTFRNTVLINPVIHAICEAYFQRTGDYWLSAAFLREIESGMPAQPFHRDDATHPLMHYQPLEAPPVSLSVIFPLTEFTEENGATEVILGSHRWTEVGTPERDQAVLATMDPGDVLIVRQRVVHAGGGNRTTAGKPRRVVLAYFNSVQLTPFETYRTMPREMVESMTVLGQRMLGWRTMKPSDPNIVGINLIDDKRLENVLQLKAADSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Verruculogen synthase
publication title Endoperoxide formation by an alpha-ketoglutarate-dependent mononuclear non-haem iron enzyme.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 87
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 1.14.11.38: Verruculogen synthase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4zonA00
2G1MA 4MHRA 5LATA 5HV4A 3EMRA 5M0TA 3W20A 5LBBA 5HV0A 4KBZA 5EQUA 5DAQA 3PL0A 4Y5TA 5DAWA 5A3UA 4NMIA 4BQWA 4XC9A 4BQXA 2V4AA 4ZONA 3NNLA 5L9RA 2RDRA 4IW3A 3KT1A 5LASA 5DAVA 4NHLA 4XACA 4NAOA 2FCTA 4UWDA 2Y33A 3NNFA 5EPAA 5IAXA 3GZEA 2FCVA 5LBCA 2HBUA 3MGUA 3ITQA 5LBEA 2FCUA 5DAPA 3OUJA 5EP9A 4J25A 3OUHA 5DAXA 4XCAA 5LBFA 2Y34A 5L9VA 3KT4A 5L9BA 2RG4A 2RDNA 3GJAA 4NHXA 3HQRA 3NNJA 5LA9A 5LB6A 4MHUA 4NHYA 4NHKA 4XCBA 5ERLA 2G19A 4ZPIA 3OBZA 3OUIA 4XAAA 4BQYA 5C5UA 3BVCA 5C5TA 2RDQA 4JZRA 2JIGA 4Q5OA 3HQUA 4NHMA 3GJBA 5IAVA 4Y5SA 5IATA 4XABA 2HBTA 3W21A 2RDSA 3NNMA 2A1XA 2JIJA 2OPWA 3DKQA 3KT7A
chains in the Genus database with same CATH superfamily
1QNYA 1O4ZA 3ECQA 5CEHA 3BUCA 3VDAA 3WCRA 2WYSA 1GWKA 4XJWA 4W6WA 1PO13 3RVHA 2D6NA 1A6CA 2IVIB 4UW4A 5IVFA 4LE3A 2NP0A 4OI2A 3DV8A 1OOPA 1UMZA 4GAZA 3OGVA 1QH6A 1NCQA 2ZAHA 4K6BA 4M01A 3ZPOA 3LSDA 4CDUC 4COVA 3THDA 4KBZA 5F5AA 4EN8B 3AKPA 5IYYA 1O59A 2YXSA 4CCOA 3POEA 3HQXA 3ZO0B 2WFPA 4FPYA 5FYHA 5CB7A 5HCBA 3M3CA 1L7QA 4COZA 4NRPA 4Y20B 4IEOA 4YWAA 5B4NA 2GC1A 3SH3A 1AX0A 2VMDA 4J1WA 4JGYA 3KQRA 4IEVA 4UXAA 3TWIA 4BQWA 3IN9A 2BGPA 4XC9A 4DINB 4EE2A 3J8F1 1PO22 1KQRA 2YGLA 2RHPA 1VBA3 2LW8A 3IPVB 3LFMA 4P00B 3A21A 3AB0A 4QKDA 3AXDA 3KV5A 1OC1A 2XB6C 3RYKA 3TRSB 1HRV1 5IK7A 1H6YA 1VMFA 4RGGA 1QJX3 1UYXA 2JEMA 4BHPA 5FZ7A 1LGBA 2W46A 4CDXC 4CU7A 1UL9A 4JCKA 3LB9A 3MI8A 4NOTA 4COYA 4QGMA 4BLJA 2BW8A 2PHWA 2TNFA 4S2GA 4CP9A 2IXCA 4LIUA 2WN2A 1LR5A 4WM8A 4LO8A 2YBPA 4AE2A 1UZWA 4CZSA 1US3A 4LE4A 2VOTA 2BFUL 4XBLA 2DUQA 2ZX0A 4AVSA 3RZZA 3POWA 4EN6B 5I0SA 5IHRA 4OMDA 1U5XA 3E6BA 1XE0A 2JDUA 4J25A 1JZ8A 2DVDA 1C28A 3N9NA 3WUCA 3KV4A 1HW5A 4XILA 2BBVA 1W8UA 5L9BA 2KXLA 1ONAA 2QQOA 2B9VA 3JQXA 2W91A 4P9LA 1YI9A 1MS0A 1GLHA 1VBB3 3S0MA 1KJLA 2Y8KA 2WZR1 1JS9A 2C0ZA 3GHNA 3I3MA 4IXLA 4JRAA 1H2NA 3Q8AA 4PLMA 2WFF3 2ZA9A 4FP2A 1ENRA 5C71A 3JBG3 4IV3B 4MGYE 2P5BA 3USUB 2DUOA 1OPOA 5KXDA 1ZBA1 5CA6A 1VBA2 2WZEA 4QXBA 3K2OA 1RHI3 2XJRA 3AMHA 3B9IA 4NR1A 1MS9A 1W28A 4FPGA 2D40A 3QBQA 1S0BA 2J1RA 5JPNB 4AI8A 1XYNA 3OBAA 3M3EA 4P9WA 5AC93 4H7MA 5FO7B 3NV4A 3HQUA 3J7LA 2QZ3A 3LDBA 3JCIA 5BV6A 5EIYB 5FPZA 5A7SA 3ES1A 4XJUA 5IATA 3BPZA 5IJRA 2O14A 2YGMA 3I2OA 1JW6A 1UOBA 2KD7A 4Q4V2 4CUGA 3OTFA 1I9RA 1NCRB 1FXZA 4IETA 3WNMA 2OPWA 3IMMA 2VZUA 2YC2A 2B7YA 4PI2A 2WA4A 1IS4A 2AENA 3U14A 5BNOC 3BOWA 4CXYA 4OHXA 3ZFFA 1JZ7A 5FBJA 2VULA 1VBB2 5GKAC 2GNMA 3E97A 2P17A 1YQCA 1W39A 2WNUA 4BK4A 2VUCA 3I2KA 1YEWA 1PNFA 5GZFA 1OI6A 4MO3M 1ASJ1 3A0KA 3AMMA 5FUNA 3NJYA 3RZLA 1QWRA 5FDBA 1K45A 4OLLA 3ZXKA 1OOPC 1RHI2 1XNKA 3M3OA 4WBBA 5FZEA 3VKMA 1I3HA 1NCQC 2PHRA 3PL0A 3IT8A 4C91A 1F4AA 4YG3A 2OQ7A 3ACGA 3OOXA 1YYNA 5KC6A 5AC92 4FTEA 2J7MA 2R073 4QKNA 4B4PA 3RWKX 4OHWA 1Y7BA 3H9AA 1RGSA 4YRDA 1BJQA 4BIOA 4LLFA 1CAVA 1H1MA 1VBE1 2TBVA 1QOTA 4NE9A 4QX1A 3RI9A 1RUI2 5FYBA 4DO0A 4DUXA 1YQ2A 2EIBA 2GH2A 2CDOA 4EWAA 2Y33A 4FPCA 4PIYA 1UN1A 3AYAA 1HN1A 4K40A 2D6KA 2R1BA 2BJSA 2VNOA 1M06G 2PQSA 1XE7A 3LPGA 4A44A 1AYM1 1PK6A 1Q8QA 2V72A 5FZ9A 3RMYA 1CGPA 3U07A 2H6BA 4OUSA 1PHMA 1VMHA 4KGGA 1MEC1 3WOGA 1VRH1 2RR12 1GU3A 2VG9A 1BBT1 2DBIA 4OUEA 5DAPA 5DDJ3 3RQ0A 5I0UA 1H8TA 2BFUS 2R30A 2JDAA 2GN3A 4NRMA 3LQCA 5FBZA 1S0EA 2XLFA 5JUVA 1LAJA 5A7WA 5EYYA 5JOYA 3HQRA 1X7NA 1O3QA 1LECA 4CEWA 2Q1FA 2CSGA 4PBPA 1QJY1 1RUE1 5HXVA 1HJFA 4FXGB 5FV3A 4XZUG 3O0VA 2ADDA 4AWDA 5FQ0A 5JSOA 1GKBA 1WBFA 1QQP3 5ERLA 3O5SA 3RZJA 3AJYA 3OBZA 3WW3A 2QVSB 4DEQA 3D8CA 4DRVA 3ZN6A 4A7KA 1BMV1 1DZTA 5FZAA 3VBUB 2GNBA 1JMUB 3B94A 2X10A 1XU1A 1DG6A 5FMDA 2P3YA 3IWZA 1JOJA 4MADA 2GC0A 2YMZA 1IPSA 1CZSA 2PHXA 3AP5A 3EBRA 3O0WA 2GNDA 1QJU2 2JIGA 3ETPA 1UWWA 1SQ4A 3NV3A 4QXCA 3TAYA 1OOPB 3VBFA 1X82A 4QHZA 4IQPA 1NCQB 1WZXA 4KH9A 5JMCA 1QJZA 5EZWA 5A1AA 1ZA7A 1D2QA 1R093 2R6QA 2YC4A 4OULA 1KITA 5ABJA 3PHMA 4BIFA 2D5HA 2ZX3A 4BU2A 4M3CA 1SLTA 5JI9A 5E6HA 3VDBA 4QPIC 5JSRA 3EO6A 3ZSKA 3CF6E 3NAPA 3OPZA 3S7IA 1R1A2 5T5PA 5FUPA 3G6JB 2ZBJA 4JGYB 4UW3A 3WF4A 1YQ5A 3GNEA 3ZOIA 2BVVA 1UU5A 2ZAAA 3LOIA 4YVSC 4S2HA 3VBSB 2W1SA 1TNRA 2DDUA 4X8PA 4Q0UA 3WDWA 2XL7A 5LBBA 2JB4A 2EIEA 5IFTA 4CUAA 3HNBM 1UKRA 3OG2A 3N7KA 1CONA 3EQEA 3ZFFC 3KGZA 4H2AA 2VMHA 4I3PA 1BHGA 2NQYA 1ZBE3 3AZWA 2A6YA 3FUQA 2J1SA 1G8WA 4HOOA 4M3CE 4W8JA 4WM8B 3ZXJA 4CP9B 4ZU7A 1J3PA 4PIZA 4YARA 3B9CA 3A4UA 5JPMB 5HCFA 1PO21 1GNZA 4BQ5A 1LEDA 4FTBA 2W95A 4GULA 3SEPA 1S0CA 2UWCA 2ETEA 2R062 2GMMA 5GZGA 3NNLA 2VZVA 3KT1A 3U0ZA 2A3XA 3ZN4A 3W9AA 2P3JA 1W06A 5FYUA 1SDWA 4HONA 4AZZA 3WW1A 2QBXA 3ILNA 5DZGA 2QQUA 2D93A 3H8OA 1LHWA 4OI1A 2ORXA 1Q8VA 4BOWA 2HWB3 2RM23 4OHZA 3T30A 1UOJA 3KS7A 1Y9GA 1R082 1W6OA 4YZ5A 2G4IA 2GP3A 5HCAA 1YIFA 2LUWA 1UU4A 4MG2A 2VUJA 3VKNA 1PX4A 2X09A 4AI0A 4LLOA 2EXIA 4IGQA 2NYYA 1K42A 1NQJA 2Y64A 5FRAA 2Q1MA 4QQPA 3RPQA 3AKTA 2Q1ZB 3O1MA 1H8VA 3ETQA 3ZYJB 4Z82A 1E5RA 1WW6A 5LB6A 4GB33 5KWRA 4NIIA 4XJ9A 1UY4A 1APNA 2ARBA 2HWF3 2ZGNA 3QACA 4NPMA 3UETA 4B29A 2VL4A 2YZ4A 5A3PA 1HX6A 1RJ7A 1V6LA 1VP6A 2CAVA 3PTRB 4CEWC 5GLVA 4QX3A 2YU1A 1YO8A 2UYAA 3DYOA 4AEKA 2AYHA 3LPFA 2CU5A 4KU7A 4CDWA 4NAMA 1YRZA 1RUC3 3MW4A 2E7TA 3C8XA 3W5NA 4C0BA 1ND3A 4UBGA 3EXUA 3W5MA 4NPLA 4CRQA 4HFSA 4V2VA 5FR3A 3FWEA 3LKJA 3HBKA 3T1MA 5JIAA 1VB2A 2EIGA 2WNUB 4CPBD 2BTVC 3I3QA 1FATA 2MEV2 2D6PA 1A3KA 2DUPA 1F15A 4Q4V1 3M8LA 1PM7A 3AFGA 1AR92 1AR63 1F5FA 1H2LA 1NOVA 3AZYA 4GXLA 3O0XA 5T54A 2ZHKA 5ANQA 4BLIA 3R4SA 1CAWA 1W8ZA 1NZCA 4K20A 3NO8A 1WLCA 3NNMA 3T4VA 3VBFC 5IVEA 2HH9A 3M70A 4YM1A 1GP5A 2FDFA 2VMGA 5JOWA 1IG0A 2QQLA 2P3IA 4KGQA 3HNMA 2JDPA 2VW2A 2QQPA 4DB5A 4DUVA 2JD4A 1PGW1 1RMU2 4C90A 5I8TA 4GJYA 1U0AA 2A75A 1D7PM 4Q8LA 4QT6A 3D4KA 5FYYA 4CCDA 4Z8BA 5M0TA 1UX7A 2PA7A 3N9LA 4K8FA 3F2ZA 3NAPC 1CAVB 4GB32 3W20A 4BQ2A 4AI9A 4EN0A 2HWF2 2ZMKA 4E8DA 4XHBA 4D0QA 3EJKA 4BE3A 1H4HA 2R1DA 5LZ6A 3TEWA 1VB4A 4RGKA 3QH7A 5EQUA 1QOSA 3QD6A 4BISA 4AK3A 2JECA 4AQTA 1ZVFA 3E5XA 3I54A 1UYPA 3J8F3 3AKRA 4Z2AA 3GHMA 5FZBA 3ZFGC 1PK6B 3KB5A 3M3QA 3AFKA 1J84A 1W9TA 1SCSA 1HRV3 2CV6A 3F95A 2GP5A 4BMEA 1YNAA 3HNYM 2ZX2A 3B00A 4BQXA 1RUI1 2XJSA 1H8TB 4AI2A 1Z7S1 1K12A 3FFZA 2UY9A 2YBKA 3MICA 5DUXA 3H8XA 2Q8OA 2BOIA 1VAKA 2XJUA 4IW3A 5FZGA 3IAPA 5A7WB 1SZBA 4K7JA 1VBC1 4XACA 5F3IA 4CEWB 4NRQA 4DPNA 2XBO2 4XBNA 3LWCA 4YVWC 1WCDJ 1GOFA 1JYVA 3VD7A 1Z0HA 1GV9A 1POV0 1YFUA 4PQQA 3UNPA 1JYWA 2P4EA 1W0OA 1UZYA 4OMCA 5FQ0B 2DVFA 2VD7A 3S57A 2RR11 2W5FA 1UO9A 2P1BA 2ZGUA 3JD73 3WDXA 4EQVA 5FO8B 4L0PA 5C8CA 2EXHA 1GYKA 1OLRA 1W2UA 3ZN6B 3HT1A 4INDA 5GJ6A 2RS12 1SFYA 3S6PA 3AXEA 1YJKA 3WQ7A 4D8MA 2VVDA 4PF5A 2OX0A 4NVPA 4BQ4A 4E8CA 1F9KA 1W0PA 2GU9A 2XKOA 2OKXA 4XIKA 2B42B 3VBFB 1F2NA 3ZMNA 1JZ2A 4IESA 2DFCA 1UY0A 4XDPA 3WNOA 4D6QA 4ARYA 3POFA 1H6XA 1GZCA 2C9AA 2D3RA 4LBLA 3P3PA 2JDNA 4QKBA 4NHKA 5ABJB 1EV12 3T0BA 4M3CB 4XCBA 4AHYA 3QLQA 2R0HA 1HB1A 2G19A 2YU2A 1WKYA 1BXHA 1MS3A 3NAPB 4QPGA 4FFGA 3H3ZA 5IVYA 1J1LA 1QJU1 4CUBA 3ME2A 2E7QA 3P6BA 1QJEA 2V09A 4KG0A 1K5MA 1RYYA 5A7QA 1W3VA 4P08A 3V56A 2RDQA 1ODNA 2IXKA 4NPRA 1A8MA 3RNSA 3PUAA 3T2TA 1G9AA 4MX3A 2AUYA 2R042 3GCXA 5EJ1B 1LGNA 2VW0A 5A33A 1UPIA 4HANA 2L9LA 4LA3A 4IV1A 3BIWE 1UY2A 2F4PA 1ND3C 2DCTA 1JODA 2J1TA 3M4FA 4L11A 5F8PA 5FLHA 1OVPA 3RS6A 5GLUA 1XOYA 3VBSA 2YPJA 3CLPA 4KWUA 2FD8A 4LHNA 3C7GA 4BYYA 4XBQA 3IMNA 4CCEA 2O8OA 2BNNA 2JIJA 5BY5A 3OJBA 1PZ9A 2H6CA 4EN7B 2WZR2 3O12A 3I2HA 1LEMA 4TTGA 1Q8OA 1DIWA 3VBOC 4LPLA 1OF4A 3M2MA 1ASJ3 1GNHA 2ARAA 2A71A 2W9XA 1AXZA 1BK0A 2XHKA 1W9WA 1ZBA2 3VZMA 5JDBA 1DZRA 3BALA 4BXFA 1IG3A 4Q2FA 3CHXA 4QB1A 4QX0A 3KM5A 3WW2A 2P34A 2VCBA 4TZDA 3SXWA 5FUIA 1GQHA 3SITA 5JZGC 2RS32 1FX5A 5J7MA 1US2A 1V6IA 4UW6A 1ZZ8A 5KHJA 1BEV3 4E4HA 1NXMA 1YLLA 2ZHNA 4DQAA 2OQ6A 4MGZE 1WA6X 5A7PA 3H8UA 2ZGMA 1VBE3 4MGIE 4BDVB 4LK6A 1W6OB 5CNAA 2JENA 2R061 1FT9A 1RUF2 2Q4SA 3IDEA 3ZKYA 5JSPA 2ZGTA 5FP3A 5BNNC 4CDUA 1FNZA 5DUWA 4Y1VA 2HWC2 2QKDA 5FZCA 4MYEA 3AZVA 4H7LA 5L9RA 1DCSA 2QQIA 2QCSB 2ZMNA 3WNLA 4ASKA 4IE5A 5C7GA 2EICA 2A3WA 4HMZA 4ATFA 2E6VA 2BP6A 2WS91 2XONA 4KWKA 1L3JA 1MEC3 3OGSA 4PIXA 4XF3A 3ZPYA 4B7EA 1S0IA 1VRH3 3VD4A 4R4ZA 3TNQA 1BBT3 4E4DX 3LA2A 3MGUA 2WDBA 4W4ZA 1AR81 1A8DA 1AYN1 1QXJA 5A3LA 2WAAA 4CDWB 4RSUA 3WNXA 1WUVA 1HB2A 3NW4A 1W8OA 4XHXA 2LRPA 4CDXA 1ND3B 1QJY3 1RUE3 1CVNA 2QQJA 3N3HA 3PUQA 4EN9B 4XPVA 5KC5A 4XURA 1O91A 1OURA 3E6DA 4BPZA 5C8CC 4HPKA 3VZJA 5A7OA 4XYXA 2EALA 4N7UA 4MOAA 5FLIA 4Q29A 2XQXA 3AP7A 4HETA 1ULGA 2DVGA 1AF9A 3PUHA 4ASLA 4N90A 1VBE2 2WSUA 1MS4A 2VECA 1W90A 2ZABA 3GZTB 4QDRA 3ILRA 1CAWB 5A3NA 5A3MA 2DU1A 3BU0A 1OXCA 2C6SA 4P9YA 5DUUA 3IZOA 3THPA 2JJ6A 3O14A 4YNIA 3MEPA 2J1AA 1V9U3 4MZUA 4A3XA 1U5ZA 2XLAA 1E5HA 1KD7A 1P8JA 1AYM2 2FBEA 5EHDA 2ZEZA 1WLDA 2MEV1 2R0FA 2ZHLA 1VRBA 2DCZA 1Y3TA 3HT2A 3POGA 1AR91 1VRH2 4IE4A 4QPGC 5HPOA 2JDMA 2VOVA 3DXUA 3HD8B 5JXHA 1RUG1 4META 3J7MA 2WT2A 1H0BA 2D6LX 2JWPA 5D8AA 2VCCA 4FXKB 1KS4A 3RDIA 3SKVA 1G9DA 2VZSA 2BWCA 5IK4A 1UQXA 5GZDA 3TN91 3AL6A 1RMU1 2FDJA 3VB9A 1RUE2 3UJOA 5JOXA 4DFSA 4EROA 2ATFA 3ROUA 1NA1C 4YM0A 4GD4A 1ZZ9A 1VAMA 1O8SA 4A7YA 2RJLA 3POIA 2Z2SB 5F32A 3SHRA 4GWJA 4RYDA 2LROA 4ZY9A 4XUNA 2CNAA 1JZ5A 3A7QA 3EMRA 2WSVA 3ZLIA 2DYCA 2OS2A 2YFZA 2VR4A 4LHSA 1GQPA 4PLOA 4SLIA 3VGIA 5I0DA 1WCQA 1JZ3A 4TLFA 3BTYA 1URXA 3J9SA 1PO23 2B4KA 3FBYA 2DTWA 3UGHA 2BBAA 2YYOA 3ILFA 1WMFA 5LK5A 1RXFA 2OT7A 2XVGA 4HN1A 2VO5A 5FWEA 5CVRA 3SLIA 3WDVA 5GALA 4TWTA 5F2WA 5BNOA 2WNVC 2QQWA 5B2GB 4UT5A 1OQDA 4BXSV 2YB7A 4LQRA 1QMJA 1X33A 5C8CB 2P6HA 1WLWA 4P02B 1ST8A 3U1XA 1RTVA 5FK7A 1KEXA 2JDZA 3UL2A 1DQ5A 4JKKA 4JTOA 2QJVA 5C6CA 3VHOA 2VZ3A 3K77A 2P2KA 5F3GA 1POV1 1XQNA 2XBO1 1S0JA 4I0AA 3PVNA 4HSJA 2P3KA 2Q0AA 5C3QA 4W50A 5K9YA 3I2IA 2UURA 4IE7A 4H55A 3T08A 2CHHA 3ALQA 4B4RA 2CAUA 5CADA 1CAUA 5FZLA 1OVSA 4R9DA 5CG9A 3AP4A 2TEPA 1V6OA 3POBA 3VL9A 2XPJA 3ZSMA 4HBNA 2RS11 3MDPA 3P1IA 4PLNA 1X8EA 5CKNA 2JDHA 4Y1UA 4QPGB 4RFRB 3I7DA 5I0RA 1OF3A 1WBLA 2D7FA 3PIGA 3GALA 1MQTA 5APAA 2PFWA 3UV9A 4CP0A 3CKHA 1K5MB 2VTFA 3MIBA 4Q4W1 5IT6A 4YZ4A 5A6YA 1Q5OA 1IPKA 1IHMA 3O1OA 1HDKA 2BDRA 4OQ8A 5A33B 3NJZA 3DKWA 5HXMA 4IV1B 1AHSA 1EV11 4ZXKA 1GZTA 1N1VA 2HEYF 3AYDA 1Z78A 2ZEWA 1YUDA 1XU2A 1VPHA 1ZX5A 4NIDA 1O5LA 5F2SA 3T2OA 1LNSA 3PIJA 3AC0A 2GSYA 3ASIA 2EF6A 1OH4A 5BNPA 3AZXA 2JE9A 1W6NA 2PLV2 3JXSA 1QGLA 4P9XA 1QEXA 3VBHA 3ZXEA 1WMEA 2R041 4Q4V3 1XYOA 4XEZA 3BVCA 4FT8A 3CZJA 1C1LA 4Y4RA 4XTMA 3U4SA 3AMNA 1G9BA 5E16A 2VVEA 2VBDA 1LTEA 3A0NA 2FMDA 3MIDA 4EJRA 3I3EA 4Q4Y1 4QU2A 3BKZA 2VJXA 1MS5A 1W8HA 3IBMA 1J58A 1K5JA 5FREA 5IAVA 2W39A 1O4TA 3ZVXA 3RSJA 3MW3A 1CD3G 3DXTA 2W52A 5CBLA 1QHDA 1S0GA 4A4AA 1GBGA 2EXJA 3MFCA 1Q8SA 5F9TA 1KRIA 1XNBA 2A7AA 4GWMA 4HK9A 4IEYA 5D8AC 4YM3A 4A7ZA 5DZFA 2G1MA 4R8HA 3ZN5A 4CDUB 1Q56A 1ZYBA 5L7OA 3RZHA 5JVVA 4M3CF 2RS31 3WCSA 1W03A 1FYUA 3AYCA 2O8QA 2Z42A 1MR5A 3H7JA 2RJ2A 2VZTA 3O1PA 4QPIA 5CFCA 5A1FA 3V65A 5CYYA 2FDHA 3RWNA 4CEYC 3O1VA 2QNKA 2HWE1 1RUI3 4FFIA 2WWSA 4A2UA 3PUIA 5JLVA 1RUF1 4YVSA 4LBQA 4PHZA 4QB2A 4XETA 1HV0A 2VPVA 3WP6A 2Y6LA 2WO1A 4MH0E 2HWC1 5FZ6A 4HG6B 5IK5A 3ZMOA 1G9FA 2PN5A 3AKQA 4XFBA 1VAVA 2XGXA 3MUY1 3LIHA 4CDXB 3E1F1 3MBWA 3OCPA 4AR2A 4HKLA 3T2QA 2PELA 1REDA 2YBSA 1X9PA 3I3DA 4EYUA 2RDRA 4Y33A 5JXGA 1PGW2 2RR13 4HPKB 1DQ0A 1JHJA 1W9SA 3MPPG 1FOD1 3BOPA 4FPJA 4IEZA 4NAOA 1A34A 2DVBA 2IXHA 2PQQA 3DECA 3OB8A 1ULEA 4X6QB 5FP8A 1BK1A 1LOEA 5LBCA 5IVJA 5DG2A 5FZIA 1JN2P 3MLLA 4QQOA 2VNRA 5FCCA 3DCQA 5AVAA 1XC6A 3CEWA 3LZZA 5IWFA 1YJLA 2WL1A 1JUIA 1ULPA 4AFMA 1XNCA 4F83A 1I5ZA 2W94A 5JMOA 1N3QA 3N4MA 3KLSA 3KQ4B 1STMA 4QM8A 4CU9A 1FI2A 3JB8A 1PMIA 2VU9A 4FPEA 4P9GA 4X8NA 5F6KA 5L19A 4EZHA 4DOUA 2DVAA 2B9UA 2XWBB 3J7NA 2A73B 5LA9A 4XOGA 4MGTA 2Q8DA 1MQTC 5FZFA 1Z7S2 1OBNA 2YROA 3OBRA 1DZQA 4LJHA 5D8AB 2LALA 5FZ3A 2EA7A 1QJU3 3BCWA 2AACA 3LSEA 3UKVA 5FY4A 1VBC2 2O1QA 4FPFA 4DRRA 3BPSA 3C2UA 4JVAA 3ZIWA 2AGSA 3WR0A 4HT1T 3WXPA 1VJ2A 4U36A 2BOJA 1RUH1 1G6NA 5FFOC 5CIRA 1XXNA 1PMJX 4BQYA 3THCA 1QOOA 2ZKNA 3WVJA 4A6OA 5DMYA 1F31A 4LORA 4ZZ8A 2BPA2 1R1A3 3UGFA 2ADEA 2HEVF 3LEGA 3SNMA 5BNPC 4EZ4A 4L9BA 1PGSA 3VBHC 5DG1A 4AHWA 5CU1A 3AZZA 4GMP1 1NQDA 2ERFA 3OGRA 3VD5A 4DXZA 5JR2A 2WN3A 4AFBA 5DXDA 1RUD1 3W21A 2D97A 2VNGA 5BNOB 4Y4YA 1JH5A 3FHQA 5D2AA 3WF1A 3FX3A 5FZOA 4S2DA 1J83A 5HV4A 3MIGA 1CIWA 4KNCA 3BI3A 3LF7A 4Q27A 2VGDA 1EP0A 2IVJA 1C3HA 2IXJA 3L2HA 2Y6JA 5E89A 4KI5M 1PNGA 4OHYA 3VUOA 4XFCA 1O3RA 1N3OA 5FY1A 1COV1 4QGNA 4D3WA 5L7OC 2R063 2A6WA 5I8YA 1CAUB 4RS5A 5FKBA 1O4YA 2E63A 2Z69A 1W05A 3ZYPA 4I30A 5CFCC 4RA0A 3SKJE 3UYJA 3K46A 3GGLA 4NMIA 4OFGA 3H50A 3ACIA 4YPJA 1Y43B 3S7EA 2ZACA 4DNYA 1MQTB 1FMD1 5LEKA 4Y26A 4RHV1 1C5HA 1S0FA 2RE9A 4XTPA 2BUKA 1R083 4LBOA 5DAVA 3T1LA 3B5LB 2D3SA 5G04L 2QDNA 2K46A 3ZFGA 1AYN3 4H3WA 2XJVA 1NG0A 3WD5A 2J22A 3R05A 2FDIA 4XUOA 1MS1A 1O6UA 3CNAA 5A3WA 4UFMA 2DV9A 4QB6A 2CYFA 2D98A 1MZFA 2E51A 3NJVA 2QQNA 2XJPA 5FPUA 1U5YA 1EYBA 1XJAA 2VM9A 4Q1PA 2LTNA 4AEDA 5BNPB 2SBAA 3WF0A 1C8M1 1W6NB 4YLZA 1VBD2 2VQTA 2IXIA 3VBHB 4AFAA 5EP9A 2GN7A 2E7AA 3HAGA 2PAEA 4JHTA 5FZMA 4FOQA 3FLRA 2HYKA 1YFXA 4YVWA 4ZS3A 1PZ8A 3AJZA 3WF2A 1ULFA 4WVMA 5AFEA 3ZDVA 4QX7A 4CP1A 4B8EA 1DQ1A 1DLLA 5AFBA 4Y24A 3WG4A 3O1UA 1CPNA 2YG0A 2OXBA 4XQ4A 2G9GA 3BU7A 2W1UA 3WX5A 5FZKA 4MLOA 3VL8A 5C9AC 2PLV1 1UMHA 2MEV3 3CJIC 2WT0A 2WS92 3KV6A 3LDRA 4G4FA 4GZ9A 4K21A 4HN0A 5T5LA 3WHUA 1LESA 3WNKA 4E2QA 1AR93 3I2DA 2RMU1 3SC7X 4I0WB 3C7HA 4R9BA 2FZ2A 1WW5A 2Y0IA 5I93A 4HXCA 4Q4X1 1Q43A 4MUVA 4I3GA 4YZ2A 1AR82 5L7OB 1AYN2 5C5TA 3K4AA 3HR9A 4WV8A 5F5QA 3WDUA 4AQ6A 4GWNA 3RMXA 2ZEYA 4MGQA 2Y6GA 2HYXA 1RMU3 1V0AA 4KG8A 5EV7A 3ZX7A 3KSCA 3RYPA 4QPIB 4AFDA 5CFCB 3R0RA 1JOPA 4TN7A 4WVWA 4DY5A 1MZ6A 2A5ZA 3FL7A 1PO11 2VZRA 3H7YA 3WINE 1AR72 2V73A 4YFWA 2KR2A 2RDSA 5A70A 1G7YA 1ULCA 4YW6A 4YVSB 3NVCA 4LBQB 3FHIB 1H2KA 1OFSA 2WA3A 2XVKA 1S2EA 4AVTA 1N3PA 2IWGB 2KM2A 3L9JT 4UFIA 1DGRA 1X36A 4OZOA 3IDAA 5GLWA 3GXUA 3K75B 1MZEA 3ZFFB 2FDKA 1CJPA 4QHOA 4L92A 1R1ZA 5J96B 3OPWA 3KCXA 5HV0A 1D4M2 2F6BA 4FO9A 4E27A 4YZ1A 4FI9A 1IPJA 1ENSA 3JZVA 2BNMA 4WM7C 3MF6A 3X29B 3WNPA 2Y38A 1WW4A 1RJ8A 4ZS2A 3V64A 1LJ7A 3VBOA 1W6QA 1RUG2 2J1UA 1QU0A 4QPWA 4L97A 2VBPA 5K0UA 4Z92B 1POV3 5CZKA 4AFCA 2XBO3 3WSOA 4DXSA 5LK7B 4N43A 4X6RB 2A70A 3WZ1A 4RS5C 2XR4A 2WAOA 3TN92 2Y0OA 4BWOA 4IE6A 5F5CA 2V4AA 1UX6A 1OLQA 5JZGA 2JXAA 4QD2A 5I8SA 3R6SA 1KXGA 5KHHA 5KHGA 4JDMA 5LASA 1DDLA 1UW8A 3NSTA 2PAMA 1WLTA 1XB9A 2RS13 1PVC1 1SLLA 1YFYA 2CDPA 1XNAA 2JE8A 4FPKA 4XJ8A 3DPRC 3NNFA 4AEMA 1IS5A 5JXIA 4AHZA 1BCXA 1QKQA 4DXRA 3O1TA 1O7FA 5T5JA 4AYUA 3O1SA 3OYWA 1BVVA 2UY8A 4FQ4A 4AVAA 4GIQA 4Q4W3 4K9SA 1C1FA 4N7IA 5BNNA 1S2KA 3D82A 4LUKA 1BYHA 2BV4A 3FMGA 3UKTA 3I97A 4ES9A 2CWSA 3I2FA 3TOJA 3OD0A 1EV13 2WFF1 1EAH2 4DMIA 2DF7A 3LE0A 3IKWA 3JBG1 1W0NA 3K4DA 1OA4A 4IEPA 4NN0A 5LY1A 2D6OX 3KT4A 1Y9QA 3KF3A 2Q8EA 1JYCA 5L73A 2JX9A 3ZM8A 4C1XA 4AEDC 4BH9A 1YC61 5TSWA 2F17A 5KBFA 1SHWB 2FMYA 1DQ6A 3ES4A 4CCJA 1W6MA 5HCHA 2E33A 4JQTA 2UYBA 2WR9A 3GBWA 4AGGA 3Q8CA 2R043 2B5HA 3HIFA 1HKDA 4CUCA 1KDMA 2WYFA 4JTNA 1HQNA 2ZJCA 1R64A 2E53A 5FZOB 3RZKA 4UAPA 4FAGA 4CP2A 4V2WA 2PXJA 2R32A 3WV6A 2J42A 2WZR3 1OHFA 1TVGA 2WWJA 3H3UA 1DLCA 4MXWA 1UU6A 4RR3C 3ZXGA 2I45A 4DIQA 5LWBA 4IEQA 2P37A 4N9HA 2NN8A 2WC2A 5DZEA 3RGBA 1YHFA 1H9WA 3VBRA 5KHIA 4LEJA 4Q4W2 1W9YA 1ZBA3 4OZXA 5FY8A 5A6XA 4E4SA 2VNVA 1H4GA 3I8TA 4W6YA 1ZRCA 1ZRDA 4RS5B 5F1RA 1OA3A 3I59A 2C9KA 3E5UA 1UZZA 4PJYA 4CYDA 1VIWB 1SFPA 1ZA4A 2RS33 1PX3A 4KU8A 4PDWA 4YM2A 1SDDB 2OW4A 1ODMA 1WCUA 3FE5A 5FPLA 3VZLA 3DYPA 3NQHA 1AXYA 1XNTA 3J4UH 4M4RA 4NWVA 3L2YA 1U5IA 5JOZA 4E9KA 2W87A 2G9ZA 4CPBA 1LHOA 3WG1A 3U4XA 4LHLA 4OVEA 1EY2A 1RUF3 3KVAA 4A42A 2VMFA 4KBBA 5FYSA 2HWC3 3ZFGB 1AL21 2VTXJ 4LO4B 4LBNA 5C3RA 5C33A 3PDQA 1HB3A 4Q26A 3WW4A 4QXKA 1NA1A 1GWMA 1HB4A 2BEOA 2OZJA 3H42B 1JOBA 4IDZA 5KXBA 2I74A 2ZEXA 2ZXQA 4YSFA 4Q4Y2 3FFQA 2WQ4A 3H1WA 5T3NA 4XW3A 2K2SA 4HKOA 4C0HA 4AEDB 4LTAA 1FOD3 2LM3A 2IUWA 1Y9MA 3ACLA 4LOTA 4ONUA 4XDQA 5FY7A 3IPVA 3U78A 5K0UC 5J3UA 1UZ0A 4XQWA 4YVWB 1UD1A 1GUIA 1OD5A 2VUAA 2OUJA 3LD8A 4N43C 4WVMB 5GZEA 3VN4A 3MIEA 2R16A 3QOPA 4NHLA 2IC1A 2WNVA 5FY5A 2WKKA 2YFUA 4GH4A 1T6GC 4CDQA 1HV1A 2BVBA 5JI7A 5F37A 5IAXA 2R7EB 1HQLA 4KL1A 4SBVA 4FQZA 1OSGA 3CO2A 2BWAA 3KD4A 1QIQA 1ULDA 1OA2A 1S2BA 1G86A 1VALA 1VBD1 1OUSA 4MGSA 3K3NA 4XFIA 5LBEA 1UPSA 1T6BX 1NAEA 2XHNA 4RGAA 3FZ3A 1H9PA 1U12A 1UAIA 2QUOA 4QWNA 2HWE2 4BB3A 4ISRA 2FHRA 2WZ8A 4URAA 4FPHA 2GAUA 4ZHNA 2FCUA 3B69A 2DBNA 1JYNA 1GSLA 1HXS2 2F4LA 4XZPA 2PHDA 2VE1A 3OF1A 1QQP1 5LBFA 2ES3A 1V00A 2VOXA 3WDYA 4XFAA 5BPXA 1TZOA 3WQBA 1AYM3 3THTA 3OY8A 2NZ9A 3DF0A 1OQ1A 2ET7A 5C4WA 2ZGLA 3CQOA 4MHUA 4A45A 5GZCA 1FOD2 4JGZA 4D7SA 4YW1A 2WRAA 1OQEA 4ES8A 1REFA 1ZREA 4FFHA 1YI7A 1PIV2 2BGOA 2MHFA 1CAXA 1LOBA 2WO2A 3DL3A 3N9QA 3Q8EA 4LO5B 4UFJA 3HOBA 3ST7A 3LOBA 4HVOA 1D0GA 3MLKA 4LITA 1R091 2EAKA 4GMP3 4I0BA 3VDDA 3ZFEA 4DXTA 4FFFA 4G3YC 3A23A 3MPBA 4LT5A 5FPVA 3EYPA 3T09A 3AP9A 1OPMA 2ZZQA 4JZRA 5ACA1 3RG0A 2IZWA 3U10A 3DEMA 3I4IA 3MV11 1OD3A 1AR71 1WA4A 4NHMA 4D94A 3WG3A 3K48A 4K1YA 3TBDA 1ENQA 1UZVA 2JKXA 2X29A 1DU3D 3AK0A 1DBNA 1JI6A 4FOVA 3VBOB 4BJ0A 1L7RA 1W6QB 2ZGSA 4HVQA 1SBEA 5K0UB 3VBRC 1TME2 2DCKA 3IM0A 2JD9A 3C7EA 4OHVA 2YC0A 1TMF1 4N43B 1LENA 2ILMA 5FPBA 1CZVA 1SMVA 1LHUA 5ANNA 1COV3 1RINA 1RUJ2 1JYTA 3ELNA 5JZGB 1D4M1 4CCCA 4H14A 4PDWC 1RUH2 2BERA 5FZ4A 3ZYBA 2CGOA 5T52A 2SLIA 2VQAA 4BMBA 1WGPA 1UYYA 2NM1A 4JKLA 3MIFA 4IEUA 3BTAA 1NLRA 3PMSA 5FZ1A 1XSRA 1O3TA 3APBA 4FVVA 3MZHA 4QMAA 4LO6B 2VCAA 3N36A 3OYWB 1I1EA 1SLAA 3B93A 4XDOA 4B4QA 3UJQA 4XMIA 3OEBA 5BNNB 2Y6KA 1JBCA 1LOFA 3PNAA 1WD3A 4Y5TA 1FNYA 2ZOEB 3WP5A 1NE6A 5FMBA 5H9RA 1LCLA 3SEEA 2XG3A 3NRUA 1RUD2 2XLGA 3MLJA 1LKNA 4AI1A 4CU8A 4I02A 2EVXA 4I2OA 2WIIB 2LS6A 4TSVA 2DU0A 1QXPA 4Q0SA 4E4ZA 5IK8A 3TB0A 1LGCA 3GCWA 1NLSA 4J1XA 4CEYA 3RFRA 4G9SB 4W6XA 3BYWA 1O3SA 1DGWX 1G9CA 2H0BA 4YFZA 1W6MB 3CU7A 3ZSJA 1QF3A 1C8M3 3ZXLA 4PBOA 2HBUA 3N7JA 4QX8A 3TEXA 4K1ZA 5J1XA 4LNVA 1GP4A 4JQRA 3WQ1A 2PHTA 4AQ2A 1COV2 4JAAA 3OD4A 1YFWA 1GANA 3H1MA 1EAH1 4GH4C 4LXLA 4ARXA 4CDQC 2WZPP 3MUZ1 5KR7A 1N1SA 1OMIA 4JC1A 3UGGA 4D6RA 2ARCA 3AVSA 4LULA 2GC3A 4XE9A 5CFDA 4M4PA 2NLRA 4KMQA 3PTYA 4ZKTB 2EAAA 2Q30A 2YV8A 5E1RA 1A78A 3GYDA 4MXWB 2PLV3 3PURA 3V0AA 2W1WA 4YGBA 3VBRB 1FMD2 1HRI2 1REEA 2OPKA 4RHV2 2WLQA 4R52A 5DABA 3C7FA 1MVQA 4HSLA 1EUUA 2I07B 4Q4X3 3D0JA 4XIOA 3PJQA 5JAXA 3I59B 1YWKA 2AEYA 4IEXA 4AAXA 1RVF2 1ZZ6A 3IIIA 3GBFA 3HBZA 1ZZ7A 3ATGA 4JKMA 4PDWB 4ZPIA 3MF9A 3EHKA 1AR61 5C4WC 4LR4A 2OZ6A 2XXZA 3LEKA 1LOAA 1PVXA 2CGNA 2VCMA 2Y60A 3WG2A 3E5QA 4U2AA 4IV3C 4JGZC 3ZYIB 3VHRA 4PT6A 1AJOA 4YW4A 2VAUA 1AL0G 2GNTA 1C8M2 1UOFA 3TNPB 5C70A 3LA7A 4Q5OA 3O7OA 4FSJA 3VDDC 4MV2A 3AL5A 1XSQA 3ACFA 3ZFEC 2GC2A 3GM8A 1SBFA 3I3BA 4OQ9A 2ZX1A 5A32A 4UW5A 3B02A 3BIEA 4L2NA 4CSWA 3NV2A 1DHKB 1NA1B 3FLTA 2MNGA 4AGVA 2ZKLA 5FP7A 4XF0A 4GJZA 3H0OA 4XXPA 3MIHA 2RS51 2XJQA 5JXJA 3LIGA 3I2GA 3Q9OA 3KT7A 2QDRA 2W3JA 2JG9A 5FMOS 1NCRC 2E26A 4XFGA 2XUEA 3CBNA 2RMU2 5JWPA 5LY2A 1BVP1 4FOWA 4Q4X2 3S5QA 5C8WA 4P9IA 5GLTA 3VHNA 2K0GA 3CL1A 5H9SA 2WNVB 1W2TA 4GH4B 2HKXA 1NZIA 2B45X 4CDQB 2JDKA 4DS0A 1ZRIA 3JUUA 3ZIXA 4D7YA 1NXD1 1ZRFA 5KHKA 2XWJB 4UFLA 1FAYA 4ZXEA 1PO12 2N7GA 1JZ4A 1QDCA 2VQUA 1YQ8A 4CXXA 1MPXA 2J1VA 2PYTA 1PVC3 2WNEA 3OPTA 4WZCA 1JU4A 5E88A 4ZU5A 1IKQA 4LA2A 4YG6A 3TEZA 3ZYFA 3JD71 1YIPA 5EFUA 1LOFC 1QY4A 2IXLA 2G9FA 1GR3A 3WP4A 2W08A 5BYNA 1J3QA 1X50A 3U11A 3OY8B 3VD3A 5C4WB 5G05L 3EB7A 3KHBA 1V6NA 3BGAA 2XOMA 4P5HA 1MVEA 3ZYGA 4JGZB 2VQ0A 2OUHA 4YW3A 3GZAA 2OYZA 1Z7S3 1HXS1 1LRHA 1CAXB 1QNWA 3IDCB 4DY3A 4IGPA 4HVRA 2CWMA 1W8TA 1ZNPA 4AF9A 5DQ0A 2DWRA 1VBC3 3AX4A 3VDDB 3ZFEB 2C5DA 5A80A 1NX9A 2GZWA 1QJX2 2K9ZA 1GWLA 4J6GA 2A6XA 3GDBA 4NWWA 2HJIA 1CZTA 1PGL1 4QU1A 2X05A 1AVBA 4BK5A 5FY9A 2IFWA 3NNJA 1W9FA 3KVBA 4COUA 5CFDC 3HN1A 2NMNA 1DYOA 1PIV1 1FPN1 5SV5A 1OKOA 1O8PA 3VV1A 4LOSA 3DYMA 1JZ6A 4UOJA 2QFEA 1PVC2 1BLZA 2XVLA 3QCWA 1ZZBA 2W1QA 1UY1A 1CR7A 1XBFA 1Q3EA 3CZUA 4XVHA 1ZZCA 3KV9A 5J37A 3OUIA 5FZDA 1GMMA 5ISLA 4RQPA 5FYMA 2PTMA 3RJRA 3MHZA 3G7DA 4PQ9A 5C5UA 1GNYA 3LEIA 5LRSA 2PMWB 5FXVA 3PU8A 5FJKA 1SEFA 3NKGA 4Z2WA 2BRTA 1SG3A 5BNQA 4XJZA 1CX4A 4CCLA 4F3JA 1LHNA 4IE0A 2CGPA 1DYKA 3AKSA 3VBUC 1NT0A 5C9AA 2WFF2 2Q8CA 2A6ZA 3CJIA 3CDZB 3JBG2 4RL7A 2HWD1 1JYXA 1V70A 3GJBA 1TME1 1W8NA 4Y5SA 5FYZA 5F39A 1XE8A 3ZYHA 2VW1A 2VY0A 2C4XA 4AI3A 3CJXA 2AC1A 3LAGA 1CESA 3N9PA 2DURA 3ABZA 4FPLA 1RUJ1 1UXXX 4MSVA 1CJDA 2AEZA 2UWBA 3K4ZA 3WNNA 4CCKA 1BEV1 5CG8A 1ZM1A 2AREA 2XUMA 1XNDA 1E5IA 2ZCWA 3OEAA 1AL23 2DFBA 5LATA 1KFXL 3POJA 2FDGA 5F7UA 3IDBB 4NIGA 4YZ3A 4CEYB 2B46X 5F5IA 4JGYC 5FK8A 2WJSA 2YHJA 3ZDSA 4XFFA 1KDKA 2C24A 1WMXA 4I01A 4JDOA 3NKTA 4AL9A 3AMQA 4PF1A 3VBSC 2JG9C 1LOGA 1RB8G 4QM9A 2XKPA 4CTEA 5HI0A 5DAQA 5A1LA 4QQHA 4OYUA 5T50A 1NY71 2XQRA 1GZWA 1GOGA 2PHLA 1DP0A 5DAWA 2ZGKA 1NYWA 3PLQA 3BODA 3AM2A 1UF2C 5K8SA 5A3UA 2DCJA 1JHNA 4WM8C 4QKFA 5CAZA 2WQ8A 4XXAA 5CFDB 5LA0A 4WM7A 3VZKA 5JCTA 2W0XA 1TG7A 4LKFA 4JX0A 1KFUL 4P9JA 3AP6A 4QPYA 3VZNA 1VBD3 3ZYRA 2UU8A 3V0AB 5EJ3A 3K51A 1JUHA 2WT1A 2GH8A 1UY3A 1C5IA 4RFT0 4GALA 3VKFC 1S4CA 4AOCA 4N53A 3GZEA 1ND2A 4D69A 5FYTA 2R072 3KCCA 1AX1A 3RZMA 1RXGA 4XF1A 4ET7A 1AL22 2VXRA 2VOKA 2Z79A 5FOJB 1SACA 1CN1A 4IGOA 4Q0PA 1KJRA 3IAQA 1CQ9A 1L7LA 3OGJA 3D5OA 4DEVA 1I6XA 1E5SA 2FZ1A 2WS93 3HN3A 4K3UA 5EWSA 3T3YA 1YQ6A 2XL9A 3OUHA 3DPRA 5DAXA 3DGTA 1HRI1 3MFAA 5FXXA 4B1LA 5K7PA 1WCSA 1CIYA 5L9VA 3HVDA 5JR7B 4XFHA 4LUMA 1ENXA 1V9U1 2E31A 2ZGRA 3PVOA 3RYRA 2W2IA 4YGDA 2WQZC 4FBFA 5BUVA 4ZZ5A 3BB6A 4P5YA 2OA2A 1AR83 1RVF1 3ENRA 3M7AA 2BZDA 2VH9A 4AG4A 5A32B 2DTYA 5IFPA 5FYIA 3POYA 5IW0A 2QQKA 2QE3A 3SCHA 5DDJ2 4YYOA 3D3AA 3E6CC 5ACA3 2C1FA 4OI0A 1W2OA 2TUNA 2ZGPA 2WINB 4AQSA 2X8KA 3WLUA 1UCXA 4K8RB 4C1WA 4XAAA 1AR73 4LBMA 1N1TA 5FIXA 4Y22A 2D44A 2GALA 2HEWF 1LB2A 3NL1A 4HK8A 3GBGA 2JG9B 3FJSA 4QQ2A 1CX1A 2B8MA 1LULA 1W04A 1XPWA 1S1AA 1WCKA 5IVCA 4HZFA 2JB8A 1GOHA 5L36A 4RQPC 1GQGA 1QQP2 3LA3A 1TMF3 3VKLA 3DN7A 4UI9L 1ALYA 2QZ2A 4E2GA 5IVVA 4XABA 5EYXA 2ZX4A 2XH6A 5J36A 2WNUC 4GKXA 4CVUA 1B09A 1D4M3 4DUWA 1IKPA 1IOAA 2ZZJA 5A6QA 1Q8PA 1X8MA 1D4VB 4RR3A 3VHPA 3R4DB 2VMEA 3JQWA 1J1TA 1RUG3 1N47A 2V4VA 4RN5A 5C3OA 5DN2A 3SCGA 1GFF2 5FPXA 1AZDA 1R092 1AUYA 2O0OA 4LO7A 4IUGA 1NLQA 1J59A 3TN93 5FP9A 4FPOB 1EUTA 2IFRA 3N9OA 1AXKA 4UFHA 4XUPA 5C3PA 3RI8A 5ACA2 1W8WA 3H8RA 1FV3A 1I5PA 4XUTA 5FJHA 4HLTA 2W68A 3H3LA 3NWKA 3I49A 3PVEA 3S5AA 1VE0A 4AVBA 4Y1ZA 5SV8A 4QDSA 3USSA 1TEIA 3K3OA 1KGYA 3S30A 2BU9A 4M0HA 2VMCA 1KS5A 1H1IA 1PK6C 1X9TA 3HMYA 4ZONA 2V5DA 4QXHA 4NROA 1TMF2 2XJTA 3VLBB 3MV01 4LHKA 1BZWA 3P5BA 5F3EA 1ZBE2 4C8DA 5KXEA 1W6PA 2VZOA 5A3OA 5FMCA 3RJ2X 2YY1A 5LEJA 2VUDA 1EAH3 1VMJA 4HL0A 1D2SA 1H8TC 1Y4WA 1IS3A 3N9MA 5I0TA 3LCPA 5EPAA 5FYVA 1NUKA 1DYPA 1VBA1 2EXKA 2PHFA 2Z4FA 2ZPXA 4L99A 4W65A 4XF9A 5AVPA 4LK7A 4A41A 3WUDA 4XF4A 3CMGA 3WDTA 3Q8FA 4QGLA 4WVZA 1QJX1 2A3YA 2X5IA 4N53C 2A6VA 4V1PA 2VXJA 1ND2C 5CKMA 4FCAA 5FPAA 4EV0A 4RQPB 4O61A 2W92A 3LGRA 3MYXA 2JG8A 1POQA 2VTXA 5FY0A 2MPFA 4LKEA 1WWYA 3JB4C 2ENRA 2RG4A 2VBBA 2RDNA 3KGLA 4FP3A 4IERA 5B4XA 3IB3A 1D0HA 1MZ5A 5BXXA 3CJIB 5C9AB 1W8FA 1H30A 3TEYA 2HWB2 2RM22 5K4LA 5KXCA 5J98B 3HEIA 5LCWL 4JHZA 3URFA 1UKGA 5LRRA 4OI4A 1XYPA 1M4WA 4B1MA 4AVCA 1GICA 1VBB1 1LHVA 1SPPA 4AXOA 1NKGA 2H0VA 5FO9B 3NNGA 5ABJC 5E8AA 1JYIA 2D5FA 1WW7A 4XJAA 4Q8KA 2E9QA 5FKCA 3FLPA 4CCNA 3BTZA 1B35A 3NJXA 4JDNA 2KA3A 1QH7A 4DZGA 4YG0A 3NV1A 1RHI1 3PVBB 1RUOA 2RS53 1GZ9A 4CCMA 1BQPA 3V0BA 3ORJA 2WO3A 2X53S 3WF3A 4ATEA 1OUXA 1RUC2 1OKQA 1V6MA 2JKBA 1GP6A 5AC91 2GDFA 2A1XA 5A7NA 1GZWB 1YXWA 1PMHX 1EPWA 2BYVE 5C3SA 4I09A 3W58A 5JIUA 4FOYA 4MHRA 3J7HA 1F4HA 4Q4Y3 3HWJA 4WM7B 1AR62 2Y6FA 5T55A 1JXNA 5EXOA 1NE4A 4PCRA 4GQ7A 4UF0A 4YW2A 3PUSA 1IQDC 3T0AA 3UK9A 2PHUA 1DGRN 3RZGA 1F5JA 4N53B 4OUMA 2E32A 3UKNA 1ND2B 3KF5A 5GM0A 4TXWA 2P6CA 1AX2A 4Q0VA 1LODA 3DUIA 1K3IA 1EPZA 5IVBA 5CKQA 3PU3A 3KCYA 2J1EA 3D0SA 4F7ZA 5FOBB 4Y5Z0 4XMAA 2WLPA 2EIDA 4AEJA 4KWLA 3HJRA 3LDKA 3UESA 2D6MA 4QX5A 2JDYA 1S0DA 4GA9A 2PAKA 1JTZX 2DCYA 3C3VA 3DPRB 1N1YA 2RS52 1VLNA 1DQ2A 2HWE3 1DGWA 2NPIA 4QHBA 1O5UA 4Y1XA 5DPNA 4CU6A 3J8F2 1OFNA 1IQAA 4B3NA 1HXS3 3LEMA 2R071 3AMPA 1V6KA 2FCTA 4UWDA 1TNFA 4A6SA 4IL7A 4URTA 5FYCA 4UBHA 1HRV2 2FCVA 3D6EA 4WVVA 4LBKA 1T2XA 5DUVA 3WP3A 2AZ5A 5D1IA 4PI0A 4BQ3A 2ZGOA 1VR3A 3ITQA 3R4UA 3GZUC 2Y6HA 1RITA 3I2JA 4Y20A 5FZHA 3BN6A 4Y22B 3SMHA 3OUJA 3RRDA 2UWAA 3ACHA 1PIV3 2ZHMA 1FPN3 4LKSA 4XCAA 2D43A 4YW7A 2Y34A 4D6SA 1LOCA 2WUHA 4CDWC 2X5IC 1H2MA 4D7TA 2HLEA 2ZS6B 1AJKA 2RVAA 4Z1VA 4Y3OA 3JD72 4AGRA 2CL2A 3SQOA 5DDJ1 3KHCA 2QQVA 2JG8C 2CY6A 3B01A 2AH2A 3VDCA 4NHYA 1R1A1 1W99A 3KWVA 4NIAA 4BA6A 2Z5WA 4UFKA 5FWJA 1MS8A 1OLMA 4JV4A 1RIRA 3A22A 4KQ7A 1QJFA 2QQMA 1RL3A 4OCTA 4YGCA 4QDQA 4RR3B 4XQDA 4LIVA 4LMFA 2RV9A 2WWUA 3MW2A 1W2AX 4O9EA 1H1AA 2HWD3 3Q8BA 1TME3 4NO4A 4Y1YA 2B39A 4AHXA 4IEWA 4O7XA 3ZSEA 1HIXA 2VZQA 4L8QA 4N9IA 1IS6A 4CE8A 1JU3A 5IUQA 4UYBA 1RUJ3 1DFQA 3M1HA 4HKWA 2ZGQA 5LA1A 3HPNA 1RUH3 4XAEA 1PGL2 3J26N 1DGLA 3OGGA 4XUQA 3ZXDA 4EWEA 3KMHA 5F3CA 4MVTA 3T4HB 1B35C 1OLME 4QX2A 3WY6A 2D3PA 4IV3A 3ON7A 3USUA 2BQPA 3ZXAC 1IZ3A 5LA2A 4BQ1A 1FPN2 3DKQA 2FQPA 3IIAA 2GMPA 1SLIA 3POSA 1C57A 3PMEA 1SLCA 4AAPA 3ZR6A 3CIHA 4NUBA 1C4RA 1PZ7A 2WABA 1V6JA 1F35A 1SFNA 1XRUA 1RUD3 2AR6A 3INAA 1E57A 1OH3A 3WT3A 1W6PB 4CXWA 4Q1RA 4MGKE 4R9AA 1DF0A 1UMIA 2JE7A 2ARXA 3GF6A 4GKYA 4E2SA 1UXZA 4RD7A 2OVUA 4LKDA 4QAWA 1R081 2W47A 1LU1A 2VZPA 3N7LA 4FTSA 2R49A 4ORFA 5D21A 1ASJ2 1NCRA 3FHAA 2HWD2 5J09A 4S2FA 4AVVA 4TLGA 5FMOL 3TYJA 1C8NA 2X5IB 2C26A 3ZR5A 3KZ4C 5J48A 2V5YA 3U75A 1S55A 1FV2A 1ZBE1 3WQ0A 4F8AA 4N8MA 1QXRA 2VZ1A 3WEZA 3VD9A 2JG8B 1IGOA 5FZ8A 1W3XA 2QTWB 3OBTA 1BEV2 5FTTC 4A3ZA 5F6LB 4Q0QA 3FBMA 3N7MA 2ORZA 2NMOA 4QQLA 3B3QE 5FXZA 2ZTNA 2XMLA 3SCFA 3VKOA 3LFIA 2BGCA 2YDEA 3B7MA 4AW7A 1ULOA 4MXVA 4FAHA 1ACCA 5FAXA 2ZMLA 1CPMA 5FLJA 4ITCA 1FMD3 1HRI3 1HN0A 4R9CA 1SCRA 5A3TA 4M00A 4RHV3 1UOGA 4R4XA 2YPDA 4O65A 1DQ4A 1SPPB 5T5OA 1UNBA 3O1RA 1TE1B 2VMIA 5CISA 4YGEA 1RVF3 1YCIA 3QH6A 4ZU4A 5EJZB 1NY72 1SLBA 3N35A 3H1YA 1MEC2 1UIJA 1WMDA 2ID4A 1WD4A 4O9GA 3ZXFA 2WNOA 1BBT2 5H9PA 2HWB1 2RM21 1B35B 5FZ0A 3GJAA 1J3RA 3MO4A 4NHXA 4WZFA 3T2PA 4B7KA 3AYEA 1HQWA 3C7OA 1K5MC 1UYZA 5FXWA 5A6ZA 3NMBA 4ISQA 3V0BB 3T0DA 4BZ4A 1PM4A 3OSDA 2BNOA 5H9QA 4GMP0 4GWIA 4IV1C 1QJY2 5HBAA 1MACA 5FP4A 5I91A 3BTXA 1F8VA 2YUEA 4ASMB 4NJ4A 1ZRRA 3FN9A 2VOWA 5LW9A 3AVRA 4TYSA 4GB31 4CA9A 4YW5A 1RC6A 2HWF1 3U37A 3VZOA 3W59A 4BCUA 1HJGA 2OIIA 5GLZA 2XDVA 2WO7A 2Y26A 3FUOA 1BMV2 2GMEA 4P14A 3JU9A 1LU2A 1BKZA 2Q5TA 4M0NA 3WHTA 2JICA 1QDOA 1RUC1 2RJKA 4UF0B 4LBJA 2ET1A 2WBKA 1RUNA 4KWJA 3SH5A 4BM8A 2RMU3 2VC9A 4COWA 3P3NA 3SISA 1V9U2 2I2SA 3M3IA 1OT5A 3ZKUA 3SH4A 2HBTA 1W2NA 1HLCA 1TQ5A 3PJYA 3FC0A 1SBDA 4EWDA 3UT0A 4NIHA 1CWPA 1UIKA 4LBQD 2VVFA 3VBUA 2CTVA 4Z07A 4JRLA 3ZSLA
chains in the Genus database with same CATH topology
2G1MA 4MHRA 5LATA 5HV4A 3EMRA 5M0TA 3W20A 5LBBA 5HV0A 4KBZA 5EQUA 5DAQA 3PL0A 4Y5TA 5DAWA 5A3UA 4NMIA 4BQWA 4XC9A 4BQXA 2V4AA 4ZONA 3NNLA 5L9RA 2RDRA 4IW3A 3KT1A 5LASA 5DAVA 4NHLA 4XACA 4NAOA 2FCTA 4UWDA 2Y33A 3NNFA 5EPAA 5IAXA 3GZEA 2FCVA 5LBCA 2HBUA 3MGUA 3ITQA 5LBEA 2FCUA 5DAPA 3OUJA 5EP9A 4J25A 3OUHA 5DAXA 4XCAA 5LBFA 2Y34A 5L9VA 3KT4A 5L9BA 2RG4A 2RDNA 3GJAA 4NHXA 3HQRA 3NNJA 5LA9A 5LB6A 4MHUA 4NHYA 4NHKA 4XCBA 5ERLA 2G19A 4ZPIA 3OBZA 3OUIA 4XAAA 4BQYA 5C5UA 3BVCA 5C5TA 2RDQA 4JZRA 2JIGA 4Q5OA 3HQUA 4NHMA 3GJBA 5IAVA 4Y5SA 5IATA 4XABA 2HBTA 3W21A 2RDSA 3NNMA 2A1XA 2JIJA 2OPWA 3DKQA 3KT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1M A;  4MHR A;  5LAT A;  5HV4 A;  3EMR A;  5M0T A;  3W20 A;  5LBB A;  5HV0 A;  4KBZ A;  5EQU A;  5DAQ A;  3PL0 A;  4Y5T A;  5DAW A;  5A3U A;  4NMI A;  4BQW A;  4XC9 A;  4BQX A;  2V4A A;  4ZON A;  3NNL A;  5L9R A;  2RDR A;  4IW3 A;  3KT1 A;  5LAS A;  5DAV A;  4NHL A;  4XAC A;  4NAO A;  2FCT A;  4UWD A;  2Y33 A;  3NNF A;  5EPA A;  5IAX A;  3GZE A;  2FCV A;  5LBC A;  2HBU A;  3MGU A;  3ITQ A;  5LBE A;  2FCU A;  5DAP A;  3OUJ A;  5EP9 A;  4J25 A;  3OUH A;  5DAX A;  4XCA A;  5LBF A;  2Y34 A;  5L9V A;  3KT4 A;  5L9B A;  2RG4 A;  2RDN A;  3GJA A;  4NHX A;  3HQR A;  3NNJ A;  5LA9 A;  5LB6 A;  4MHU A;  4NHY A;  4NHK A;  4XCB A;  5ERL A;  2G19 A;  4ZPI A;  3OBZ A;  3OUI A;  4XAA A;  4BQY A;  5C5U A;  3BVC A;  5C5T A;  2RDQ A;  4JZR A;  2JIG A;  4Q5O A;  3HQU A;  4NHM A;  3GJB A;  5IAV A;  4Y5S A;  5IAT A;  4XAB A;  2HBT A;  3W21 A;  2RDS A;  3NNM A;  2A1X A;  2JIJ A;  2OPW A;  3DKQ A;  3KT7 A; 
#chains in the Genus database with same CATH topology
 1QNY A;  1O4Z A;  3ECQ A;  5CEH A;  3BUC A;  3VDA A;  3WCR A;  2WYS A;  1GWK A;  4XJW A;  4W6W A;  1PO1 3;  3RVH A;  2D6N A;  1A6C A;  2IVI B;  4UW4 A;  5IVF A;  4LE3 A;  2NP0 A;  4OI2 A;  3DV8 A;  1OOP A;  1UMZ A;  4GAZ A;  3OGV A;  1QH6 A;  1NCQ A;  2ZAH A;  4K6B A;  4M01 A;  3ZPO A;  3LSD A;  4CDU C;  4COV A;  3THD A;  4KBZ A;  5F5A A;  4EN8 B;  3AKP A;  5IYY A;  1O59 A;  2YXS A;  4CCO A;  3POE A;  3HQX A;  3ZO0 B;  2WFP A;  4FPY A;  5FYH A;  5CB7 A;  5HCB A;  3M3C A;  1L7Q A;  4COZ A;  4NRP A;  4Y20 B;  4IEO A;  4YWA A;  5B4N A;  2GC1 A;  3SH3 A;  1AX0 A;  2VMD A;  4J1W A;  4JGY A;  3KQR A;  4IEV A;  4UXA A;  3TWI A;  4BQW A;  3IN9 A;  2BGP A;  4XC9 A;  4DIN B;  4EE2 A;  3J8F 1;  1PO2 2;  1KQR A;  2YGL A;  2RHP A;  1VBA 3;  2LW8 A;  3IPV B;  3LFM A;  4P00 B;  3A21 A;  3AB0 A;  4QKD A;  3AXD A;  3KV5 A;  1OC1 A;  2XB6 C;  3RYK A;  3TRS B;  1HRV 1;  5IK7 A;  1H6Y A;  1VMF A;  4RGG A;  1QJX 3;  1UYX A;  2JEM A;  4BHP A;  5FZ7 A;  1LGB A;  2W46 A;  4CDX C;  4CU7 A;  1UL9 A;  4JCK A;  3LB9 A;  3MI8 A;  4NOT A;  4COY A;  4QGM A;  4BLJ A;  2BW8 A;  2PHW A;  2TNF A;  4S2G A;  4CP9 A;  2IXC A;  4LIU A;  2WN2 A;  1LR5 A;  4WM8 A;  4LO8 A;  2YBP A;  4AE2 A;  1UZW A;  4CZS A;  1US3 A;  4LE4 A;  2VOT A;  2BFU L;  4XBL A;  2DUQ A;  2ZX0 A;  4AVS A;  3RZZ A;  3POW A;  4EN6 B;  5I0S A;  5IHR A;  4OMD A;  1U5X A;  3E6B A;  1XE0 A;  2JDU A;  4J25 A;  1JZ8 A;  2DVD A;  1C28 A;  3N9N A;  3WUC A;  3KV4 A;  1HW5 A;  4XIL A;  2BBV A;  1W8U A;  5L9B A;  2KXL A;  1ONA A;  2QQO A;  2B9V A;  3JQX A;  2W91 A;  4P9L A;  1YI9 A;  1MS0 A;  1GLH A;  1VBB 3;  3S0M A;  1KJL A;  2Y8K A;  2WZR 1;  1JS9 A;  2C0Z A;  3GHN A;  3I3M A;  4IXL A;  4JRA A;  1H2N A;  3Q8A A;  4PLM A;  2WFF 3;  2ZA9 A;  4FP2 A;  1ENR A;  5C71 A;  3JBG 3;  4IV3 B;  4MGY E;  2P5B A;  3USU B;  2DUO A;  1OPO A;  5KXD A;  1ZBA 1;  5CA6 A;  1VBA 2;  2WZE A;  4QXB A;  3K2O A;  1RHI 3;  2XJR A;  3AMH A;  3B9I A;  4NR1 A;  1MS9 A;  1W28 A;  4FPG A;  2D40 A;  3QBQ A;  1S0B A;  2J1R A;  5JPN B;  4AI8 A;  1XYN A;  3OBA A;  3M3E A;  4P9W A;  5AC9 3;  4H7M A;  5FO7 B;  3NV4 A;  3HQU A;  3J7L A;  2QZ3 A;  3LDB A;  3JCI A;  5BV6 A;  5EIY B;  5FPZ A;  5A7S A;  3ES1 A;  4XJU A;  5IAT A;  3BPZ A;  5IJR A;  2O14 A;  2YGM A;  3I2O A;  1JW6 A;  1UOB A;  2KD7 A;  4Q4V 2;  4CUG A;  3OTF A;  1I9R A;  1NCR B;  1FXZ A;  4IET A;  3WNM A;  2OPW A;  3IMM A;  2VZU A;  2YC2 A;  2B7Y A;  4PI2 A;  2WA4 A;  1IS4 A;  2AEN A;  3U14 A;  5BNO C;  3BOW A;  4CXY A;  4OHX A;  3ZFF A;  1JZ7 A;  5FBJ A;  2VUL A;  1VBB 2;  5GKA C;  2GNM A;  3E97 A;  2P17 A;  1YQC A;  1W39 A;  2WNU A;  4BK4 A;  2VUC A;  3I2K A;  1YEW A;  1PNF A;  5GZF A;  1OI6 A;  4MO3 M;  1ASJ 1;  3A0K A;  3AMM A;  5FUN A;  3NJY A;  3RZL A;  1QWR A;  5FDB A;  1K45 A;  4OLL A;  3ZXK A;  1OOP C;  1RHI 2;  1XNK A;  3M3O A;  4WBB A;  5FZE A;  3VKM A;  1I3H A;  1NCQ C;  2PHR A;  3PL0 A;  3IT8 A;  4C91 A;  1F4A A;  4YG3 A;  2OQ7 A;  3ACG A;  3OOX A;  1YYN A;  5KC6 A;  5AC9 2;  4FTE A;  2J7M A;  2R07 3;  4QKN A;  4B4P A;  3RWK X;  4OHW A;  1Y7B A;  3H9A A;  1RGS A;  4YRD A;  1BJQ A;  4BIO A;  4LLF A;  1CAV A;  1H1M A;  1VBE 1;  2TBV A;  1QOT A;  4NE9 A;  4QX1 A;  3RI9 A;  1RUI 2;  5FYB A;  4DO0 A;  4DUX A;  1YQ2 A;  2EIB A;  2GH2 A;  2CDO A;  4EWA A;  2Y33 A;  4FPC A;  4PIY A;  1UN1 A;  3AYA A;  1HN1 A;  4K40 A;  2D6K A;  2R1B A;  2BJS A;  2VNO A;  1M06 G;  2PQS A;  1XE7 A;  3LPG A;  4A44 A;  1AYM 1;  1PK6 A;  1Q8Q A;  2V72 A;  5FZ9 A;  3RMY A;  1CGP A;  3U07 A;  2H6B A;  4OUS A;  1PHM A;  1VMH A;  4KGG A;  1MEC 1;  3WOG A;  1VRH 1;  2RR1 2;  1GU3 A;  2VG9 A;  1BBT 1;  2DBI A;  4OUE A;  5DAP A;  5DDJ 3;  3RQ0 A;  5I0U A;  1H8T A;  2BFU S;  2R30 A;  2JDA A;  2GN3 A;  4NRM A;  3LQC A;  5FBZ A;  1S0E A;  2XLF A;  5JUV A;  1LAJ A;  5A7W A;  5EYY A;  5JOY A;  3HQR A;  1X7N A;  1O3Q A;  1LEC A;  4CEW A;  2Q1F A;  2CSG A;  4PBP A;  1QJY 1;  1RUE 1;  5HXV A;  1HJF A;  4FXG B;  5FV3 A;  4XZU G;  3O0V A;  2ADD A;  4AWD A;  5FQ0 A;  5JSO A;  1GKB A;  1WBF A;  1QQP 3;  5ERL A;  3O5S A;  3RZJ A;  3AJY A;  3OBZ A;  3WW3 A;  2QVS B;  4DEQ A;  3D8C A;  4DRV A;  3ZN6 A;  4A7K A;  1BMV 1;  1DZT A;  5FZA A;  3VBU B;  2GNB A;  1JMU B;  3B94 A;  2X10 A;  1XU1 A;  1DG6 A;  5FMD A;  2P3Y A;  3IWZ A;  1JOJ A;  4MAD A;  2GC0 A;  2YMZ A;  1IPS A;  1CZS A;  2PHX A;  3AP5 A;  3EBR A;  3O0W A;  2GND A;  1QJU 2;  2JIG A;  3ETP A;  1UWW A;  1SQ4 A;  3NV3 A;  4QXC A;  3TAY A;  1OOP B;  3VBF A;  1X82 A;  4QHZ A;  4IQP A;  1NCQ B;  1WZX A;  4KH9 A;  5JMC A;  1QJZ A;  5EZW A;  5A1A A;  1ZA7 A;  1D2Q A;  1R09 3;  2R6Q A;  2YC4 A;  4OUL A;  1KIT A;  5ABJ A;  3PHM A;  4BIF A;  2D5H A;  2ZX3 A;  4BU2 A;  4M3C A;  1SLT A;  5JI9 A;  5E6H A;  3VDB A;  4QPI C;  5JSR A;  3EO6 A;  3ZSK A;  3CF6 E;  3NAP A;  3OPZ A;  3S7I A;  1R1A 2;  5T5P A;  5FUP A;  3G6J B;  2ZBJ A;  4JGY B;  4UW3 A;  3WF4 A;  1YQ5 A;  3GNE A;  3ZOI A;  2BVV A;  1UU5 A;  2ZAA A;  3LOI A;  4YVS C;  4S2H A;  3VBS B;  2W1S A;  1TNR A;  2DDU A;  4X8P A;  4Q0U A;  3WDW A;  2XL7 A;  5LBB A;  2JB4 A;  2EIE A;  5IFT A;  4CUA A;  3HNB M;  1UKR A;  3OG2 A;  3N7K A;  1CON A;  3EQE A;  3ZFF C;  3KGZ A;  4H2A A;  2VMH A;  4I3P A;  1BHG A;  2NQY A;  1ZBE 3;  3AZW A;  2A6Y A;  3FUQ A;  2J1S A;  1G8W A;  4HOO A;  4M3C E;  4W8J A;  4WM8 B;  3ZXJ A;  4CP9 B;  4ZU7 A;  1J3P A;  4PIZ A;  4YAR A;  3B9C A;  3A4U A;  5JPM B;  5HCF A;  1PO2 1;  1GNZ A;  4BQ5 A;  1LED A;  4FTB A;  2W95 A;  4GUL A;  3SEP A;  1S0C A;  2UWC A;  2ETE A;  2R06 2;  2GMM A;  5GZG A;  3NNL A;  2VZV A;  3KT1 A;  3U0Z A;  2A3X A;  3ZN4 A;  3W9A A;  2P3J A;  1W06 A;  5FYU A;  1SDW A;  4HON A;  4AZZ A;  3WW1 A;  2QBX A;  3ILN A;  5DZG A;  2QQU A;  2D93 A;  3H8O A;  1LHW A;  4OI1 A;  2ORX A;  1Q8V A;  4BOW A;  2HWB 3;  2RM2 3;  4OHZ A;  3T30 A;  1UOJ A;  3KS7 A;  1Y9G A;  1R08 2;  1W6O A;  4YZ5 A;  2G4I A;  2GP3 A;  5HCA A;  1YIF A;  2LUW A;  1UU4 A;  4MG2 A;  2VUJ A;  3VKN A;  1PX4 A;  2X09 A;  4AI0 A;  4LLO A;  2EXI A;  4IGQ A;  2NYY A;  1K42 A;  1NQJ A;  2Y64 A;  5FRA A;  2Q1M A;  4QQP A;  3RPQ A;  3AKT A;  2Q1Z B;  3O1M A;  1H8V A;  3ETQ A;  3ZYJ B;  4Z82 A;  1E5R A;  1WW6 A;  5LB6 A;  4GB3 3;  5KWR A;  4NII A;  4XJ9 A;  1UY4 A;  1APN A;  2ARB A;  2HWF 3;  2ZGN A;  3QAC A;  4NPM A;  3UET A;  4B29 A;  2VL4 A;  2YZ4 A;  5A3P A;  1HX6 A;  1RJ7 A;  1V6L A;  1VP6 A;  2CAV A;  3PTR B;  4CEW C;  5GLV A;  4QX3 A;  2YU1 A;  1YO8 A;  2UYA A;  3DYO A;  4AEK A;  2AYH A;  3LPF A;  2CU5 A;  4KU7 A;  4CDW A;  4NAM A;  1YRZ A;  1RUC 3;  3MW4 A;  2E7T A;  3C8X A;  3W5N A;  4C0B A;  1ND3 A;  4UBG A;  3EXU A;  3W5M A;  4NPL A;  4CRQ A;  4HFS A;  4V2V A;  5FR3 A;  3FWE A;  3LKJ A;  3HBK A;  3T1M A;  5JIA A;  1VB2 A;  2EIG A;  2WNU B;  4CPB D;  2BTV C;  3I3Q A;  1FAT A;  2MEV 2;  2D6P A;  1A3K A;  2DUP A;  1F15 A;  4Q4V 1;  3M8L A;  1PM7 A;  3AFG A;  1AR9 2;  1AR6 3;  1F5F A;  1H2L A;  1NOV A;  3AZY A;  4GXL A;  3O0X A;  5T54 A;  2ZHK A;  5ANQ A;  4BLI A;  3R4S A;  1CAW A;  1W8Z A;  1NZC A;  4K20 A;  3NO8 A;  1WLC A;  3NNM A;  3T4V A;  3VBF C;  5IVE A;  2HH9 A;  3M70 A;  4YM1 A;  1GP5 A;  2FDF A;  2VMG A;  5JOW A;  1IG0 A;  2QQL A;  2P3I A;  4KGQ A;  3HNM A;  2JDP A;  2VW2 A;  2QQP A;  4DB5 A;  4DUV A;  2JD4 A;  1PGW 1;  1RMU 2;  4C90 A;  5I8T A;  4GJY A;  1U0A A;  2A75 A;  1D7P M;  4Q8L A;  4QT6 A;  3D4K A;  5FYY A;  4CCD A;  4Z8B A;  5M0T A;  1UX7 A;  2PA7 A;  3N9L A;  4K8F A;  3F2Z A;  3NAP C;  1CAV B;  4GB3 2;  3W20 A;  4BQ2 A;  4AI9 A;  4EN0 A;  2HWF 2;  2ZMK A;  4E8D A;  4XHB A;  4D0Q A;  3EJK A;  4BE3 A;  1H4H A;  2R1D A;  5LZ6 A;  3TEW A;  1VB4 A;  4RGK A;  3QH7 A;  5EQU A;  1QOS A;  3QD6 A;  4BIS A;  4AK3 A;  2JEC A;  4AQT A;  1ZVF A;  3E5X A;  3I54 A;  1UYP A;  3J8F 3;  3AKR A;  4Z2A A;  3GHM A;  5FZB A;  3ZFG C;  1PK6 B;  3KB5 A;  3M3Q A;  3AFK A;  1J84 A;  1W9T A;  1SCS A;  1HRV 3;  2CV6 A;  3F95 A;  2GP5 A;  4BME A;  1YNA A;  3HNY M;  2ZX2 A;  3B00 A;  4BQX A;  1RUI 1;  2XJS A;  1H8T B;  4AI2 A;  1Z7S 1;  1K12 A;  3FFZ A;  2UY9 A;  2YBK A;  3MIC A;  5DUX A;  3H8X A;  2Q8O A;  2BOI A;  1VAK A;  2XJU A;  4IW3 A;  5FZG A;  3IAP A;  5A7W B;  1SZB A;  4K7J A;  1VBC 1;  4XAC A;  5F3I A;  4CEW B;  4NRQ A;  4DPN A;  2XBO 2;  4XBN A;  3LWC A;  4YVW C;  1WCD J;  1GOF A;  1JYV A;  3VD7 A;  1Z0H A;  1GV9 A;  1POV 0;  1YFU A;  4PQQ A;  3UNP A;  1JYW A;  2P4E A;  1W0O A;  1UZY A;  4OMC A;  5FQ0 B;  2DVF A;  2VD7 A;  3S57 A;  2RR1 1;  2W5F A;  1UO9 A;  2P1B A;  2ZGU A;  3JD7 3;  3WDX A;  4EQV A;  5FO8 B;  4L0P A;  5C8C A;  2EXH A;  1GYK A;  1OLR A;  1W2U A;  3ZN6 B;  3HT1 A;  4IND A;  5GJ6 A;  2RS1 2;  1SFY A;  3S6P A;  3AXE A;  1YJK A;  3WQ7 A;  4D8M A;  2VVD A;  4PF5 A;  2OX0 A;  4NVP A;  4BQ4 A;  4E8C A;  1F9K A;  1W0P A;  2GU9 A;  2XKO A;  2OKX A;  4XIK A;  2B42 B;  3VBF B;  1F2N A;  3ZMN A;  1JZ2 A;  4IES A;  2DFC A;  1UY0 A;  4XDP A;  3WNO A;  4D6Q A;  4ARY A;  3POF A;  1H6X A;  1GZC A;  2C9A A;  2D3R A;  4LBL A;  3P3P A;  2JDN A;  4QKB A;  4NHK A;  5ABJ B;  1EV1 2;  3T0B A;  4M3C B;  4XCB A;  4AHY A;  3QLQ A;  2R0H A;  1HB1 A;  2G19 A;  2YU2 A;  1WKY A;  1BXH A;  1MS3 A;  3NAP B;  4QPG A;  4FFG A;  3H3Z A;  5IVY A;  1J1L A;  1QJU 1;  4CUB A;  3ME2 A;  2E7Q A;  3P6B A;  1QJE A;  2V09 A;  4KG0 A;  1K5M A;  1RYY A;  5A7Q A;  1W3V A;  4P08 A;  3V56 A;  2RDQ A;  1ODN A;  2IXK A;  4NPR A;  1A8M A;  3RNS A;  3PUA A;  3T2T A;  1G9A A;  4MX3 A;  2AUY A;  2R04 2;  3GCX A;  5EJ1 B;  1LGN A;  2VW0 A;  5A33 A;  1UPI A;  4HAN A;  2L9L A;  4LA3 A;  4IV1 A;  3BIW E;  1UY2 A;  2F4P A;  1ND3 C;  2DCT A;  1JOD A;  2J1T A;  3M4F A;  4L11 A;  5F8P A;  5FLH A;  1OVP A;  3RS6 A;  5GLU A;  1XOY A;  3VBS A;  2YPJ A;  3CLP A;  4KWU A;  2FD8 A;  4LHN A;  3C7G A;  4BYY A;  4XBQ A;  3IMN A;  4CCE A;  2O8O A;  2BNN A;  2JIJ A;  5BY5 A;  3OJB A;  1PZ9 A;  2H6C A;  4EN7 B;  2WZR 2;  3O12 A;  3I2H A;  1LEM A;  4TTG A;  1Q8O A;  1DIW A;  3VBO C;  4LPL A;  1OF4 A;  3M2M A;  1ASJ 3;  1GNH A;  2ARA A;  2A71 A;  2W9X A;  1AXZ A;  1BK0 A;  2XHK A;  1W9W A;  1ZBA 2;  3VZM A;  5JDB A;  1DZR A;  3BAL A;  4BXF A;  1IG3 A;  4Q2F A;  3CHX A;  4QB1 A;  4QX0 A;  3KM5 A;  3WW2 A;  2P34 A;  2VCB A;  4TZD A;  3SXW A;  5FUI A;  1GQH A;  3SIT A;  5JZG C;  2RS3 2;  1FX5 A;  5J7M A;  1US2 A;  1V6I A;  4UW6 A;  1ZZ8 A;  5KHJ A;  1BEV 3;  4E4H A;  1NXM A;  1YLL A;  2ZHN A;  4DQA A;  2OQ6 A;  4MGZ E;  1WA6 X;  5A7P A;  3H8U A;  2ZGM A;  1VBE 3;  4MGI E;  4BDV B;  4LK6 A;  1W6O B;  5CNA A;  2JEN A;  2R06 1;  1FT9 A;  1RUF 2;  2Q4S A;  3IDE A;  3ZKY A;  5JSP A;  2ZGT A;  5FP3 A;  5BNN C;  4CDU A;  1FNZ A;  5DUW A;  4Y1V A;  2HWC 2;  2QKD A;  5FZC A;  4MYE A;  3AZV A;  4H7L A;  5L9R A;  1DCS A;  2QQI A;  2QCS B;  2ZMN A;  3WNL A;  4ASK A;  4IE5 A;  5C7G A;  2EIC A;  2A3W A;  4HMZ A;  4ATF A;  2E6V A;  2BP6 A;  2WS9 1;  2XON A;  4KWK A;  1L3J A;  1MEC 3;  3OGS A;  4PIX A;  4XF3 A;  3ZPY A;  4B7E A;  1S0I A;  1VRH 3;  3VD4 A;  4R4Z A;  3TNQ A;  1BBT 3;  4E4D X;  3LA2 A;  3MGU A;  2WDB A;  4W4Z A;  1AR8 1;  1A8D A;  1AYN 1;  1QXJ A;  5A3L A;  2WAA A;  4CDW B;  4RSU A;  3WNX A;  1WUV A;  1HB2 A;  3NW4 A;  1W8O A;  4XHX A;  2LRP A;  4CDX A;  1ND3 B;  1QJY 3;  1RUE 3;  1CVN A;  2QQJ A;  3N3H A;  3PUQ A;  4EN9 B;  4XPV A;  5KC5 A;  4XUR A;  1O91 A;  1OUR A;  3E6D A;  4BPZ A;  5C8C C;  4HPK A;  3VZJ A;  5A7O A;  4XYX A;  2EAL A;  4N7U A;  4MOA A;  5FLI A;  4Q29 A;  2XQX A;  3AP7 A;  4HET A;  1ULG A;  2DVG A;  1AF9 A;  3PUH A;  4ASL A;  4N90 A;  1VBE 2;  2WSU A;  1MS4 A;  2VEC A;  1W90 A;  2ZAB A;  3GZT B;  4QDR A;  3ILR A;  1CAW B;  5A3N A;  5A3M A;  2DU1 A;  3BU0 A;  1OXC A;  2C6S A;  4P9Y A;  5DUU A;  3IZO A;  3THP A;  2JJ6 A;  3O14 A;  4YNI A;  3MEP A;  2J1A A;  1V9U 3;  4MZU A;  4A3X A;  1U5Z A;  2XLA A;  1E5H A;  1KD7 A;  1P8J A;  1AYM 2;  2FBE A;  5EHD A;  2ZEZ A;  1WLD A;  2MEV 1;  2R0F A;  2ZHL A;  1VRB A;  2DCZ A;  1Y3T A;  3HT2 A;  3POG A;  1AR9 1;  1VRH 2;  4IE4 A;  4QPG C;  5HPO A;  2JDM A;  2VOV A;  3DXU A;  3HD8 B;  5JXH A;  1RUG 1;  4MET A;  3J7M A;  2WT2 A;  1H0B A;  2D6L X;  2JWP A;  5D8A A;  2VCC A;  4FXK B;  1KS4 A;  3RDI A;  3SKV A;  1G9D A;  2VZS A;  2BWC A;  5IK4 A;  1UQX A;  5GZD A;  3TN9 1;  3AL6 A;  1RMU 1;  2FDJ A;  3VB9 A;  1RUE 2;  3UJO A;  5JOX A;  4DFS A;  4ERO A;  2ATF A;  3ROU A;  1NA1 C;  4YM0 A;  4GD4 A;  1ZZ9 A;  1VAM A;  1O8S A;  4A7Y A;  2RJL A;  3POI A;  2Z2S B;  5F32 A;  3SHR A;  4GWJ A;  4RYD A;  2LRO A;  4ZY9 A;  4XUN A;  2CNA A;  1JZ5 A;  3A7Q A;  3EMR A;  2WSV A;  3ZLI A;  2DYC A;  2OS2 A;  2YFZ A;  2VR4 A;  4LHS A;  1GQP A;  4PLO A;  4SLI A;  3VGI A;  5I0D A;  1WCQ A;  1JZ3 A;  4TLF A;  3BTY A;  1URX A;  3J9S A;  1PO2 3;  2B4K A;  3FBY A;  2DTW A;  3UGH A;  2BBA A;  2YYO A;  3ILF A;  1WMF A;  5LK5 A;  1RXF A;  2OT7 A;  2XVG A;  4HN1 A;  2VO5 A;  5FWE A;  5CVR A;  3SLI A;  3WDV A;  5GAL A;  4TWT A;  5F2W A;  5BNO A;  2WNV C;  2QQW A;  5B2G B;  4UT5 A;  1OQD A;  4BXS V;  2YB7 A;  4LQR A;  1QMJ A;  1X33 A;  5C8C B;  2P6H A;  1WLW A;  4P02 B;  1ST8 A;  3U1X A;  1RTV A;  5FK7 A;  1KEX A;  2JDZ A;  3UL2 A;  1DQ5 A;  4JKK A;  4JTO A;  2QJV A;  5C6C A;  3VHO A;  2VZ3 A;  3K77 A;  2P2K A;  5F3G A;  1POV 1;  1XQN A;  2XBO 1;  1S0J A;  4I0A A;  3PVN A;  4HSJ A;  2P3K A;  2Q0A A;  5C3Q A;  4W50 A;  5K9Y A;  3I2I A;  2UUR A;  4IE7 A;  4H55 A;  3T08 A;  2CHH A;  3ALQ A;  4B4R A;  2CAU A;  5CAD A;  1CAU A;  5FZL A;  1OVS A;  4R9D A;  5CG9 A;  3AP4 A;  2TEP A;  1V6O A;  3POB A;  3VL9 A;  2XPJ A;  3ZSM A;  4HBN A;  2RS1 1;  3MDP A;  3P1I A;  4PLN A;  1X8E A;  5CKN A;  2JDH A;  4Y1U A;  4QPG B;  4RFR B;  3I7D A;  5I0R A;  1OF3 A;  1WBL A;  2D7F A;  3PIG A;  3GAL A;  1MQT A;  5APA A;  2PFW A;  3UV9 A;  4CP0 A;  3CKH A;  1K5M B;  2VTF A;  3MIB A;  4Q4W 1;  5IT6 A;  4YZ4 A;  5A6Y A;  1Q5O A;  1IPK A;  1IHM A;  3O1O A;  1HDK A;  2BDR A;  4OQ8 A;  5A33 B;  3NJZ A;  3DKW A;  5HXM A;  4IV1 B;  1AHS A;  1EV1 1;  4ZXK A;  1GZT A;  1N1V A;  2HEY F;  3AYD A;  1Z78 A;  2ZEW A;  1YUD A;  1XU2 A;  1VPH A;  1ZX5 A;  4NID A;  1O5L A;  5F2S A;  3T2O A;  1LNS A;  3PIJ A;  3AC0 A;  2GSY A;  3ASI A;  2EF6 A;  1OH4 A;  5BNP A;  3AZX A;  2JE9 A;  1W6N A;  2PLV 2;  3JXS A;  1QGL A;  4P9X A;  1QEX A;  3VBH A;  3ZXE A;  1WME A;  2R04 1;  4Q4V 3;  1XYO A;  4XEZ A;  3BVC A;  4FT8 A;  3CZJ A;  1C1L A;  4Y4R A;  4XTM A;  3U4S A;  3AMN A;  1G9B A;  5E16 A;  2VVE A;  2VBD A;  1LTE A;  3A0N A;  2FMD A;  3MID A;  4EJR A;  3I3E A;  4Q4Y 1;  4QU2 A;  3BKZ A;  2VJX A;  1MS5 A;  1W8H A;  3IBM A;  1J58 A;  1K5J A;  5FRE A;  5IAV A;  2W39 A;  1O4T A;  3ZVX A;  3RSJ A;  3MW3 A;  1CD3 G;  3DXT A;  2W52 A;  5CBL A;  1QHD A;  1S0G A;  4A4A A;  1GBG A;  2EXJ A;  3MFC A;  1Q8S A;  5F9T A;  1KRI A;  1XNB A;  2A7A A;  4GWM A;  4HK9 A;  4IEY A;  5D8A C;  4YM3 A;  4A7Z A;  5DZF A;  2G1M A;  4R8H A;  3ZN5 A;  4CDU B;  1Q56 A;  1ZYB A;  5L7O A;  3RZH A;  5JVV A;  4M3C F;  2RS3 1;  3WCS A;  1W03 A;  1FYU A;  3AYC A;  2O8Q A;  2Z42 A;  1MR5 A;  3H7J A;  2RJ2 A;  2VZT A;  3O1P A;  4QPI A;  5CFC A;  5A1F A;  3V65 A;  5CYY A;  2FDH A;  3RWN A;  4CEY C;  3O1V A;  2QNK A;  2HWE 1;  1RUI 3;  4FFI A;  2WWS A;  4A2U A;  3PUI A;  5JLV A;  1RUF 1;  4YVS A;  4LBQ A;  4PHZ A;  4QB2 A;  4XET A;  1HV0 A;  2VPV A;  3WP6 A;  2Y6L A;  2WO1 A;  4MH0 E;  2HWC 1;  5FZ6 A;  4HG6 B;  5IK5 A;  3ZMO A;  1G9F A;  2PN5 A;  3AKQ A;  4XFB A;  1VAV A;  2XGX A;  3MUY 1;  3LIH A;  4CDX B;  3E1F 1;  3MBW A;  3OCP A;  4AR2 A;  4HKL A;  3T2Q A;  2PEL A;  1RED A;  2YBS A;  1X9P A;  3I3D A;  4EYU A;  2RDR A;  4Y33 A;  5JXG A;  1PGW 2;  2RR1 3;  4HPK B;  1DQ0 A;  1JHJ A;  1W9S A;  3MPP G;  1FOD 1;  3BOP A;  4FPJ A;  4IEZ A;  4NAO A;  1A34 A;  2DVB A;  2IXH A;  2PQQ A;  3DEC A;  3OB8 A;  1ULE A;  4X6Q B;  5FP8 A;  1BK1 A;  1LOE A;  5LBC A;  5IVJ A;  5DG2 A;  5FZI A;  1JN2 P;  3MLL A;  4QQO A;  2VNR A;  5FCC A;  3DCQ A;  5AVA A;  1XC6 A;  3CEW A;  3LZZ A;  5IWF A;  1YJL A;  2WL1 A;  1JUI A;  1ULP A;  4AFM A;  1XNC A;  4F83 A;  1I5Z A;  2W94 A;  5JMO A;  1N3Q A;  3N4M A;  3KLS A;  3KQ4 B;  1STM A;  4QM8 A;  4CU9 A;  1FI2 A;  3JB8 A;  1PMI A;  2VU9 A;  4FPE A;  4P9G A;  4X8N A;  5F6K A;  5L19 A;  4EZH A;  4DOU A;  2DVA A;  2B9U A;  2XWB B;  3J7N A;  2A73 B;  5LA9 A;  4XOG A;  4MGT A;  2Q8D A;  1MQT C;  5FZF A;  1Z7S 2;  1OBN A;  2YRO A;  3OBR A;  1DZQ A;  4LJH A;  5D8A B;  2LAL A;  5FZ3 A;  2EA7 A;  1QJU 3;  3BCW A;  2AAC A;  3LSE A;  3UKV A;  5FY4 A;  1VBC 2;  2O1Q A;  4FPF A;  4DRR A;  3BPS A;  3C2U A;  4JVA A;  3ZIW A;  2AGS A;  3WR0 A;  4HT1 T;  3WXP A;  1VJ2 A;  4U36 A;  2BOJ A;  1RUH 1;  1G6N A;  5FFO C;  5CIR A;  1XXN A;  1PMJ X;  4BQY A;  3THC A;  1QOO A;  2ZKN A;  3WVJ A;  4A6O A;  5DMY A;  1F31 A;  4LOR A;  4ZZ8 A;  2BPA 2;  1R1A 3;  3UGF A;  2ADE A;  2HEV F;  3LEG A;  3SNM A;  5BNP C;  4EZ4 A;  4L9B A;  1PGS A;  3VBH C;  5DG1 A;  4AHW A;  5CU1 A;  3AZZ A;  4GMP 1;  1NQD A;  2ERF A;  3OGR A;  3VD5 A;  4DXZ A;  5JR2 A;  2WN3 A;  4AFB A;  5DXD A;  1RUD 1;  3W21 A;  2D97 A;  2VNG A;  5BNO B;  4Y4Y A;  1JH5 A;  3FHQ A;  5D2A A;  3WF1 A;  3FX3 A;  5FZO A;  4S2D A;  1J83 A;  5HV4 A;  3MIG A;  1CIW A;  4KNC A;  3BI3 A;  3LF7 A;  4Q27 A;  2VGD A;  1EP0 A;  2IVJ A;  1C3H A;  2IXJ A;  3L2H A;  2Y6J A;  5E89 A;  4KI5 M;  1PNG A;  4OHY A;  3VUO A;  4XFC A;  1O3R A;  1N3O A;  5FY1 A;  1COV 1;  4QGN A;  4D3W A;  5L7O C;  2R06 3;  2A6W A;  5I8Y A;  1CAU B;  4RS5 A;  5FKB A;  1O4Y A;  2E63 A;  2Z69 A;  1W05 A;  3ZYP A;  4I30 A;  5CFC C;  4RA0 A;  3SKJ E;  3UYJ A;  3K46 A;  3GGL A;  4NMI A;  4OFG A;  3H50 A;  3ACI A;  4YPJ A;  1Y43 B;  3S7E A;  2ZAC A;  4DNY A;  1MQT B;  1FMD 1;  5LEK A;  4Y26 A;  4RHV 1;  1C5H A;  1S0F A;  2RE9 A;  4XTP A;  2BUK A;  1R08 3;  4LBO A;  5DAV A;  3T1L A;  3B5L B;  2D3S A;  5G04 L;  2QDN A;  2K46 A;  3ZFG A;  1AYN 3;  4H3W A;  2XJV A;  1NG0 A;  3WD5 A;  2J22 A;  3R05 A;  2FDI A;  4XUO A;  1MS1 A;  1O6U A;  3CNA A;  5A3W A;  4UFM A;  2DV9 A;  4QB6 A;  2CYF A;  2D98 A;  1MZF A;  2E51 A;  3NJV A;  2QQN A;  2XJP A;  5FPU A;  1U5Y A;  1EYB A;  1XJA A;  2VM9 A;  4Q1P A;  2LTN A;  4AED A;  5BNP B;  2SBA A;  3WF0 A;  1C8M 1;  1W6N B;  4YLZ A;  1VBD 2;  2VQT A;  2IXI A;  3VBH B;  4AFA A;  5EP9 A;  2GN7 A;  2E7A A;  3HAG A;  2PAE A;  4JHT A;  5FZM A;  4FOQ A;  3FLR A;  2HYK A;  1YFX A;  4YVW A;  4ZS3 A;  1PZ8 A;  3AJZ A;  3WF2 A;  1ULF A;  4WVM A;  5AFE A;  3ZDV A;  4QX7 A;  4CP1 A;  4B8E A;  1DQ1 A;  1DLL A;  5AFB A;  4Y24 A;  3WG4 A;  3O1U A;  1CPN A;  2YG0 A;  2OXB A;  4XQ4 A;  2G9G A;  3BU7 A;  2W1U A;  3WX5 A;  5FZK A;  4MLO A;  3VL8 A;  5C9A C;  2PLV 1;  1UMH A;  2MEV 3;  3CJI C;  2WT0 A;  2WS9 2;  3KV6 A;  3LDR A;  4G4F A;  4GZ9 A;  4K21 A;  4HN0 A;  5T5L A;  3WHU A;  1LES A;  3WNK A;  4E2Q A;  1AR9 3;  3I2D A;  2RMU 1;  3SC7 X;  4I0W B;  3C7H A;  4R9B A;  2FZ2 A;  1WW5 A;  2Y0I A;  5I93 A;  4HXC A;  4Q4X 1;  1Q43 A;  4MUV A;  4I3G A;  4YZ2 A;  1AR8 2;  5L7O B;  1AYN 2;  5C5T A;  3K4A A;  3HR9 A;  4WV8 A;  5F5Q A;  3WDU A;  4AQ6 A;  4GWN A;  3RMX A;  2ZEY A;  4MGQ A;  2Y6G A;  2HYX A;  1RMU 3;  1V0A A;  4KG8 A;  5EV7 A;  3ZX7 A;  3KSC A;  3RYP A;  4QPI B;  4AFD A;  5CFC B;  3R0R A;  1JOP A;  4TN7 A;  4WVW A;  4DY5 A;  1MZ6 A;  2A5Z A;  3FL7 A;  1PO1 1;  2VZR A;  3H7Y A;  3WIN E;  1AR7 2;  2V73 A;  4YFW A;  2KR2 A;  2RDS A;  5A70 A;  1G7Y A;  1ULC A;  4YW6 A;  4YVS B;  3NVC A;  4LBQ B;  3FHI B;  1H2K A;  1OFS A;  2WA3 A;  2XVK A;  1S2E A;  4AVT A;  1N3P A;  2IWG B;  2KM2 A;  3L9J T;  4UFI A;  1DGR A;  1X36 A;  4OZO A;  3IDA A;  5GLW A;  3GXU A;  3K75 B;  1MZE A;  3ZFF B;  2FDK A;  1CJP A;  4QHO A;  4L92 A;  1R1Z A;  5J96 B;  3OPW A;  3KCX A;  5HV0 A;  1D4M 2;  2F6B A;  4FO9 A;  4E27 A;  4YZ1 A;  4FI9 A;  1IPJ A;  1ENS A;  3JZV A;  2BNM A;  4WM7 C;  3MF6 A;  3X29 B;  3WNP A;  2Y38 A;  1WW4 A;  1RJ8 A;  4ZS2 A;  3V64 A;  1LJ7 A;  3VBO A;  1W6Q A;  1RUG 2;  2J1U A;  1QU0 A;  4QPW A;  4L97 A;  2VBP A;  5K0U A;  4Z92 B;  1POV 3;  5CZK A;  4AFC A;  2XBO 3;  3WSO A;  4DXS A;  5LK7 B;  4N43 A;  4X6R B;  2A70 A;  3WZ1 A;  4RS5 C;  2XR4 A;  2WAO A;  3TN9 2;  2Y0O A;  4BWO A;  4IE6 A;  5F5C A;  2V4A A;  1UX6 A;  1OLQ A;  5JZG A;  2JXA A;  4QD2 A;  5I8S A;  3R6S A;  1KXG A;  5KHH A;  5KHG A;  4JDM A;  5LAS A;  1DDL A;  1UW8 A;  3NST A;  2PAM A;  1WLT A;  1XB9 A;  2RS1 3;  1PVC 1;  1SLL A;  1YFY A;  2CDP A;  1XNA A;  2JE8 A;  4FPK A;  4XJ8 A;  3DPR C;  3NNF A;  4AEM A;  1IS5 A;  5JXI A;  4AHZ A;  1BCX A;  1QKQ A;  4DXR A;  3O1T A;  1O7F A;  5T5J A;  4AYU A;  3O1S A;  3OYW A;  1BVV A;  2UY8 A;  4FQ4 A;  4AVA A;  4GIQ A;  4Q4W 3;  4K9S A;  1C1F A;  4N7I A;  5BNN A;  1S2K A;  3D82 A;  4LUK A;  1BYH A;  2BV4 A;  3FMG A;  3UKT A;  3I97 A;  4ES9 A;  2CWS A;  3I2F A;  3TOJ A;  3OD0 A;  1EV1 3;  2WFF 1;  1EAH 2;  4DMI A;  2DF7 A;  3LE0 A;  3IKW A;  3JBG 1;  1W0N A;  3K4D A;  1OA4 A;  4IEP A;  4NN0 A;  5LY1 A;  2D6O X;  3KT4 A;  1Y9Q A;  3KF3 A;  2Q8E A;  1JYC A;  5L73 A;  2JX9 A;  3ZM8 A;  4C1X A;  4AED C;  4BH9 A;  1YC6 1;  5TSW A;  2F17 A;  5KBF A;  1SHW B;  2FMY A;  1DQ6 A;  3ES4 A;  4CCJ A;  1W6M A;  5HCH A;  2E33 A;  4JQT A;  2UYB A;  2WR9 A;  3GBW A;  4AGG A;  3Q8C A;  2R04 3;  2B5H A;  3HIF A;  1HKD A;  4CUC A;  1KDM A;  2WYF A;  4JTN A;  1HQN A;  2ZJC A;  1R64 A;  2E53 A;  5FZO B;  3RZK A;  4UAP A;  4FAG A;  4CP2 A;  4V2W A;  2PXJ A;  2R32 A;  3WV6 A;  2J42 A;  2WZR 3;  1OHF A;  1TVG A;  2WWJ A;  3H3U A;  1DLC A;  4MXW A;  1UU6 A;  4RR3 C;  3ZXG A;  2I45 A;  4DIQ A;  5LWB A;  4IEQ A;  2P37 A;  4N9H A;  2NN8 A;  2WC2 A;  5DZE A;  3RGB A;  1YHF A;  1H9W A;  3VBR A;  5KHI A;  4LEJ A;  4Q4W 2;  1W9Y A;  1ZBA 3;  4OZX A;  5FY8 A;  5A6X A;  4E4S A;  2VNV A;  1H4G A;  3I8T A;  4W6Y A;  1ZRC A;  1ZRD A;  4RS5 B;  5F1R A;  1OA3 A;  3I59 A;  2C9K A;  3E5U A;  1UZZ A;  4PJY A;  4CYD A;  1VIW B;  1SFP A;  1ZA4 A;  2RS3 3;  1PX3 A;  4KU8 A;  4PDW A;  4YM2 A;  1SDD B;  2OW4 A;  1ODM A;  1WCU A;  3FE5 A;  5FPL A;  3VZL A;  3DYP A;  3NQH A;  1AXY A;  1XNT A;  3J4U H;  4M4R A;  4NWV A;  3L2Y A;  1U5I A;  5JOZ A;  4E9K A;  2W87 A;  2G9Z A;  4CPB A;  1LHO A;  3WG1 A;  3U4X A;  4LHL A;  4OVE A;  1EY2 A;  1RUF 3;  3KVA A;  4A42 A;  2VMF A;  4KBB A;  5FYS A;  2HWC 3;  3ZFG B;  1AL2 1;  2VTX J;  4LO4 B;  4LBN A;  5C3R A;  5C33 A;  3PDQ A;  1HB3 A;  4Q26 A;  3WW4 A;  4QXK A;  1NA1 A;  1GWM A;  1HB4 A;  2BEO A;  2OZJ A;  3H42 B;  1JOB A;  4IDZ A;  5KXB A;  2I74 A;  2ZEX A;  2ZXQ A;  4YSF A;  4Q4Y 2;  3FFQ A;  2WQ4 A;  3H1W A;  5T3N A;  4XW3 A;  2K2S A;  4HKO A;  4C0H A;  4AED B;  4LTA A;  1FOD 3;  2LM3 A;  2IUW A;  1Y9M A;  3ACL A;  4LOT A;  4ONU A;  4XDQ A;  5FY7 A;  3IPV A;  3U78 A;  5K0U C;  5J3U A;  1UZ0 A;  4XQW A;  4YVW B;  1UD1 A;  1GUI A;  1OD5 A;  2VUA A;  2OUJ A;  3LD8 A;  4N43 C;  4WVM B;  5GZE A;  3VN4 A;  3MIE A;  2R16 A;  3QOP A;  4NHL A;  2IC1 A;  2WNV A;  5FY5 A;  2WKK A;  2YFU A;  4GH4 A;  1T6G C;  4CDQ A;  1HV1 A;  2BVB A;  5JI7 A;  5F37 A;  5IAX A;  2R7E B;  1HQL A;  4KL1 A;  4SBV A;  4FQZ A;  1OSG A;  3CO2 A;  2BWA A;  3KD4 A;  1QIQ A;  1ULD A;  1OA2 A;  1S2B A;  1G86 A;  1VAL A;  1VBD 1;  1OUS A;  4MGS A;  3K3N A;  4XFI A;  5LBE A;  1UPS A;  1T6B X;  1NAE A;  2XHN A;  4RGA A;  3FZ3 A;  1H9P A;  1U12 A;  1UAI A;  2QUO A;  4QWN A;  2HWE 2;  4BB3 A;  4ISR A;  2FHR A;  2WZ8 A;  4URA A;  4FPH A;  2GAU A;  4ZHN A;  2FCU A;  3B69 A;  2DBN A;  1JYN A;  1GSL A;  1HXS 2;  2F4L A;  4XZP A;  2PHD A;  2VE1 A;  3OF1 A;  1QQP 1;  5LBF A;  2ES3 A;  1V00 A;  2VOX A;  3WDY A;  4XFA A;  5BPX A;  1TZO A;  3WQB A;  1AYM 3;  3THT A;  3OY8 A;  2NZ9 A;  3DF0 A;  1OQ1 A;  2ET7 A;  5C4W A;  2ZGL A;  3CQO A;  4MHU A;  4A45 A;  5GZC A;  1FOD 2;  4JGZ A;  4D7S A;  4YW1 A;  2WRA A;  1OQE A;  4ES8 A;  1REF A;  1ZRE A;  4FFH A;  1YI7 A;  1PIV 2;  2BGO A;  2MHF A;  1CAX A;  1LOB A;  2WO2 A;  3DL3 A;  3N9Q A;  3Q8E A;  4LO5 B;  4UFJ A;  3HOB A;  3ST7 A;  3LOB A;  4HVO A;  1D0G A;  3MLK A;  4LIT A;  1R09 1;  2EAK A;  4GMP 3;  4I0B A;  3VDD A;  3ZFE A;  4DXT A;  4FFF A;  4G3Y C;  3A23 A;  3MPB A;  4LT5 A;  5FPV A;  3EYP A;  3T09 A;  3AP9 A;  1OPM A;  2ZZQ A;  4JZR A;  5ACA 1;  3RG0 A;  2IZW A;  3U10 A;  3DEM A;  3I4I A;  3MV1 1;  1OD3 A;  1AR7 1;  1WA4 A;  4NHM A;  4D94 A;  3WG3 A;  3K48 A;  4K1Y A;  3TBD A;  1ENQ A;  1UZV A;  2JKX A;  2X29 A;  1DU3 D;  3AK0 A;  1DBN A;  1JI6 A;  4FOV A;  3VBO B;  4BJ0 A;  1L7R A;  1W6Q B;  2ZGS A;  4HVQ A;  1SBE A;  5K0U B;  3VBR C;  1TME 2;  2DCK A;  3IM0 A;  2JD9 A;  3C7E A;  4OHV A;  2YC0 A;  1TMF 1;  4N43 B;  1LEN A;  2ILM A;  5FPB A;  1CZV A;  1SMV A;  1LHU A;  5ANN A;  1COV 3;  1RIN A;  1RUJ 2;  1JYT A;  3ELN A;  5JZG B;  1D4M 1;  4CCC A;  4H14 A;  4PDW C;  1RUH 2;  2BER A;  5FZ4 A;  3ZYB A;  2CGO A;  5T52 A;  2SLI A;  2VQA A;  4BMB A;  1WGP A;  1UYY A;  2NM1 A;  4JKL A;  3MIF A;  4IEU A;  3BTA A;  1NLR A;  3PMS A;  5FZ1 A;  1XSR A;  1O3T A;  3APB A;  4FVV A;  3MZH A;  4QMA A;  4LO6 B;  2VCA A;  3N36 A;  3OYW B;  1I1E A;  1SLA A;  3B93 A;  4XDO A;  4B4Q A;  3UJQ A;  4XMI A;  3OEB A;  5BNN B;  2Y6K A;  1JBC A;  1LOF A;  3PNA A;  1WD3 A;  4Y5T A;  1FNY A;  2ZOE B;  3WP5 A;  1NE6 A;  5FMB A;  5H9R A;  1LCL A;  3SEE A;  2XG3 A;  3NRU A;  1RUD 2;  2XLG A;  3MLJ A;  1LKN A;  4AI1 A;  4CU8 A;  4I02 A;  2EVX A;  4I2O A;  2WII B;  2LS6 A;  4TSV A;  2DU0 A;  1QXP A;  4Q0S A;  4E4Z A;  5IK8 A;  3TB0 A;  1LGC A;  3GCW A;  1NLS A;  4J1X A;  4CEY A;  3RFR A;  4G9S B;  4W6X A;  3BYW A;  1O3S A;  1DGW X;  1G9C A;  2H0B A;  4YFZ A;  1W6M B;  3CU7 A;  3ZSJ A;  1QF3 A;  1C8M 3;  3ZXL A;  4PBO A;  2HBU A;  3N7J A;  4QX8 A;  3TEX A;  4K1Z A;  5J1X A;  4LNV A;  1GP4 A;  4JQR A;  3WQ1 A;  2PHT A;  4AQ2 A;  1COV 2;  4JAA A;  3OD4 A;  1YFW A;  1GAN A;  3H1M A;  1EAH 1;  4GH4 C;  4LXL A;  4ARX A;  4CDQ C;  2WZP P;  3MUZ 1;  5KR7 A;  1N1S A;  1OMI A;  4JC1 A;  3UGG A;  4D6R A;  2ARC A;  3AVS A;  4LUL A;  2GC3 A;  4XE9 A;  5CFD A;  4M4P A;  2NLR A;  4KMQ A;  3PTY A;  4ZKT B;  2EAA A;  2Q30 A;  2YV8 A;  5E1R A;  1A78 A;  3GYD A;  4MXW B;  2PLV 3;  3PUR A;  3V0A A;  2W1W A;  4YGB A;  3VBR B;  1FMD 2;  1HRI 2;  1REE A;  2OPK A;  4RHV 2;  2WLQ A;  4R52 A;  5DAB A;  3C7F A;  1MVQ A;  4HSL A;  1EUU A;  2I07 B;  4Q4X 3;  3D0J A;  4XIO A;  3PJQ A;  5JAX A;  3I59 B;  1YWK A;  2AEY A;  4IEX A;  4AAX A;  1RVF 2;  1ZZ6 A;  3III A;  3GBF A;  3HBZ A;  1ZZ7 A;  3ATG A;  4JKM A;  4PDW B;  4ZPI A;  3MF9 A;  3EHK A;  1AR6 1;  5C4W C;  4LR4 A;  2OZ6 A;  2XXZ A;  3LEK A;  1LOA A;  1PVX A;  2CGN A;  2VCM A;  2Y60 A;  3WG2 A;  3E5Q A;  4U2A A;  4IV3 C;  4JGZ C;  3ZYI B;  3VHR A;  4PT6 A;  1AJO A;  4YW4 A;  2VAU A;  1AL0 G;  2GNT A;  1C8M 2;  1UOF A;  3TNP B;  5C70 A;  3LA7 A;  4Q5O A;  3O7O A;  4FSJ A;  3VDD C;  4MV2 A;  3AL5 A;  1XSQ A;  3ACF A;  3ZFE C;  2GC2 A;  3GM8 A;  1SBF A;  3I3B A;  4OQ9 A;  2ZX1 A;  5A32 A;  4UW5 A;  3B02 A;  3BIE A;  4L2N A;  4CSW A;  3NV2 A;  1DHK B;  1NA1 B;  3FLT A;  2MNG A;  4AGV A;  2ZKL A;  5FP7 A;  4XF0 A;  4GJZ A;  3H0O A;  4XXP A;  3MIH A;  2RS5 1;  2XJQ A;  5JXJ A;  3LIG A;  3I2G A;  3Q9O A;  3KT7 A;  2QDR A;  2W3J A;  2JG9 A;  5FMO S;  1NCR C;  2E26 A;  4XFG A;  2XUE A;  3CBN A;  2RMU 2;  5JWP A;  5LY2 A;  1BVP 1;  4FOW A;  4Q4X 2;  3S5Q A;  5C8W A;  4P9I A;  5GLT A;  3VHN A;  2K0G A;  3CL1 A;  5H9S A;  2WNV B;  1W2T A;  4GH4 B;  2HKX A;  1NZI A;  2B45 X;  4CDQ B;  2JDK A;  4DS0 A;  1ZRI A;  3JUU A;  3ZIX A;  4D7Y A;  1NXD 1;  1ZRF A;  5KHK A;  2XWJ B;  4UFL A;  1FAY A;  4ZXE A;  1PO1 2;  2N7G A;  1JZ4 A;  1QDC A;  2VQU A;  1YQ8 A;  4CXX A;  1MPX A;  2J1V A;  2PYT A;  1PVC 3;  2WNE A;  3OPT A;  4WZC A;  1JU4 A;  5E88 A;  4ZU5 A;  1IKQ A;  4LA2 A;  4YG6 A;  3TEZ A;  3ZYF A;  3JD7 1;  1YIP A;  5EFU A;  1LOF C;  1QY4 A;  2IXL A;  2G9F A;  1GR3 A;  3WP4 A;  2W08 A;  5BYN A;  1J3Q A;  1X50 A;  3U11 A;  3OY8 B;  3VD3 A;  5C4W B;  5G05 L;  3EB7 A;  3KHB A;  1V6N A;  3BGA A;  2XOM A;  4P5H A;  1MVE A;  3ZYG A;  4JGZ B;  2VQ0 A;  2OUH A;  4YW3 A;  3GZA A;  2OYZ A;  1Z7S 3;  1HXS 1;  1LRH A;  1CAX B;  1QNW A;  3IDC B;  4DY3 A;  4IGP A;  4HVR A;  2CWM A;  1W8T A;  1ZNP A;  4AF9 A;  5DQ0 A;  2DWR A;  1VBC 3;  3AX4 A;  3VDD B;  3ZFE B;  2C5D A;  5A80 A;  1NX9 A;  2GZW A;  1QJX 2;  2K9Z A;  1GWL A;  4J6G A;  2A6X A;  3GDB A;  4NWW A;  2HJI A;  1CZT A;  1PGL 1;  4QU1 A;  2X05 A;  1AVB A;  4BK5 A;  5FY9 A;  2IFW A;  3NNJ A;  1W9F A;  3KVB A;  4COU A;  5CFD C;  3HN1 A;  2NMN A;  1DYO A;  1PIV 1;  1FPN 1;  5SV5 A;  1OKO A;  1O8P A;  3VV1 A;  4LOS A;  3DYM A;  1JZ6 A;  4UOJ A;  2QFE A;  1PVC 2;  1BLZ A;  2XVL A;  3QCW A;  1ZZB A;  2W1Q A;  1UY1 A;  1CR7 A;  1XBF A;  1Q3E A;  3CZU A;  4XVH A;  1ZZC A;  3KV9 A;  5J37 A;  3OUI A;  5FZD A;  1GMM A;  5ISL A;  4RQP A;  5FYM A;  2PTM A;  3RJR A;  3MHZ A;  3G7D A;  4PQ9 A;  5C5U A;  1GNY A;  3LEI A;  5LRS A;  2PMW B;  5FXV A;  3PU8 A;  5FJK A;  1SEF A;  3NKG A;  4Z2W A;  2BRT A;  1SG3 A;  5BNQ A;  4XJZ A;  1CX4 A;  4CCL A;  4F3J A;  1LHN A;  4IE0 A;  2CGP A;  1DYK A;  3AKS A;  3VBU C;  1NT0 A;  5C9A A;  2WFF 2;  2Q8C A;  2A6Z A;  3CJI A;  3CDZ B;  3JBG 2;  4RL7 A;  2HWD 1;  1JYX A;  1V70 A;  3GJB A;  1TME 1;  1W8N A;  4Y5S A;  5FYZ A;  5F39 A;  1XE8 A;  3ZYH A;  2VW1 A;  2VY0 A;  2C4X A;  4AI3 A;  3CJX A;  2AC1 A;  3LAG A;  1CES A;  3N9P A;  2DUR A;  3ABZ A;  4FPL A;  1RUJ 1;  1UXX X;  4MSV A;  1CJD A;  2AEZ A;  2UWB A;  3K4Z A;  3WNN A;  4CCK A;  1BEV 1;  5CG8 A;  1ZM1 A;  2ARE A;  2XUM A;  1XND A;  1E5I A;  2ZCW A;  3OEA A;  1AL2 3;  2DFB A;  5LAT A;  1KFX L;  3POJ A;  2FDG A;  5F7U A;  3IDB B;  4NIG A;  4YZ3 A;  4CEY B;  2B46 X;  5F5I A;  4JGY C;  5FK8 A;  2WJS A;  2YHJ A;  3ZDS A;  4XFF A;  1KDK A;  2C24 A;  1WMX A;  4I01 A;  4JDO A;  3NKT A;  4AL9 A;  3AMQ A;  4PF1 A;  3VBS C;  2JG9 C;  1LOG A;  1RB8 G;  4QM9 A;  2XKP A;  4CTE A;  5HI0 A;  5DAQ A;  5A1L A;  4QQH A;  4OYU A;  5T50 A;  1NY7 1;  2XQR A;  1GZW A;  1GOG A;  2PHL A;  1DP0 A;  5DAW A;  2ZGK A;  1NYW A;  3PLQ A;  3BOD A;  3AM2 A;  1UF2 C;  5K8S A;  5A3U A;  2DCJ A;  1JHN A;  4WM8 C;  4QKF A;  5CAZ A;  2WQ8 A;  4XXA A;  5CFD B;  5LA0 A;  4WM7 A;  3VZK A;  5JCT A;  2W0X A;  1TG7 A;  4LKF A;  4JX0 A;  1KFU L;  4P9J A;  3AP6 A;  4QPY A;  3VZN A;  1VBD 3;  3ZYR A;  2UU8 A;  3V0A B;  5EJ3 A;  3K51 A;  1JUH A;  2WT1 A;  2GH8 A;  1UY3 A;  1C5I A;  4RFT 0;  4GAL A;  3VKF C;  1S4C A;  4AOC A;  4N53 A;  3GZE A;  1ND2 A;  4D69 A;  5FYT A;  2R07 2;  3KCC A;  1AX1 A;  3RZM A;  1RXG A;  4XF1 A;  4ET7 A;  1AL2 2;  2VXR A;  2VOK A;  2Z79 A;  5FOJ B;  1SAC A;  1CN1 A;  4IGO A;  4Q0P A;  1KJR A;  3IAQ A;  1CQ9 A;  1L7L A;  3OGJ A;  3D5O A;  4DEV A;  1I6X A;  1E5S A;  2FZ1 A;  2WS9 3;  3HN3 A;  4K3U A;  5EWS A;  3T3Y A;  1YQ6 A;  2XL9 A;  3OUH A;  3DPR A;  5DAX A;  3DGT A;  1HRI 1;  3MFA A;  5FXX A;  4B1L A;  5K7P A;  1WCS A;  1CIY A;  5L9V A;  3HVD A;  5JR7 B;  4XFH A;  4LUM A;  1ENX A;  1V9U 1;  2E31 A;  2ZGR A;  3PVO A;  3RYR A;  2W2I A;  4YGD A;  2WQZ C;  4FBF A;  5BUV A;  4ZZ5 A;  3BB6 A;  4P5Y A;  2OA2 A;  1AR8 3;  1RVF 1;  3ENR A;  3M7A A;  2BZD A;  2VH9 A;  4AG4 A;  5A32 B;  2DTY A;  5IFP A;  5FYI A;  3POY A;  5IW0 A;  2QQK A;  2QE3 A;  3SCH A;  5DDJ 2;  4YYO A;  3D3A A;  3E6C C;  5ACA 3;  2C1F A;  4OI0 A;  1W2O A;  2TUN A;  2ZGP A;  2WIN B;  4AQS A;  2X8K A;  3WLU A;  1UCX A;  4K8R B;  4C1W A;  4XAA A;  1AR7 3;  4LBM A;  1N1T A;  5FIX A;  4Y22 A;  2D44 A;  2GAL A;  2HEW F;  1LB2 A;  3NL1 A;  4HK8 A;  3GBG A;  2JG9 B;  3FJS A;  4QQ2 A;  1CX1 A;  2B8M A;  1LUL A;  1W04 A;  1XPW A;  1S1A A;  1WCK A;  5IVC A;  4HZF A;  2JB8 A;  1GOH A;  5L36 A;  4RQP C;  1GQG A;  1QQP 2;  3LA3 A;  1TMF 3;  3VKL A;  3DN7 A;  4UI9 L;  1ALY A;  2QZ2 A;  4E2G A;  5IVV A;  4XAB A;  5EYX A;  2ZX4 A;  2XH6 A;  5J36 A;  2WNU C;  4GKX A;  4CVU A;  1B09 A;  1D4M 3;  4DUW A;  1IKP A;  1IOA A;  2ZZJ A;  5A6Q A;  1Q8P A;  1X8M A;  1D4V B;  4RR3 A;  3VHP A;  3R4D B;  2VME A;  3JQW A;  1J1T A;  1RUG 3;  1N47 A;  2V4V A;  4RN5 A;  5C3O A;  5DN2 A;  3SCG A;  1GFF 2;  5FPX A;  1AZD A;  1R09 2;  1AUY A;  2O0O A;  4LO7 A;  4IUG A;  1NLQ A;  1J59 A;  3TN9 3;  5FP9 A;  4FPO B;  1EUT A;  2IFR A;  3N9O A;  1AXK A;  4UFH A;  4XUP A;  5C3P A;  3RI8 A;  5ACA 2;  1W8W A;  3H8R A;  1FV3 A;  1I5P A;  4XUT A;  5FJH A;  4HLT A;  2W68 A;  3H3L A;  3NWK A;  3I49 A;  3PVE A;  3S5A A;  1VE0 A;  4AVB A;  4Y1Z A;  5SV8 A;  4QDS A;  3USS A;  1TEI A;  3K3O A;  1KGY A;  3S30 A;  2BU9 A;  4M0H A;  2VMC A;  1KS5 A;  1H1I A;  1PK6 C;  1X9T A;  3HMY A;  4ZON A;  2V5D A;  4QXH A;  4NRO A;  1TMF 2;  2XJT A;  3VLB B;  3MV0 1;  4LHK A;  1BZW A;  3P5B A;  5F3E A;  1ZBE 2;  4C8D A;  5KXE A;  1W6P A;  2VZO A;  5A3O A;  5FMC A;  3RJ2 X;  2YY1 A;  5LEJ A;  2VUD A;  1EAH 3;  1VMJ A;  4HL0 A;  1D2S A;  1H8T C;  1Y4W A;  1IS3 A;  3N9M A;  5I0T A;  3LCP A;  5EPA A;  5FYV A;  1NUK A;  1DYP A;  1VBA 1;  2EXK A;  2PHF A;  2Z4F A;  2ZPX A;  4L99 A;  4W65 A;  4XF9 A;  5AVP A;  4LK7 A;  4A41 A;  3WUD A;  4XF4 A;  3CMG A;  3WDT A;  3Q8F A;  4QGL A;  4WVZ A;  1QJX 1;  2A3Y A;  2X5I A;  4N53 C;  2A6V A;  4V1P A;  2VXJ A;  1ND2 C;  5CKM A;  4FCA A;  5FPA A;  4EV0 A;  4RQP B;  4O61 A;  2W92 A;  3LGR A;  3MYX A;  2JG8 A;  1POQ A;  2VTX A;  5FY0 A;  2MPF A;  4LKE A;  1WWY A;  3JB4 C;  2ENR A;  2RG4 A;  2VBB A;  2RDN A;  3KGL A;  4FP3 A;  4IER A;  5B4X A;  3IB3 A;  1D0H A;  1MZ5 A;  5BXX A;  3CJI B;  5C9A B;  1W8F A;  1H30 A;  3TEY A;  2HWB 2;  2RM2 2;  5K4L A;  5KXC A;  5J98 B;  3HEI A;  5LCW L;  4JHZ A;  3URF A;  1UKG A;  5LRR A;  4OI4 A;  1XYP A;  1M4W A;  4B1M A;  4AVC A;  1GIC A;  1VBB 1;  1LHV A;  1SPP A;  4AXO A;  1NKG A;  2H0V A;  5FO9 B;  3NNG A;  5ABJ C;  5E8A A;  1JYI A;  2D5F A;  1WW7 A;  4XJA A;  4Q8K A;  2E9Q A;  5FKC A;  3FLP A;  4CCN A;  3BTZ A;  1B35 A;  3NJX A;  4JDN A;  2KA3 A;  1QH7 A;  4DZG A;  4YG0 A;  3NV1 A;  1RHI 1;  3PVB B;  1RUO A;  2RS5 3;  1GZ9 A;  4CCM A;  1BQP A;  3V0B A;  3ORJ A;  2WO3 A;  2X53 S;  3WF3 A;  4ATE A;  1OUX A;  1RUC 2;  1OKQ A;  1V6M A;  2JKB A;  1GP6 A;  5AC9 1;  2GDF A;  2A1X A;  5A7N A;  1GZW B;  1YXW A;  1PMH X;  1EPW A;  2BYV E;  5C3S A;  4I09 A;  3W58 A;  5JIU A;  4FOY A;  4MHR A;  3J7H A;  1F4H A;  4Q4Y 3;  3HWJ A;  4WM7 B;  1AR6 2;  2Y6F A;  5T55 A;  1JXN A;  5EXO A;  1NE4 A;  4PCR A;  4GQ7 A;  4UF0 A;  4YW2 A;  3PUS A;  1IQD C;  3T0A A;  3UK9 A;  2PHU A;  1DGR N;  3RZG A;  1F5J A;  4N53 B;  4OUM A;  2E32 A;  3UKN A;  1ND2 B;  3KF5 A;  5GM0 A;  4TXW A;  2P6C A;  1AX2 A;  4Q0V A;  1LOD A;  3DUI A;  1K3I A;  1EPZ A;  5IVB A;  5CKQ A;  3PU3 A;  3KCY A;  2J1E A;  3D0S A;  4F7Z A;  5FOB B;  4Y5Z 0;  4XMA A;  2WLP A;  2EID A;  4AEJ A;  4KWL A;  3HJR A;  3LDK A;  3UES A;  2D6M A;  4QX5 A;  2JDY A;  1S0D A;  4GA9 A;  2PAK A;  1JTZ X;  2DCY A;  3C3V A;  3DPR B;  1N1Y A;  2RS5 2;  1VLN A;  1DQ2 A;  2HWE 3;  1DGW A;  2NPI A;  4QHB A;  1O5U A;  4Y1X A;  5DPN A;  4CU6 A;  3J8F 2;  1OFN A;  1IQA A;  4B3N A;  1HXS 3;  3LEM A;  2R07 1;  3AMP A;  1V6K A;  2FCT A;  4UWD A;  1TNF A;  4A6S A;  4IL7 A;  4URT A;  5FYC A;  4UBH A;  1HRV 2;  2FCV A;  3D6E A;  4WVV A;  4LBK A;  1T2X A;  5DUV A;  3WP3 A;  2AZ5 A;  5D1I A;  4PI0 A;  4BQ3 A;  2ZGO A;  1VR3 A;  3ITQ A;  3R4U A;  3GZU C;  2Y6H A;  1RIT A;  3I2J A;  4Y20 A;  5FZH A;  3BN6 A;  4Y22 B;  3SMH A;  3OUJ A;  3RRD A;  2UWA A;  3ACH A;  1PIV 3;  2ZHM A;  1FPN 3;  4LKS A;  4XCA A;  2D43 A;  4YW7 A;  2Y34 A;  4D6S A;  1LOC A;  2WUH A;  4CDW C;  2X5I C;  1H2M A;  4D7T A;  2HLE A;  2ZS6 B;  1AJK A;  2RVA A;  4Z1V A;  4Y3O A;  3JD7 2;  4AGR A;  2CL2 A;  3SQO A;  5DDJ 1;  3KHC A;  2QQV A;  2JG8 C;  2CY6 A;  3B01 A;  2AH2 A;  3VDC A;  4NHY A;  1R1A 1;  1W99 A;  3KWV A;  4NIA A;  4BA6 A;  2Z5W A;  4UFK A;  5FWJ A;  1MS8 A;  1OLM A;  4JV4 A;  1RIR A;  3A22 A;  4KQ7 A;  1QJF A;  2QQM A;  1RL3 A;  4OCT A;  4YGC A;  4QDQ A;  4RR3 B;  4XQD A;  4LIV A;  4LMF A;  2RV9 A;  2WWU A;  3MW2 A;  1W2A X;  4O9E A;  1H1A A;  2HWD 3;  3Q8B A;  1TME 3;  4NO4 A;  4Y1Y A;  2B39 A;  4AHX A;  4IEW A;  4O7X A;  3ZSE A;  1HIX A;  2VZQ A;  4L8Q A;  4N9I A;  1IS6 A;  4CE8 A;  1JU3 A;  5IUQ A;  4UYB A;  1RUJ 3;  1DFQ A;  3M1H A;  4HKW A;  2ZGQ A;  5LA1 A;  3HPN A;  1RUH 3;  4XAE A;  1PGL 2;  3J26 N;  1DGL A;  3OGG A;  4XUQ A;  3ZXD A;  4EWE A;  3KMH A;  5F3C A;  4MVT A;  3T4H B;  1B35 C;  1OLM E;  4QX2 A;  3WY6 A;  2D3P A;  4IV3 A;  3ON7 A;  3USU A;  2BQP A;  3ZXA C;  1IZ3 A;  5LA2 A;  4BQ1 A;  1FPN 2;  3DKQ A;  2FQP A;  3IIA A;  2GMP A;  1SLI A;  3POS A;  1C57 A;  3PME A;  1SLC A;  4AAP A;  3ZR6 A;  3CIH A;  4NUB A;  1C4R A;  1PZ7 A;  2WAB A;  1V6J A;  1F35 A;  1SFN A;  1XRU A;  1RUD 3;  2AR6 A;  3INA A;  1E57 A;  1OH3 A;  3WT3 A;  1W6P B;  4CXW A;  4Q1R A;  4MGK E;  4R9A A;  1DF0 A;  1UMI A;  2JE7 A;  2ARX A;  3GF6 A;  4GKY A;  4E2S A;  1UXZ A;  4RD7 A;  2OVU A;  4LKD A;  4QAW A;  1R08 1;  2W47 A;  1LU1 A;  2VZP A;  3N7L A;  4FTS A;  2R49 A;  4ORF A;  5D21 A;  1ASJ 2;  1NCR A;  3FHA A;  2HWD 2;  5J09 A;  4S2F A;  4AVV A;  4TLG A;  5FMO L;  3TYJ A;  1C8N A;  2X5I B;  2C26 A;  3ZR5 A;  3KZ4 C;  5J48 A;  2V5Y A;  3U75 A;  1S55 A;  1FV2 A;  1ZBE 1;  3WQ0 A;  4F8A A;  4N8M A;  1QXR A;  2VZ1 A;  3WEZ A;  3VD9 A;  2JG8 B;  1IGO A;  5FZ8 A;  1W3X A;  2QTW B;  3OBT A;  1BEV 2;  5FTT C;  4A3Z A;  5F6L B;  4Q0Q A;  3FBM A;  3N7M A;  2ORZ A;  2NMO A;  4QQL A;  3B3Q E;  5FXZ A;  2ZTN A;  2XML A;  3SCF A;  3VKO A;  3LFI A;  2BGC A;  2YDE A;  3B7M A;  4AW7 A;  1ULO A;  4MXV A;  4FAH A;  1ACC A;  5FAX A;  2ZML A;  1CPM A;  5FLJ A;  4ITC A;  1FMD 3;  1HRI 3;  1HN0 A;  4R9C A;  1SCR A;  5A3T A;  4M00 A;  4RHV 3;  1UOG A;  4R4X A;  2YPD A;  4O65 A;  1DQ4 A;  1SPP B;  5T5O A;  1UNB A;  3O1R A;  1TE1 B;  2VMI A;  5CIS A;  4YGE A;  1RVF 3;  1YCI A;  3QH6 A;  4ZU4 A;  5EJZ B;  1NY7 2;  1SLB A;  3N35 A;  3H1Y A;  1MEC 2;  1UIJ A;  1WMD A;  2ID4 A;  1WD4 A;  4O9G A;  3ZXF A;  2WNO A;  1BBT 2;  5H9P A;  2HWB 1;  2RM2 1;  1B35 B;  5FZ0 A;  3GJA A;  1J3R A;  3MO4 A;  4NHX A;  4WZF A;  3T2P A;  4B7K A;  3AYE A;  1HQW A;  3C7O A;  1K5M C;  1UYZ A;  5FXW A;  5A6Z A;  3NMB A;  4ISQ A;  3V0B B;  3T0D A;  4BZ4 A;  1PM4 A;  3OSD A;  2BNO A;  5H9Q A;  4GMP 0;  4GWI A;  4IV1 C;  1QJY 2;  5HBA A;  1MAC A;  5FP4 A;  5I91 A;  3BTX A;  1F8V A;  2YUE A;  4ASM B;  4NJ4 A;  1ZRR A;  3FN9 A;  2VOW A;  5LW9 A;  3AVR A;  4TYS A;  4GB3 1;  4CA9 A;  4YW5 A;  1RC6 A;  2HWF 1;  3U37 A;  3VZO A;  3W59 A;  4BCU A;  1HJG A;  2OII A;  5GLZ A;  2XDV A;  2WO7 A;  2Y26 A;  3FUO A;  1BMV 2;  2GME A;  4P14 A;  3JU9 A;  1LU2 A;  1BKZ A;  2Q5T A;  4M0N A;  3WHT A;  2JIC A;  1QDO A;  1RUC 1;  2RJK A;  4UF0 B;  4LBJ A;  2ET1 A;  2WBK A;  1RUN A;  4KWJ A;  3SH5 A;  4BM8 A;  2RMU 3;  2VC9 A;  4COW A;  3P3N A;  3SIS A;  1V9U 2;  2I2S A;  3M3I A;  1OT5 A;  3ZKU A;  3SH4 A;  2HBT A;  1W2N A;  1HLC A;  1TQ5 A;  3PJY A;  3FC0 A;  1SBD A;  4EWD A;  3UT0 A;  4NIH A;  1CWP A;  1UIK A;  4LBQ D;  2VVF A;  3VBU A;  2CTV A;  4Z07 A;  4JRL A;  3ZSL A; 
#chains in the Genus database with same CATH homology
 2G1M A;  4MHR A;  5LAT A;  5HV4 A;  3EMR A;  5M0T A;  3W20 A;  5LBB A;  5HV0 A;  4KBZ A;  5EQU A;  5DAQ A;  3PL0 A;  4Y5T A;  5DAW A;  5A3U A;  4NMI A;  4BQW A;  4XC9 A;  4BQX A;  2V4A A;  4ZON A;  3NNL A;  5L9R A;  2RDR A;  4IW3 A;  3KT1 A;  5LAS A;  5DAV A;  4NHL A;  4XAC A;  4NAO A;  2FCT A;  4UWD A;  2Y33 A;  3NNF A;  5EPA A;  5IAX A;  3GZE A;  2FCV A;  5LBC A;  2HBU A;  3MGU A;  3ITQ A;  5LBE A;  2FCU A;  5DAP A;  3OUJ A;  5EP9 A;  4J25 A;  3OUH A;  5DAX A;  4XCA A;  5LBF A;  2Y34 A;  5L9V A;  3KT4 A;  5L9B A;  2RG4 A;  2RDN A;  3GJA A;  4NHX A;  3HQR A;  3NNJ A;  5LA9 A;  5LB6 A;  4MHU A;  4NHY A;  4NHK A;  4XCB A;  5ERL A;  2G19 A;  4ZPI A;  3OBZ A;  3OUI A;  4XAA A;  4BQY A;  5C5U A;  3BVC A;  5C5T A;  2RDQ A;  4JZR A;  2JIG A;  4Q5O A;  3HQU A;  4NHM A;  3GJB A;  5IAV A;  4Y5S A;  5IAT A;  4XAB A;  2HBT A;  3W21 A;  2RDS A;  3NNM A;  2A1X A;  2JIJ A;  2OPW A;  3DKQ A;  3KT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...