4ZONA

Structure of ftmox1 with fumitremorgen b complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
285
structure length
285
Chain Sequence
KPQLQRLAADADVDRMCRLLEEDGAFILKGLLPFDVVESFNRELDVQMAIPPPKGERLLADKYPPHFKYVPNVATTCPTFRNTVLINPVIHAICEAYFQRTGDYWLSAAFLREIESGMPAQPFHRDDATHPLMHYQPLEAPPVSLSVIFPLTEFTEENGATEVILGSHRWTEVGTPERDQAVLATMDPGDVLIVRQRVVHAGGGNRTTAGKPRRVVLAYFNSVQLTPFETYRTMPREMVESMTVLGQRMLGWRTMKPSDPNIVGINLIDDKRLENVLQLKAADSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Endoperoxide formation by an alpha-ketoglutarate-dependent mononuclear non-haem iron enzyme.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Verruculogen synthase
total genus 87
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 1.14.11.38: Verruculogen synthase.
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 4zonA00
3HQUA 5DAXA 4BQYA 4UWDA 2FCTA 5DAPA 3W20A 4BQXA 4NHXA 3OUIA 5LATA 5LB6A 4NHYA 3KT7A 2RDRA 4XABA 3GZEA 5LBFA 2Y34A 3ITQA 2JIGA 4XAAA 4NHKA 5C5UA 2G19A 4XACA 5DAWA 4KBZA 4Y5SA 4ZONA 2FCVA 4IW3A 4NAOA 3OUJA 5C5TA 4MHRA 5ERLA 2HBUA 3OBZA 4Q5OA 3OUHA 3GJBA 3EMRA 4XCBA 3KT1A 2RG4A 3NNLA 2Y33A 5EPAA 5IAVA 2JIJA 5IATA 2A1XA 5DAVA 2RDSA 3BVCA 5LBEA 3MGUA 5EP9A 4J25A 5A3UA 4NMIA 4MHUA 3DKQA 4NHMA 5L9VA 2RDQA 3W21A 3HQRA 5LASA 5LA9A 2G1MA 3KT4A 2FCUA 5LBBA 5HV4A 5HV0A 4NHLA 3NNFA 4Y5TA 3NNJA 4ZPIA 5DAQA 5L9RA 4JZRA 2OPWA 5M0TA 2RDNA 5L9BA 4BQWA 4XCAA 5IAXA 3NNMA 3PL0A 2V4AA 5EQUA 3GJAA 4XC9A 5LBCA 2HBTA
chains in the Genus database with same CATH superfamily
5EJ1B 2HYXA 1OLMA 2DVFA 4CEYB 4YG3A 3IT8A 4OHZA 4LLOA 4PDWA 3K3NA 1PVC3 3R0RA 5FREA 5FWJA 3KZ4C 1I6XA 3LA2A 4PLOA 3MBWA 1HV0A 1DQ0A 1XNTA 3VDCA 3BCWA 4Q8LA 2H0VA 2XJRA 3CU7A 3CF6E 3D8CA 4BQ3A 5JZGA 4XBQA 4FBFA 1ZA4A 1DGRN 1W8TA 2VTFA 2YU1A 1UOGA 3KD4A 4G3YC 4NROA 4Q4Y2 4XIKA 5JI7A 1SG3A 2HWF3 3AJYA 3T0BA 1PVXA 2ZXQA 4CPBA 3KHCA 2XKPA 4LBLA 2R0FA 2VGDA 3HJRA 4OZOA 1YQ2A 1TME3 2DF7A 4M00A 3OB8A 1VRH1 4CZSA 1XU1A 3D5OA 2WYSA 3HMYA 3CJIA 4WM8C 1W99A 5FUIA 3GDBA 3TNQA 5BNPA 5C5UA 4Q4Y3 1VBB3 1KEXA 4QPIB 4RS5B 1VBB2 2O0OA 4OUEA 5DG1A 5F7UA 5F2WA 1NYWA 3HT2A 2Q4SA 4CCKA 1YQ8A 1H4GA 1Q56A 2DTWA 1EV11 3ILNA 4J1XA 3R4DB 4NPLA 4Y1UA 3MLKA 2KXLA 4IQPA 4JAAA 1ENSA 3ZXJA 5KR7A 4OHXA 4XQ4A 2Q5TA 4YM1A 1OPMA 1BZWA 3M3OA 4CXYA 3NQHA 2NM1A 4RD7A 1FPN1 4JDNA 4YLZA 1RB8G 2EA7A 1CIWA 2VZVA 1RHI2 2X5IC 1P8JA 2WYFA 3FC0A 4XMIA 1XB9A 3F95A 3PVNA 2NN8A 4W6XA 2W92A 5FFOC 2ZZJA 2UWBA 1IS3A 2V73A 3B01A 2A3YA 3VD3A 4COYA 2DDUA 3NAPA 4RR3A 4R9CA 4XOGA 5C7GA 4DPNA 4I0WB 3THPA 2BQPA 4RHV3 3H50A 1QIQA 4LLFA 3FUQA 3VD4A 2A5ZA 4XDQA 3RWNA 2XL7A 5F3EA 4CDQC 3W59A 1LECA 4J25A 3O1TA 5K4LA 2XJUA 1H1IA 1XRUA 5FZIA 5K9YA 4N43A 2H6BA 3EXUA 1ND2A 4AQ6A 3FLRA 4JVAA 3GALA 4IE0A 4CRQA 5J36A 2R063 2QTWB 4AOCA 2AH2A 2W3JA 1TEIA 4YGBA 1S0JA 2BPA2 1RHI1 3O12A 1R081 4I3GA 1KDMA 2DVGA 1QJEA 1NKGA 3M3CA 3OGSA 2RMU1 3SITA 5C71A 2VO5A 3E5QA 3RZKA 3BN6A 3J8F2 3NV2A 2IVJA 4LKEA 4NE9A 3VD7A 2AEZA 4Q0QA 5IK4A 2CNAA 1ST8A 2VR4A 2GP3A 1AR83 3CJIC 2VECA 2PHLA 2PLV2 4WVVA 3TN93 5AC92 5LCWL 2WO1A 5DAQA 5F3IA 1AYM1 1VLNA 5FYHA 3LSEA 3RMYA 4XBLA 4CP0A 5M0TA 3N4MA 4FOQA 2VMGA 3WQBA 5JDBA 2DUPA 4YVWA 4UW3A 1Y4WA 3ZO0B 2Q1ZB 1CAXA 1ND2B 2RS13 4W8JA 2P3JA 2XL9A 3C8XA 4JGYB 5CZKA 5HXVA 3USSA 1AL23 3OD4A 4N9IA 4K8FA 4XURA 3SEPA 3TB0A 1HW5A 1UYZA 1X7NA 3ZYJB 3TWIA 3C7FA 4ZXKA 3WNPA 4QX5A 2D5FA 4UFKA 4DINB 1RJ8A 3T3YA 3BB6A 1CJPA 3ZXFA 2YGLA 1W05A 2JB4A 4D7YA 1JBCA 5JCTA 4EN0A 5CG9A 3FHIB 5JVVA 2R042 2PAKA 2VOWA 3BPSA 2CTVA 4ORFA 4BJ0A 3DKWA 2JG9B 3UKVA 4E2QA 5JSPA 3POGA 4DXZA 1BKZA 2IZWA 5TSWA 2VOXA 4N90A 2JIGA 3UKNA 3ZFFA 2YV8A 1XE8A 2G19A 5FZDA 2PA7A 4GULA 5GKAC 4YM3A 1DDLA 1LOFA 5AFEA 5IVYA 4MX3A 1CQ9A 4JRLA 3T08A 4BWOA 2D3RA 2BGOA 1VBB1 4Q8KA 1QJU2 5FP3A 1RUC1 2Y38A 2PHFA 3GBWA 2G9GA 4IV3A 5A7SA 1COV2 4LBQD 4K1YA 3VBOA 1LHVA 4D69A 1IHMA 1H9PA 1R1A3 1O3QA 3ENRA 5LK5A 3BTYA 1BEV2 1U5YA 1ULOA 1NQDA 1QH7A 3IDBB 3FE5A 2I07B 1E5SA 4GXLA 4AAPA 5A3MA 3AMPA 3WUCA 4LHSA 4LNVA 1GOHA 2XVGA 4L11A 4PBOA 5A7WA 3OEAA 4H7LA 4TXWA 3UK9A 3JB4C 2W47A 2HWE3 4XMAA 1GMMA 1O4ZA 1J1TA 5EP9A 5FRAA 5LBEA 3VZNA 1J59A 4AVTA 1C8M1 4CUAA 2Q1MA 1PO12 4DXTA 1W8OA 3BOWA 4IV1B 4PIZA 2CAUA 3DYMA 4HN0A 5FMBA 2QFEA 4MGQA 3RPQA 4E4HA 1JYIA 4LKSA 3E1F1 3VBHA 2XJSA 1VAVA 3H0OA 1MS4A 2XHNA 3ALQA 5A3LA 3WDUA 1BBT2 1W0OA 4HPKB 1Q8PA 4NN0A 5A6YA 3FBMA 3RNSA 4XDPA 5CFDC 2A3XA 5FYZA 5KHJA 1JZ7A 3CBNA 4RGGA 5C9AC 4AI9A 4Q27A 1VP6A 3SKJE 5IYYA 1UWWA 2JDYA 5L19A 1ZREA 1UXXX 1WLCA 4QDSA 3MZHA 4BA6A 4XFIA 1GNHA 3ZXDA 4QHZA 4RGKA 2MEV2 2VW0A 1BK0A 1V70A 2BBAA 3NAPB 2NP0A 3NNJA 4ASLA 3HT1A 4U36A 1HXS2 1FOD2 1UPSA 5A3TA 2RDNA 5CFCB 2QJVA 4RSUA 4UBGA 1AR81 4CDWC 2GMMA 4BLIA 3K3OA 4QDRA 5A70A 4DQAA 3I2IA 4X8PA 2BV4A 4D8MA 4YVWB 2RMU2 2HBTA 4FPGA 4Y3OA 2IXKA 2JB8A 4LBQB 3VHPA 1JYWA 3J4UH 2DVBA 3BIWE 2OQ7A 3TRSB 4N53C 3ZMOA 1D4M2 4LE4A 1ODMA 3VBHB 2DFCA 4C8DA 3AYDA 3JBG2 2WN2A 3IMMA 1NCRA 4YNIA 4BXFA 1IKPA 4CP1A 1WW6A 2ZA9A 4QQ2A 2WT1A 3L2YA 1F4AA 4BZ4A 2VMCA 1HRI1 1SLTA 1NZIA 1UYYA 4CDQA 1LR5A 1W2NA 2QE3A 3ZDSA 1UKGA 1GP5A 2D43A 4YVSC 3V0BA 1SLLA 5LWBA 2QNKA 1NCRC 1F9KA 1WW4A 1AX0A 2JG8B 3GGLA 1SHWB 5GZFA 4AQ2A 3I97A 3GZEA 5I8SA 4CDUB 2YGMA 3U07A 5HCFA 1RC6A 3IPVB 2G9FA 1AR72 1RGSA 1VBC2 1IS5A 2JD4A 4XAAA 4CDWB 1JZ3A 2TBVA 2ZGMA 2X5IA 3EYPA 3PUHA 3ACLA 1RUI2 4FPLA 3BTAA 2BNMA 4HSJA 4KBZA 5CADA 4MGZE 3S5QA 4CCMA 3T4VA 4IW3A 3JUUA 4AEDC 2FMYA 2VVEA 1CJDA 4YG6A 3DGTA 2VUAA 5FQ0B 5F5QA 5FLHA 1ULPA 1XYOA 4C1XA 1G7YA 1Q43A 1ZYBA 4DEQA 3WP6A 1S0CA 2OT7A 2C5DA 4I09A 3KB5A 4Z2WA 5FBZA 2P3YA 2W0XA 4BCUA 1POV1 2WLPA 4QB6A 2ZMLA 1V6IA 2XBO3 5IK7A 3K48A 5FZCA 5BNNB 3PUIA 4V2WA 1QJY3 5IAVA 2XLGA 4FPJA 2ZX0A 1PGW2 2OUJA 4BIFA 2JENA 2VZ1A 2ZKLA 5IFTA 1YJKA 4ATEA 3LGRA 5FZ3A 2JICA 1JZ6A 3VB9A 1MS9A 1QJU1 4IV1C 3ZR6A 5C8WA 4PDWC 2WQ4A 3UESA 3ZM8A 2FZ1A 5C9AB 1MS5A 3WV6A 3AMNA 2ZACA 2O8QA 1W03A 1OUSA 4LQRA 1FMD1 1UQXA 4Q4V1 1RUI3 4QQOA 4AEDB 2XGXA 3LEMA 2IXJA 1OMIA 2HYKA 1JXNA 3I2FA 4CCEA 4META 4YW1A 4AGGA 4ZY9A 1YI9A 4UW6A 4XIOA 4P9GA 4FAHA 4ISRA 1VBD2 5FYVA 3O1OA 4WM8B 5I8YA 1PIV2 5LA2A 2RDQA 4HVOA 1SFYA 1KS5A 1OT5A 1O8PA 2KA3A 2QQLA 3NV4A 3QH6A 4ZU4A 3ZFGA 4A45A 2R49A 4E4ZA 1EPZA 4YGCA 2J42A 1ULCA 2WZEA 1CAWA 1F31A 2Q1FA 4IGPA 3VKFC 2XONA 3EHKA 3UETA 4E4DX 1DQ5A 4QX0A 2HWD3 2CGPA 2WZ8A 3NNFA 4I0BA 1GZ9A 4GH4B 4JZRA 5FKCA 1PMJX 1W8UA 2MEV1 2YDEA 3CIHA 3FBYA 3O0WA 2NZ9A 3KV5A 1QKQA 3A22A 2W46A 4QX1A 2TUNA 3GZUC 1PGW1 1JOJA 1UZZA 2AR6A 3WDVA 4CEWA 2W2IA 4KL1A 1HXS3 1UY4A 3A0NA 1YEWA 2Q8CA 3T30A 3ZIXA 4LMFA 2D97A 3UV9A 1V6MA 1UU6A 3INAA 1GZWB 3CJXA 3NW4A 4GKXA 1RUJ1 4WVZA 5FLIA 3VDDB 4LBJA 3I2HA 1CPNA 3POBA 4LT5A 3O1SA 1W9TA 4BYYA 3FLTA 5K0UC 4BMEA 1YC61 3VKOA 4Z1VA 1BXHA 3FHQA 3USUA 4YVWC 1HRI3 2GC1A 3RS6A 1XNKA 3ASIA 4IDZA 5D8AA 5FZFA 5IFPA 5FYMA 2RVAA 4D94A 1PGSA 5I0RA 1JZ2A 1PZ8A 1MEC1 5DPNA 1LKNA 1XU2A 4BM8A 3WEZA 3S0MA 3WY6A 1AR73 4QU1A 3S30A 1Q8OA 4F83A 5T54A 3ZR5A 5AC91 4INDA 1W0PA 2AEYA 1W8HA 1MS0A 5FY9A 3D0SA 1UIJA 3AKQA 3UGGA 4YSFA 3VDBA 2W39A 1D7PM 3N36A 3SKVA 1RVF3 1W8ZA 2QDNA 4ARYA 2WFF1 3I59A 1W6MA 3KV6A 5JOYA 4JGZB 2E6VA 4QXKA 3WW2A 5FCCA 5BNQA 4RS5C 2XLFA 3AP4A 4HANA 1K45A 1LOAA 2IC1A 5FZBA 1Q8VA 3KCCA 4PI2A 1OOPC 2P3KA 1PK6A 5EPAA 1H8VA 4YW5A 3MW4A 4U2AA 4C1WA 2P2KA 3AKRA 2IXHA 3WQ0A 1COV3 4JX0A 2R16A 2WFPA 5IATA 5E6HA 5FYBA 1LHWA 2DCYA 2VJXA 1ZM1A 2XG3A 1UX7A 4OCTA 1QJY1 3MGUA 5D1IA 1OQDA 1B09A 4M01A 1VMFA 3WDTA 1JYVA 4QKDA 2FDFA 5J37A 2QQPA 4Q0VA 3VHOA 5FYTA 5KC6A 2C1FA 4KI5M 2VC9A 2OPKA 5FLJA 1AR61 3QBQA 3ST7A 3GZTB 1O4YA 4XJWA 1RMU2 2GC0A 3V65A 4NO4A 4GH4A 3RVHA 1U5XA 1XYNA 2QBXA 4N53A 4GJZA 3RZZA 5A1AA 3PNAA 2RS33 1N47A 2AGSA 3TEYA 1OVSA 3W21A 4FP2A 2R0HA 2WNVC 4UFLA 1UY1A 3B7MA 4XQDA 2FCUA 2IXIA 4QU2A 2OYZA 2HLEA 4AEJA 1IG3A 1F8VA 5EZWA 4OZXA 2JKXA 4HL0A 1F2NA 4WM8A 4ZS2A 5LA0A 5JI9A 4Y33A 2P34A 3BODA 1H4HA 4P14A 3O1RA 1R092 1EV13 1HQWA 5A3NA 5JIAA 3TAYA 1V9U1 4Y24A 5J1XA 1JZ5A 1WLDA 5C9AA 2FDKA 1LU2A 4RQPA 3ZSEA 3VZOA 1SFNA 2GNBA 2J1TA 4TN7A 1YNAA 4DRVA 5CKQA 4XF3A 2A7AA 5EWSA 4GB32 2JWPA 1ZZ6A 1YXWA 5FY1A 3MPBA 3OGRA 1CAUB 2QCSB 1W28A 4P5YA 1LHOA 3ZX7A 3OYWA 2XQRA 4IGOA 4ATFA 4JQRA 4G9SB 1EUTA 4A6SA 4AI0A 2ZTNA 3KMHA 1MVQA 2PMWB 3I7DA 3AZVA 3WLUA 2D40A 2WNUA 2ERFA 2UYBA 5LBFA 3ILFA 4HBNA 5FXWA 4P00B 4QKBA 4RR3B 1LNSA 1SLCA 1FV2A 1MZFA 3LCPA 2CY6A 2YPDA 1I1EA 3PIGA 4JKLA 3OYWB 1UU4A 4COUA 3IPVA 1O3TA 3HD8B 1QJFA 2MNGA 2X53S 3VBRA 5C5TA 1WLWA 4MHRA 4ES8A 1AYM2 4TLFA 3HQXA 2SLIA 4JTNA 1T6GC 3HBZA 5L36A 3S5AA 4BK5A 1PVC2 3OBZA 3OCPA 3FJSA 2GP5A 3OUHA 3PIJA 3GJBA 3POYA 2SBAA 4FCAA 4L2NA 3RGBA 3TN91 3U37A 5F1RA 2P6HA 3J26N 2RG4A 4AE2A 4ONUA 4TTGA 3U0ZA 4N7UA 4ZS3A 5GZDA 3NNLA 3VZMA 1X9PA 2WFF3 3ZFGC 4WM7B 2VBBA 1Q8QA 2YPJA 1BCXA 2JD9A 4BPZA 2EICA 1B35C 1OC1A 2JIJA 2ZS6B 2K0GA 2ZPXA 4L97A 5FYUA 5EYXA 5FZMA 4XYXA 2QKDA 3OTFA 1OF4A 5BYNA 1FYUA 2P1BA 5FOBB 5JIUA 4IL7A 1DF0A 4XDOA 4HXCA 5FXVA 3THDA 4QX7A 1PGL1 2Q8OA 1D2SA 3I2GA 5J09A 2W94A 2DWRA 5FZKA 1K12A 1SMVA 1W6MB 2ARCA 1EUUA 1Y9GA 3OGJA 3NKTA 4E8CA 4QGMA 1YLLA 3POWA 1PIV1 4CCLA 1W6OB 3QOPA 2VXRA 1BQPA 2VNRA 2GH8A 5CBLA 2E7QA 3MW3A 3PTYA 1VIWB 2B9UA 1LOGA 1TME2 1OH3A 2VZTA 2VG9A 1N3QA 2ZGKA 1FNYA 4DUVA 4FOVA 2ZEZA 1KFXL 1W6QA 3P3NA 4RQPC 1F4HA 4R9DA 3U14A 2HWF2 1D4VB 5I0TA 3KWVA 3ZOIA 1VMHA 2RS31 2RJKA 3OPZA 5FXZA 4XHXA 1VBA2 2ZZQA 1H8TB 4LORA 5HPOA 4OQ8A 2A6XA 1KQRA 2PLV3 3TN92 1V9U2 1OPOA 1VR3A 1WMEA 4KMQA 5FZ6A 3H8OA 3J9SA 5EJZB 2Q8DA 1AVBA 1AXKA 5E1RA 1JYXA 4SBVA 1QJX2 2RR12 1ZBE3 3OOXA 1QF3A 1LULA 4GKYA 4K21A 3VBUC 1G9FA 3LDBA 2J1UA 5GZGA 3J7MA 4AFCA 5IAXA 1ND2C 2VZPA 2WS92 4QXHA 3WNLA 5BNNC 1N1TA 4FTBA 3KLSA 2BRTA 4A2UA 4L99A 5FJKA 4ARXA 5FQ0A 5IVFA 4DIQA 4B1MA 4QXBA 2R1DA 3K51A 3WCSA 1YIPA 3ZXKA 3ACHA 4PIXA 2YC2A 1ZA7A 2OS2A 4LBOA 2EVXA 2LW8A 4TWTA 4KBBA 3I2JA 5A32A 4CPBD 5JAXA 3U10A 1ASJ1 4BXSV 4DB5A 1BVP1 3LA3A 1KJLA 1S0FA 2ZX1A 4WM7C 2VBDA 1GFF2 2V5YA 2ZHKA 3AFKA 3WHTA 2E51A 1RUD1 1RUNA 4RN5A 4KU7A 5APAA 3KQ4B 4YG0A 2J1EA 3H42B 3BIEA 1ODNA 1W6NB 1ALYA 2XOMA 1US2A 2FDHA 3POSA 3ZMNA 3NWKA 2VOTA 3SEEA 1S0BA 1RUOA 4PF1A 1NCRB 4NWVA 2W91A 4XACA 3PU3A 2EXIA 2QQNA 2CWSA 2DCTA 1G86A 4LBQA 1O3RA 4OMCA 3B5LB 3UJOA 4Y26A 1YFUA 2C6SA 4K40A 5EHDA 3Q8CA 3K46A 1DFQA 5B4NA 1OQ1A 2Y6LA 2XJPA 2VQAA 4BQ1A 1CPMA 1OKQA 1LHNA 2PYTA 3SXWA 3SH4A 1ULGA 2VZOA 4Q29A 5CFDB 5CVRA 3ZYHA 3O1UA 2JDAA 3AP5A 3C7OA 4P5HA 5DDJ1 1OBNA 1AYN2 4YGDA 1ZRRA 3M2MA 4Q4X3 5I8TA 4HG6B 1AR93 4AHWA 1BBT1 3KF5A 4AGRA 4PQQA 1SBDA 1IPSA 2OXBA 1ZBA2 4H14A 3RDIA 4UYBA 3SMHA 2EXKA 3FUOA 4XJUA 5JWPA 2L9LA 1U12A 2GU9A 5H9QA 3U4SA 1A3KA 1URXA 1VBA3 4QQPA 5LY1A 4FPYA 3B3QE 2VMDA 4QPGC 4FFFA 1KFUL 1NCQA 3Q8FA 4C0HA 3T2TA 2KM2A 3UJQA 2A6YA 4BIOA 5A1LA 3ZLIA 1A78A 2UU8A 4XFFA 2VMIA 1WD4A 4CEWC 3RWKX 1D0GA 1WCUA 4EE2A 3ZSLA 5JR2A 4P9JA 1EAH2 5GLWA 2JG9C 4CDUA 1PO11 3SCGA 1WGPA 1PO22 2WL1A 5FP4A 1YFWA 5FXXA 2CGNA 3WZ1A 2JG8A 2OKXA 1ZZ8A 4NHLA 1GQHA 3WNOA 4MGKE 4NVPA 2UWAA 1CZSA 4Y20A 1FT9A 4A6OA 1V6KA 3RRDA 1QGLA 5AFBA 1OURA 1GV9A 1PZ7A 2BFUS 1VRH3 1PNFA 3H3UA 2ZGNA 4OUMA 4QKNA 4BQWA 1JYNA 2W1SA 4FT8A 1X50A 4JDMA 3RG0A 3PU8A 3I2KA 1S55A 1ZBA1 4LHNA 2XBO1 3OJBA 4H2AA 2P6CA 3CZUA 4BQ2A 1ZRFA 1ULDA 2HKXA 5FMOS 2JDNA 4G4FA 2ZGUA 3HQUA 5A33A 2VTXA 5HCAA 1W9WA 5GZEA 5A80A 1TVGA 3OBAA 3TNPB 4H55A 1W06A 4JKMA 1ND3A 1NY71 2ARAA 5F3GA 4TZDA 5C4WA 1NXD1 1HRV1 3Q8AA 4E2GA 4AQTA 3G6JB 4EV0A 4BQXA 3GYDA 2JDKA 1OOPB 1MR5A 4GMP3 2C9KA 2YZ4A 4YZ2A 1HN0A 2UY8A 1ASJ3 1WKYA 3BKZA 4HKWA 2XJVA 3VKNA 4LOTA 4Q4X2 4AVBA 1VPHA 4JC1A 4CCJA 1LGCA 2OIIA 4XETA 3WD5A 1Y3TA 1ACCA 3RQ0A 1GUIA 2ZHMA 5A3OA 3UKTA 2DYCA 3GNEA 3SCHA 1ULEA 4CU8A 1RUH1 4NPRA 4DZGA 2D44A 3WP4A 2ZX3A 3FL7A 2B9VA 2JDUA 4LKFA 2XLAA 3MF9A 3ZFEC 2RS51 3N9QA 2WSVA 5T3NA 1IQDC 1JI6A 3G7DA 2D6KA 4LJHA 4MGIE 4OI4A 1J58A 2D5HA 4B7EA 5JPNB 1RUF2 4QB2A 3UGHA 1Z7S1 2Y6JA 1RUH2 3WDXA 4GWMA 1C1LA 3LEIA 4UF0B 3IN9A 2A70A 3ACFA 1K5MA 5GLZA 2WKKA 4XJ9A 5DZEA 4CCOA 3IAQA 4XJAA 4JHZA 3M7AA 4F8AA 4Q4X1 2VUCA 1GLHA 4GH4C 3BVCA 4OYUA 4GALA 1AR91 4B29A 1S4CA 2GNMA 2ZBJA 3AYAA 3C3VA 4NAMA 4P9IA 2WZR1 4N8MA 2HWC1 3OSDA 3MIFA 5C70A 2V72A 3E6CC 2A6WA 3ORJA 3VDDA 5I91A 1UNBA 3BYWA 1HRI2 3J7NA 3POJA 1V00A 1H2KA 4N43B 4LUKA 4QDQA 1UW8A 4DO0A 4EWDA 1TMF3 2VCCA 3POFA 4CCCA 4CU6A 1DG6A 4E4SA 1VALA 1G6NA 3WOGA 5IVJA 4AL9A 2QQWA 3AKTA 1K5JA 1T2XA 2JXAA 2YBKA 1H2MA 1LCLA 3Q8BA 4YW6A 1PX3A 3KV9A 3NV1A 5GLTA 1HKDA 2JG8C 1XJAA 1NLRA 1T6BX 3CO2A 1AR71 3SH3A 1K5MB 4YZ1A 3LFIA 1H8TA 1KD7A 2P3IA 2GDFA 3KCXA 4Y1YA 2J1SA 4YARA 1ND3B 4N9HA 3AC0A 2OQ6A 4IE4A 4Q4W2 4RGAA 1JYTA 3PMEA 1RXGA 1W6QB 2R30A 1MVEA 1QNYA 2JE7A 3J7LA 1RITA 4KWJA 4XTPA 3K4AA 3O0XA 2CU5A 4LR4A 3VGIA 5CAZA 1DLCA 1EPWA 1S0DA 3GJAA 4OMDA 2E31A 3PJQA 4XC9A 5BNPC 2R6QA 1S2BA 3DXUA 1IKQA 3LQCA 3QACA 4W4ZA 1XSQA 1QMJA 1PMIA 2VH9A 1DLLA 4JGYA 3JQWA 2Y6KA 3V0AB 5CKNA 3N9PA 2F4LA 2HWB3 1DZQA 5FZ4A 3WG2A 4CUBA 2WRAA 3URFA 3BGAA 2HWC2 3J7HA 2AYHA 4NIHA 2XUMA 4K7JA 5K0UA 1MACA 1F5FA 4LPLA 3VKMA 2BOIA 2YU2A 4BLJA 4QX2A 3MO4A 4CXXA 1GWLA 1TQ5A 2EAKA 3WR0A 1XNCA 1NX9A 3OGVA 4CUCA 3C7EA 2R072 3WW1A 3M3IA 1RUE3 3T0DA 5IK5A 4FFGA 1GQPA 1C8M2 3VLBB 3E5XA 2VMEA 4WZFA 2OZ6A 1VAKA 5ABJC 3CQOA 3PDQA 2XKOA 4OHYA 5C4WB 3OBRA 5A1FA 2Y34A 1X36A 2VD7A 1QDCA 1W9FA 2HWE1 1A8MA 5KBFA 4AHXA 1O7FA 2B45X 3I3DA 2Y26A 4R9BA 5A33B 4OVEA 4Q1RA 2ET1A 2FCVA 4NAOA 4JV4A 3VBRB 4AAXA 1R091 4B4PA 4HKOA 4XUNA 3U1XA 1ZZCA 1STMA 1SLIA 2YBPA 5FZ8A 2HBUA 2CYFA 2BW8A 4ISQA 4Q2FA 4PLMA 4MG2A 2QQOA 4XF0A 5BV6A 5FMDA 2ZGRA 3JD72 3VBSB 4EWAA 1PX4A 3MPPG 4HLTA 4IEVA 4K3UA 1C1FA 1KGYA 1LHUA 1WW7A 2F17A 4AI8A 1AX1A 2ARBA 3JB8A 2OX0A 4LE3A 5JSRA 5L7OA 1H9WA 3P6BA 1S0GA 4LO4B 4EJRA 2BEOA 4NRQA 1KS4A 2WO7A 3ES1A 1W0NA 3MICA 1DZRA 3HWJA 2D6OX 4YPJA 1OLQA 4KGQA 4LHLA 4DRRA 3V0BB 3Q9OA 1OFSA 1IPJA 1E5IA 1QEXA 3JQXA 2RDSA 1E5RA 3H8UA 1UOBA 4WV8A 4AI3A 2YFUA 4HOOA 4YVSB 5J3UA 3AP6A 3C7HA 3K2OA 3AKPA 3N35A 2VXJA 4LO8A 4M3CA 1D4M1 5FYSA 1UX6A 5C3OA 3ZKUA 1BYHA 2CDPA 2WS91 1O4TA 1XQNA 5DXDA 5FDBA 3WINE 1NCQB 2ILMA 4FP3A 1PHMA 4IEUA 3AMHA 1OKOA 3KHBA 2WT0A 1Q3EA 2YXSA 3DKQA 3PURA 2B5HA 1W90A 5GLVA 5FUPA 1CX4A 1DYKA 4ASKA 2Z4FA 5L9VA 2WN3A 1REDA 4ET7A 1TMF1 4MV2A 1AXZA 1V6LA 2IUWA 3A4UA 3JBG3 1J3RA 1Z78A 2NQYA 4MZUA 3RYKA 3SQOA 4PT6A 5C3RA 3HAGA 5CFCA 5HBAA 4IEZA 2VQUA 5KXCA 2W52A 3B02A 5JMCA 4YGEA 5HV0A 1OVPA 4XJZA 3JD71 4GZ9A 1A6CA 2UURA 3IWZA 3H8XA 4AEKA 2DBIA 1IZ3A 5C3PA 3ACIA 4CA9A 4DS0A 5JZGB 3KV4A 4LK6A 2K2SA 3WW4A 5FZEA 5FP7A 4SLIA 2XQXA 1HB3A 4ITCA 1FOD1 1U5ZA 4RL7A 2CHHA 3GBGA 3O1PA 2D6MA 5G04L 5E16A 5DUWA 4H7MA 5BNOC 5F5IA 3FFQA 3DYPA 4FPCA 2D93A 3RI8A 5ACA3 3ZXGA 1OHFA 2YYOA 2W1WA 5CG8A 1TME1 3MW2A 2VULA 4W50A 5FZLA 5FWEA 2ES3A 2R32A 2WWSA 1W6PB 2DV9A 2RV9A 1YUDA 5BPXA 3VKLA 2JKBA 4O9EA 5JMOA 3W9AA 2WINB 1X33A 4QPIA 5JSOA 3DPRA 4Q26A 5DZFA 1FPN2 2MPFA 2VCAA 3WP3A 4D6RA 4F3JA 2E26A 3CMGA 3MIBA 1KJRA 1NA1B 1PK6B 2Z79A 1PVC1 4N7IA 1PIV3 5H9PA 1TNFA 4P08A 1NQJA 5J48A 3O1MA 1QXJA 4DUXA 4Q0PA 4GB31 1JUHA 1W9YA 4YWAA 1QJU3 1MQTC 4CDXA 4DXSA 2CV6A 5LEJA 3O5SA 1FPN3 3NJZA 3T09A 1CZTA 5FIXA 1DQ1A 5GZCA 3U4XA 1I9RA 1UN1A 2DTYA 1A8DA 3KM5A 5HCBA 1VE0A 5FBJA 2GMPA 3VBFA 4NRPA 1VBC3 1N1YA 5DUXA 5LEKA 2HEWF 1NUKA 3ME2A 4PDWB 3P5BA 2WC2A 1SCRA 1XE7A 4EN6B 2E33A 4CEYA 4HKLA 1LOCA 1HX6A 4XCBA 3VL9A 1DU3D 3VN4A 3K4ZA 1SQ4A 3GZAA 1RUG1 1ZBE1 1NLQA 1SCSA 3N7MA 4Q4Y1 3AL5A 4OI2A 4AEMA 4AHYA 5A6XA 3N9LA 4QX8A 2G4IA 2B39A 4AGVA 1DHKB 5KHIA 4ZHNA 1UD1A 4CP9A 4HZFA 1MZEA 2DCJA 4Z92B 3OPTA 2HWD1 1A34A 4OI0A 2A1XA 2AZ5A 5DAVA 3AZYA 5DZGA 1O3SA 1IG0A 1GZWA 1XSRA 3O7OA 1JUIA 2ARXA 2ZEXA 3FN9A 2WO2A 4ZU7A 2DFBA 3QH7A 4JGYC 5FZGA 5A7OA 3D3AA 4CTEA 5C3SA 2ZGLA 2PN5A 5JUVA 4UFHA 4IERA 1LEDA 5CEHA 4M3CF 4NMIA 2Z5WA 1NY72 3B9IA 1D2QA 3UGFA 2JDPA 2XXZA 3AP9A 3TEXA 1YRZA 3TEZA 1D4M3 3OY8B 1BJQA 5C8CB 3O0VA 4LA2A 3LA7A 4UOJA 5FKBA 3FHAA 2VQ0A 4MXVA 5BY5A 4MXWB 4EWEA 2G1MA 2PTMA 3VBFC 2VMHA 3BOPA 3N7JA 1H8TC 4WVMA 3T2PA 4BB3A 4LTAA 4E8DA 3I2OA 1OD3A 3LDRA 3GF6A 3MLJA 2E63A 5JLVA 3H1MA 1EYBA 3AZWA 2XJTA 2RS32 1CR7A 1N3PA 2P4EA 2VZQA 1ZVFA 5F9TA 1LTEA 2QZ2A 2ZMKA 2W87A 3S7IA 2W1QA 3V64A 4A44A 2BBVA 2WNEA 1MEC3 3C2UA 2V4AA 3NJYA 3RI9A 4KG0A 5FPXA 3RMXA 2RHPA 1RUD2 1MZ5A 1W2UA 4JGZC 4YVSA 3IZOA 5LBCA 1GWMA 5CKMA 5D21A 5H9SA 4B8EA 4EYUA 1PZ9A 3KVBA 5KXEA 1GZCA 2VVDA 3MF6A 5C8CC 3PUQA 3M70A 4LO7A 2NMOA 5F37A 1QH6A 3AJZA 1LESA 2AC1A 2WT2A 3HN3A 2QQUA 2ZGPA 1SLBA 4WZCA 1CD3G 4IE5A 4BQYA 5C33A 2WO3A 4GA9A 4L8QA 5BNOA 2FCTA 2RS11 1BEV3 5DAPA 3ILRA 3RZHA 1OQEA 3WDWA 3BPZA 4XXAA 3VBSA 1JU4A 3OUIA 1YYNA 3PUSA 3PVOA 2X05A 5BNNA 4HK8A 3VV1A 1BK1A 2ET7A 2VCBA 4LUMA 3VHNA 4D3WA 3DCQA 2LROA 2R7EB 1F5JA 2BFUL 4AG4A 4BISA 2GC2A 1JOBA 1L7QA 2ZAAA 2CDOA 5IWFA 3ZYBA 1DBNA 2QQKA 4LKDA 2D6LX 5H9RA 4OLLA 1VRBA 1JHJA 4JCKA 4URTA 1DGLA 2DUOA 2Y64A 3M8LA 5T55A 2IFWA 3OUJA 4XPVA 2J1VA 1PO13 5FZOA 5FMOL 3L9JT 3N7LA 4IESA 2DVAA 3NV3A 5AVPA 3PJYA 5CFDA 2E53A 4CDXB 3KVAA 3FX3A 5LRRA 4IEWA 4UFMA 3ZXLA 3ZSKA 4GWJA 1UY2A 4K20A 5BNPB 5C6CA 1C8M3 2OVUA 1GKBA 3QD6A 5DABA 5E8AA 3C7GA 4XF1A 4CUGA 1G9BA 3SC7X 2CSGA 4AF9A 1GSLA 2CGOA 5FYIA 5IVCA 4IEXA 2WZPP 3ZFEB 4COZA 4E2SA 4AWDA 1HB2A 2H6CA 3WF1A 2FQPA 4M0HA 4Q4W3 3VBSC 2ZKNA 1NAEA 4KQ7A 3D4KA 1REEA 3NO8A 3MHZA 4XHBA 3WSOA 2Y0OA 4NWWA 2PHDA 3R4SA 2VPVA 1ASJ2 3ECQA 5B4XA 4QHOA 1GQGA 2NMNA 4RR3C 4CVUA 1AXYA 1NG0A 3VBOC 4LIVA 1LODA 5C8CA 4I30A 1QXPA 2F4PA 3A7QA 3I49A 1UL9A 1PM4A 2W68A 4I02A 1ENXA 2OZJA 3AB0A 3W5NA 1AR82 4JQTA 1YHFA 1AJKA 3KT4A 3WCRA 3FLPA 1AL0G 4GWIA 2WA3A 2XVLA 3ZPOA 3BTXA 2X29A 2ZEWA 3QLQA 3H7YA 3BTZA 5F8PA 1FV3A 2Y6HA 3BUCA 1UYPA 1RUC2 2C9AA 2FMDA 5EXOA 1GU3A 4R9AA 3NJVA 4AXOA 1WA6X 2XUEA 4Y5TA 4IEQA 2GZWA 5A6ZA 4O7XA 3WT3A 4C91A 3MI8A 4XFGA 4CP9B 4O65A 4FQ4A 4XE9A 1QOSA 1WWYA 5IVVA 5LRSA 4UFJA 5FY4A 2YY1A 3L2HA 4TSVA 2BP6A 5E88A 2V4VA 4LEJA 3O1VA 2Y6GA 2HWE2 1D0HA 3FFZA 2B4KA 3I3QA 5G05L 2VL4A 5B2GB 5BUVA 5F32A 5ABJB 1RIRA 1RMU1 3PHMA 1QNWA 1NXMA 4K9SA 2E32A 4XILA 1AR92 1W2TA 2D6PA 3W5MA 2J22A 4IV1A 3T1LA 2GAUA 3LAGA 1FXZA 1H2LA 2VNGA 3NMBA 3WNXA 4B7KA 4CXWA 4L0PA 1LENA 4P02B 3AYCA 3WQ1A 2RM21 4QT6A 5A7WB 1UY0A 1DGWX 5FZ7A 3D6EA 2VE1A 3WF0A 4BH9A 2EXJA 2W5FA 1W9SA 5IK8A 1PGL2 4XF4A 1VAMA 5GM0A 3H3ZA 3M1HA 4MUVA 4A7ZA 3IIAA 1NZCA 1R1ZA 3WG3A 2ADEA 4AFMA 4MGTA 1IS6A 2MHFA 3M4FA 3VBOB 4Y22B 4FPKA 3HIFA 1VB2A 1C4RA 3VZKA 5FZ1A 2PHWA 3E97A 3AZZA 4LK7A 4NHKA 4AEDA 1C28A 3EQEA 1VBE1 3AXEA 1J84A 1N3OA 1MS8A 4AK3A 1BMV1 2BVBA 3DEMA 5FP8A 1H30A 2Q0AA 4N53B 3RZGA 4V1PA 4FO9A 2WAOA 4CDXC 2ZHLA 4Y1ZA 1AZDA 1SBEA 4XJ8A 1L7RA 5IHRA 2V5DA 3MIGA 1NLSA 3EMRA 3ZDVA 5LW9A 1PNGA 3PVBB 3SISA 3LKJA 4K6BA 3H3LA 3IMNA 4IEOA 4MYEA 1VBE2 3RZMA 5ISLA 2O8OA 3ZKYA 1FMD3 4Q4V3 4ZKTB 2UY9A 3UYJA 1CAVA 4C0BA 3APBA 1ENQA 2VU9A 4CU9A 3MUY1 2PLV1 3MIDA 5FPUA 3ZN4A 2FD8A 5CNAA 2VZRA 3SCFA 1FI2A 2D98A 2HWB1 4UI9L 1C57A 2JE9A 3OF1A 3PTRB 2N7GA 4JKKA 2KR2A 2OA2A 5F5CA 1W3XA 1LB2A 3HVDA 4YW7A 4I2OA 2IXCA 4CE8A 5I93A 5K7PA 1DYOA 3I59B 2BDRA 4Q4W1 3SLIA 2D3PA 1UY3A 1C5HA 4CDWA 4KWLA 1XE0A 3A0KA 4ZU5A 2VCMA 1CAUA 3J8F3 1MQTB 5HI0A 1GBGA 1OI6A 2ZGSA 1F35A 5CU1A 1OFNA 1ZRCA 4XAEA 4NIGA 3U78A 4PBPA 2MEV3 4COVA 1WCKA 5DQ0A 3OBTA 1N1SA 4H3WA 4QGNA 4LHKA 2XMLA 1E5HA 3LDKA 3DPRB 1HIXA 5HV4A 5CYYA 1FAYA 5FZHA 4CDQB 5LZ6A 3WNMA 1N1VA 4Q0SA 3O14A 4ES9A 3USUB 3UT0A 1R093 1RUD3 5FZAA 4Q0UA 3H8RA 4FXKB 2DBNA 1HB1A 5A7PA 4ASMB 2KD7A 1V6OA 2WLQA 4WVWA 5IT6A 5F3CA 1I5ZA 2WQ8A 4GMP0 4XCAA 1YJLA 4FFHA 3IIIA 4QM8A 2VAUA 3ABZA 3N9OA 4HVRA 3PL0A 4PI0A 1QY4A 3WDYA 1AYN3 1W39A 3SH5A 2GMEA 4I3PA 2D6NA 4MH0E 2GN3A 5F39A 5KHKA 4IGQA 1Z7S2 1W04A 4B4QA 2DUQA 1UPIA 3OD0A 2FZ2A 3AKSA 1RHI3 5BXXA 1RMU3 2ORXA 1GOFA 1R083 2RJ2A 5FZ0A 2RS52 3GM8A 4D7TA 5CA6A 2BTVC 3POIA 2VOKA 2Z69A 1DGWA 3ZIWA 2RM22 1VBD1 4FI9A 2P5BA 3Q8EA 4AFBA 2GH2A 2YFZA 1LAJA 1CZVA 5I0SA 2XHKA 2BGPA 3AK0A 3IBMA 4PIYA 2BJSA 1YWKA 4XUTA 2I2SA 1CGPA 1QJX1 1SDDB 1JODA 1H6YA 1RVF1 2RR11 2VZ3A 4FVVA 1ZRDA 1HQLA 3ITQA 1W8NA 4QAWA 5ANQA 5F2SA 4A41A 5LY2A 3ZFGB 1NA1C 2A6ZA 3DYOA 4XUQA 4XZPA 2GNTA 4XTMA 5L7OC 1HV1A 3DXTA 1LOFC 3DV8A 4RA0A 4M3CB 4PF5A 4LXLA 2JX9A 1VB4A 2W08A 2P17A 1MZ6A 1R082 1W6NA 2W1UA 4S2HA 4X6RB 1CIYA 1COV1 1UZ0A 1VBE3 2B7YA 3ZYGA 3T0AA 3M3EA 4D7SA 3WXPA 3IDEA 2FDGA 4Q5OA 1REFA 3ETQA 3I54A 4YZ4A 4DNYA 3V0AA 1DQ2A 2WNUC 3TOJA 3RJRA 4WBBA 3AX4A 5FO9B 4QM9A 2BNNA 2H0BA 2Y0IA 3K75B 4W6WA 4AZZA 2OUHA 4CP2A 3RZJA 1SBFA 4QQHA 5I0DA 3K4DA 2WWUA 5FZOB 4IE7A 3ACGA 1HDKA 3EO6A 4Z2AA 1UZYA 3RYRA 5JXJA 1AR63 5JXIA 1DZTA 4QWNA 3VD9A 4YYOA 3KF3A 1UIKA 5T52A 1GZTA 1W8FA 1RTVA 2PHTA 4LA3A 3N7KA 2DCZA 4AVSA 4EQVA 5A6QA 1CONA 2WJSA 4FPEA 5D8AB 2X8KA 3WX5A 4BE3A 4AYUA 5C3QA 4I01A 2ZX2A 5FV3A 3NKGA 4F7ZA 5FOJB 1W6PA 4YZ5A 2QZ3A 4EN8B 5KWRA 3MV01 3ZXAC 2LALA 1JTZX 1POV0 3JZVA 3N3HA 5J96B 3BI3A 4DEVA 4R4XA 5FUNA 1QOTA 3WNNA 5JXGA 4XEZA 1WBFA 4XUPA 2GNDA 4CEYC 2EIBA 5CIRA 3E5UA 4TYSA 1Y7BA 3WG1A 4AI2A 1IGOA 5JR7B 2AREA 4ZXEA 5DDJ2 1DQ6A 2WSUA 1UKRA 1XXNA 2WDBA 2IFRA 4GB33 1JMUB 4NOTA 1PMHX 1HRV3 1JW6A 1XBFA 5FZ9A 2EAAA 3NVCA 5K0UB 3LOBA 2Q8EA 2JJ6A 1MQTA 5SV8A 1W6OA 2E7AA 1H6XA 3AMQA 4BQ4A 4FQZA 4AQSA 2PQSA 2WABA 3IDAA 4IV3B 4A4AA 1EAH3 4CYDA 4C90A 3KCYA 1JH5A 1XYPA 2VZSA 4Z07A 3RZLA 3KS7A 2VTXJ 4CU7A 4ZZ5A 4KNCA 3WW3A 1LEMA 4M4PA 2QQVA 1RUG3 1WLTA 1LRHA 4NIDA 2YUEA 1BMV2 4P9WA 2VM9A 5J98B 4WVMB 1QQP3 1WCSA 1H0BA 1ULFA 2BZDA 4B4RA 1ENRA 3D0JA 1CN1A 3VHRA 3ZPYA 2FBEA 3T1MA 3PVEA 2HH9A 5GALA 2I74A 2EIGA 3GCWA 3ZXEA 4QPYA 1QU0A 1V9U3 2WA4A 1FNZA 4WM7A 3WHUA 4A7KA 4UXAA 4AW7A 1H1MA 4JTOA 5FY5A 4O61A 3A23A 2FDIA 4M3CE 3LFMA 2ZGOA 3JXSA 2WZR2 5A7NA 5LB6A 2A71A 4IUGA 2NYYA 4NHYA 2ZJCA 2RDRA 3X29B 3KGZA 4QXCA 3ZN6A 1CWPA 2DU0A 3LPGA 2J1AA 2UWCA 3QCWA 2ZGQA 1VBD3 1AUYA 1LOBA 3BU0A 2ENRA 1G8WA 5FY0A 3WG4A 4M4RA 4Y5Z0 1IPKA 3VUOA 1OOPA 4NRMA 1JOPA 2AACA 1RVF2 3AM2A 1JZ8A 1OH4A 1NE6A 3HBKA 4B3NA 5DAWA 2PELA 1NOVA 2B46X 1TE1B 3GXUA 4EN7B 4XXPA 3KSCA 5EJ3A 2JEMA 3LEKA 2V09A 1YFYA 1HQNA 3I3EA 5JOWA 4GQ7A 4QB1A 4XZUG 4NUBA 3NRUA 5FY7A 2YG0A 3KT1A 5KC5A 4COWA 2WBKA 4BMBA 3H7JA 1HJGA 1WCDJ 4R8HA 4YW2A 4KG8A 3WQ7A 2R041 2XPJA 1GYKA 3WF2A 5C4WC 4D0QA 2X5IB 1RXFA 3GHNA 4HETA 2ZGTA 4K8RB 1SEFA 5FTTC 2JDZA 1G9DA 4EROA 3AVRA 4IEYA 4DUWA 4LIUA 4MGSA 3R4UA 1Y43B 4UAPA 2HWF1 3HOBA 1AL22 4MADA 4K1ZA 1V0AA 5A3UA 3I3BA 2IWGB 1BEV1 1ZZ7A 3WUDA 4IEPA 3KQRA 3DL3A 2O14A 3NSTA 2R071 3EJKA 4UFIA 1X82A 3WF3A 1B35A 4HVQA 1S2KA 4AR2A 2ATFA 4QMAA 1WCQA 2BWCA 4URAA 2RE9A 1PO21 2WWJA 2K46A 3ETPA 1RL3A 2I45A 3BU7A 2BVVA 5KXBA 1GNYA 5EYYA 4KWKA 2JG9A 4DMIA 2VW1A 2WQZC 5IJRA 1C5IA 4Q1PA 1SDWA 2VQTA 3N9MA 3MEPA 5J7MA 3HEIA 3MV11 5FPBA 3RYPA 3EB7A 4PJYA 3DECA 2A73B 2BGCA 2WR9A 3N9NA 5L9RA 2VNOA 1HN1A 3P3PA 5HXMA 5FMCA 3U11A 1HRV2 4KGGA 1ZRIA 2RJLA 4CDUC 4EN9B 3NNMA 1SZBA 4OHWA 1O8SA 1OF3A 1X9TA 3JU9A 3ELNA 3ZSJA 1ZX5A 1XPWA 2HEYF 2GALA 4QKFA 1RJ7A 1XOYA 2C26A 3LD8A 3GHMA 4QHBA 1F15A 2ZMNA 5IUQA 4J6GA 1YCIA 1RUJ2 1UMHA 1EV12 1WMXA 2PFWA 1TNRA 5IW0A 2XBO2 3CJIB 3H1YA 4FPHA 5EV7A 4UBHA 3K77A 4FPFA 1AHSA 4IE6A 4UWDA 3VDAA 1OD5A 4X6QB 1GICA 1C8NA 4LBMA 3PLQA 4HFSA 4S2FA 3DF0A 5LATA 3ZYFA 4CCDA 1LJ7A 2D7FA 1GNZA 2R061 3HN1A 1DQ4A 4PHZA 4R4ZA 2YBSA 4XVHA 3KT7A 4HSLA 5L73A 1CESA 2JDMA 4XABA 4XBNA 3TYJA 5ANNA 1FMD2 4Q4V2 2TEPA 4DY3A 2LM3A 3VZLA 1OA2A 4FXGB 1O6UA 5FPLA 1U5IA 1VMJA 4P9YA 4ZZ8A 4FPOB 4QQLA 3HNBM 2G9ZA 2YC4A 1DCSA 1MS1A 3IKWA 3CHXA 4ZONA 3R05A 5T50A 4UW4A 1ZZ9A 1MS3A 1RINA 5ERLA 1HXS1 4CSWA 2P37A 4JHTA 1G9AA 3IM0A 1AYM3 1WW5A 3I8TA 4J1WA 3ZYIB 2EIEA 1RUJ3 1YI7A 3NL1A 4LITA 1G9CA 1MPXA 5DMYA 3ZN5A 4HT1T 5BNOB 2GN7A 1QDOA 5FPAA 1UZWA 4QX3A 1NE4A 1R1A2 1J3QA 1S0EA 4OULA 4XUOA 4AFAA 3IB3A 4OUSA 3ZN6B 1CAVB 2VMFA 4D6SA 4JRAA 5F6LB 3JD73 5FO8B 2YMZA 2A6VA 2EXHA 2YC0A 3RSJA 2ID4A 4YW3A 1JN2P 2D3SA 3NAPC 3MIEA 4NIIA 4NPMA 2R043 4HN1A 1GP4A 4AI1A 4GD4A 3S57A 5GJ6A 4BQ5A 3H9AA 1US3A 4QD2A 4QPIC 3LE0A 1SFPA 1X8MA 4FSJA 3W20A 4R52A 3S6PA 5F6KA 1UYXA 1GOGA 1JS9A 1UAIA 2O1QA 2VUJA 2VW2A 2Z42A 3THCA 3F2ZA 5FK7A 3AZXA 3CEWA 5AVAA 1LU1A 3PMSA 1HLCA 2JE8A 1SPPB 1WMDA 4HONA 4YW4A 4RS5A 2C24A 2AUYA 3LPFA 4Y1XA 1IS4A 3HNYM 4V2VA 5ACA1 1V6NA 1VBA1 2C4XA 2DCKA 2VOVA 2WAAA 1YIFA 5CISA 3OG2A 1O59A 3T2QA 3HPNA 2LS6A 2QQJA 2R073 3FZ3A 3WF4A 1KXGA 5LBBA 1QWRA 4PQ9A 5DG2A 5T5JA 4W65A 3ZFEA 5CFCC 1GR3A 4Y20B 5FO7B 1J1LA 2OW4A 1PO23 5FY8A 4XF9A 4XW3A 1RUC3 3B94A 1RUG2 4PCRA 4D6QA 2GSYA 1PM7A 3OGGA 1X8EA 2OPWA 4LULA 1QXRA 5SV5A 4I0AA 1R1A1 1S2EA 4RFT0 5JXHA 2BERA 1M06G 1UXZA 1SPPA 1GANA 4FTEA 2B8MA 2PXJA 2WNVB 3WNKA 4E9KA 3R6SA 2BYVE 4L9BA 1EP0A 4IETA 2FHRA 1V6JA 2W9XA 5D8AC 2ZOEB 4DY5A 3SNMA 4LBKA 2E7TA 4LO6B 1VBC1 2FDJA 4BHPA 2BUKA 2QUOA 4QGLA 1I3HA 2E9QA 2XB6C 3B00A 5KHHA 5DAXA 3VZJA 2BWAA 3ATGA 1VJ2A 1UCXA 3ZYPA 1ZBA3 2EIDA 3T2OA 1UMIA 1DP0A 1ND3C 4NHXA 1J83A 1H2NA 1HB4A 3GBFA 4B1LA 5FAXA 5FYCA 1LGNA 3LSDA 4Y22A 4DFSA 3VBFB 2WNUB 2XDVA 2R062 4FOWA 4AVAA 3J8F1 5IVEA 1WUVA 1APNA 1O5LA 1OXCA 4JGZA 4Y4RA 1WA4A 2Z2SB 1UOFA 1RUF1 1SACA 4TLGA 4UF0A 4GMP1 3LF7A 2PHUA 4XFCA 2CL2A 5JOZA 3WVJA 3AP7A 4XFAA 5JPMB 2PHXA 1RUE2 2W95A 1R64A 1ZNPA 4MSVA 1FX5A 2DURA 4NIAA 3CL1A 5HCHA 1GWKA 4OI1A 3FWEA 2K9ZA 2ZCWA 3VBRC 2QQIA 2YB7A 1DYPA 2QVSB 3AVSA 4E27A 3ROUA 5ABJA 2WZR3 1RUH3 2XWBB 3ZFFC 3EBRA 2HWC3 2Y33A 3NJXA 2DU1A 2JDHA 1BLZA 3LOIA 2VY0A 4HK9A 4QPGA 2VZUA 3AFGA 3A21A 4DXRA 1AYN1 4AVCA 4Y4YA 4MLOA 1CX1A 1KDKA 4OHVA 4KU8A 2BU9A 2JECA 1S1AA 3IAPA 4GWNA 2X10A 2C0ZA 1Y9MA 1OSGA 2ORZA 2RS53 2IXLA 3MLLA 4JDOA 3WP5A 4FTSA 1WBLA 2LRPA 1Q8SA 4MXWA 4MOAA 4S2GA 4MGYE 2PAMA 3CLPA 1QQP2 4OQ9A 1Z7S3 1AF9A 2F6BA 1O5UA 2VNVA 2Y6FA 3B9CA 3OEBA 4GAZA 4CEWB 1K42A 3MIHA 1TG7A 1J3PA 4RFRB 3MUZ1 4MHUA 3HNMA 2ZAHA 2Q30A 1OLME 3PUAA 5A7QA 4GJYA 1BVVA 3HQRA 5LASA 5IVBA 5LA9A 3CKHA 1QJX3 2RR13 2J7MA 3LIHA 2CAVA 5FYYA 1RYYA 1UF2C 3D82A 1WMFA 2YHJA 1CVNA 5I0UA 2Y60A 3VBUB 1ONAA 1TMF2 1LOEA 3LB9A 1W3VA 5GLUA 4HPKA 1CAWB 4AFDA 2AENA 2HWD2 4YFZA 4LOSA 1YO8A 4BDVB 4ZPIA 3CNAA 4A3XA 4L92A 1POV3 1W8WA 1WD3A 2YROA 2ADDA 4UW5A 4W6YA 5L9BA 1B35B 5DN2A 3H1WA 1JHNA 4Z8BA 4KH9A 5EQUA 2R1BA 3M3QA 4P9LA 1UO9A 3VL8A 5LK7B 4RQPB 2WNVA 4AHZA 3GCXA 1XC6A 1YQ5A 1W2AX 1AJOA 2ZX4A 4OFGA 4IXLA 5T5PA 4A3ZA 1KRIA 4FOYA 1VRH2 1QJY2 2EALA 3FMGA 1QJZA 1DIWA 1XNAA 2J1RA 1Y9QA 3U75A 3AMMA 4RHV2 5FP9A 1YFXA 2A75A 4N43C 5FK8A 4NR1A 5FPZA 5E89A 1XNBA 1SLAA 3CZJA 1L7LA 2HJIA 3DUIA 1AR62 1K5MC 4LO5B 3VDDC 1RUI1 3DPRC 4YZ3A 2LTNA 2Y8KA 1EY2A 4GIQA 1AX2A 2WNOA 3RJ2X 5FR3A 1H1AA 2XWJB 3ES4A 4BOWA 3TBDA 1KITA 3B69A 2WFF2 1OA4A 2PQQA 4CCNA 2X09A 3V56A 3VBUA 3AL6A 5KXDA 3UNPA 3IDCB 3OPWA 1Z0HA 3ZYRA 4BU2A 3MFAA 1C3HA 1PK6C 5FJHA 1YQ6A 2B42B 3ZFFB 2BOJA 2XH6A 1K3IA 1RUE1 2QDRA 4Y5SA 3LIGA 5FPVA 1L3JA 1BHGA 3MYXA 2ZEYA 2WIIB 3OY8A 1UOJA 2ZHNA 4HMZA 4Y1VA 3UL2A 4AVVA 1WZXA 3JCIA 2ZABA 1I5PA 3AXDA 3NNGA 1RUF3 4A42A 2HEVF 4EZ4A 5JOXA 1QHDA 2HWB2 5T5LA 4O9GA 1UZVA 5KHGA 1IQAA 3E6DA 4M0NA 4NJ4A 2RS12 3T4HB 1EAH1 3B93A 4DOUA 3LWCA 4RYDA 1FATA 4YM2A 5EIYB 2IVIB 2VVFA 4RHV1 4FFIA 1ZBE2 1POQA 5JZGC 3RFRA 1U0AA 1QQP1 4QPGB 5F5AA 2NPIA 3AYEA 1W2OA 3VBHC 1CAXB 4LBNA 5CB7A 2PAEA 3I4IA 5DUUA 1JZ4A 2CWMA 3LEGA 3E6BA 3KGLA 1NT0A 2ETEA 2WUHA 4XFHA 1TZOA 3JBG1 2VUDA 4P9XA 4XQWA 2VBPA 1M4WA 3DN7A 1HJFA 3LZZA 3THTA 5K8SA 1O91A 5ACA2 1JYCA 3S7EA 3I3MA 3W58A 2DVDA 1IOAA 1S0IA 2EF6A 4IV3C 1OLRA 1JU3A 2A3WA 2RMU3 4KWUA 4YM0A 5A32B 2BNOA 4NHMA 2NLRA 1Q5OA 3VD5A 1OA3A 1QOOA 2LUWA 2QQMA 1E57A 3P1IA 5DDJ3 4BK4A 5AC93 4YFWA 5T5OA 1OUXA 4PLNA 3ZSMA 4A7YA 2RM23 2WS93 4UT5A 1MEC2 3ZVXA 1FOD3 1LGBA 1BBT3 2XR4A 4QPWA 4X8NA 5D2AA 2PHRA 3HR9A 3MFCA 5A3PA 5EFUA 1NA1A 3POEA 4MO3M 2GC3A 2XVKA 3BALA 1ZZBA 3TEWA 5L7OB 1XNDA 2TNFA 4MVTA 1UU5A 5A3WA 4XFBA 3I2DA 1YQCA 4FAGA 1DGRA 1AL21 4S2DA 4YRDA 5LA1A 4Z82A 1NCQC 3SHRA 4EZHA 3ON7A 2XJQA 5DUVA 3CDZB 1UMZA 1GP6A 2UYAA 3MDPA
chains in the Genus database with same CATH topology
3HQUA 5DAXA 4BQYA 4UWDA 2FCTA 5DAPA 3W20A 4BQXA 4NHXA 3OUIA 5LATA 5LB6A 4NHYA 3KT7A 2RDRA 4XABA 3GZEA 5LBFA 2Y34A 3ITQA 2JIGA 4XAAA 4NHKA 5C5UA 2G19A 4XACA 5DAWA 4KBZA 4Y5SA 4ZONA 2FCVA 4IW3A 4NAOA 3OUJA 5C5TA 4MHRA 5ERLA 2HBUA 3OBZA 4Q5OA 3OUHA 3GJBA 3EMRA 4XCBA 3KT1A 2RG4A 3NNLA 2Y33A 5EPAA 5IAVA 2JIJA 5IATA 2A1XA 5DAVA 2RDSA 3BVCA 5LBEA 3MGUA 5EP9A 4J25A 5A3UA 4NMIA 4MHUA 3DKQA 4NHMA 5L9VA 2RDQA 3W21A 3HQRA 5LASA 5LA9A 2G1MA 3KT4A 2FCUA 5LBBA 5HV4A 5HV0A 4NHLA 3NNFA 4Y5TA 3NNJA 4ZPIA 5DAQA 5L9RA 4JZRA 2OPWA 5M0TA 2RDNA 5L9BA 4BQWA 4XCAA 5IAXA 3NNMA 3PL0A 2V4AA 5EQUA 3GJAA 4XC9A 5LBCA 2HBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQU A;  5DAX A;  4BQY A;  4UWD A;  2FCT A;  5DAP A;  3W20 A;  4BQX A;  4NHX A;  3OUI A;  5LAT A;  5LB6 A;  4NHY A;  3KT7 A;  2RDR A;  4XAB A;  3GZE A;  5LBF A;  2Y34 A;  3ITQ A;  2JIG A;  4XAA A;  4NHK A;  5C5U A;  2G19 A;  4XAC A;  5DAW A;  4KBZ A;  4Y5S A;  4ZON A;  2FCV A;  4IW3 A;  4NAO A;  3OUJ A;  5C5T A;  4MHR A;  5ERL A;  2HBU A;  3OBZ A;  4Q5O A;  3OUH A;  3GJB A;  3EMR A;  4XCB A;  3KT1 A;  2RG4 A;  3NNL A;  2Y33 A;  5EPA A;  5IAV A;  2JIJ A;  5IAT A;  2A1X A;  5DAV A;  2RDS A;  3BVC A;  5LBE A;  3MGU A;  5EP9 A;  4J25 A;  5A3U A;  4NMI A;  4MHU A;  3DKQ A;  4NHM A;  5L9V A;  2RDQ A;  3W21 A;  3HQR A;  5LAS A;  5LA9 A;  2G1M A;  3KT4 A;  2FCU A;  5LBB A;  5HV4 A;  5HV0 A;  4NHL A;  3NNF A;  4Y5T A;  3NNJ A;  4ZPI A;  5DAQ A;  5L9R A;  4JZR A;  2OPW A;  5M0T A;  2RDN A;  5L9B A;  4BQW A;  4XCA A;  5IAX A;  3NNM A;  3PL0 A;  2V4A A;  5EQU A;  3GJA A;  4XC9 A;  5LBC A;  2HBT A; 
#chains in the Genus database with same CATH topology
 5EJ1 B;  2HYX A;  1OLM A;  2DVF A;  4CEY B;  4YG3 A;  3IT8 A;  4OHZ A;  4LLO A;  4PDW A;  3K3N A;  1PVC 3;  3R0R A;  5FRE A;  5FWJ A;  3KZ4 C;  1I6X A;  3LA2 A;  4PLO A;  3MBW A;  1HV0 A;  1DQ0 A;  1XNT A;  3VDC A;  3BCW A;  4Q8L A;  2H0V A;  2XJR A;  3CU7 A;  3CF6 E;  3D8C A;  4BQ3 A;  5JZG A;  4XBQ A;  4FBF A;  1ZA4 A;  1DGR N;  1W8T A;  2VTF A;  2YU1 A;  1UOG A;  3KD4 A;  4G3Y C;  4NRO A;  4Q4Y 2;  4XIK A;  5JI7 A;  1SG3 A;  2HWF 3;  3AJY A;  3T0B A;  1PVX A;  2ZXQ A;  4CPB A;  3KHC A;  2XKP A;  4LBL A;  2R0F A;  2VGD A;  3HJR A;  4OZO A;  1YQ2 A;  1TME 3;  2DF7 A;  4M00 A;  3OB8 A;  1VRH 1;  4CZS A;  1XU1 A;  3D5O A;  2WYS A;  3HMY A;  3CJI A;  4WM8 C;  1W99 A;  5FUI A;  3GDB A;  3TNQ A;  5BNP A;  5C5U A;  4Q4Y 3;  1VBB 3;  1KEX A;  4QPI B;  4RS5 B;  1VBB 2;  2O0O A;  4OUE A;  5DG1 A;  5F7U A;  5F2W A;  1NYW A;  3HT2 A;  2Q4S A;  4CCK A;  1YQ8 A;  1H4G A;  1Q56 A;  2DTW A;  1EV1 1;  3ILN A;  4J1X A;  3R4D B;  4NPL A;  4Y1U A;  3MLK A;  2KXL A;  4IQP A;  4JAA A;  1ENS A;  3ZXJ A;  5KR7 A;  4OHX A;  4XQ4 A;  2Q5T A;  4YM1 A;  1OPM A;  1BZW A;  3M3O A;  4CXY A;  3NQH A;  2NM1 A;  4RD7 A;  1FPN 1;  4JDN A;  4YLZ A;  1RB8 G;  2EA7 A;  1CIW A;  2VZV A;  1RHI 2;  2X5I C;  1P8J A;  2WYF A;  3FC0 A;  4XMI A;  1XB9 A;  3F95 A;  3PVN A;  2NN8 A;  4W6X A;  2W92 A;  5FFO C;  2ZZJ A;  2UWB A;  1IS3 A;  2V73 A;  3B01 A;  2A3Y A;  3VD3 A;  4COY A;  2DDU A;  3NAP A;  4RR3 A;  4R9C A;  4XOG A;  5C7G A;  4DPN A;  4I0W B;  3THP A;  2BQP A;  4RHV 3;  3H50 A;  1QIQ A;  4LLF A;  3FUQ A;  3VD4 A;  2A5Z A;  4XDQ A;  3RWN A;  2XL7 A;  5F3E A;  4CDQ C;  3W59 A;  1LEC A;  4J25 A;  3O1T A;  5K4L A;  2XJU A;  1H1I A;  1XRU A;  5FZI A;  5K9Y A;  4N43 A;  2H6B A;  3EXU A;  1ND2 A;  4AQ6 A;  3FLR A;  4JVA A;  3GAL A;  4IE0 A;  4CRQ A;  5J36 A;  2R06 3;  2QTW B;  4AOC A;  2AH2 A;  2W3J A;  1TEI A;  4YGB A;  1S0J A;  2BPA 2;  1RHI 1;  3O12 A;  1R08 1;  4I3G A;  1KDM A;  2DVG A;  1QJE A;  1NKG A;  3M3C A;  3OGS A;  2RMU 1;  3SIT A;  5C71 A;  2VO5 A;  3E5Q A;  3RZK A;  3BN6 A;  3J8F 2;  3NV2 A;  2IVJ A;  4LKE A;  4NE9 A;  3VD7 A;  2AEZ A;  4Q0Q A;  5IK4 A;  2CNA A;  1ST8 A;  2VR4 A;  2GP3 A;  1AR8 3;  3CJI C;  2VEC A;  2PHL A;  2PLV 2;  4WVV A;  3TN9 3;  5AC9 2;  5LCW L;  2WO1 A;  5DAQ A;  5F3I A;  1AYM 1;  1VLN A;  5FYH A;  3LSE A;  3RMY A;  4XBL A;  4CP0 A;  5M0T A;  3N4M A;  4FOQ A;  2VMG A;  3WQB A;  5JDB A;  2DUP A;  4YVW A;  4UW3 A;  1Y4W A;  3ZO0 B;  2Q1Z B;  1CAX A;  1ND2 B;  2RS1 3;  4W8J A;  2P3J A;  2XL9 A;  3C8X A;  4JGY B;  5CZK A;  5HXV A;  3USS A;  1AL2 3;  3OD4 A;  4N9I A;  4K8F A;  4XUR A;  3SEP A;  3TB0 A;  1HW5 A;  1UYZ A;  1X7N A;  3ZYJ B;  3TWI A;  3C7F A;  4ZXK A;  3WNP A;  4QX5 A;  2D5F A;  4UFK A;  4DIN B;  1RJ8 A;  3T3Y A;  3BB6 A;  1CJP A;  3ZXF A;  2YGL A;  1W05 A;  2JB4 A;  4D7Y A;  1JBC A;  5JCT A;  4EN0 A;  5CG9 A;  3FHI B;  5JVV A;  2R04 2;  2PAK A;  2VOW A;  3BPS A;  2CTV A;  4ORF A;  4BJ0 A;  3DKW A;  2JG9 B;  3UKV A;  4E2Q A;  5JSP A;  3POG A;  4DXZ A;  1BKZ A;  2IZW A;  5TSW A;  2VOX A;  4N90 A;  2JIG A;  3UKN A;  3ZFF A;  2YV8 A;  1XE8 A;  2G19 A;  5FZD A;  2PA7 A;  4GUL A;  5GKA C;  4YM3 A;  1DDL A;  1LOF A;  5AFE A;  5IVY A;  4MX3 A;  1CQ9 A;  4JRL A;  3T08 A;  4BWO A;  2D3R A;  2BGO A;  1VBB 1;  4Q8K A;  1QJU 2;  5FP3 A;  1RUC 1;  2Y38 A;  2PHF A;  3GBW A;  2G9G A;  4IV3 A;  5A7S A;  1COV 2;  4LBQ D;  4K1Y A;  3VBO A;  1LHV A;  4D69 A;  1IHM A;  1H9P A;  1R1A 3;  1O3Q A;  3ENR A;  5LK5 A;  3BTY A;  1BEV 2;  1U5Y A;  1ULO A;  1NQD A;  1QH7 A;  3IDB B;  3FE5 A;  2I07 B;  1E5S A;  4GXL A;  4AAP A;  5A3M A;  3AMP A;  3WUC A;  4LHS A;  4LNV A;  1GOH A;  2XVG A;  4L11 A;  4PBO A;  5A7W A;  3OEA A;  4H7L A;  4TXW A;  3UK9 A;  3JB4 C;  2W47 A;  2HWE 3;  4XMA A;  1GMM A;  1O4Z A;  1J1T A;  5EP9 A;  5FRA A;  5LBE A;  3VZN A;  1J59 A;  4AVT A;  1C8M 1;  4CUA A;  2Q1M A;  1PO1 2;  4DXT A;  1W8O A;  3BOW A;  4IV1 B;  4PIZ A;  2CAU A;  3DYM A;  4HN0 A;  5FMB A;  2QFE A;  4MGQ A;  3RPQ A;  4E4H A;  1JYI A;  4LKS A;  3E1F 1;  3VBH A;  2XJS A;  1VAV A;  3H0O A;  1MS4 A;  2XHN A;  3ALQ A;  5A3L A;  3WDU A;  1BBT 2;  1W0O A;  4HPK B;  1Q8P A;  4NN0 A;  5A6Y A;  3FBM A;  3RNS A;  4XDP A;  5CFD C;  2A3X A;  5FYZ A;  5KHJ A;  1JZ7 A;  3CBN A;  4RGG A;  5C9A C;  4AI9 A;  4Q27 A;  1VP6 A;  3SKJ E;  5IYY A;  1UWW A;  2JDY A;  5L19 A;  1ZRE A;  1UXX X;  1WLC A;  4QDS A;  3MZH A;  4BA6 A;  4XFI A;  1GNH A;  3ZXD A;  4QHZ A;  4RGK A;  2MEV 2;  2VW0 A;  1BK0 A;  1V70 A;  2BBA A;  3NAP B;  2NP0 A;  3NNJ A;  4ASL A;  3HT1 A;  4U36 A;  1HXS 2;  1FOD 2;  1UPS A;  5A3T A;  2RDN A;  5CFC B;  2QJV A;  4RSU A;  4UBG A;  1AR8 1;  4CDW C;  2GMM A;  4BLI A;  3K3O A;  4QDR A;  5A70 A;  4DQA A;  3I2I A;  4X8P A;  2BV4 A;  4D8M A;  4YVW B;  2RMU 2;  2HBT A;  4FPG A;  4Y3O A;  2IXK A;  2JB8 A;  4LBQ B;  3VHP A;  1JYW A;  3J4U H;  2DVB A;  3BIW E;  2OQ7 A;  3TRS B;  4N53 C;  3ZMO A;  1D4M 2;  4LE4 A;  1ODM A;  3VBH B;  2DFC A;  4C8D A;  3AYD A;  3JBG 2;  2WN2 A;  3IMM A;  1NCR A;  4YNI A;  4BXF A;  1IKP A;  4CP1 A;  1WW6 A;  2ZA9 A;  4QQ2 A;  2WT1 A;  3L2Y A;  1F4A A;  4BZ4 A;  2VMC A;  1HRI 1;  1SLT A;  1NZI A;  1UYY A;  4CDQ A;  1LR5 A;  1W2N A;  2QE3 A;  3ZDS A;  1UKG A;  1GP5 A;  2D43 A;  4YVS C;  3V0B A;  1SLL A;  5LWB A;  2QNK A;  1NCR C;  1F9K A;  1WW4 A;  1AX0 A;  2JG8 B;  3GGL A;  1SHW B;  5GZF A;  4AQ2 A;  3I97 A;  3GZE A;  5I8S A;  4CDU B;  2YGM A;  3U07 A;  5HCF A;  1RC6 A;  3IPV B;  2G9F A;  1AR7 2;  1RGS A;  1VBC 2;  1IS5 A;  2JD4 A;  4XAA A;  4CDW B;  1JZ3 A;  2TBV A;  2ZGM A;  2X5I A;  3EYP A;  3PUH A;  3ACL A;  1RUI 2;  4FPL A;  3BTA A;  2BNM A;  4HSJ A;  4KBZ A;  5CAD A;  4MGZ E;  3S5Q A;  4CCM A;  3T4V A;  4IW3 A;  3JUU A;  4AED C;  2FMY A;  2VVE A;  1CJD A;  4YG6 A;  3DGT A;  2VUA A;  5FQ0 B;  5F5Q A;  5FLH A;  1ULP A;  1XYO A;  4C1X A;  1G7Y A;  1Q43 A;  1ZYB A;  4DEQ A;  3WP6 A;  1S0C A;  2OT7 A;  2C5D A;  4I09 A;  3KB5 A;  4Z2W A;  5FBZ A;  2P3Y A;  2W0X A;  4BCU A;  1POV 1;  2WLP A;  4QB6 A;  2ZML A;  1V6I A;  2XBO 3;  5IK7 A;  3K48 A;  5FZC A;  5BNN B;  3PUI A;  4V2W A;  1QJY 3;  5IAV A;  2XLG A;  4FPJ A;  2ZX0 A;  1PGW 2;  2OUJ A;  4BIF A;  2JEN A;  2VZ1 A;  2ZKL A;  5IFT A;  1YJK A;  4ATE A;  3LGR A;  5FZ3 A;  2JIC A;  1JZ6 A;  3VB9 A;  1MS9 A;  1QJU 1;  4IV1 C;  3ZR6 A;  5C8W A;  4PDW C;  2WQ4 A;  3UES A;  3ZM8 A;  2FZ1 A;  5C9A B;  1MS5 A;  3WV6 A;  3AMN A;  2ZAC A;  2O8Q A;  1W03 A;  1OUS A;  4LQR A;  1FMD 1;  1UQX A;  4Q4V 1;  1RUI 3;  4QQO A;  4AED B;  2XGX A;  3LEM A;  2IXJ A;  1OMI A;  2HYK A;  1JXN A;  3I2F A;  4CCE A;  4MET A;  4YW1 A;  4AGG A;  4ZY9 A;  1YI9 A;  4UW6 A;  4XIO A;  4P9G A;  4FAH A;  4ISR A;  1VBD 2;  5FYV A;  3O1O A;  4WM8 B;  5I8Y A;  1PIV 2;  5LA2 A;  2RDQ A;  4HVO A;  1SFY A;  1KS5 A;  1OT5 A;  1O8P A;  2KA3 A;  2QQL A;  3NV4 A;  3QH6 A;  4ZU4 A;  3ZFG A;  4A45 A;  2R49 A;  4E4Z A;  1EPZ A;  4YGC A;  2J42 A;  1ULC A;  2WZE A;  1CAW A;  1F31 A;  2Q1F A;  4IGP A;  3VKF C;  2XON A;  3EHK A;  3UET A;  4E4D X;  1DQ5 A;  4QX0 A;  2HWD 3;  2CGP A;  2WZ8 A;  3NNF A;  4I0B A;  1GZ9 A;  4GH4 B;  4JZR A;  5FKC A;  1PMJ X;  1W8U A;  2MEV 1;  2YDE A;  3CIH A;  3FBY A;  3O0W A;  2NZ9 A;  3KV5 A;  1QKQ A;  3A22 A;  2W46 A;  4QX1 A;  2TUN A;  3GZU C;  1PGW 1;  1JOJ A;  1UZZ A;  2AR6 A;  3WDV A;  4CEW A;  2W2I A;  4KL1 A;  1HXS 3;  1UY4 A;  3A0N A;  1YEW A;  2Q8C A;  3T30 A;  3ZIX A;  4LMF A;  2D97 A;  3UV9 A;  1V6M A;  1UU6 A;  3INA A;  1GZW B;  3CJX A;  3NW4 A;  4GKX A;  1RUJ 1;  4WVZ A;  5FLI A;  3VDD B;  4LBJ A;  3I2H A;  1CPN A;  3POB A;  4LT5 A;  3O1S A;  1W9T A;  4BYY A;  3FLT A;  5K0U C;  4BME A;  1YC6 1;  3VKO A;  4Z1V A;  1BXH A;  3FHQ A;  3USU A;  4YVW C;  1HRI 3;  2GC1 A;  3RS6 A;  1XNK A;  3ASI A;  4IDZ A;  5D8A A;  5FZF A;  5IFP A;  5FYM A;  2RVA A;  4D94 A;  1PGS A;  5I0R A;  1JZ2 A;  1PZ8 A;  1MEC 1;  5DPN A;  1LKN A;  1XU2 A;  4BM8 A;  3WEZ A;  3S0M A;  3WY6 A;  1AR7 3;  4QU1 A;  3S30 A;  1Q8O A;  4F83 A;  5T54 A;  3ZR5 A;  5AC9 1;  4IND A;  1W0P A;  2AEY A;  1W8H A;  1MS0 A;  5FY9 A;  3D0S A;  1UIJ A;  3AKQ A;  3UGG A;  4YSF A;  3VDB A;  2W39 A;  1D7P M;  3N36 A;  3SKV A;  1RVF 3;  1W8Z A;  2QDN A;  4ARY A;  2WFF 1;  3I59 A;  1W6M A;  3KV6 A;  5JOY A;  4JGZ B;  2E6V A;  4QXK A;  3WW2 A;  5FCC A;  5BNQ A;  4RS5 C;  2XLF A;  3AP4 A;  4HAN A;  1K45 A;  1LOA A;  2IC1 A;  5FZB A;  1Q8V A;  3KCC A;  4PI2 A;  1OOP C;  2P3K A;  1PK6 A;  5EPA A;  1H8V A;  4YW5 A;  3MW4 A;  4U2A A;  4C1W A;  2P2K A;  3AKR A;  2IXH A;  3WQ0 A;  1COV 3;  4JX0 A;  2R16 A;  2WFP A;  5IAT A;  5E6H A;  5FYB A;  1LHW A;  2DCY A;  2VJX A;  1ZM1 A;  2XG3 A;  1UX7 A;  4OCT A;  1QJY 1;  3MGU A;  5D1I A;  1OQD A;  1B09 A;  4M01 A;  1VMF A;  3WDT A;  1JYV A;  4QKD A;  2FDF A;  5J37 A;  2QQP A;  4Q0V A;  3VHO A;  5FYT A;  5KC6 A;  2C1F A;  4KI5 M;  2VC9 A;  2OPK A;  5FLJ A;  1AR6 1;  3QBQ A;  3ST7 A;  3GZT B;  1O4Y A;  4XJW A;  1RMU 2;  2GC0 A;  3V65 A;  4NO4 A;  4GH4 A;  3RVH A;  1U5X A;  1XYN A;  2QBX A;  4N53 A;  4GJZ A;  3RZZ A;  5A1A A;  3PNA A;  2RS3 3;  1N47 A;  2AGS A;  3TEY A;  1OVS A;  3W21 A;  4FP2 A;  2R0H A;  2WNV C;  4UFL A;  1UY1 A;  3B7M A;  4XQD A;  2FCU A;  2IXI A;  4QU2 A;  2OYZ A;  2HLE A;  4AEJ A;  1IG3 A;  1F8V A;  5EZW A;  4OZX A;  2JKX A;  4HL0 A;  1F2N A;  4WM8 A;  4ZS2 A;  5LA0 A;  5JI9 A;  4Y33 A;  2P34 A;  3BOD A;  1H4H A;  4P14 A;  3O1R A;  1R09 2;  1EV1 3;  1HQW A;  5A3N A;  5JIA A;  3TAY A;  1V9U 1;  4Y24 A;  5J1X A;  1JZ5 A;  1WLD A;  5C9A A;  2FDK A;  1LU2 A;  4RQP A;  3ZSE A;  3VZO A;  1SFN A;  2GNB A;  2J1T A;  4TN7 A;  1YNA A;  4DRV A;  5CKQ A;  4XF3 A;  2A7A A;  5EWS A;  4GB3 2;  2JWP A;  1ZZ6 A;  1YXW A;  5FY1 A;  3MPB A;  3OGR A;  1CAU B;  2QCS B;  1W28 A;  4P5Y A;  1LHO A;  3ZX7 A;  3OYW A;  2XQR A;  4IGO A;  4ATF A;  4JQR A;  4G9S B;  1EUT A;  4A6S A;  4AI0 A;  2ZTN A;  3KMH A;  1MVQ A;  2PMW B;  3I7D A;  3AZV A;  3WLU A;  2D40 A;  2WNU A;  2ERF A;  2UYB A;  5LBF A;  3ILF A;  4HBN A;  5FXW A;  4P00 B;  4QKB A;  4RR3 B;  1LNS A;  1SLC A;  1FV2 A;  1MZF A;  3LCP A;  2CY6 A;  2YPD A;  1I1E A;  3PIG A;  4JKL A;  3OYW B;  1UU4 A;  4COU A;  3IPV A;  1O3T A;  3HD8 B;  1QJF A;  2MNG A;  2X53 S;  3VBR A;  5C5T A;  1WLW A;  4MHR A;  4ES8 A;  1AYM 2;  4TLF A;  3HQX A;  2SLI A;  4JTN A;  1T6G C;  3HBZ A;  5L36 A;  3S5A A;  4BK5 A;  1PVC 2;  3OBZ A;  3OCP A;  3FJS A;  2GP5 A;  3OUH A;  3PIJ A;  3GJB A;  3POY A;  2SBA A;  4FCA A;  4L2N A;  3RGB A;  3TN9 1;  3U37 A;  5F1R A;  2P6H A;  3J26 N;  2RG4 A;  4AE2 A;  4ONU A;  4TTG A;  3U0Z A;  4N7U A;  4ZS3 A;  5GZD A;  3NNL A;  3VZM A;  1X9P A;  2WFF 3;  3ZFG C;  4WM7 B;  2VBB A;  1Q8Q A;  2YPJ A;  1BCX A;  2JD9 A;  4BPZ A;  2EIC A;  1B35 C;  1OC1 A;  2JIJ A;  2ZS6 B;  2K0G A;  2ZPX A;  4L97 A;  5FYU A;  5EYX A;  5FZM A;  4XYX A;  2QKD A;  3OTF A;  1OF4 A;  5BYN A;  1FYU A;  2P1B A;  5FOB B;  5JIU A;  4IL7 A;  1DF0 A;  4XDO A;  4HXC A;  5FXV A;  3THD A;  4QX7 A;  1PGL 1;  2Q8O A;  1D2S A;  3I2G A;  5J09 A;  2W94 A;  2DWR A;  5FZK A;  1K12 A;  1SMV A;  1W6M B;  2ARC A;  1EUU A;  1Y9G A;  3OGJ A;  3NKT A;  4E8C A;  4QGM A;  1YLL A;  3POW A;  1PIV 1;  4CCL A;  1W6O B;  3QOP A;  2VXR A;  1BQP A;  2VNR A;  2GH8 A;  5CBL A;  2E7Q A;  3MW3 A;  3PTY A;  1VIW B;  2B9U A;  1LOG A;  1TME 2;  1OH3 A;  2VZT A;  2VG9 A;  1N3Q A;  2ZGK A;  1FNY A;  4DUV A;  4FOV A;  2ZEZ A;  1KFX L;  1W6Q A;  3P3N A;  4RQP C;  1F4H A;  4R9D A;  3U14 A;  2HWF 2;  1D4V B;  5I0T A;  3KWV A;  3ZOI A;  1VMH A;  2RS3 1;  2RJK A;  3OPZ A;  5FXZ A;  4XHX A;  1VBA 2;  2ZZQ A;  1H8T B;  4LOR A;  5HPO A;  4OQ8 A;  2A6X A;  1KQR A;  2PLV 3;  3TN9 2;  1V9U 2;  1OPO A;  1VR3 A;  1WME A;  4KMQ A;  5FZ6 A;  3H8O A;  3J9S A;  5EJZ B;  2Q8D A;  1AVB A;  1AXK A;  5E1R A;  1JYX A;  4SBV A;  1QJX 2;  2RR1 2;  1ZBE 3;  3OOX A;  1QF3 A;  1LUL A;  4GKY A;  4K21 A;  3VBU C;  1G9F A;  3LDB A;  2J1U A;  5GZG A;  3J7M A;  4AFC A;  5IAX A;  1ND2 C;  2VZP A;  2WS9 2;  4QXH A;  3WNL A;  5BNN C;  1N1T A;  4FTB A;  3KLS A;  2BRT A;  4A2U A;  4L99 A;  5FJK A;  4ARX A;  5FQ0 A;  5IVF A;  4DIQ A;  4B1M A;  4QXB A;  2R1D A;  3K51 A;  3WCS A;  1YIP A;  3ZXK A;  3ACH A;  4PIX A;  2YC2 A;  1ZA7 A;  2OS2 A;  4LBO A;  2EVX A;  2LW8 A;  4TWT A;  4KBB A;  3I2J A;  5A32 A;  4CPB D;  5JAX A;  3U10 A;  1ASJ 1;  4BXS V;  4DB5 A;  1BVP 1;  3LA3 A;  1KJL A;  1S0F A;  2ZX1 A;  4WM7 C;  2VBD A;  1GFF 2;  2V5Y A;  2ZHK A;  3AFK A;  3WHT A;  2E51 A;  1RUD 1;  1RUN A;  4RN5 A;  4KU7 A;  5APA A;  3KQ4 B;  4YG0 A;  2J1E A;  3H42 B;  3BIE A;  1ODN A;  1W6N B;  1ALY A;  2XOM A;  1US2 A;  2FDH A;  3POS A;  3ZMN A;  3NWK A;  2VOT A;  3SEE A;  1S0B A;  1RUO A;  4PF1 A;  1NCR B;  4NWV A;  2W91 A;  4XAC A;  3PU3 A;  2EXI A;  2QQN A;  2CWS A;  2DCT A;  1G86 A;  4LBQ A;  1O3R A;  4OMC A;  3B5L B;  3UJO A;  4Y26 A;  1YFU A;  2C6S A;  4K40 A;  5EHD A;  3Q8C A;  3K46 A;  1DFQ A;  5B4N A;  1OQ1 A;  2Y6L A;  2XJP A;  2VQA A;  4BQ1 A;  1CPM A;  1OKQ A;  1LHN A;  2PYT A;  3SXW A;  3SH4 A;  1ULG A;  2VZO A;  4Q29 A;  5CFD B;  5CVR A;  3ZYH A;  3O1U A;  2JDA A;  3AP5 A;  3C7O A;  4P5H A;  5DDJ 1;  1OBN A;  1AYN 2;  4YGD A;  1ZRR A;  3M2M A;  4Q4X 3;  5I8T A;  4HG6 B;  1AR9 3;  4AHW A;  1BBT 1;  3KF5 A;  4AGR A;  4PQQ A;  1SBD A;  1IPS A;  2OXB A;  1ZBA 2;  4H14 A;  3RDI A;  4UYB A;  3SMH A;  2EXK A;  3FUO A;  4XJU A;  5JWP A;  2L9L A;  1U12 A;  2GU9 A;  5H9Q A;  3U4S A;  1A3K A;  1URX A;  1VBA 3;  4QQP A;  5LY1 A;  4FPY A;  3B3Q E;  2VMD A;  4QPG C;  4FFF A;  1KFU L;  1NCQ A;  3Q8F A;  4C0H A;  3T2T A;  2KM2 A;  3UJQ A;  2A6Y A;  4BIO A;  5A1L A;  3ZLI A;  1A78 A;  2UU8 A;  4XFF A;  2VMI A;  1WD4 A;  4CEW C;  3RWK X;  1D0G A;  1WCU A;  4EE2 A;  3ZSL A;  5JR2 A;  4P9J A;  1EAH 2;  5GLW A;  2JG9 C;  4CDU A;  1PO1 1;  3SCG A;  1WGP A;  1PO2 2;  2WL1 A;  5FP4 A;  1YFW A;  5FXX A;  2CGN A;  3WZ1 A;  2JG8 A;  2OKX A;  1ZZ8 A;  4NHL A;  1GQH A;  3WNO A;  4MGK E;  4NVP A;  2UWA A;  1CZS A;  4Y20 A;  1FT9 A;  4A6O A;  1V6K A;  3RRD A;  1QGL A;  5AFB A;  1OUR A;  1GV9 A;  1PZ7 A;  2BFU S;  1VRH 3;  1PNF A;  3H3U A;  2ZGN A;  4OUM A;  4QKN A;  4BQW A;  1JYN A;  2W1S A;  4FT8 A;  1X50 A;  4JDM A;  3RG0 A;  3PU8 A;  3I2K A;  1S55 A;  1ZBA 1;  4LHN A;  2XBO 1;  3OJB A;  4H2A A;  2P6C A;  3CZU A;  4BQ2 A;  1ZRF A;  1ULD A;  2HKX A;  5FMO S;  2JDN A;  4G4F A;  2ZGU A;  3HQU A;  5A33 A;  2VTX A;  5HCA A;  1W9W A;  5GZE A;  5A80 A;  1TVG A;  3OBA A;  3TNP B;  4H55 A;  1W06 A;  4JKM A;  1ND3 A;  1NY7 1;  2ARA A;  5F3G A;  4TZD A;  5C4W A;  1NXD 1;  1HRV 1;  3Q8A A;  4E2G A;  4AQT A;  3G6J B;  4EV0 A;  4BQX A;  3GYD A;  2JDK A;  1OOP B;  1MR5 A;  4GMP 3;  2C9K A;  2YZ4 A;  4YZ2 A;  1HN0 A;  2UY8 A;  1ASJ 3;  1WKY A;  3BKZ A;  4HKW A;  2XJV A;  3VKN A;  4LOT A;  4Q4X 2;  4AVB A;  1VPH A;  4JC1 A;  4CCJ A;  1LGC A;  2OII A;  4XET A;  3WD5 A;  1Y3T A;  1ACC A;  3RQ0 A;  1GUI A;  2ZHM A;  5A3O A;  3UKT A;  2DYC A;  3GNE A;  3SCH A;  1ULE A;  4CU8 A;  1RUH 1;  4NPR A;  4DZG A;  2D44 A;  3WP4 A;  2ZX3 A;  3FL7 A;  2B9V A;  2JDU A;  4LKF A;  2XLA A;  3MF9 A;  3ZFE C;  2RS5 1;  3N9Q A;  2WSV A;  5T3N A;  1IQD C;  1JI6 A;  3G7D A;  2D6K A;  4LJH A;  4MGI E;  4OI4 A;  1J58 A;  2D5H A;  4B7E A;  5JPN B;  1RUF 2;  4QB2 A;  3UGH A;  1Z7S 1;  2Y6J A;  1RUH 2;  3WDX A;  4GWM A;  1C1L A;  3LEI A;  4UF0 B;  3IN9 A;  2A70 A;  3ACF A;  1K5M A;  5GLZ A;  2WKK A;  4XJ9 A;  5DZE A;  4CCO A;  3IAQ A;  4XJA A;  4JHZ A;  3M7A A;  4F8A A;  4Q4X 1;  2VUC A;  1GLH A;  4GH4 C;  3BVC A;  4OYU A;  4GAL A;  1AR9 1;  4B29 A;  1S4C A;  2GNM A;  2ZBJ A;  3AYA A;  3C3V A;  4NAM A;  4P9I A;  2WZR 1;  4N8M A;  2HWC 1;  3OSD A;  3MIF A;  5C70 A;  2V72 A;  3E6C C;  2A6W A;  3ORJ A;  3VDD A;  5I91 A;  1UNB A;  3BYW A;  1HRI 2;  3J7N A;  3POJ A;  1V00 A;  1H2K A;  4N43 B;  4LUK A;  4QDQ A;  1UW8 A;  4DO0 A;  4EWD A;  1TMF 3;  2VCC A;  3POF A;  4CCC A;  4CU6 A;  1DG6 A;  4E4S A;  1VAL A;  1G6N A;  3WOG A;  5IVJ A;  4AL9 A;  2QQW A;  3AKT A;  1K5J A;  1T2X A;  2JXA A;  2YBK A;  1H2M A;  1LCL A;  3Q8B A;  4YW6 A;  1PX3 A;  3KV9 A;  3NV1 A;  5GLT A;  1HKD A;  2JG8 C;  1XJA A;  1NLR A;  1T6B X;  3CO2 A;  1AR7 1;  3SH3 A;  1K5M B;  4YZ1 A;  3LFI A;  1H8T A;  1KD7 A;  2P3I A;  2GDF A;  3KCX A;  4Y1Y A;  2J1S A;  4YAR A;  1ND3 B;  4N9H A;  3AC0 A;  2OQ6 A;  4IE4 A;  4Q4W 2;  4RGA A;  1JYT A;  3PME A;  1RXG A;  1W6Q B;  2R30 A;  1MVE A;  1QNY A;  2JE7 A;  3J7L A;  1RIT A;  4KWJ A;  4XTP A;  3K4A A;  3O0X A;  2CU5 A;  4LR4 A;  3VGI A;  5CAZ A;  1DLC A;  1EPW A;  1S0D A;  3GJA A;  4OMD A;  2E31 A;  3PJQ A;  4XC9 A;  5BNP C;  2R6Q A;  1S2B A;  3DXU A;  1IKQ A;  3LQC A;  3QAC A;  4W4Z A;  1XSQ A;  1QMJ A;  1PMI A;  2VH9 A;  1DLL A;  4JGY A;  3JQW A;  2Y6K A;  3V0A B;  5CKN A;  3N9P A;  2F4L A;  2HWB 3;  1DZQ A;  5FZ4 A;  3WG2 A;  4CUB A;  2WRA A;  3URF A;  3BGA A;  2HWC 2;  3J7H A;  2AYH A;  4NIH A;  2XUM A;  4K7J A;  5K0U A;  1MAC A;  1F5F A;  4LPL A;  3VKM A;  2BOI A;  2YU2 A;  4BLJ A;  4QX2 A;  3MO4 A;  4CXX A;  1GWL A;  1TQ5 A;  2EAK A;  3WR0 A;  1XNC A;  1NX9 A;  3OGV A;  4CUC A;  3C7E A;  2R07 2;  3WW1 A;  3M3I A;  1RUE 3;  3T0D A;  5IK5 A;  4FFG A;  1GQP A;  1C8M 2;  3VLB B;  3E5X A;  2VME A;  4WZF A;  2OZ6 A;  1VAK A;  5ABJ C;  3CQO A;  3PDQ A;  2XKO A;  4OHY A;  5C4W B;  3OBR A;  5A1F A;  2Y34 A;  1X36 A;  2VD7 A;  1QDC A;  1W9F A;  2HWE 1;  1A8M A;  5KBF A;  4AHX A;  1O7F A;  2B45 X;  3I3D A;  2Y26 A;  4R9B A;  5A33 B;  4OVE A;  4Q1R A;  2ET1 A;  2FCV A;  4NAO A;  4JV4 A;  3VBR B;  4AAX A;  1R09 1;  4B4P A;  4HKO A;  4XUN A;  3U1X A;  1ZZC A;  1STM A;  1SLI A;  2YBP A;  5FZ8 A;  2HBU A;  2CYF A;  2BW8 A;  4ISQ A;  4Q2F A;  4PLM A;  4MG2 A;  2QQO A;  4XF0 A;  5BV6 A;  5FMD A;  2ZGR A;  3JD7 2;  3VBS B;  4EWA A;  1PX4 A;  3MPP G;  4HLT A;  4IEV A;  4K3U A;  1C1F A;  1KGY A;  1LHU A;  1WW7 A;  2F17 A;  4AI8 A;  1AX1 A;  2ARB A;  3JB8 A;  2OX0 A;  4LE3 A;  5JSR A;  5L7O A;  1H9W A;  3P6B A;  1S0G A;  4LO4 B;  4EJR A;  2BEO A;  4NRQ A;  1KS4 A;  2WO7 A;  3ES1 A;  1W0N A;  3MIC A;  1DZR A;  3HWJ A;  2D6O X;  4YPJ A;  1OLQ A;  4KGQ A;  4LHL A;  4DRR A;  3V0B B;  3Q9O A;  1OFS A;  1IPJ A;  1E5I A;  1QEX A;  3JQX A;  2RDS A;  1E5R A;  3H8U A;  1UOB A;  4WV8 A;  4AI3 A;  2YFU A;  4HOO A;  4YVS B;  5J3U A;  3AP6 A;  3C7H A;  3K2O A;  3AKP A;  3N35 A;  2VXJ A;  4LO8 A;  4M3C A;  1D4M 1;  5FYS A;  1UX6 A;  5C3O A;  3ZKU A;  1BYH A;  2CDP A;  2WS9 1;  1O4T A;  1XQN A;  5DXD A;  5FDB A;  3WIN E;  1NCQ B;  2ILM A;  4FP3 A;  1PHM A;  4IEU A;  3AMH A;  1OKO A;  3KHB A;  2WT0 A;  1Q3E A;  2YXS A;  3DKQ A;  3PUR A;  2B5H A;  1W90 A;  5GLV A;  5FUP A;  1CX4 A;  1DYK A;  4ASK A;  2Z4F A;  5L9V A;  2WN3 A;  1RED A;  4ET7 A;  1TMF 1;  4MV2 A;  1AXZ A;  1V6L A;  2IUW A;  3A4U A;  3JBG 3;  1J3R A;  1Z78 A;  2NQY A;  4MZU A;  3RYK A;  3SQO A;  4PT6 A;  5C3R A;  3HAG A;  5CFC A;  5HBA A;  4IEZ A;  2VQU A;  5KXC A;  2W52 A;  3B02 A;  5JMC A;  4YGE A;  5HV0 A;  1OVP A;  4XJZ A;  3JD7 1;  4GZ9 A;  1A6C A;  2UUR A;  3IWZ A;  3H8X A;  4AEK A;  2DBI A;  1IZ3 A;  5C3P A;  3ACI A;  4CA9 A;  4DS0 A;  5JZG B;  3KV4 A;  4LK6 A;  2K2S A;  3WW4 A;  5FZE A;  5FP7 A;  4SLI A;  2XQX A;  1HB3 A;  4ITC A;  1FOD 1;  1U5Z A;  4RL7 A;  2CHH A;  3GBG A;  3O1P A;  2D6M A;  5G04 L;  5E16 A;  5DUW A;  4H7M A;  5BNO C;  5F5I A;  3FFQ A;  3DYP A;  4FPC A;  2D93 A;  3RI8 A;  5ACA 3;  3ZXG A;  1OHF A;  2YYO A;  2W1W A;  5CG8 A;  1TME 1;  3MW2 A;  2VUL A;  4W50 A;  5FZL A;  5FWE A;  2ES3 A;  2R32 A;  2WWS A;  1W6P B;  2DV9 A;  2RV9 A;  1YUD A;  5BPX A;  3VKL A;  2JKB A;  4O9E A;  5JMO A;  3W9A A;  2WIN B;  1X33 A;  4QPI A;  5JSO A;  3DPR A;  4Q26 A;  5DZF A;  1FPN 2;  2MPF A;  2VCA A;  3WP3 A;  4D6R A;  4F3J A;  2E26 A;  3CMG A;  3MIB A;  1KJR A;  1NA1 B;  1PK6 B;  2Z79 A;  1PVC 1;  4N7I A;  1PIV 3;  5H9P A;  1TNF A;  4P08 A;  1NQJ A;  5J48 A;  3O1M A;  1QXJ A;  4DUX A;  4Q0P A;  4GB3 1;  1JUH A;  1W9Y A;  4YWA A;  1QJU 3;  1MQT C;  4CDX A;  4DXS A;  2CV6 A;  5LEJ A;  3O5S A;  1FPN 3;  3NJZ A;  3T09 A;  1CZT A;  5FIX A;  1DQ1 A;  5GZC A;  3U4X A;  1I9R A;  1UN1 A;  2DTY A;  1A8D A;  3KM5 A;  5HCB A;  1VE0 A;  5FBJ A;  2GMP A;  3VBF A;  4NRP A;  1VBC 3;  1N1Y A;  5DUX A;  5LEK A;  2HEW F;  1NUK A;  3ME2 A;  4PDW B;  3P5B A;  2WC2 A;  1SCR A;  1XE7 A;  4EN6 B;  2E33 A;  4CEY A;  4HKL A;  1LOC A;  1HX6 A;  4XCB A;  3VL9 A;  1DU3 D;  3VN4 A;  3K4Z A;  1SQ4 A;  3GZA A;  1RUG 1;  1ZBE 1;  1NLQ A;  1SCS A;  3N7M A;  4Q4Y 1;  3AL5 A;  4OI2 A;  4AEM A;  4AHY A;  5A6X A;  3N9L A;  4QX8 A;  2G4I A;  2B39 A;  4AGV A;  1DHK B;  5KHI A;  4ZHN A;  1UD1 A;  4CP9 A;  4HZF A;  1MZE A;  2DCJ A;  4Z92 B;  3OPT A;  2HWD 1;  1A34 A;  4OI0 A;  2A1X A;  2AZ5 A;  5DAV A;  3AZY A;  5DZG A;  1O3S A;  1IG0 A;  1GZW A;  1XSR A;  3O7O A;  1JUI A;  2ARX A;  2ZEX A;  3FN9 A;  2WO2 A;  4ZU7 A;  2DFB A;  3QH7 A;  4JGY C;  5FZG A;  5A7O A;  3D3A A;  4CTE A;  5C3S A;  2ZGL A;  2PN5 A;  5JUV A;  4UFH A;  4IER A;  1LED A;  5CEH A;  4M3C F;  4NMI A;  2Z5W A;  1NY7 2;  3B9I A;  1D2Q A;  3UGF A;  2JDP A;  2XXZ A;  3AP9 A;  3TEX A;  1YRZ A;  3TEZ A;  1D4M 3;  3OY8 B;  1BJQ A;  5C8C B;  3O0V A;  4LA2 A;  3LA7 A;  4UOJ A;  5FKB A;  3FHA A;  2VQ0 A;  4MXV A;  5BY5 A;  4MXW B;  4EWE A;  2G1M A;  2PTM A;  3VBF C;  2VMH A;  3BOP A;  3N7J A;  1H8T C;  4WVM A;  3T2P A;  4BB3 A;  4LTA A;  4E8D A;  3I2O A;  1OD3 A;  3LDR A;  3GF6 A;  3MLJ A;  2E63 A;  5JLV A;  3H1M A;  1EYB A;  3AZW A;  2XJT A;  2RS3 2;  1CR7 A;  1N3P A;  2P4E A;  2VZQ A;  1ZVF A;  5F9T A;  1LTE A;  2QZ2 A;  2ZMK A;  2W87 A;  3S7I A;  2W1Q A;  3V64 A;  4A44 A;  2BBV A;  2WNE A;  1MEC 3;  3C2U A;  2V4A A;  3NJY A;  3RI9 A;  4KG0 A;  5FPX A;  3RMX A;  2RHP A;  1RUD 2;  1MZ5 A;  1W2U A;  4JGZ C;  4YVS A;  3IZO A;  5LBC A;  1GWM A;  5CKM A;  5D21 A;  5H9S A;  4B8E A;  4EYU A;  1PZ9 A;  3KVB A;  5KXE A;  1GZC A;  2VVD A;  3MF6 A;  5C8C C;  3PUQ A;  3M70 A;  4LO7 A;  2NMO A;  5F37 A;  1QH6 A;  3AJZ A;  1LES A;  2AC1 A;  2WT2 A;  3HN3 A;  2QQU A;  2ZGP A;  1SLB A;  4WZC A;  1CD3 G;  4IE5 A;  4BQY A;  5C33 A;  2WO3 A;  4GA9 A;  4L8Q A;  5BNO A;  2FCT A;  2RS1 1;  1BEV 3;  5DAP A;  3ILR A;  3RZH A;  1OQE A;  3WDW A;  3BPZ A;  4XXA A;  3VBS A;  1JU4 A;  3OUI A;  1YYN A;  3PUS A;  3PVO A;  2X05 A;  5BNN A;  4HK8 A;  3VV1 A;  1BK1 A;  2ET7 A;  2VCB A;  4LUM A;  3VHN A;  4D3W A;  3DCQ A;  2LRO A;  2R7E B;  1F5J A;  2BFU L;  4AG4 A;  4BIS A;  2GC2 A;  1JOB A;  1L7Q A;  2ZAA A;  2CDO A;  5IWF A;  3ZYB A;  1DBN A;  2QQK A;  4LKD A;  2D6L X;  5H9R A;  4OLL A;  1VRB A;  1JHJ A;  4JCK A;  4URT A;  1DGL A;  2DUO A;  2Y64 A;  3M8L A;  5T55 A;  2IFW A;  3OUJ A;  4XPV A;  2J1V A;  1PO1 3;  5FZO A;  5FMO L;  3L9J T;  3N7L A;  4IES A;  2DVA A;  3NV3 A;  5AVP A;  3PJY A;  5CFD A;  2E53 A;  4CDX B;  3KVA A;  3FX3 A;  5LRR A;  4IEW A;  4UFM A;  3ZXL A;  3ZSK A;  4GWJ A;  1UY2 A;  4K20 A;  5BNP B;  5C6C A;  1C8M 3;  2OVU A;  1GKB A;  3QD6 A;  5DAB A;  5E8A A;  3C7G A;  4XF1 A;  4CUG A;  1G9B A;  3SC7 X;  2CSG A;  4AF9 A;  1GSL A;  2CGO A;  5FYI A;  5IVC A;  4IEX A;  2WZP P;  3ZFE B;  4COZ A;  4E2S A;  4AWD A;  1HB2 A;  2H6C A;  3WF1 A;  2FQP A;  4M0H A;  4Q4W 3;  3VBS C;  2ZKN A;  1NAE A;  4KQ7 A;  3D4K A;  1REE A;  3NO8 A;  3MHZ A;  4XHB A;  3WSO A;  2Y0O A;  4NWW A;  2PHD A;  3R4S A;  2VPV A;  1ASJ 2;  3ECQ A;  5B4X A;  4QHO A;  1GQG A;  2NMN A;  4RR3 C;  4CVU A;  1AXY A;  1NG0 A;  3VBO C;  4LIV A;  1LOD A;  5C8C A;  4I30 A;  1QXP A;  2F4P A;  3A7Q A;  3I49 A;  1UL9 A;  1PM4 A;  2W68 A;  4I02 A;  1ENX A;  2OZJ A;  3AB0 A;  3W5N A;  1AR8 2;  4JQT A;  1YHF A;  1AJK A;  3KT4 A;  3WCR A;  3FLP A;  1AL0 G;  4GWI A;  2WA3 A;  2XVL A;  3ZPO A;  3BTX A;  2X29 A;  2ZEW A;  3QLQ A;  3H7Y A;  3BTZ A;  5F8P A;  1FV3 A;  2Y6H A;  3BUC A;  1UYP A;  1RUC 2;  2C9A A;  2FMD A;  5EXO A;  1GU3 A;  4R9A A;  3NJV A;  4AXO A;  1WA6 X;  2XUE A;  4Y5T A;  4IEQ A;  2GZW A;  5A6Z A;  4O7X A;  3WT3 A;  4C91 A;  3MI8 A;  4XFG A;  4CP9 B;  4O65 A;  4FQ4 A;  4XE9 A;  1QOS A;  1WWY A;  5IVV A;  5LRS A;  4UFJ A;  5FY4 A;  2YY1 A;  3L2H A;  4TSV A;  2BP6 A;  5E88 A;  2V4V A;  4LEJ A;  3O1V A;  2Y6G A;  2HWE 2;  1D0H A;  3FFZ A;  2B4K A;  3I3Q A;  5G05 L;  2VL4 A;  5B2G B;  5BUV A;  5F32 A;  5ABJ B;  1RIR A;  1RMU 1;  3PHM A;  1QNW A;  1NXM A;  4K9S A;  2E32 A;  4XIL A;  1AR9 2;  1W2T A;  2D6P A;  3W5M A;  2J22 A;  4IV1 A;  3T1L A;  2GAU A;  3LAG A;  1FXZ A;  1H2L A;  2VNG A;  3NMB A;  3WNX A;  4B7K A;  4CXW A;  4L0P A;  1LEN A;  4P02 B;  3AYC A;  3WQ1 A;  2RM2 1;  4QT6 A;  5A7W B;  1UY0 A;  1DGW X;  5FZ7 A;  3D6E A;  2VE1 A;  3WF0 A;  4BH9 A;  2EXJ A;  2W5F A;  1W9S A;  5IK8 A;  1PGL 2;  4XF4 A;  1VAM A;  5GM0 A;  3H3Z A;  3M1H A;  4MUV A;  4A7Z A;  3IIA A;  1NZC A;  1R1Z A;  3WG3 A;  2ADE A;  4AFM A;  4MGT A;  1IS6 A;  2MHF A;  3M4F A;  3VBO B;  4Y22 B;  4FPK A;  3HIF A;  1VB2 A;  1C4R A;  3VZK A;  5FZ1 A;  2PHW A;  3E97 A;  3AZZ A;  4LK7 A;  4NHK A;  4AED A;  1C28 A;  3EQE A;  1VBE 1;  3AXE A;  1J84 A;  1N3O A;  1MS8 A;  4AK3 A;  1BMV 1;  2BVB A;  3DEM A;  5FP8 A;  1H30 A;  2Q0A A;  4N53 B;  3RZG A;  4V1P A;  4FO9 A;  2WAO A;  4CDX C;  2ZHL A;  4Y1Z A;  1AZD A;  1SBE A;  4XJ8 A;  1L7R A;  5IHR A;  2V5D A;  3MIG A;  1NLS A;  3EMR A;  3ZDV A;  5LW9 A;  1PNG A;  3PVB B;  3SIS A;  3LKJ A;  4K6B A;  3H3L A;  3IMN A;  4IEO A;  4MYE A;  1VBE 2;  3RZM A;  5ISL A;  2O8O A;  3ZKY A;  1FMD 3;  4Q4V 3;  4ZKT B;  2UY9 A;  3UYJ A;  1CAV A;  4C0B A;  3APB A;  1ENQ A;  2VU9 A;  4CU9 A;  3MUY 1;  2PLV 1;  3MID A;  5FPU A;  3ZN4 A;  2FD8 A;  5CNA A;  2VZR A;  3SCF A;  1FI2 A;  2D98 A;  2HWB 1;  4UI9 L;  1C57 A;  2JE9 A;  3OF1 A;  3PTR B;  2N7G A;  4JKK A;  2KR2 A;  2OA2 A;  5F5C A;  1W3X A;  1LB2 A;  3HVD A;  4YW7 A;  4I2O A;  2IXC A;  4CE8 A;  5I93 A;  5K7P A;  1DYO A;  3I59 B;  2BDR A;  4Q4W 1;  3SLI A;  2D3P A;  1UY3 A;  1C5H A;  4CDW A;  4KWL A;  1XE0 A;  3A0K A;  4ZU5 A;  2VCM A;  1CAU A;  3J8F 3;  1MQT B;  5HI0 A;  1GBG A;  1OI6 A;  2ZGS A;  1F35 A;  5CU1 A;  1OFN A;  1ZRC A;  4XAE A;  4NIG A;  3U78 A;  4PBP A;  2MEV 3;  4COV A;  1WCK A;  5DQ0 A;  3OBT A;  1N1S A;  4H3W A;  4QGN A;  4LHK A;  2XML A;  1E5H A;  3LDK A;  3DPR B;  1HIX A;  5HV4 A;  5CYY A;  1FAY A;  5FZH A;  4CDQ B;  5LZ6 A;  3WNM A;  1N1V A;  4Q0S A;  3O14 A;  4ES9 A;  3USU B;  3UT0 A;  1R09 3;  1RUD 3;  5FZA A;  4Q0U A;  3H8R A;  4FXK B;  2DBN A;  1HB1 A;  5A7P A;  4ASM B;  2KD7 A;  1V6O A;  2WLQ A;  4WVW A;  5IT6 A;  5F3C A;  1I5Z A;  2WQ8 A;  4GMP 0;  4XCA A;  1YJL A;  4FFH A;  3III A;  4QM8 A;  2VAU A;  3ABZ A;  3N9O A;  4HVR A;  3PL0 A;  4PI0 A;  1QY4 A;  3WDY A;  1AYN 3;  1W39 A;  3SH5 A;  2GME A;  4I3P A;  2D6N A;  4MH0 E;  2GN3 A;  5F39 A;  5KHK A;  4IGQ A;  1Z7S 2;  1W04 A;  4B4Q A;  2DUQ A;  1UPI A;  3OD0 A;  2FZ2 A;  3AKS A;  1RHI 3;  5BXX A;  1RMU 3;  2ORX A;  1GOF A;  1R08 3;  2RJ2 A;  5FZ0 A;  2RS5 2;  3GM8 A;  4D7T A;  5CA6 A;  2BTV C;  3POI A;  2VOK A;  2Z69 A;  1DGW A;  3ZIW A;  2RM2 2;  1VBD 1;  4FI9 A;  2P5B A;  3Q8E A;  4AFB A;  2GH2 A;  2YFZ A;  1LAJ A;  1CZV A;  5I0S A;  2XHK A;  2BGP A;  3AK0 A;  3IBM A;  4PIY A;  2BJS A;  1YWK A;  4XUT A;  2I2S A;  1CGP A;  1QJX 1;  1SDD B;  1JOD A;  1H6Y A;  1RVF 1;  2RR1 1;  2VZ3 A;  4FVV A;  1ZRD A;  1HQL A;  3ITQ A;  1W8N A;  4QAW A;  5ANQ A;  5F2S A;  4A41 A;  5LY2 A;  3ZFG B;  1NA1 C;  2A6Z A;  3DYO A;  4XUQ A;  4XZP A;  2GNT A;  4XTM A;  5L7O C;  1HV1 A;  3DXT A;  1LOF C;  3DV8 A;  4RA0 A;  4M3C B;  4PF5 A;  4LXL A;  2JX9 A;  1VB4 A;  2W08 A;  2P17 A;  1MZ6 A;  1R08 2;  1W6N A;  2W1U A;  4S2H A;  4X6R B;  1CIY A;  1COV 1;  1UZ0 A;  1VBE 3;  2B7Y A;  3ZYG A;  3T0A A;  3M3E A;  4D7S A;  3WXP A;  3IDE A;  2FDG A;  4Q5O A;  1REF A;  3ETQ A;  3I54 A;  4YZ4 A;  4DNY A;  3V0A A;  1DQ2 A;  2WNU C;  3TOJ A;  3RJR A;  4WBB A;  3AX4 A;  5FO9 B;  4QM9 A;  2BNN A;  2H0B A;  2Y0I A;  3K75 B;  4W6W A;  4AZZ A;  2OUH A;  4CP2 A;  3RZJ A;  1SBF A;  4QQH A;  5I0D A;  3K4D A;  2WWU A;  5FZO B;  4IE7 A;  3ACG A;  1HDK A;  3EO6 A;  4Z2A A;  1UZY A;  3RYR A;  5JXJ A;  1AR6 3;  5JXI A;  1DZT A;  4QWN A;  3VD9 A;  4YYO A;  3KF3 A;  1UIK A;  5T52 A;  1GZT A;  1W8F A;  1RTV A;  2PHT A;  4LA3 A;  3N7K A;  2DCZ A;  4AVS A;  4EQV A;  5A6Q A;  1CON A;  2WJS A;  4FPE A;  5D8A B;  2X8K A;  3WX5 A;  4BE3 A;  4AYU A;  5C3Q A;  4I01 A;  2ZX2 A;  5FV3 A;  3NKG A;  4F7Z A;  5FOJ B;  1W6P A;  4YZ5 A;  2QZ3 A;  4EN8 B;  5KWR A;  3MV0 1;  3ZXA C;  2LAL A;  1JTZ X;  1POV 0;  3JZV A;  3N3H A;  5J96 B;  3BI3 A;  4DEV A;  4R4X A;  5FUN A;  1QOT A;  3WNN A;  5JXG A;  4XEZ A;  1WBF A;  4XUP A;  2GND A;  4CEY C;  2EIB A;  5CIR A;  3E5U A;  4TYS A;  1Y7B A;  3WG1 A;  4AI2 A;  1IGO A;  5JR7 B;  2ARE A;  4ZXE A;  5DDJ 2;  1DQ6 A;  2WSU A;  1UKR A;  1XXN A;  2WDB A;  2IFR A;  4GB3 3;  1JMU B;  4NOT A;  1PMH X;  1HRV 3;  1JW6 A;  1XBF A;  5FZ9 A;  2EAA A;  3NVC A;  5K0U B;  3LOB A;  2Q8E A;  2JJ6 A;  1MQT A;  5SV8 A;  1W6O A;  2E7A A;  1H6X A;  3AMQ A;  4BQ4 A;  4FQZ A;  4AQS A;  2PQS A;  2WAB A;  3IDA A;  4IV3 B;  4A4A A;  1EAH 3;  4CYD A;  4C90 A;  3KCY A;  1JH5 A;  1XYP A;  2VZS A;  4Z07 A;  3RZL A;  3KS7 A;  2VTX J;  4CU7 A;  4ZZ5 A;  4KNC A;  3WW3 A;  1LEM A;  4M4P A;  2QQV A;  1RUG 3;  1WLT A;  1LRH A;  4NID A;  2YUE A;  1BMV 2;  4P9W A;  2VM9 A;  5J98 B;  4WVM B;  1QQP 3;  1WCS A;  1H0B A;  1ULF A;  2BZD A;  4B4R A;  1ENR A;  3D0J A;  1CN1 A;  3VHR A;  3ZPY A;  2FBE A;  3T1M A;  3PVE A;  2HH9 A;  5GAL A;  2I74 A;  2EIG A;  3GCW A;  3ZXE A;  4QPY A;  1QU0 A;  1V9U 3;  2WA4 A;  1FNZ A;  4WM7 A;  3WHU A;  4A7K A;  4UXA A;  4AW7 A;  1H1M A;  4JTO A;  5FY5 A;  4O61 A;  3A23 A;  2FDI A;  4M3C E;  3LFM A;  2ZGO A;  3JXS A;  2WZR 2;  5A7N A;  5LB6 A;  2A71 A;  4IUG A;  2NYY A;  4NHY A;  2ZJC A;  2RDR A;  3X29 B;  3KGZ A;  4QXC A;  3ZN6 A;  1CWP A;  2DU0 A;  3LPG A;  2J1A A;  2UWC A;  3QCW A;  2ZGQ A;  1VBD 3;  1AUY A;  1LOB A;  3BU0 A;  2ENR A;  1G8W A;  5FY0 A;  3WG4 A;  4M4R A;  4Y5Z 0;  1IPK A;  3VUO A;  1OOP A;  4NRM A;  1JOP A;  2AAC A;  1RVF 2;  3AM2 A;  1JZ8 A;  1OH4 A;  1NE6 A;  3HBK A;  4B3N A;  5DAW A;  2PEL A;  1NOV A;  2B46 X;  1TE1 B;  3GXU A;  4EN7 B;  4XXP A;  3KSC A;  5EJ3 A;  2JEM A;  3LEK A;  2V09 A;  1YFY A;  1HQN A;  3I3E A;  5JOW A;  4GQ7 A;  4QB1 A;  4XZU G;  4NUB A;  3NRU A;  5FY7 A;  2YG0 A;  3KT1 A;  5KC5 A;  4COW A;  2WBK A;  4BMB A;  3H7J A;  1HJG A;  1WCD J;  4R8H A;  4YW2 A;  4KG8 A;  3WQ7 A;  2R04 1;  2XPJ A;  1GYK A;  3WF2 A;  5C4W C;  4D0Q A;  2X5I B;  1RXF A;  3GHN A;  4HET A;  2ZGT A;  4K8R B;  1SEF A;  5FTT C;  2JDZ A;  1G9D A;  4ERO A;  3AVR A;  4IEY A;  4DUW A;  4LIU A;  4MGS A;  3R4U A;  1Y43 B;  4UAP A;  2HWF 1;  3HOB A;  1AL2 2;  4MAD A;  4K1Z A;  1V0A A;  5A3U A;  3I3B A;  2IWG B;  1BEV 1;  1ZZ7 A;  3WUD A;  4IEP A;  3KQR A;  3DL3 A;  2O14 A;  3NST A;  2R07 1;  3EJK A;  4UFI A;  1X82 A;  3WF3 A;  1B35 A;  4HVQ A;  1S2K A;  4AR2 A;  2ATF A;  4QMA A;  1WCQ A;  2BWC A;  4URA A;  2RE9 A;  1PO2 1;  2WWJ A;  2K46 A;  3ETP A;  1RL3 A;  2I45 A;  3BU7 A;  2BVV A;  5KXB A;  1GNY A;  5EYY A;  4KWK A;  2JG9 A;  4DMI A;  2VW1 A;  2WQZ C;  5IJR A;  1C5I A;  4Q1P A;  1SDW A;  2VQT A;  3N9M A;  3MEP A;  5J7M A;  3HEI A;  3MV1 1;  5FPB A;  3RYP A;  3EB7 A;  4PJY A;  3DEC A;  2A73 B;  2BGC A;  2WR9 A;  3N9N A;  5L9R A;  2VNO A;  1HN1 A;  3P3P A;  5HXM A;  5FMC A;  3U11 A;  1HRV 2;  4KGG A;  1ZRI A;  2RJL A;  4CDU C;  4EN9 B;  3NNM A;  1SZB A;  4OHW A;  1O8S A;  1OF3 A;  1X9T A;  3JU9 A;  3ELN A;  3ZSJ A;  1ZX5 A;  1XPW A;  2HEY F;  2GAL A;  4QKF A;  1RJ7 A;  1XOY A;  2C26 A;  3LD8 A;  3GHM A;  4QHB A;  1F15 A;  2ZMN A;  5IUQ A;  4J6G A;  1YCI A;  1RUJ 2;  1UMH A;  1EV1 2;  1WMX A;  2PFW A;  1TNR A;  5IW0 A;  2XBO 2;  3CJI B;  3H1Y A;  4FPH A;  5EV7 A;  4UBH A;  3K77 A;  4FPF A;  1AHS A;  4IE6 A;  4UWD A;  3VDA A;  1OD5 A;  4X6Q B;  1GIC A;  1C8N A;  4LBM A;  3PLQ A;  4HFS A;  4S2F A;  3DF0 A;  5LAT A;  3ZYF A;  4CCD A;  1LJ7 A;  2D7F A;  1GNZ A;  2R06 1;  3HN1 A;  1DQ4 A;  4PHZ A;  4R4Z A;  2YBS A;  4XVH A;  3KT7 A;  4HSL A;  5L73 A;  1CES A;  2JDM A;  4XAB A;  4XBN A;  3TYJ A;  5ANN A;  1FMD 2;  4Q4V 2;  2TEP A;  4DY3 A;  2LM3 A;  3VZL A;  1OA2 A;  4FXG B;  1O6U A;  5FPL A;  1U5I A;  1VMJ A;  4P9Y A;  4ZZ8 A;  4FPO B;  4QQL A;  3HNB M;  2G9Z A;  2YC4 A;  1DCS A;  1MS1 A;  3IKW A;  3CHX A;  4ZON A;  3R05 A;  5T50 A;  4UW4 A;  1ZZ9 A;  1MS3 A;  1RIN A;  5ERL A;  1HXS 1;  4CSW A;  2P37 A;  4JHT A;  1G9A A;  3IM0 A;  1AYM 3;  1WW5 A;  3I8T A;  4J1W A;  3ZYI B;  2EIE A;  1RUJ 3;  1YI7 A;  3NL1 A;  4LIT A;  1G9C A;  1MPX A;  5DMY A;  3ZN5 A;  4HT1 T;  5BNO B;  2GN7 A;  1QDO A;  5FPA A;  1UZW A;  4QX3 A;  1NE4 A;  1R1A 2;  1J3Q A;  1S0E A;  4OUL A;  4XUO A;  4AFA A;  3IB3 A;  4OUS A;  3ZN6 B;  1CAV B;  2VMF A;  4D6S A;  4JRA A;  5F6L B;  3JD7 3;  5FO8 B;  2YMZ A;  2A6V A;  2EXH A;  2YC0 A;  3RSJ A;  2ID4 A;  4YW3 A;  1JN2 P;  2D3S A;  3NAP C;  3MIE A;  4NII A;  4NPM A;  2R04 3;  4HN1 A;  1GP4 A;  4AI1 A;  4GD4 A;  3S57 A;  5GJ6 A;  4BQ5 A;  3H9A A;  1US3 A;  4QD2 A;  4QPI C;  3LE0 A;  1SFP A;  1X8M A;  4FSJ A;  3W20 A;  4R52 A;  3S6P A;  5F6K A;  1UYX A;  1GOG A;  1JS9 A;  1UAI A;  2O1Q A;  2VUJ A;  2VW2 A;  2Z42 A;  3THC A;  3F2Z A;  5FK7 A;  3AZX A;  3CEW A;  5AVA A;  1LU1 A;  3PMS A;  1HLC A;  2JE8 A;  1SPP B;  1WMD A;  4HON A;  4YW4 A;  4RS5 A;  2C24 A;  2AUY A;  3LPF A;  4Y1X A;  1IS4 A;  3HNY M;  4V2V A;  5ACA 1;  1V6N A;  1VBA 1;  2C4X A;  2DCK A;  2VOV A;  2WAA A;  1YIF A;  5CIS A;  3OG2 A;  1O59 A;  3T2Q A;  3HPN A;  2LS6 A;  2QQJ A;  2R07 3;  3FZ3 A;  3WF4 A;  1KXG A;  5LBB A;  1QWR A;  4PQ9 A;  5DG2 A;  5T5J A;  4W65 A;  3ZFE A;  5CFC C;  1GR3 A;  4Y20 B;  5FO7 B;  1J1L A;  2OW4 A;  1PO2 3;  5FY8 A;  4XF9 A;  4XW3 A;  1RUC 3;  3B94 A;  1RUG 2;  4PCR A;  4D6Q A;  2GSY A;  1PM7 A;  3OGG A;  1X8E A;  2OPW A;  4LUL A;  1QXR A;  5SV5 A;  4I0A A;  1R1A 1;  1S2E A;  4RFT 0;  5JXH A;  2BER A;  1M06 G;  1UXZ A;  1SPP A;  1GAN A;  4FTE A;  2B8M A;  2PXJ A;  2WNV B;  3WNK A;  4E9K A;  3R6S A;  2BYV E;  4L9B A;  1EP0 A;  4IET A;  2FHR A;  1V6J A;  2W9X A;  5D8A C;  2ZOE B;  4DY5 A;  3SNM A;  4LBK A;  2E7T A;  4LO6 B;  1VBC 1;  2FDJ A;  4BHP A;  2BUK A;  2QUO A;  4QGL A;  1I3H A;  2E9Q A;  2XB6 C;  3B00 A;  5KHH A;  5DAX A;  3VZJ A;  2BWA A;  3ATG A;  1VJ2 A;  1UCX A;  3ZYP A;  1ZBA 3;  2EID A;  3T2O A;  1UMI A;  1DP0 A;  1ND3 C;  4NHX A;  1J83 A;  1H2N A;  1HB4 A;  3GBF A;  4B1L A;  5FAX A;  5FYC A;  1LGN A;  3LSD A;  4Y22 A;  4DFS A;  3VBF B;  2WNU B;  2XDV A;  2R06 2;  4FOW A;  4AVA A;  3J8F 1;  5IVE A;  1WUV A;  1APN A;  1O5L A;  1OXC A;  4JGZ A;  4Y4R A;  1WA4 A;  2Z2S B;  1UOF A;  1RUF 1;  1SAC A;  4TLG A;  4UF0 A;  4GMP 1;  3LF7 A;  2PHU A;  4XFC A;  2CL2 A;  5JOZ A;  3WVJ A;  3AP7 A;  4XFA A;  5JPM B;  2PHX A;  1RUE 2;  2W95 A;  1R64 A;  1ZNP A;  4MSV A;  1FX5 A;  2DUR A;  4NIA A;  3CL1 A;  5HCH A;  1GWK A;  4OI1 A;  3FWE A;  2K9Z A;  2ZCW A;  3VBR C;  2QQI A;  2YB7 A;  1DYP A;  2QVS B;  3AVS A;  4E27 A;  3ROU A;  5ABJ A;  2WZR 3;  1RUH 3;  2XWB B;  3ZFF C;  3EBR A;  2HWC 3;  2Y33 A;  3NJX A;  2DU1 A;  2JDH A;  1BLZ A;  3LOI A;  2VY0 A;  4HK9 A;  4QPG A;  2VZU A;  3AFG A;  3A21 A;  4DXR A;  1AYN 1;  4AVC A;  4Y4Y A;  4MLO A;  1CX1 A;  1KDK A;  4OHV A;  4KU8 A;  2BU9 A;  2JEC A;  1S1A A;  3IAP A;  4GWN A;  2X10 A;  2C0Z A;  1Y9M A;  1OSG A;  2ORZ A;  2RS5 3;  2IXL A;  3MLL A;  4JDO A;  3WP5 A;  4FTS A;  1WBL A;  2LRP A;  1Q8S A;  4MXW A;  4MOA A;  4S2G A;  4MGY E;  2PAM A;  3CLP A;  1QQP 2;  4OQ9 A;  1Z7S 3;  1AF9 A;  2F6B A;  1O5U A;  2VNV A;  2Y6F A;  3B9C A;  3OEB A;  4GAZ A;  4CEW B;  1K42 A;  3MIH A;  1TG7 A;  1J3P A;  4RFR B;  3MUZ 1;  4MHU A;  3HNM A;  2ZAH A;  2Q30 A;  1OLM E;  3PUA A;  5A7Q A;  4GJY A;  1BVV A;  3HQR A;  5LAS A;  5IVB A;  5LA9 A;  3CKH A;  1QJX 3;  2RR1 3;  2J7M A;  3LIH A;  2CAV A;  5FYY A;  1RYY A;  1UF2 C;  3D82 A;  1WMF A;  2YHJ A;  1CVN A;  5I0U A;  2Y60 A;  3VBU B;  1ONA A;  1TMF 2;  1LOE A;  3LB9 A;  1W3V A;  5GLU A;  4HPK A;  1CAW B;  4AFD A;  2AEN A;  2HWD 2;  4YFZ A;  4LOS A;  1YO8 A;  4BDV B;  4ZPI A;  3CNA A;  4A3X A;  4L92 A;  1POV 3;  1W8W A;  1WD3 A;  2YRO A;  2ADD A;  4UW5 A;  4W6Y A;  5L9B A;  1B35 B;  5DN2 A;  3H1W A;  1JHN A;  4Z8B A;  4KH9 A;  5EQU A;  2R1B A;  3M3Q A;  4P9L A;  1UO9 A;  3VL8 A;  5LK7 B;  4RQP B;  2WNV A;  4AHZ A;  3GCX A;  1XC6 A;  1YQ5 A;  1W2A X;  1AJO A;  2ZX4 A;  4OFG A;  4IXL A;  5T5P A;  4A3Z A;  1KRI A;  4FOY A;  1VRH 2;  1QJY 2;  2EAL A;  3FMG A;  1QJZ A;  1DIW A;  1XNA A;  2J1R A;  1Y9Q A;  3U75 A;  3AMM A;  4RHV 2;  5FP9 A;  1YFX A;  2A75 A;  4N43 C;  5FK8 A;  4NR1 A;  5FPZ A;  5E89 A;  1XNB A;  1SLA A;  3CZJ A;  1L7L A;  2HJI A;  3DUI A;  1AR6 2;  1K5M C;  4LO5 B;  3VDD C;  1RUI 1;  3DPR C;  4YZ3 A;  2LTN A;  2Y8K A;  1EY2 A;  4GIQ A;  1AX2 A;  2WNO A;  3RJ2 X;  5FR3 A;  1H1A A;  2XWJ B;  3ES4 A;  4BOW A;  3TBD A;  1KIT A;  3B69 A;  2WFF 2;  1OA4 A;  2PQQ A;  4CCN A;  2X09 A;  3V56 A;  3VBU A;  3AL6 A;  5KXD A;  3UNP A;  3IDC B;  3OPW A;  1Z0H A;  3ZYR A;  4BU2 A;  3MFA A;  1C3H A;  1PK6 C;  5FJH A;  1YQ6 A;  2B42 B;  3ZFF B;  2BOJ A;  2XH6 A;  1K3I A;  1RUE 1;  2QDR A;  4Y5S A;  3LIG A;  5FPV A;  1L3J A;  1BHG A;  3MYX A;  2ZEY A;  2WII B;  3OY8 A;  1UOJ A;  2ZHN A;  4HMZ A;  4Y1V A;  3UL2 A;  4AVV A;  1WZX A;  3JCI A;  2ZAB A;  1I5P A;  3AXD A;  3NNG A;  1RUF 3;  4A42 A;  2HEV F;  4EZ4 A;  5JOX A;  1QHD A;  2HWB 2;  5T5L A;  4O9G A;  1UZV A;  5KHG A;  1IQA A;  3E6D A;  4M0N A;  4NJ4 A;  2RS1 2;  3T4H B;  1EAH 1;  3B93 A;  4DOU A;  3LWC A;  4RYD A;  1FAT A;  4YM2 A;  5EIY B;  2IVI B;  2VVF A;  4RHV 1;  4FFI A;  1ZBE 2;  1POQ A;  5JZG C;  3RFR A;  1U0A A;  1QQP 1;  4QPG B;  5F5A A;  2NPI A;  3AYE A;  1W2O A;  3VBH C;  1CAX B;  4LBN A;  5CB7 A;  2PAE A;  3I4I A;  5DUU A;  1JZ4 A;  2CWM A;  3LEG A;  3E6B A;  3KGL A;  1NT0 A;  2ETE A;  2WUH A;  4XFH A;  1TZO A;  3JBG 1;  2VUD A;  4P9X A;  4XQW A;  2VBP A;  1M4W A;  3DN7 A;  1HJF A;  3LZZ A;  3THT A;  5K8S A;  1O91 A;  5ACA 2;  1JYC A;  3S7E A;  3I3M A;  3W58 A;  2DVD A;  1IOA A;  1S0I A;  2EF6 A;  4IV3 C;  1OLR A;  1JU3 A;  2A3W A;  2RMU 3;  4KWU A;  4YM0 A;  5A32 B;  2BNO A;  4NHM A;  2NLR A;  1Q5O A;  3VD5 A;  1OA3 A;  1QOO A;  2LUW A;  2QQM A;  1E57 A;  3P1I A;  5DDJ 3;  4BK4 A;  5AC9 3;  4YFW A;  5T5O A;  1OUX A;  4PLN A;  3ZSM A;  4A7Y A;  2RM2 3;  2WS9 3;  4UT5 A;  1MEC 2;  3ZVX A;  1FOD 3;  1LGB A;  1BBT 3;  2XR4 A;  4QPW A;  4X8N A;  5D2A A;  2PHR A;  3HR9 A;  3MFC A;  5A3P A;  5EFU A;  1NA1 A;  3POE A;  4MO3 M;  2GC3 A;  2XVK A;  3BAL A;  1ZZB A;  3TEW A;  5L7O B;  1XND A;  2TNF A;  4MVT A;  1UU5 A;  5A3W A;  4XFB A;  3I2D A;  1YQC A;  4FAG A;  1DGR A;  1AL2 1;  4S2D A;  4YRD A;  5LA1 A;  4Z82 A;  1NCQ C;  3SHR A;  4EZH A;  3ON7 A;  2XJQ A;  5DUV A;  3CDZ B;  1UMZ A;  1GP6 A;  2UYA A;  3MDP A; 
#chains in the Genus database with same CATH homology
 3HQU A;  5DAX A;  4BQY A;  4UWD A;  2FCT A;  5DAP A;  3W20 A;  4BQX A;  4NHX A;  3OUI A;  5LAT A;  5LB6 A;  4NHY A;  3KT7 A;  2RDR A;  4XAB A;  3GZE A;  5LBF A;  2Y34 A;  3ITQ A;  2JIG A;  4XAA A;  4NHK A;  5C5U A;  2G19 A;  4XAC A;  5DAW A;  4KBZ A;  4Y5S A;  4ZON A;  2FCV A;  4IW3 A;  4NAO A;  3OUJ A;  5C5T A;  4MHR A;  5ERL A;  2HBU A;  3OBZ A;  4Q5O A;  3OUH A;  3GJB A;  3EMR A;  4XCB A;  3KT1 A;  2RG4 A;  3NNL A;  2Y33 A;  5EPA A;  5IAV A;  2JIJ A;  5IAT A;  2A1X A;  5DAV A;  2RDS A;  3BVC A;  5LBE A;  3MGU A;  5EP9 A;  4J25 A;  5A3U A;  4NMI A;  4MHU A;  3DKQ A;  4NHM A;  5L9V A;  2RDQ A;  3W21 A;  3HQR A;  5LAS A;  5LA9 A;  2G1M A;  3KT4 A;  2FCU A;  5LBB A;  5HV4 A;  5HV0 A;  4NHL A;  3NNF A;  4Y5T A;  3NNJ A;  4ZPI A;  5DAQ A;  5L9R A;  4JZR A;  2OPW A;  5M0T A;  2RDN A;  5L9B A;  4BQW A;  4XCA A;  5IAX A;  3NNM A;  3PL0 A;  2V4A A;  5EQU A;  3GJA A;  4XC9 A;  5LBC A;  2HBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...