4ZOQI

Crystal structure of a lanthipeptide protease
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
337
structure length
337
Chain Sequence
VISGSPAWGLDGILELKEYLWFAAKQTDSYRTYQIERGHPDVKVALIDSGLDLDHPDLKASVNTNGGWNYIDGKPVSGDPTGHGTQTAGMINIIAPDVTITPYQVLDEKGGDSYNIMKAMVDAVNDGHEVINISTGSYTSLDREGKVLMKAYQRAANYAAKHQVLVFSSAGNKGVNLDEMRKTENKVHLPSALKHVVSVGSNMKSNNISPYSNQGREIEFTAPGGYLGETYDQDGMVRVTDLVLTTYPKGKDNTALDQMLNIPKGYSLSYGTSLAAPQVAGTAALVISEYRERHHRKPSAKQVHHILRKSALDLGKPGKDVIYGYGEVRAYQALKMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Applications of the class II lanthipeptide protease LicP for sequence-specific, traceless peptide bond cleavage.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords Intracellular serine protease
total genus 128
structure length 337
sequence length 337
chains with identical sequence J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4zoqI00
1T1IA 1R64A 4DWWA 1WMDA 2HPZA 3SQOA 3EIFA 4WOCA 1GCIA 4MZDA 1AH2A 1GTG1 4AKSA 4CG0A 1PJ8A 2XTJA 1KE2A 5FBZA 1PFGA 1P7WA 1OYVA 1Y3BE 1AK9A 2PKCA 2X8JA 3AFGA 4J94A 1GA4A 1S2NA 3I34X 4JP8A 1GA1A 1BJRE 1TM4E 3BPSA 1PEKE 3Q5GA 3F49S 1AU9A 3D9QX 5AQEA 2P4EA 2QTWB 3I30X 4AKTA 1Y3CE 2HD4A 3ZXXA 2Z30A 5K7SA 3A3PA 5B1EA 1AVTA 1Y3FE 1Y33E 2SNIE 2PMWB 3QMPA 1JEAA 2DUJA 1S01A 1SELA 1YU6A 3DE0X 3DYBA 1OYOA 3L1KA 1SUEA 1S02A 1Y1KE 3DVSX 1C3LA 1GTJ1 5JXIA 2XRMA 4C3UA 3P5BA 1KDVA 3CO0S 1IC6A 3A3OA 1YJAA 4H6WA 2ID4A 3BX1A 5ARCA 1SUDA 5B1DA 2IXTA 3LPDA 1XF1A 1EA7A 1Y34E 4HVLA 3VV2A 4NE9A 5ARBA 3DDZX 3TI7A 1V6CA 3DE4X 2V8BA 3DE2X 1BFUA 3GT4A 1C9NA 1WVMA 1DUIA 2IY9A 2WWTA 3AJ9A 2Z57A 1MEEA 1ZVKA 3GCWA 1R0RE 5ARDA 4DZTA 5AVKA 1KE1A 1GNSA 1Y48E 3H42B 1TMGE 1NLUA 1SBHA 1SIBE 3F7MA 1A2QA 2WV7A 3WIVA 2B6NA 2PYZA 1BFKA 1KDZA 2W2OA 5JXGA 1SUAA 2TECE 1Y9ZA 4KG7A 2PRKA 3DE3X 1GT91 1SN7A 4RYDA 1AQNA 4NMXB 2SECE 1Y4DE 4LVNA 5AMXA 2W2NA 1DBIA 2ZWPA 3DE7X 3F7OA 3EE6A 1SCNE 4FONA 3TECE 1C9MA 2W2QA 1MPTA 1THMA 1SCDA 1SBTA 2G4VA 3VSBA 3VYVA 4ZOQI 1SCJA 1EGQA 1TM3E 1SCBA 1SBCA 5FAXA 3SICE 4GI3A 2W2MA 1SPBS 3BGOS 4LVOA 1LW6E 3DE6X 3HJRA 3UNXA 1HT3A 3Q40A 3VHQA 4K8RB 4HX2A 3T41A 1BH6A 3GCXA 1Y3DE 3I37X 1SIOA 3PRKE 5JXJA 3DWEX 3CNQS 1T1EA 4I0WB 3EDYA 2GKOA 2ID8A 4BWGA 1YJBA 1VSBA 3LPCA 4OMCA 1GNVA 3D43A 4C3VA 3A3NA 3WIUA 1AV7A 4NE7A 5CW1A 3QTLA 4M1ZA 3VTAA 3VV3A 1BE6A 4YN3A 1P7VA 1SUCA 1TM1E 1V5IA 1UBNA 1WMEA 1ST3A 1WSDA 2DP4E 2DQKA 2ST1A 4H6XA 1SH7A 3TI9A 5AVJA 1OT5A 1SUBA 1TO2E 2Z2YA 3WQBA 2ZRQA 2Z58A 1P8JA 3PTLA 1CNMA 3GT3A 4OMDA 4CFYA 1PTKA 4CFZA 1GA6A 1BE8A 2X8JB 3LPAA 4KPGA 1SCAA 2PWBA 2SBTA 4ZARA 3WHIA 2SICE 1C9JA 1SIUA 4H6VA 3DVRX 5JXHA 1GTL1 1Y4AE 1TM5E 3QFHA 3DW1X 5SICE 3DE1X 1NDUA 1NDQA 1ST2A 1TM7E 2Z56A 4OV6B 1CSEE 1YJCA 1IAVA 2PQ2A 2WUVA 2E1PA 4B5LA 1Q5PA 1TECE 1R6VA 1SUPA 1SBIA 1TO1E 1ZVJA 2Z2XA 2ZWOA 1SVNA 3AJ8A 3DE5X 1WMFA 3LXUX 3OSZA 4WOBA 4DJ5X 4Z2AA 2Z2ZA 5I9SA 1T1GA 4KB5A 1TK2A 3ZXYA 3DW3X 3DVQX 1SBNE 1KDYA 2W2PA 5JMOA 1AF4A 2WUWE 2PWAA 3I2YX 5FFNA
chains in the Genus database with same CATH superfamily
3IV9A 4DDWA 4WK4B 2ZXUA 3KOXA 3SJUA 4MIYA 2HO4A 1WW2A 3O2SB 1APBA 4PQEA 2O1EA 1UKEA 3C7TA 4R1PA 2YCBA 4JT8A 1L8OA 3T5GA 3OE7D 4OIMA 2WKRA 1YV9A 3I9KA 1E9BA 3KP1A 4YAJA 4M21A 1OV6A 1PFWA 1DQYA 3HFRA 4LTNA 4X63A 4C9BA 3Q88A 3AIMA 2OCDA 4A8JA 1ECBA 3WNBA 1G5TA 4B3TB 2HL6A 4CM5A 2E49A 3E0XA 3G02A 3L6CA 2OECA 1PYOA 5LQMA 1SXJB 1NULA 5F35A 3JD4A 3TJMA 2WYVA 2AE1A 1EK1A 1Y3FE 2HK8A 4HWPA 3W3AA 1J21A 4L9SA 4XGIA 1B0AA 4H1TA 1VLZA 4R81A 2HXYA 2AXEA 3UBTA 2ZB3A 2RGAA 2H5EA 4FOTA 2F55A 1S02A 4PPYA 3CTPA 3P94A 4RHCA 2BJVA 3OE7A 3P1JA 3QWBA 3EXIA 1QH1B 2R1ZA 4ZGBA 1QP7A 2WABA 3BXHA 1UP6A 4OP2A 2P9ZA 4DLRA 4YRTA 5AK4A 4EPTA 4XQCA 3PNMA 2QLLA 4G0VA 1ODCA 4LISA 1WPGA 4TS4A 1AHNA 2YV4A 4MMYB 1DTEA 2V5VA 4HEJA 3T1YB 1BVRA 2ISQA 4MYSA 3H2IA 3ZTWA 5JATA 4EA9A 3H8WA 2BSAA 4ARBA 5EIHA 2WJIA 3QVWA 2VBCA 3U62A 5LIRA 1T35A 2D74A 3NIFB 4EHLA 1FSZA 5DHFA 4PLYA 2WPDA 1FFYA 2GN0A 1CJBA 4QYMA 4NCNA 2EZTA 2QQGA 4LA4A 1U1CA 4CKWA 4BMZA 4KBFA 4H7HA 4D6XA 4N82A 4WJLA 2BY4A 2UYQA 1BSVA 1YRYE 2WTEA 1AKMA 3LJKA 1PTJC 1N0WA 4X90A 3N53A 3E8XA 4YO7A 5EEHA 5JNRA 2QR5A 2VJYA 4Z0TA 4AP9A 3T99A 1EGQA 4EITA 4H4CA 4UBLA 5I51A 4PZZA 2WIGA 1ZISA 1JP7A 5FTMA 1BD4A 7AT1A 5F23A 4PICA 3GWZA 3N1UA 2C5SA 3HVHA 4MDHA 4IHJA 2CE2X 5DHPA 4L9AA 2QZZA 1OASA 3WE7A 5J2TF 1I80A 3UCXA 5BR8B 1Z5UA 2ZSBA 3AW9A 3EOZA 4P92A 5M3BA 1D4FA 1F8YA 2I1WA 4GM4A 5IUNC 4V0NA 4UEKA 1PT8A 4OK5A 5CH5A 4Y7CA 1V45E 2WM2A 1DRUA 4WJZA 1YR9A 3AF5A 3NGLA 4K9OA 3VU9B 2JFBA 2HPHA 1CJUC 1XEWY 2DPHA 4ZKEA 2H2WA 1XPUA 3SR0A 2QAGB 3KLOA 3RSFA 3E23A 4E21A 5DWVA 4BU0A 3WGOA 5IS2A 2GO7A 1N6LA 4YROA 4PGHA 1TZMA 4MB0A 3X2EA 4E08A 3TQOA 2K2WA 4PYOA 4AJ4A 3ZCRA 1IAVA 2YJZA 2ZSFA 1Y42X 2QB5A 1JFLA 2GKGA 2PR2A 3D8SA 4CL2A 2WKSA 1ZNXA 3VVBA 3WMEA 1G41A 4TTAA 5LD2B 1XLUA 2KWIA 4JXZA 1AS2A 1IIRA 3AUUA 3HBJA 1G2IA 3FPGA 1X6VA 5JSQA 3IPLA 4UM8B 2IUEA 3GJYA 4K0RA 3SC6A 1M1NB 3HNPA 1CEEA 1T6YA 3LQ4A 2OCKA 1OYYA 5EJIA 5THKA 3IQDB 5K0CA 2IITA 3DM5A 5KC9A 5KTOA 1Q3HA 1NJ1A 3AFGA 2FETA 1GADO 2WWFA 2ZIWB 4ZT3A 1M0WA 3KTFA 4MV5A 4D98A 2BH2A 3A6EA 4CXMA 1YR6A 4CLHA 5B6IA 4DDKA 2BFBA 2EZ9A 1NKTA 1VPLA 1WL8A 2DBVO 3G9TA 3KWJA 5JSYA 3MINA 4JK3A 2UZ1A 3RK1A 2XQVA 1BX1A 3VVCA 3ZTYA 4CKYA 2XMCA 5CAEA 3A4MA 3HCNA 1WZ2A 1QGUA 4H7KA 2BD0A 4K87A 3FPBA 4TPKA 1VE6A 3KB8A 4PBRA 1G3UA 4CTNA 2C20A 3MLBA 4WKOA 3UMBA 2OESA 3PQ3A 3A8TA 4L4ZA 1A8HA 2X5XA 3TTUA 3ZVRA 1NNEA 3DYIA 5EG5A 4F4JA 4AKHA 2ARKA 2EBHX 5P8WA 2G9ZA 3PQ5A 4PR3A 1I6LA 4PX3A 3K4PA 4QYTA 3IC5A 5E6UB 4AY4A 2MR6A 2V7VA 4J3NA 3HBNA 4EZEA 5KC8A 5LNK6 1KFCB 1ACLA 4QTUB 1NVBA 3B51X 1N6HA 2H08A 2EKQA 2I54A 2PX3A 3OJLA 5EOVA 5A7HA 3DTTA 2QZJA 2GH1A 2WVAA 4KWCA 2Y0CA 1BFDA 5EHZA 1UPAA 4LRUA 1OWLA 2XDYA 3I9V6 1RI5A 3ST7A 1UEJA 1XZNA 5CB4F 4FLMA 3SLGA 1GL9B 4QVKA 5DASA 4CODB 5HX7A 1M67A 2E5FA 4QEKA 4F1WA 1ZCJA 1WETA 3Q0IA 4GUAA 5BY2A 4AXBA 3FBTA 3CT4A 1IJKA 3NXSA 3OM9A 1T5HX 1Y1QA 3PFBA 3IKVA 3RR2A 1AX9A 1KP3A 3TRDA 2CV1A 3FMVA 3HJRA 4AF6A 1P0FA 1SVIA 1A2BA 3D31A 2E37A 2CNLA 3FX2A 2KS6A 4WBSA 2HDNB 2ID8A 3QBDA 1H2EA 2NSYA 5KWJA 1G5RA 1R7RA 3D43A 1OREA 1IHPA 2JD2A 4LHYA 3RFTA 2YWDA 5C31A 2XE4A 1NP7A 2BEUA 2EFHB 3KELA 4FWIB 3WK9A 5EJEA 1II9A 4KFRA 4CCAA 2WAOA 3CZAA 5PGMA 2WY2D 2O8FA 3VGJA 1DBRA 3PSAA 1M34A 2REQA 1ID8A 1XZKA 2GNOA 4HDCA 2C4TA 1OIXA 2FXVA 2ZIXA 2QBYB 2AZDA 1ZRNA 2Y1WA 5AKEA 4PYLA 1T15A 1XEFA 5E7QA 3EZ9A 1KH3A 1KK3A 3E84A 1Q0TA 2VAXA 2X5JO 3O75A 5AESA 1T29A 1LPBB 2ZTHA 4LOHA 5JSHA 1NHGA 4FWTA 1S6YA 2G6TA 4ZI7A 4R2WA 2GLUA 3ZWCA 3R23A 3HSYA 4FLFA 4LCJA 4YCJA 4TVBA 3SBEA 3HJFA 2HMWA 5JD3A 4WCDA 2HBZA 3I6QA 4IHAA 3E7XA 4QOIA 3DDSA 4TOIA 1KYTA 1JYEA 2YN2A 2JG3A 2DT5A 2QUKA 4Z99A 1GFZA 3EA0A 5ALXA 4UHKA 4IGFA 1IBSA 3GRKA 2O3RA 4I1OA 4J1TC 2H1HA 4YAGA 5C8YA 3ASVA 4NABA 1XMQB 2H85A 4ZCRA 1XQYA 2DF8A 4ER5A 3EFEA 3TLEA 5CEFA 3LUJA 4QXQA 2P9HA 4GE0A 4Y8VA 2VSFA 4YCMA 4WBNB 3KHTA 3W04A 5ITSA 1NQWA 3PHIA 2QRZA 1BX3A 3CH4B 3L5OA 1TJ4A 3WB2A 1NN1A 1QFSA 3K9BA 4G63A 4I4TF 4L4YA 4YJ2F 1FFEA 3I4FA 1TYDE 4DSZA 5K5EA 1SMKA 5HZGA 2FHSA 1BWRA 1H5UA 2F3QA 3KVRA 2NOAA 1ZO8A 2BI4A 1E5QA 2H1SA 3Q87B 2FKNA 4KSBA 4QBFA 3R8XA 1NC1A 3PF8A 4I5DA 4RY0A 2P78A 5EXPA 5CX1A 3DZDA 3RAPR 1W7AA 2W7TA 4PW0A 4RF5A 2H1IA 4MS4A 1K6MA 4CIDA 3P4XA 4D56A 5I4BA 3D3KA 1BIFA 1EH5A 5G4KA 4FZVA 3CNOA 3P5SA 5JNVA 1R0KA 3HI6A 4RZHA 2BHTA 3JASA 1H1TA 1UFKA 3CKLA 3EIOA 2ZLBA 3V7FA 5JI3E 1KQOA 2X9VA 4HGZA 4J0FA 4P7JA 4RD3A 4MS1B 2G0AA 4EKIA 2Q3JA 2XDAA 3WKEA 3M6AA 1TU3A 5BOSA 1Z3IX 3SI7A 2QW0X 4FHCA 3IBTA 4FFWA 3WKBA 5IDXA 2OLEA 3P2MA 1X86B 4H0NA 5EJGA 4E14A 5BURA 4LZZA 1HPLA 1I33A 1D0IA 2HU5A 1Z33A 5FWXB 3F73A 4IUCS 3Q8WA 5TF4A 1KEZA 2I4NA 2QIOA 3I9NA 2R6JA 3PFIA 1T10A 1W5SA 4RD4A 5FI1B 2X0IA 3CNHA 4XCXA 5FYDA 1W34A 2VF8A 5EESA 5J1SB 1O8CA 4C14A 3TQFA 5HZKA 3G8YA 5IASA 5IJ9B 1KQGA 4IO1A 4EG7A 2UDPA 1CZKA 1EQAA 2XH8A 4CR6A 1S2IA 3BAZA 3SICE 5SYNA 2IIVA 3A3KA 1EB9A 3WYDA 1P4GA 3C85A 3AZQA 4KH0A 3UWMA 4CPDA 2WUDA 3QX7A 4HDOB 4F06A 1EXWA 1ZH8A 3FYUA 3UJ8A 1Y4UA 2GK6A 2JAXA 1Z4KA 2NPIA 3CNQS 2HT1A 3ZKWA 5BV8A 3HK2A 2O2XA 5JD6A 3REGA 1PJTA 3BRWA 5KYWA 2ZSIA 3N2ZB 3TR6A 4UOQA 1G18A 1L5LA 3FTQA 2NVUA 3GHYA 4YJHB 4W9NA 1EGHA 1K63A 1K08A 1N2ZA 4WOJA 4MDEA 2YBDA 2WAYA 1DSSG 1BMFD 1V8OA 1M5TA 2WPNA 3SZRA 4AZ0A 4MARA 2LKCA 4TL6A 1NYQA 5JE8A 4DCSA 2ZSEA 4B33A 2DWCA 5JXHA 1MABB 2NO0A 2VZ8A 2HIGA 2OILA 4E33A 5KB3A 1NDQA 2PZKA 1PS8A 2R1UA 3P2KA 3BZWA 4J6FA 3KAKA 4PSVA 2ZUTA 4C78A 4ARAA 3OLWA 2QGZA 1QGED 4RFVA 4KQFA 4FZRA 2RK4A 4ND8B 3KJQA 4AUEA 3U7JA 2O06A 2B21A 4XSGA 2ZJ8A 1G5PA 4OL9A 4REOA 2UUCB 2G08A 4FR5A 2E5LB 2OCXA 3N0WA 1KK0A 5ILQA 4E30A 1E3DA 4G1VA 4BE7B 1K5GA 4JLKA 1GNRA 1R37A 3H4IA 3U4QA 4COKA 2GN2A 3R9KA 1SHJA 3OZAA 4J7AA 1RI4A 4LF7B 4LNHA 4CTKA 3FGOA 4X8LA 4C2BA 1UC5B 5GINE 4TKUA 5U9CA 1R6UA 4EVQA 3WDLA 2A1UB 2RHJA 5JYCA 4HWTA 1FVHA 2DBYA 4YJKA 3WYAA 4FMPA 1I3MA 1D4ZA 2BGWA 1IJEA 2QVGA 1A82A 2X3FA 3SDSA 1MDBA 4FW9A 1MP0A 5I47A 1H9CA 3AHHA 5EY5B 3F6EX 3TBFA 4DBVO 4JOQA 3TL6A 3P0RA 3KHSA 1XQVA 5FWNA 1YK1A 3EF3A 3AM3A 4QYSA 4RENA 3IR6A 2ZQYA 3BERA 1BX0A 4JVNA 5IMBA 3GPDG 3QUCA 3VGPA 2BYTA 5T4HA 2VH2A 1QH8A 1RLTA 1T3TA 2IHKA 3N86A 3Q6NA 2NO5A 2R6DA 3MPOA 4HADA 1DPFA 1F17A 1J8MF 1TYEB 4LSMA 3EOAI 3UPDA 4DYVA 3D5TA 1RQPA 1S3SA 4IFTA 1O77A 3A1DA 3A9SA 1QFXA 2WJHA 3IVMA 3K96A 3NWPA 4UAJA 4ZU6X 5L3QA 1PDOA 2O4CA 1GT6A 1VP3A 5BUSA 2ZR7A 5AHXA 4TXNA 2Y05A 4O4IF 4D8VA 1E8NA 1P7YA 1MA3A 4G24A 3JSXA 4RY8A 5DP2A 3TL2A 4S04A 3QE2A 4KK4A 4NPCA 3RTGA 3EVGA 2OP0A 4IDEA 3S2EA 4DADA 4FI3F 3QTBA 2AEJA 4GX5A 1BFKA 1Q21A 1HRKA 5JU6A 2GN6A 2X14A 3IESA 2M1XA 4NCIA 1GT91 1PJBA 2VYFA 3JYQA 3DMTC 5B53A 4WLFA 4Q9LA 3VJRA 2H6EA 1NYTA 1PR3A 2VDPB 3K7EA 1Y4ZA 1Q3KA 3UK7A 4JWKA 1U6KA 1S2DA 4MHTA 3O9ZA 3UMVA 4BMYA 4KQJA 2R60A 2VYCA 2LGJA 3JQBA 3H1EA 1BDHA 1TPZA 4NBUA 5CXQA 2RBEA 4LY0A 1JJAA 1PFYA 1XN4A 2O2JA 3B20A 5DVZA 3QKIA 2AK2A 3OLVA 1P44A 3FGZA 1G21A 2HRBA 3QVUA 1W73A 1NOKA 3UB4A 1U9JA 2JI9A 3RJ9A 3G13A 2HNKA 4MWTA 3K5WA 1QV6A 2D0PB 2H2GA 4Q4AB 4MUJA 3JRWA 4WXEA 3C1TA 2ERYA 4U2EA 2AVNA 5JMTA 3RFUA 4DR6B 4IIEA 3MWDB 1JDTA 1MO4A 1E79A 4YR7A 1ESNA 1SVOA 1W75A 2PX8A 5TX7A 4EO4A 2WD7A 2QNIA 1NYRA 2OK8A 4INZA 5SZHB 3RV3A 2QUHA 4DMKA 2BJHA 4B34A 1MH1A 4CM8A 1WMAA 1VKHA 3MUNA 3PHLA 3R0VA 1Q1QA 1M1ZA 1H1LA 1XTZA 5FWXA 2NIPA 4YX9A 3DPUA 1JA9A 3K8YA 4K9DA 3EC2A 3GPBA 3K72B 4CLRA 3FWNA 4LJ9A 3CO5A 1QHYA 3HP7A 2QD2A 1YDFA 2IZ5A 2EERA 3KU1A 1K06A 7ABPA 1XPRA 1XLVA 1L7MA 4N5IX 3TL3A 2X2EA 1ZGHA 4CMIA 2DPLA 2HWYA 1HLFA 2B5WA 3PC3A 2EW1A 4KPUA 5SY9A 1RPTA 1TLFA 1YRWA 2GCOA 2IYYA 3EIFA 3HDQA 4DN6A 4B3JA 1CR0A 1MH9A 5KDLA 5BW6B 5K51A 3ZZ0A 5E2BA 3S1AB 1AE1A 1ZD3A 3CZ5A 4HQFA 3HJTA 3JQQA 4PYKA 4BNGA 2AF4C 2Y1CA 4J94A 3ORRA 4P2GA 3C97A 4G8DA 3HR8A 1XQ1A 3HB9A 4C43A 4N76A 1UFRA 3STTA 4V0ME 4JEUA 3V00A 4C0QC 3Q5GA 2DPXA 4GR5A 4IKPA 2PGAA 4JBHA 2ZGVA 1U28C 3ROXA 1A7JA 1UQUA 4H6PA 1BA3A 4UQLA 4RGVA 4X1KA 1EHYA 3I2KA 5KTRA 2XB8A 4ETNA 4QBGB 1F7VA 3I72A 4HLUC 4BNLA 3H9UA 1E4OA 4PC7A 1A9PA 2CL7X 1PJRA 4H7IA 4UMFA 3G7SA 1IHXA 1G4HA 2C84A 4YCLA 1KFBB 3OLCX 2E4ZA 3E9MA 5U4XA 4DDHA 2PL5A 3ANXA 3QVGB 4RK5A 3O2JA 2WHEA 1J33A 4QDTA 3VV2A 2BC9A 2CDBA 4Q7MB 3IDAA 1R6AA 2NQ8A 2OHFA 4IDPA 3SZOA 5B4TA 3I8XA 3Q10A 1YS7A 3D4BA 4NMWA 2FWNA 2C3UA 3JAMA 3IE0A 4U9UA 2C00A 1OBOA 3WFJA 5A4FS 1NKVA 2E48A 3QWAA 3OE5A 3BE4A 4XUGB 1NFRA 4FMCF 4JQSA 3ZGZA 1M34B 4NOLA 4NV0A 4XJVA 1C4WA 1F12A 1DQZA 1TCBA 3ZC3A 4JLNA 1VE1A 1JIIA 2VCHA 2D2XA 5JCOA 4ARSA 3TW4A 3KZXA 4PLTA 3GPCA 1QE0A 1BS1A 1JKFA 2WYHA 1OVGA 1KIFA 3RS8A 4ZOQI 1R9GA 2QX8A 1OCEA 1SU8A 1Z37A 3E5RA 2VDMB 4NESA 4UCXA 3RUHA 1F06A 1AUQA 3GEIA 4IDAA 1LPNA 2XYGA 3QI7A 3Q0EA 4GI3A 3N6RA 1WOYA 1ZUHA 3ANLA 2VDWA 5FR2A 3GLHB 3DTNA 3A26A 4KDFA 4ABTA 1QX4A 4XLTA 1LTQA 2BE9A 5FWAA 3WJ7A 3QG1A 4HYEA 5HKOA 1MDFA 2XQKA 4R8LA 1D04A 4C6SA 4AROA 1X8JA 6Q21A 5CVTA 1PZNA 4CKEA 2IH2A 2C99A 2QVBA 1DO8A 1RP1A 3UAWA 1K6XA 5TS3A 3UAZA 3RQSA 4CMJA 5IJ0B 4JLUA 3NWJA 4PNZA 4N49A 3SSNA 3VZRA 2QIPA 1WPQA 3CJRA 1QMPA 5TMBA 5I9LA 2AMYA 3C74A 1T6NA 1NI3A 3PPVA 3ADDA 3PDIA 1P8JA 1K5PA 2MSNA 1M2VA 2YYAA 2R5WA 3N8IA 3HG7A 4P83A 4XJSA 4ZMBA 2RKOA 3OP4A 2XNCA 1DIGA 4MVJH 4B7XA 3G6WA 3NDIA 3QYFA 4EHDA 4D80A 1TE2A 3P32A 1EUCB 1PD1A 2FRVA 2XA9A 4C4ZA 1TI7A 1MT3A 1S8OA 4U6QA 1DRKA 3KZVA 1FP6A 4I4TB 5KOHA 1GZ3A 3MN1A 2GR9A 2DFPA 3B8HA 2Y0BA 3ZGXA 4A73A 2VJQA 1H4QA 3SYNA 5KQPA 3FOEC 3UAGA 4YJ3A 5IG2A 4YIKA 5D3MA 5ECYA 2YZGA 4NAVA 1Q83A 2OD2A 2VPYA 1TGYA 3P0IA 4E5KA 2BGGA 1Z6YA 1ZMOA 1ZOSA 3L06A 2GHIA 4CHTA 5IEBA 4ITUA 4ZK6A 1TJNA 2QTFA 2O23A 1PYDA 1PJQA 4HDRA 4WLNA 5KNBD 1E59A 5K0LA 4J1NA 2W83A 2XGOA 4UVHA 1FX1A 3HWRA 4OI4A 3PIDA 4HFMA 3F6PA 3H2BA 4NLLA 4F6RA 1CIVA 4BTEA 3GZ4A 3VAAA 1UXIA 1LDYA 1C9DB 1JZQA 2C4HA 4O0MA 2ZBPA 1E3WB 5CUQA 2Q3DA 4Z86A 1A7KA 3MS2A 3Q4GA 2PX6A 3WB1A 3H0EA 3WLKX 1PS0A 1QGDA 1SXJE 1FZQA 2O5VA 3NJ4A 1CR4A 5AKYA 3EXEB 2GVZC 5EZYA 1Z0JA 4O4JF 3A3OA 3UHAA 1K7FB 3IPXA 1SUDA 4N0QA 5JSFA 1YA4A 3F8WA 4A4DA 2WOJA 5DF1A 3UJAA 1U9IC 3A58B 5KNLA 1NZDA 4YCAA 4LF6B 1G8SA 4RMGA 4V38A 4DXDA 1ZK4A 5IT5A 3R44A 3SJ7A 2QY6A 2GAIA 3FPEA 3RYIB 1R6BX 4EBFA 2FWJA 5IXSA 1VB5A 3ZD6A 1ABFA 2WU1A 2WAAA 5CLJA 2EFCB 5KWSA 2JB9A 3IPRA 3ORHA 1TCCA 2JA1A 4ILEA 5IKOA 3X1WA 5BSKA 1LQUA 3E9NA 3WHPA 5JW6A 1V3QE 3J7AC 4R2KA 1C14A 3SS7X 4C0SA 3G8DA 4QDXA 2Q5EA 2EOAA 3OKFA 4O2AA 3TSZA 4YV7A 4Z49A 4MCAA 1H2WA 1XPOA 1QPBA 4V03A 1L1FA 4K1LA 4XRRA 5T3UA 1T3HA 2W42A 1O95C 4O29A 1SXJA 1VG9B 3PFGA 2XSZA 3BSWA 4IICA 3HWSA 3BSYA 1P5FA 1NVFA 4WK0B 5J2UA 1ND5A 1CZHA 1DT5A 2FDRA 3PA6A 2J87A 3RC3A 2FFJA 3WA6A 4QVIA 1UEIA 4YAWA 1Z36A 3FSJX 5DN9A 5TE9A 2ZRHA 4INPA 3AESA 3MGBA 2F59A 1P9NA 2ONKA 2V7WA 3PNLA 2AOWA 2IHYA 3NBAA 4HNSA 4HLCA 4DQXA 2P2NA 3K6SB 2YWGA 3AIOA 5AUNB 2UUBB 1IBCA 1P60A 3MM4A 5FFNA 3DKIA 4I4NA 4MIOA 3PWZA 5JBIA 1G8PA 4ITRC 3NCTA 3QKTA 4WOPA 3PWSA 2FRDC 2G9QA 3DMPA 3PPYA 4GYKA 3MCZA 5AXCA 4D9IA 2FP3A 3MZ0A 4BQPA 2IYTA 3PENA 3PKJA 3DW1X 4B17A 5J4KA 1D2RA 1N2IA 1ULSA 1SU6A 3MC1A 4LZNA 1XVUA 4HB0A 4JUFA 3SQMA 4M9UA 4P0PB 4B5KA 1UKZA 1MEJA 1XIVA 2OV3A 3E61A 4IIJA 5T41A 2JIMA 5FX2A 2EJTA 2OGZA 1O9GA 3I0MA 1ZI9A 1MB9A 4BLWA 2DRIA 1ABBA 1XOIA 4GAEA 3DAGA 5EAIA 4WBNF 2K5UA 3B89A 9ABPA 2H7YA 3RK4A 2TMDA 2IVFA 4C07A 3REQA 1KOGA 1VI2A 1XALA 4Y2VA 2EDAA 1VZ3A 1Z16A 1ZJJA 2B5OA 1HBJA 1KYWA 4HY3A 4P5PA 3UTDA 2UZIR 4DWOA 3WAGA 3QVMA 1VG8A 3KQQA 3TGLA 2DKFA 3FJYA 4IH1A 4TSFA 3NB0A 3UPTA 3OVMA 1AQUA 1SC4A 3GQVA 4BVEA 1UMDA 2ZRIA 1YT5A 4KO2S 1G59A 1VL1A 1VLLA 3FNBA 4DMGA 4BY9E 3G59A 4C1BA 2Q1SA 2J31A 2JFPA 3AOGA 3AUJB 3NBYC 4W8OA 3AKYA 2FX5A 5FBLB 1SUEA 2I4TA 3PDCA 5KPDA 4X93A 3JARA 2W6NA 3H2GA 3P52A 1B8PA 2NSDA 3ODPA 5GVRA 3UMSA 1E4YA 2DUWA 2JCVA 2WV9A 2ZE7A 2A33A 1I5RA 2CBZA 4IGIA 4IGEA 3T7AA 2CGEA 4F4CA 2IPNA 4TWRA 3OQVA 3UGKA 1UMBB 3PPWA 3A2MA 1ILEA 5CP8A 3HJBA 3L8DA 2D4AA 2HNAA 3LKDA 1N2GA 1TT5B 1ZOLA 2XTNA 1IEQA 5BN4A 4GZ3A 2X15A 1E1DA 2DCMA 1YCGA 2DG2A 2I33A 5IARA 3UT5A 3W4IA 4OI1A 4OQPA 4XASA 4E12A 1FMFA 2ZCVA 1IOVA 3LBIA 4TZTA 2Z9BA 2WZCA 1ISJA 2GI4A 2P4QA 1TUBA 4JCCA 5FFFA 2J9YB 3RNOA 4Z7OB 1U0BB 4YLEA 4CEHB 4Z3OA 5CM8B 1YOBA 3ENZA 1MUUA 2PS1A 4KIUA 1THMA 3QPWA 3U31A 4OI0A 1JA1A 2ZXFA 5BQOA 1VLVA 5EJ8A 3CVXA 3OQNA 4B48A 2OMEA 2A14A 2C5AA 2ES4A 3WLQA 3PDJA 3CTMA 2FTKE 1UADA 4FGZA 4MLZA 1AK2A 3CT6A 4XCQA 2OQVA 2QMQA 5H16A 3I61A 2JJQA 3GARA 4DCPA 4FC7A 4TUYF 4B43A 1FFDA 5KKAA 2VDLB 4I0WB 2G72A 5JANA 5AW1A 1K4MA 2FMFA 4YJ2B 2WMOB 2P75A 3GC6A 1WF6A 1Z7GA 1PDVA 1BD3A 2NACA 4KDRA 4KE6A 3VV3A 3NOVA 4RIGA 1LKZA 4EENA 4PM4A 4YI3A 1K0FA 13PKA 1GLGA 1TEHA 1P91A 1I2ZA 2J3LA 2YV3A 3UAVA 3UXHA 4MR7A 1RZRD 2R1VB 2UAGA 1NF8A 2WB2A 4B2LA 3WMGA 3K3PA 3SCZA 2DBRA 2EYQA 3HV0A 2XUFA 3Q2IA 4D25A 2ZSKA 1E2QA 1IL0A 2F17A 3R5HA 4EX7A 5ICMA 3M6MD 1ECLA 1J8FA 1GP2A 4ZDJA 4FYMA 1HE1C 3BMQA 1DWOA 2Z2XA 3PGXA 4AG5A 3AVPA 3CBGA 1RMYA 2WFAA 4EY3A 5LU9A 2VQFB 1EBUA 4XXHA 2WM8A 2Q9CA 3DW3X 2FPMA 1PJSA 1YS4A 1N5RA 2GZDA 2PSEA 3LPLA 1OAKA 3L6RA 3MF4A 4TTIA 3AIKA 3EFOB 5A5GA 4GRAA 5THQA 1G8AA 4GKAA 4LC9A 1Z38A 2N1MA 2IHVA 2WSIA 4GICA 3SQOA 5ESDA 3A4NA 4FE3A 3K0HA 4XQEA 3P9ZA 4ZPJA 4OU5A 2BTQA 2YQZA 5B2FA 2BFOA 5IVHA 5JDCA 2ZT7A 1P7WA 2EKPA 2WT9A 2A78A 2DMRA 4F3CA 4IF4A 4JT2A 3HEMA 5DLQC 3VSAA 5AKXA 3ER9A 1EXNA 3CB4A 4YMSA 3B53X 1S8AA 1E9SA 3LSTA 2VF2A 1D2HA 1ODLA 1U3CA 3V7NA 2HD4A 4DDUA 3EC7A 3R76A 4FNGA 1GQOA 1LNSA 2LDXA 4QGAA 1EWVA 5AW4A 2L2QA 2V6MA 3LOQA 4QGGA 4CDNA 3LI2A 1SZDA 1MQ9A 1CC1S 2D7DA 1ECJA 1RQXA 1YB7A 3DZHA 3MWKA 2C3YA 4AZSA 2PRIA 3ASZA 1YBFA 4DGSA 4HH3C 4QTYA 4LSZA 4X54A 1A27A 5FTKA 1GG9A 3RASA 1SCKA 3KZOA 3GVIA 2JBAA 2VJCA 2FQXA 2NLOA 4WV3A 1P0CA 1V3UA 3H75A 5ICSA 1J5EB 5SV2A 3KSUA 5CIWA 1B8UA 4HEA6 3W6ZA 4KAAA 2AIRA 3QJGA 1XKXA 4NBVA 1NBHA 5LQNA 1R2QA 2XMQA 3LHFA 2R5NA 2BTEA 2EYUA 3WGGA 3AEQA 3BFJA 3PNVA 3G8AA 4NJEA 2OXFA 2OM2A 3VZSA 1O9BA 1VIYA 3H65A 4U5XA 1UBRS 3MT7A 1UJCA 5A4KA 2OQ2A 4DCNA 1FA9A 2HMVA 1WUIS 4WKPA 1EWQA 5EP3A 3E9EA 4HATA 2Y1XA 4U9IS 1DV1A 2BJWA 4CM4A 3JD2A 4JC4A 3K0KA 3OM8A 1HOXA 4WFJA 4FHEA 4RXTA 2WICA 4EJ0A 1WDTA 3AZOA 3C5EA 3DNMA 4TRMA 4UEOA 3U0VA 1LZLA 3D3QA 3MXTA 4BC1A 5C9ZA 3ZBUA 3SEQA 2ICAA 1GTZA 2RBGA 1Y3DE 2HK7A 2A5LA 2WTMA 1BE1A 4CLOB 3FHLA 4MRRA 3B6MA 3VKWA 2A0WA 2DHRA 3D8BA 4L4UA 4YFVA 1I9GA 1C3EA 1DKPA 3OOEA 4F7WA 2VK8A 1ES9A 4DLKA 4EY8A 5IFKA 2EKZA 4Q3CA 1NLMA 5F3WB 2BLLA 3TDKA 4HAVA 1KEEA 3Q2OA 1R0BA 5IWCA 1TVKA 1PQPA 4MWDA 1I1HA 4KREA 3W9UA 3QYPA 1H4TA 2P9GA 1W25A 4QLAA 1N8NA 4AIIA 4ZYTA 4CFZA 1TQDA 2FWRA 1O89A 2VSQA 2E4XA 4L8YA 4MQMA 4W7SA 3L41A 3EK2A 4HGQA 4HNHA 1RXWA 2X22A 4B45A 3KJHA 5SYMA 2H1LA 4IJMA 1QCYA 4HZUB 1MA0A 4ND4A 4L8FA 1QS0B 1LLCA 2IUYA 1JHRA 2ZDQA 4P7BA 4HUQB 1CQIA 1PT9A 3I83A 4PLWA 1TZ2A 2XR1A 3COZA 4N3CA 5KWEA 1QV7A 3G49A 2OB2A 4RZQA 1MX3A 3TCXB 1L5OA 3GH1A 3MTGA 4A5SA 4I1PA 3MYYA 3O8LA 1I2BA 1N5DA 3RVSA 2ZSAA 3FI9A 3SQXA 1YRHA 4UU8A 1XHLA 2NSLA 1W4LA 5A4DA 4BKPA 1V47A 3NVAA 1ORDA 3DULA 4HP8A 4JQCA 3FG9A 5K0ZA 4N3GA 2BFWA 1GTSA 2CB9A 3WICA 2EL9A 4LDNA 4C4XA 2IHTA 4LQDA 4XSVA 2NVWA 5AWFC 3TLBA 3OQ6A 3KOMA 1VYUA 3WGJA 3KQHA 4CF6A 1JDBC 2FN9A 4H15A 4DARA 4U3JA 1G3QA 4LOJA 1EX6A 2WUFA 3JZMA 1GPNA 4N0PA 2XB4A 5DYNA 4I8XA 1P1HA 2V3CC 2X41A 1Y98A 1CE8A 5DK4A 3T9BA 3HY6A 1CQPA 1EX9A 1G55A 4TLBA 5LYYA 4YH1A 3I6BA 2WMYA 3PFHA 3B52X 4HH4A 4L2IA 3NVKI 4XYMA 5A7GA 4HN4B 5CX1B 3VR3A 3SF8B 4S2UA 2IVZA 3EDCA 2BDEA 2QL5A 1EDOA 3VSDA 5KZMB 3IDOA 5KCMA 1XDDA 3OFSA 4JU8A 4P4SB 4BEWA 4FQ5A 4KH1A 4JL6A 2AR7A 1V1JA 2FMUA 4NE9A 4P4UA 3WYEA 4X3PA 5BSVA 4O4HB 1YRBA 3I3SR 1D6JA 1JI3A 1KAOA 1WP9A 2K4MA 4HKTA 3ROFA 2PT9A 3SVTA 4B32A 3EUAA 1B14A 3STWA 4JIGA 3KVVA 3BGSA 5D2CA 2ZYHA 2EDCA 2J5RA 2XGSA 3S70A 2AG6A 4EB6B 4XAQA 5EVJA 1LI7A 1JXAA 1Q1NA 2C9OA 1OF1A 1U2SA 2JBWA 2VPTA 3IR7A 4XOUA 2E4WA 3UH0A 4OB6A 1ZJYA 3OPYA 5FBHA 1ANKA 3CX3A 1GG2A 4KO3S 5DCYA 2ZZMA 1CK4A 4MVYA 3T7IA 1NVVR 2N42A 3BFVA 1JEJA 4AY5A 4HDMB 5FUXA 1E98A 2G67A 4ZDWA 5HWSA 1KP9A 2PPLA 1SCDA 1Y63A 4IM7A 4TTQA 1J07A 1ZN2A 3B12A 4NAHA 3ZE7A 3F6CA 4Z9BA 1G8KA 4C0HA 4CN9A 5E95A 4GW3A 4XX0A 4JB0A 1M1YA 4DIKA 4N7MA 4KNYA 1EDDA 2IEIA 2A1IA 2OTCA 1ONSA 1Q92A 1RADA 3CF6R 4HYQA 1E1MA 2GZHA 3P96A 4KPYA 4BFCA 5HS6A 5MGNA 1C30B 3DQZA 2VJDA 1GUAA 3O21A 1OI7A 3Q7EA 5TC4A 5KNDD 1U8AA 3HVJA 2VT7A 1EWYA 1ZHFA 2H1FA 2ZYRA 4EB3A 4EPYA 1PN3A 2CVHA 3L79A 3COWA 3EBOA 2ZREA 4RKQA 2ZWVA 3PHJA 2A9FA 5TQ0B 1C8LA 2NAPA 3CNBA 3G9UA 1BG6A 2IXDA 2A9RA 3DO5A 1RRPA 2DY1A 1KA9H 3T3EA 3U17A 1U65A 3MYRA 2JGFA 3ULKA 1NQ5A 4CKEB 4W4TA 2HREA 2YINC 3M9LA 2X2PA 5JNWA 2R48A 1H42A 5J23A 3NBZC 1QQ7A 5CJJA 3PS9A 3DSRA 5CB4A 2F1OA 4L8GA 2W6IA 2WWWA 3I9V1 2ZYIA 5BRAA 5CG2A 2A5JA 1YCDA 5EUCA 3M2PA 4KMSA 1E2BA 3JASB 1FDIA 2K7ZA 1O1YA 3GLIA 3K1TA 3MBIA 3PJRA 5G4KB 2YVLA 3RVPA 4BGDA 5BUCA 3HB5X 2I6GA 2XQJA 3GVXA 2IIPA 1JH8A 5FOVA 4M4SA 4G65A 3RTAA 2PYIA 2CWDA 4LK3A 4GKVA 3M34A 2GWRA 4W63A 5LQRA 3KEMA 2VFAA 1GVHA 1IUOA 3NHRA 1GUDA 2QEQA 4TSKA 3ZQ6A 1EVIA 2IBMA 2DZDA 2ZS8A 4TRRA 4I1VA 3RHSA 4BTLA 1J06A 1CX9B 2G8NA 4HUJA 2HFJA 4Q3BA 1TVKB 5CNKA 1M2OB 3FPAA 5ALIA 3IT2A 4BLUA 5GQSA 1FDWA 3BD7A 3EQ8A 3MMXA 5JFTA 2HDOA 2I2AA 2WKWA 3E6AA 4EKDA 2QG6A 1HEYA 1A8IA 4QTTB 4OMUA 3ROGA 3D3NA 3KR0A 3TQRA 3FFBA 2I7TA 3DOCA 1N1MA 1NMQA 2I9KA 4E31A 4KW7A 3NPMA 1IQRA 1VCMA 3PGA1 4S1OA 4NONA 3C45A 5DHQA 1A4IA 1NNUA 1W85A 4DM4A 1WEKA 1KKLA 3DKPA 2HMUA 5LOVA 4DOMA 2RH5A 4UTOA 2YV5A 1MB3A 3PI7A 3FTDA 1Z4PX 3W2IA 1YHYA 4K8OA 3EGXB 3DE4X 1MRSA 3Q12A 2NSHA 4R1QA 4TKMA 4ESHA 3F7NA 3TOVA 2E6UX 2B1JA 2NXEA 2OZPA 4H16A 5EXDA 1FLAA 3SJAA 3FWKA 1B43A 1W85B 4CE6A 2OXEA 2BBSA 2QZPA 3D7LA 3GMTA 3JYLA 3LDFA 3HL4A 5DX0A 3QOYA 1NNLA 2WIDA 3TNFA 3WLSA 1K5DA 1XNHA 2W2TA 3CSDA 1BWQA 1RLUA 1XCJA 1X1EA 2GZAA 2IOQA 2YV2A 3A6HA 1T5BA 3NYIA 4NMXB 2FEKA 1E6LA 2WDPA 4XB6B 3OJCA 3ZCTA 4HQLA 3N8DA 4WBXC 1POXA 2E82A 4G8BA 5A5FA 1JSRA 2GBGA 4O08A 3OEYA 2WTXA 3SR3A 4RQUA 3GBSA 1G2PA 4MWZA 3L7BA 3QVJA 1ZJ6A 1Q14A 4QWMA 3T94A 1SZJG 1W581 2HA2A 1M76A 3DUWA 3NHAA 1J8DA 4U7PB 4YFYA 1FX0B 4V24A 2H7CA 1OTHA 3NFRA 1J97A 1X8KA 3GCXA 1BHSA 1S2GA 5C7YA 3FY4A 3AZPA 3NV7A 3UCFA 3BVPA 2XECA 2E4UA 3S2GA 1RE1A 4KLCA 3ZVLA 4NP6A 3Q7PA 1I2CA 4FGWA 1JU9A 1FXSA 3NYRA 4ER3A 3ZHSA 1CIPA 3B82A 4Q00A 5AKGA 3SS9X 4C7VA 3CISA 4EY4A 5K3FB 5KOYA 3BN3A 2PO7A 3QLUA 4HLDA 2B61A 4HL6A 4MWOA 2RHBA 1BRMA 1ODJA 2G83A 4P5EA 3FH0A 3TK1A 3SYLA 3ELBA 4EUSA 4DHWA 3BWVA 3ND6A 4ZO4A 521PA 2ECPA 2WSSD 3OU6A 3SEZA 1LXCA 1U8EA 1MX1A 4YRGA 3KX2A 4MGEA 3F3SA 3SXUA 1BQEA 1LC0A 3B1WA 4BVKA 5KYWB 3W1EA 4MVWA 2F7SA 4RLFA 1E2UA 1BJTA 4HWRA 1TYCA 2JKZA 1JXMA 3LBNA 5EXEA 3ZQKA 3ZYCA 2VJNA 1C1XB 4B3XA 1EPUA 3TZQA 2XODA 1JHPA 4LY6A 2GJKA 1RKUA 2JLYA 4MR7B 1E5TA 3I42A 3PXAA 5GP1A 5SZIA 3JQPA 4C0KA 1T4MA 4JB3A 5G02A 2VTVA 4BYGA 1HFKA 4LS3A 3R40A 3C4VA 3N74A 1XNJA 3R7SA 1OLSA 2XZDA 3AR6A 2DY0A 4AP6A 5I01A 3QUBA 4AO7A 2P69A 3AONB 3EGXA 2XOKD 1VSTA 4JH0A 4GXQA 3UHPA 3T9EA 2PNFA 1DVRA 3GR6A 3LYLA 2P6OA 4TS3A 3TH5A 2KQUA 4RD0A 1N9KA 1WO8A 2GXAA 3EB9A 4JP5A 2UXBB 1COWD 4XQ9A 4O4IA 2Y2VA 3DNFA 5JNSA 3AY0A 3FZEA 1UDWA 2V7QA 3U7HB 4I6GA 1EUCA 2ZJOA 2HLPA 3HUFA 1RHRA 4G09A 3P26A 2VP6A 4J91A 4JVOA 3KIPA 4MROA 5DDIP 3EXIB 1ULBA 2AX4A 4QJ5A 4H31A 4E2XA 4TYWA 2ZPTX 1CY6A 4PQGA 1AXEA 5C4IA 2R44A 2HHAA 2QOEA 3EGWA 3TXXA 3ADBA 2RONA 5GONA 1X9IA 3NRBA 1Y3AA 3BJMA 3EFBA 1EK5A 4AZTA 4B0OA 2Q4BA 2Z57A 5DGCA 4RTLA 1KMMA 2AI1A 2PZAA 2VEDA 4K0KB 1A9TA 1GCAA 4TLAA 4WNYA 3ZXUB 3B1KA 1EE1A 1SY7A 3ZY2A 5CEEA 2QN3A 1ISSA 3O6VA 3KZKA 2DKNA 1EZZA 2PVSA 1HETA 1IBMB 5KUTA 4X20B 3MRSA 4GS5A 1IHDA 3OLQA 1UMBA 1T1RA 3JX9A 1ZI8A 4YLGA 3H9CA 4NFYA 5KMGB 3HFGA 4KVAA 3TSWA 3NZEA 4M7PA 4DJDC 2AF3C 2ODPA 2QMZA 3U4CA 4POOA 4U02A 1T3ZA 1FVFA 2FW1A 3R6TA 2F00A 1REQA 1QIMA 2F3PA 2VRWA 4OJNA 3A7EA 5J5AA 3BBPA 4DR5B 1MO5A 1N5LA 1N2EA 2V58A 3BXOA 1SWWA 3TTVA 1NTRA 1H2BA 2P9YA 5DCLA 2Q5CA 5E4YA 4UPEA 2DX7A 1KJWA 4RTOA 2OQRA 2V4ZA 4IHJB 4HS4A 4BUCA 3FNIA 1O96B 1TT7A 4B87A 3D7KA 1LI4A 3M1IA 4UHDA 5ITZA 3G5AA 1P7ZA 4N12A 3HXQA 2HWUA 5IAOA 1RYHA 1VSBA 3NGXA 2KSQA 4UJ3A 1H0RA 1M6EX 1YS9A 1PFUA 4A8JB 5BMOA 2DAPA 1L7EA 5ERXA 2B1IA 3D3JA 1TM1E 4P5DA 4RL4A 3ZLBA 1ZN9A 2AUTA 4PC1A 5DM60 2XWSA 2EGHA 1YVEI 4CM7A 1SQFA 1IXSB 1LDBA 3NRJA 1EGMB 3IS3A 4G5GA 1FTQA 4N5HX 2G71A 3R4VA 4ZCMA 1Z28A 1TK9A 5FF9A 5HRAA 1U3FA 1YC2A 5HIMA 3LCRA 3W9BA 2RH9B 1PW5A 1ZIPA 4N0EA 3QFSA 3A9CA 4CV2A 2VP9A 4NFLA 5AUQA 3SU8A 1O57A 1Z7EA 5I4IA 2XYQA 4CL3A 2C9DA 4ZV7A 1HZZA 2WTUA 4BO7A 1KY3A 2RAVA 3P4UA 4F4IA 1NE7A 1ESCA 3P9RA 4GP9A 3A05A 1JR4A 1PWZA 3MWEB 4IPTA 4KNWA 4YC7A 3HU5A 2Y68A 2LWIA 3UA3A 4F9TA 1Q6ZA 2X23A 1Y5IA 1K92A 3AXTA 3EF1A 3WJ1A 2FH5B 3OPYI 3LYHA 1F8GA 1AURA 5HA5A 1NFFA 2CWWA 2DCUA 4JT4A 4NYIQ 5DM0A 4JBGA 4DIDA 3I73A 4QDJA 2O8CB 2CFTA 3TM5A 1T8WA 4P81A 3RC1A 3V42A 9ATCA 1CUUA 1C29B 1I1QB 2WQZA 1Q1GA 1VBMA 2EEZA 3SHVA 2QTVB 3U3RA 1EHIA 2DH6A 3V33A 4HDQB 1HZZC 3KSDO 5ANRB 5CBKA 3BB3A 3L8ZA 2I4MA 4DG5A 4PFQA 3V8QA 1VBKA 2I76A 1CB7A 4L0DA 5BW4A 1PEKE 1WXHA 2CFCA 1AU9A 2B98A 4KC0A 3WL6A 4KITB 1ONNA 1SGWA 1PFQA 1W36C 1KNQA 4PPNA 4MUEA 2P7IA 4Z5XA 1JXQA 1YRAA 4BO9A 1ULAA 1SELA 2QU7A 3FNQA 1XZEA 2A0FA 4QRHA 4DQUA 4MUGA 4GRDA 4HNAB 3U3KA 4AMBA 5BMVB 1UBFA 4ZVRA 1OJLA 5MDHA 1DQRA 3O2NA 1YB6A 1CQZA 1P5HA 2IV2X 4BZWA 1VE3A 2CFOA 3C41J 4LRTB 4DBZA 5K01A 5EXSA 4NZMA 2GEBA 4YRCA 3TQTA 3GJ6A 2Q21A 4OA5A 5FKJA 4A0GA 4U6NA 2F4NA 1RFGE 4AAYA 3NYQA 5A03A 1P81A 1V7PC 2ZJYA 2ET6A 1ZXBA 2K7FA 2AC4A 4TTVA 2KLBA 5MGBA 5DN6D 4BDSA 5AHRA 5IJ0A 1R0RE 4EGJA 1AN9A 3COYA 5FH9A 4NFHA 2PK3A 5JO9A 4WY5A 3A3YA 4YJDA 5T4EA 2NWQA 3I64A 4GOMD 1SVMA 1Z0UA 1M8GA 2QI9F 2XGMA 1IEXA 3VC3A 5E7IA 4DSAA 3E8SA 1YVDA 4FB4A 3E82A 4BASA 2DHQA 1QWSA 3Q3CA 4O2BB 3U7IA 4KQWA 1O94A 5LB2A 2R6AA 2D1RA 2P8SA 4URWR 4R2JA 1J90A 2EW2A 4YJHA 4QT0A 1IZ7A 3L49A 2GBCA 2PGLA 3BK7A 2Q6LA 3QTTA 4IIVA 4OJQA 3ZLJA 2J48A 1A7UA 4LTDA 2GN9A 4YVFA 1RWWA 3KT8A 1EMDA 2IYRA 5ILGA 5HJEA 4XGKA 4EG3A 3F4BA 1PWHA 4LHXA 4EYSA 2AD5A 3EMBA 4UNSA 3RAJA 2O1SA 5FOSA 1JEYA 2QL6A 2ASVA 4HQRA 2C8VA 1VRWA 2D5CA 4DPKA 4XTRA 1D2MA 3AJAA 1J1IA 1SHZA 5E0OA 4KO8A 3D4NA 5LA6A 1IY9A 3QLUC 2FFRA 4X1OA 1H0SA 4HFJA 4ZV9A 1CEYA 5IBQA 1RAEA 4OYHA 3W7BA 5K7SA 3E3AA 2R4QA 3GZTB 3HHPA 1K89A 3CMMA 4E7OA 1Z08A 4LXHA 3BE5A 4ZOLB 3LPAA 1BE8A 4I9NA 3VHLB 5ADHA 4R6XA 1VRVA 1DB3A 2DGDA 3WDSA 3FF1A 4ASUA 4DV7B 3JQ9C 2EX0A 1E0SA 4W1PA 1NI4A 1U90A 5AHWA 1JFSA 4XWGA 1JILA 5IF3A 3AU9A 1NZFA 2CUNA 4R7GA 2PN1A 4OLJA 2UXDB 4YWHA 3TQSA 4NSNA 1TIKA 3GCDA 1TA9A 3ASUA 4L51A 1GXSA 4REQA 5K8IA 5IDVA 5AIBA 3VJKA 2OE2A 2VOJA 1F2VA 3LYAA 3WP0A 1SBNE 1V5EA 2ZCUA 3CRRA 2HADA 4WCFC 5D5PA 4EG0A 2I6FA 4F92B 4R7ZA 2HPZA 2HXGA 4AJ2A 3T7SA 3FSRA 4QNNA 3V1KA 3X1KA 3RRBA 3E9RA 3A2LA 5TPWB 1WZEA 3WTCA 1Y3BE 1XBTA 3FUVA 5LL6P 1DQNA 1M7GA 3BQMB 2P2GA 5GY7A 4B79A 3L77A 3NO4A 3M89A 1AKEA 3ZY5A 1P72A 2ATXA 4BFVA 3GRAA 2D62A 2GPAA 2AKEA 3RC2A 1J0AA 1PLLA 1XL0A 3RFCA 1JB1A 4F04A 4WLUA 2AC2A 4P34A 3L7CA 5GZ1A 1DBSA 3VFDA 1UBCA 2DKOA 2VDRB 2HMSA 4FCCA 3NUQA 1L5MA 1E20A 3ZDEA 2Z04A 4PNHA 3ESXA 1GQQA 3CEHA 1XZ8A 4OSPA 1L5VA 2YJTD 3U7QA 1I1OA 4BVLA 2O1XA 3GK3A 5B1DA 1SRQA 1FFBA 3ILYA 1CW2B 5IKPA 3FZNA 2SKCA 3L84A 1YQDA 1P2FA 8ADHA 1YDEA 4OX9B 4MQEA 2RAPA 4QE3A 5FLKA 2FCAA 3R74A 5J43A 1Y6RA 3TZBA 1NWCA 1ECFA 1ENYA 2I2XB 2ZSDA 4G0QA 1RYFA 4DCGA 1MJFA 2D1TA 4L2IB 3JAWB 3NHJA 4KQ2A 4Z4EA 1ISGA 1LWNA 3DA8A 1R27A 2IPOA 2FZ4A 5K3DA 2G4CA 1YVPA 2BEWA 4QDZA 1T5OA 1TQ2A 2CYBA 3CMCO 2ZWPA 2PD3A 4NBTA 1UQTA 1LPOA 1E3LA 1WUJS 4KN6A 4QBTA 5AVWA 3DB2A 3HKEB 1ZGCA 3JQ8B 1T2FA 1C9MA 2OG1A 4Y7DA 4F56A 1YQQA 5HE9A 4DT1A 3MW8A 2WHRA 4LRSB 1E3JA 3QFTA 2JJMA 4GOXA 4FGUA 5FA5A 3W4KA 3RC7A 2QRKA 4QOFA 2UV8A 2BE7A 4MIKA 4NEHB 2IPXA 4K28A 2WJPA 3L7NA 5K8CA 4P4LA 3A31A 1H2HA 4BNNA 1OU0A 1Y3HA 1SM4A 3HLTA 5I8WA 4L22A 1O6GA 2WLTA 2W2VA 3IEIA 2CYCA 2OFPA 2Q2QA 3CPEA 3EISA 3O4GA 4IQ4A 4Q4HB 4RA6A 4PQFA 4CIXA 5EIXA 1GAWA 2B1QA 3L6BA 3BHMA 5HOQA 1U1EA 2XMZA 3NT2A 1H5NA 1KJNA 1L5NA 4NEQA 4UEWA 3ZV7A 2I62A 1IN1A 3TEFA 1NXPA 2CUZA 4ZARA 4GOLD 3G2PA 3L4BA 3NBMA 3OKCA 3Q41A 3T3GA 3WGHA 3L82B 5KREA 3T1TA 5AMXA 3ICEA 1KMHA 1RWBA 2Q9AA 3FETA 3S7TA 3CLRC 1U5AA 2YWXA 1ZVVA 2YQ4A 1ZU4A 4YALA 5GZ6A 2OENG 4L0CA 2X8WA 5FJJA 2J3IA 3JR7A 4I5IA 5COQA 3WNZA 1Z22A 2GHRA 1WHSA 3DVQX 4TMXA 2DECA 2EFEB 1RYDA 1XZPA 3A4LA 1IVSA 5LBIA 4JJ6A 3G1UA 1F7UA 1G9TA 4DKXA 1ZMTA 1UZMA 1SOWA 2CYAA 1QP0A 3KB2A 3KV1A 2QY9A 1XDUA 1WXQA 2J07A 4HFNA 4WRRA 4D9GA 2J0SA 3EPHA 4KXYA 3DTYA 1WY7A 2NUBA 3KWLA 4BX3A 4KNVA 1TC2A 3FMGA 3G2NA 3ILVA 4INOA 2TMGA 1H9AA 2AA3A 4JI6B 2Q0QA 4RLHA 2FG5A 4BECA 2EARA 1UANA 5KSPA 4UHFA 1EUYA 1A3CA 3HCEA 4EWLA 1G3MA 3L0OA 4C5BA 5ITVA 4KQXA 1JR3A 1RCTE 4UDYX 3QMVA 4S1VA 1Y33E 4QU8A 1KVSA 1NBEA 2XB6A 4B73A 1WSAA 3IMGA 1U0TA 3PUKA 3HM9A 3QF4B 5DGTA 1AHIA 3AJRA 2CZCA 1N5OX 1IAQA 4HOYA 5CURA 2X4DA 4D5EA 1IM5A 3ESDA 2AFIB 1TYAE 2EL7A 3PQ2A 4TKVB 3T15A 4RF3A 4LW8A 3FWYA 3ELYA 5JPCA 2VTBA 4UUPA 2QT0A 2ZYDA 4F9FA 3TLXA 4AM8A 3ZVKA 3OPNA 4YACA 2JBAB 2Y3IA 1OI2A 4EJMA 3FMPB 2PUFA 1XCBA 2VZLA 4PCUA 3CSUA 1BC5A 4DIEA 2QQ0A 3OQOA 3TLKA 5BN3A 3C87A 4XRGA 3IILA 5AW8A 1YUBA 1DZIA 2O57A 4BBPA 4GZLA 1KNXA 3IDSA 1KORA 2BN4A 2QVZX 4D3XA 3VMFA 1G9SA 2DUNA 3UC9A 1QO0A 3VC7A 3GOHA 4KX5A 3PT9A 1OFGA 3TCNA 1ZHOA 2CK3D 3JXEA 4M6WB 2WTBA 2FPIB 3TXYA 3OIWA 3NTRA 2HIMA 1XD2A 2YJ5A 4IO0A 8AT1A 4BB6A 4X1IB 1FUEA 1HEUA 2ZU0C 2BGMA 3HMKA 5E1DA 3RSZA 4B09A 4F2GA 5A3JA 2WNIA 3G1WA 2WRZA 5TDHA 4XLZA 2GCEA 4B2YA 2X2FA 4F2WA 1NLZA 5KYVA 3RD5A 1S9HA 4HVTA 4C0XA 1DC5A 3F1KA 4HC4A 5E9AA 1EG2A 5EWJB 5F1KA 2BHRA 2G04A 1GRRA 3IMCA 1YWGO 4X3OA 3LHKA 4CMAA 1D1QA 5AVSA 3WBKA 1BMTA 5E8RA 3B6IA 3WGVA 2D8AA 1HG0A 2PJZA 3LRTA 4AN0A 2JGMA 3FCOA 4Z3DA 5HRUA 4JBXA 1ZMBA 2JJ2D 4OGLA 3SGLA 1TEZA 3HYCA 4HSEA 4ALJA 1NMYA 5EHQA 2IEBA 3M1YA 1U99A 2E2WA 4ZVSA 4AMUA 5C46F 6GPBA 4CCYB 2PD6A 5ESXA 2X86A 4RFSA 4BO5A 4RBNA 3BFKA 1A7AA 1P75A 4WDQA 4R31A 1VJTA 4XI9A 2H2AA 1I51A 3O1IC 4L9WA 1OXVA 2GKSA 1WABA 5HEKA 2C2HA 2F90A 5JLAA 1QDUA 5DYTA 4AO6A 1T2NA 2ZG6A 1XE3A 1NVGA 1JECA 3D8HA 1GPH1 1ZGZA 3RTBA 1B4DA 4IBOA 4F4HA 2HHJA 1IHUA 3GYGA 3RARA 1GQYA 4DF3A 1ZR2A 4R01A 2ZRBA 4WLOA 4CDGA 4D8XA 1W5TA 3MMSA 5FUWA 3ILHA 2HF9A 3SE0A 2WU4A 1QF7A 4NYMQ 1A0OA 1AZLA 1JBQA 1VJRA 2HV8A 4A1FA 4AKEA 4BL5A 5DGIA 2HRDA 3GFRA 1PJ4A 4GC5A 1ADYA 1CS0A 1G2OA 2JL1A 1SZCA 2VH5R 3D3WB 4AF7A 2C7QA 2ZT6A 4ZOEA 3TGWA 4AJHA 4HAUA 4MW4A 4U1RA 1W4CA 3IEVA 2BLNA 3N5KA 3PX2A 5DNAA 2Z30A 4J0JA 3TTSA 2CXUA 2VRBA 1ZH2A 3FZGA 3JR3A 3QRWA 3G6KA 1R5OA 4GDMA 3SM9A 3W2HA 3LUPA 2BFFA 3MRVA 3VPHA 1YZLA 3TD2A 2C2MA 4AURA 1R8SA 1ZQ1A 2IE0A 2TSYB 1DOZA 1I4DD 3AWIA 4GPEA 4MOWA 3UQZA 2RHHA 4U8GA 3CV3A 2W48A 4HDAA 1UXOA 2WM3A 4RVDA 2VXYA 3NR2A 3UKOA 4J75A 4NH4A 3HKCA 1ZESA 1EA7A 3ENVA 5LBTA 4MQEB 2E18A 3GMIA 3LP8A 1KTIA 3FE2A 1O97D 1AXRA 4EHHA 3TI7A 7YASA 5C8ZA 1Q11A 2VKTA 3IV7A 2PKXA 4BUJA 3GNTA 2NYUA 4Q9AA 1I1NA 1V5FA 3EHDA 3EOBI 4RY2A 3V80A 5A3RA 5KYKA 2FSUA 2XADA 1UOPA 2IS2A 3AGPA 4LUCA 4A3SA 5F7OA 1OX4A 1USKA 3OPYB 1I4LD 1JEQB 1NUQA 3QWIA 3R7FA 1Y6FA 3PWKA 3G9ZA 2GZMA 1R8JA 3PSHA 3L0ZA 1V8BA 2X8BA 4M1MA 3QWHA 3WP1B 1GFSA 3C3XA 4A8PA 3M4YA 2G07A 3BRCA 4WD3A 4LYYA 5E3JA 2P4HX 4MUKA 4RTSA 2OORA 1QP4A 2V0NA 3VISA 3ZGLA 3GJXC 3VYVA 3WYFA 4AJKA 5L3SB 2LPMA 3DBVO 2WHPB 2PTHA 2HBQA 2OL4A 1U0EA 2XNJA 3EW9A 2GPNA 2B4RO 3FMFA 3QHQA 3TVTA 1ZMXA 3NDBB 2X9QA 4DLLA 4IMRA 3ZX5A 1P2DA 2HTEA 2BKLA 2BR3A 3BMNB 2ZB4A 1MC1A 3UTCA 4D46A 4F21A 2VWHA 5H9VA 3NH6A 5ICGA 4Q1DA 3LA6A 1RHKA 2HQOA 4Q05A 3LS2A 4TM7A 5IAJA 3ZW9A 5CW1A 4XH9B 1S8FA 4YN3A 2QPAA 4P08A 4HYYA 4ZCSA 2Y67A 1X39A 1GUYA 1JAYA 3EXG2 1QCDA 4HGRA 3KE9A 5GM1A 1KSFX 3F9CA 4MDFA 1NW5A 4ND2A 1SPXA 1JYSA 3WNVA 1G4AE 1VL0A 4HEA1 3G82C 3BS4A 2JAUA 3HB0A 5B4VA 4RCYA 2JH9A 3GEEA 1YJ5A 5J40A 4YRDA 2W2XA 3D8UA 1DBVO 3OOWA 1TDJA 5DZSA 2Q1YA 1J42A 4EKYA 3WRYA 2VLIA 3GUVA 3AJ8A 1ZCBA 4WOBA 4WIAA 2XHEA 1AY0A 1FYVA 2G80A 2VHWA 4I3GA 4I3FA 1QHSA 1GNPA 1ORHA 4CETA 1RJDA 1GZHB 1A8SA 4NBSA 2Q6VA 2YW9A 5CFRA 2HY7A 1RW4A 1TZCA 4O63O 4OXKA 5JPDA 2CJYA 2F4VB 4BLQA 2A9JA 4RKEA 1QBKC 2PMDA 1J1ZA 3TFWA 3ZDBA 2F8LA 4J1SA 1UAYA 1KXZA 1UJBA 4IG4A 3BH0A 1VG0B 5FBZA 1LEHA 1KJQA 4H7FA 5HF9A 1C5KA 1QDLB 1EBFA 2XDWA 3DXXA 1C4OA 5LXTA 4RK4A 2RGGA 1U8YA 4N1AA 3LV8A 5IDWA 1EFAA 3WFIA 1B93A 4GVXA 5CA1F 1WXIA 3R3YA 2GYUA 4IXNA 1Q15A 3TX2A 1UJ4A 3WK7A 2PXAA 1CQJA 1E9DA 2AG8A 1Y8RB 3DB1A 1T4DA 4L7QA 2Z3ZA 3MT0A 3EASA 4NMHA 2IXEA 5GIPE 4JI8B 4N9QA 5KQRA 2BR5A 3NHBA 1Y6JA 1E66A 3VPDA 4XVRA 1WXWA 1G8YA 1NBOA 2PSDA 1XZDA 4KKXB 1EWTA 4A6EA 4F71A 1XK6A 2CMGA 4Q19A 3DNPA 2ACVA 3TOZA 1DXYA 4I9HA 3IX7A 1LC3A 1HDZA 4H3SA 4UFNA 1AD2A 1MGPA 1U2GC 1G63A 1X7XA 1P31A 2X1VA 1FZTA 1TU0A 1GZDA 4RZUA 3RWBA 3LGSA 1XDGA 5EWLB 1N75A 2IP2A 3H42B 1VYTA 4PLGA 2OK7A 4LDAA 3PJGA 1V2HE 3LHIA 5COBA 5IMSA 4TS1A 4S1WA 5HIIA 421PA 4EX6A 2QTRA 1VPWA 3ZJUA 2KB0A 2GPTA 3ANTA 4B3DA 4UOEA 4DYDA 3Q98A 2FPOA 1W44A 4ZAGA 4PN7A 1KP2A 2ZWIA 1WKVA 1YZYA 1SU4A 4QSHA 2C83A 1RNLA 1G7TA 3B5EA 2A59A 3RHZA 2ZK7A 2BISA 4FONA 5D00A 2OZLA 5ALGA 3U48A 4DY4A 3R9XB 1KI8A 1GAQA 1EA5A 1XSEA 2IDMA 3DBIA 2XQIA 2MYTA 1U94A 1HNZB 2A5DA 3EIWA 1SWVA 3ZUGA 1SBCA 1AGXA 1B3RA 2IEAA 2PX0A 4K9LA 4RLSA 1AHPA 3AUSA 5K2OA 3S1SA 3PG5A 5FPQA 5B6PA 4MYRA 1SIOA 2R6R1 4UCWA 3FDJA 4O4LB 1E1CA 3W8EA 1BOFA 4R1MA 4G81A 2F64A 1K75A 1ZNZA 3UO8B 5JVDF 2ISCA 2QJWA 3IH5A 5LDHA 2V96A 2QTMA 4D99A 1EKXA 4HNTA 5JS7A 4FFOA 4DQVA 1I0ZA 2HKIA 1RRGA 2CLMB 1MF7A 2DP4E 2H17A 1L4LA 3HYRA 2ZBQA 3CUVA 3RYHB 1USVA 2ZR8A 2PUJA 3EXAA 3ICWA 3OQJA 5FBQB 5HP4A 2G5TA 2XAAA 2BV3A 3F46A 5CH8A 2PCJA 4KPGA 4N6NA 3GRYA 2PMBA 2WG1A 3SR4A 3WKCA 3YASA 3F9IA 4N7RA 3HV2A 4AZ0B 4J0KA 4KQIA 2FR8C 2I8CA 5LZ4A 1PV4A 1BVUA 2ECFA 2J3HA 4OV6B 5KNDA 2AMFA 3KJXA 3MJRA 4QUJA 4YPVA 2UYCA 5C8XA 3P2JA 1WMFA 3LQRA 3H5WA 1D0SA 3EY9A 3T4EA 1E0JA 3OJWA 1TQHA 3H1TA 4MJ7A 5G3ZA 5A0VA 1KAEA 1V4BA 2BHNA 1A2KC 3GIWA 1WWKA 4HAXA 2OBNA 5M2QA 4M99A 4DLUA 1B15A 3E0QA 3LAWA 1IN6A 2OCLA 2IOFA 4B74A 1O94C 1LK7A 1C1DB 2QMUA 2XUZA 3VPCA 1ZGBA 2CXXA 1KYQA 1MXFA 2X4IA 3PXUA 2C96A 4AX8A 1ESZA 1PL0A 2BRUC 3QLVC 4MA5A 1A9QA 4HWKA 4B71A 3ZR4B 5B7NA 3R0ZA 3TRFA 3ZCXA 1YZHA 5LSAA 1S2NA 2GBLC 3QP9A 3X2SA 3EFHA 1K2WA 1AKQA 3H5TA 3PF9A 3WADA 3NLLA 4ECAA 2PQ0A 1VCOA 1CUDA 1XTTA 2BEVA 3AH8A 3A9TA 1WSBA 2LKDA 4X1IA 5LBUA 1W88B 4RCVA 3C43A 4DV0B 4LF4B 3ODGA 1CVRA 1XWWA 4I55A 3VTFA 1U1DA 3D4LA 4KQHA 3B6KA 221PA 5F2OA 2P5YA 2V9CA 4ENWA 1FS5A 2ZRKA 4KUEA 1U9ZA 5HK8A 3ZWAA 3MTJA 4EPXA 5A5EA 1NT4A 5EJAA 1T13A 1R4AA 4EI2A 2G9RA 4YT4A 3AERB 3LGAA 3C6KA 2IXTA 3ZV5A 4BWVA 2XCTB 1OH5A 4NNPA 1Q7EA 3PJDA 3P20A 4FK8A 3STUA 1DEOA 3WO1A 2V45A 4W9RA 1AKVA 4RELA 4Q18A 4CKWB 3VKGA 3D59A 1MEEA 3WKAA 3D2LA 1P45A 1UDXA 2ZVDA 1W76A 5JH7B 3F98A 4LQLA 2GGSA 4U9HS 4QHYA 3AF2A 1XROA 3RIMA 1IOZA 3A6ZA 1IZ8A 1W30A 2NGRA 4TYMA 1TU4A 3OX4A 2Q6TA 1IN7A 1XMOB 1JEQA 5BYKA 1ZSVA 4R84A 2AZXA 1CERA 2Z2JA 3HCRA 1C4KA 1TD1A 3AHCA 2CJWA 1P2UA 2XCUA 3F5QA 1MCZA 5T3YA 1UWLA 3MGCA 2Q50A 1N8KA 4D82A 5EKSA 2DUMA 1C41A 2WHYA 4ZVTA 1BGXT 1EVLA 2EQAA 1MOPA 2XBLA 2WFZA 3IQZA 4BQRA 5C80A 4JELA 3G79A 4TZ0A 3TLJA 1UCFA 4JI7B 4AKIA 2J9FA 4OXRA 3W5CA 3GP3A 4KLZA 3N8GA 3OJOA 4EYGA 1NW8A 1RABA 2XX3A 3HE3A 4K8RB 2XMBA 2W4MA 1IY1A 4NV3A 4P93A 3AVUA 4FDAA 4IWYA 1FLNA 2OD9A 4LOLA 5L9AA 5TF0A 2WJVA 4HAIA 1ZAKA 3NANA 3K70D 5CRIA 4B4VA 3VR6D 5JLJA 2C7RA 3WLPA 1AV7A 2C1ZA 4GBED 4L7VA 4WNAA 5C18A 1J0XO 4MQ5A 1LRKA 4RFLA 4XPZA 3BIWA 1YBHA 1ODTC 2HQBA 2V03A 3RU3A 4TMYA 4MV9A 1L4BA 2HGZA 3SMQA 4N03A 3X1XA 2PKRA 4OBWA 3EEOA 1AZTA 1L2TA 3DBLA 4Q4JA 4A36A 1JZTA 4JI4B 2ZT8A 3AUKA 1GTL1 3QFHA 3LL7A 5J2UB 1P4RA 3ROMA 1NVKA 3NBXX 3UW1A 4BVHA 5B64A 1B1AA 3PQFA 3DUFA 3IQHX 1Q0RA 1Z2PX 3HH8A 3LW8A 4TMFA 2DBQA 1F6WA 4KXMA 3WLJA 5IF9A 2QN9A 4KQ9A 1LJLA 4OK3A 1W46A 2ZOSA 4PYNA 4Z2AA 1QYRA 3GUUA 1H0KA 2BFBB 1RQLA 2VHZA 5DTQA 3MOSA 3D7RA 1GRQA 3NEJA 5THXA 1BEZA 2CBGA 4BDTA 3LUFA 3MIIA 2YVQA 1WIWA 1RWOA 2R4TA 3JY6A 3Q7RA 1ZA2A 4FUQA 4K9SA 3H4MA 2NU6A 1JVBA 1RXVA 4BFTA 3Q3VA 1B8OA 3GNQA 3HCBA 4QOGA 4ZEVA 2OO3A 2FEPA 3OE4A 2GBPA 3PNPA 2Q3FA 1SOAA 3OX1A 2J0EA 1DKRA 3B60A 3O3OB 1YL7A 4F3KA 1RAFA 4JB8A 3IOYA 4I36A 2QF7A 2R8OA 4YAEA 2W2KB 1GGHA 3OTHA 1Q95A 5BVGA 4IZHA 1CKEA 1VZ2A 4FYYA 3WMRA 4P58A 4BNKA 1DLIA 4GXTA 3DZBA 4RH0A 5EJ2A 2WSSA 4DVJA 2FPUA 1QIEA 1X9HA 2YXLA 1UXGA 1DTWB 5FEMA 4CV3A 3LDGA 1K8RA 1FUIA 2X1LA 4R69A 3TQIA 2BEWB 5A4MS 4CT5A 2WE7A 4CI0B 2GTIA 3DDCA 5BMVA 2VZ0A 1JUDA 3NNNA 1RQ7A 1SUFA 4YBZA 5JXIA 4EYKA 1SHTX 1E5LA 2PLRA 4HRYA 4G0ZA 1CE8B 3HBFA 3M5WA 3OEWA 2Q9BA 1TZBA 1OIWA 4UQOA 4X91A 4ANFA 2A9KA 5IXYA 1CZLA 4REQB 9MHTA 2IYAA 4RPIA 1YR1A 3HGMA 1CIJA 1TIPA 5JYEA 3DXYA 2FSVC 3HR4A 2O2IA 1VM6A 2ZJ0A 3MHPA 3ZHVA 2P9QA 1KPIA 5AUOB 1FDTA 1IFXA 4LY9A 3LUDA 1U2GA 2R7NA 2WR8A 1UWCA 1R74A 2DT8A 2X1MA 2XOKA 1ULZA 3CBQA 3EGDA 2IYLD 2ZJ6A 4OEHA 1KK2A 1RC8A 1NMSA 1JSZA 2YWJA 3IVRA 2YJ3A 4XVQA 1SCQA 4IIJF 3RUAA 1QVAA 4TXMA 3I0ZA 4BKQA 1Z12A 3U1BA 1JG1A 3DL7A 2DR2A 4Y6SA 3D6VA 2C94A 3ACDA 2IODA 2IYUA 3HKCB 3OMXA 2CLSA 3THXB 4C21A 5BUZA 3R77A 1QKJA 3JVIA 1KZ1A 2CLCX 1LLDA 3KQYA 2Q7DA 4F97A 1I8TA 1GARA 4YUVA 1U2TA 4BNFA 1XVLA 2XMPA 4Y18A 2F9LA 5HJ5A 3NX4A 4ZMRA 2O8FB 1NAIA 3MELA 1YGPA 2QTHA 1UWVA 1ZRSA 4Q9JA 4E88A 3EQ7A 2Q1XA 4H60A 4UTRA 2JGLA 2VK2A 1OWOA 3D54D 3N6XA 1G60A 4OXXA 2DULA 5EMHA 3EARA 5H70A 4CDRA 1H66A 3DDHA 5CLIA 5EHIA 4WZBB 1DAHA 1VDMA 2Y0EA 1ZHHA 1TO2E 4KWTA 2GBIA 1VLMA 2IXFA 4WY2A 2GD6A 3BXGA 3FIJA 4FSDA 3FCAA 3C6YA 3PXGA 2O59A 1JQJC 1EP9A 4CIWA 2F43B 2YHIB 5KJ1A 4NYMR 3CC8A 1KVUA 3D0KA 4Y1FA 5DW3A 2FW8A 1MAAA 1QFMA 2EWMA 2VBFA 3CF0A 2CKDA 1L7PA 3QE0A 4Y3UA 5AK6A 1Z88A 2J3DA 2XVAA 3IODA 1ZVMA 4JAVC 4XVUA 3ORSA 2PJRA 1SXHA 1JU4A 2OFWA 4PPFA 4QODA 3UGQA 4HS9A 1JBEA 3HKEA 1H2RS 3LFUA 4GXRA 5D86A 3O92A 1I7QB 2AN9A 1KKMA 4I4TA 5KOHB 3ZJ4A 5HIAA 2CN1A 4JBIA 4LHVA 3IBFA 4QEZA 3DEAA 1UK8A 1OMOA 1TUIA 5A4AA 3K70C 5CA1A 2RE8A 1SC3A 3LF2A 1XC7A 4LJLA 3AL2A 4IR7A 3JQ7B 4YLYA 4LF8B 2QLFA 5JUWA 2D1QA 5HCIA 4EEXA 4A6XA 1QLWA 3E3LA 4WNAB 3WGKA 3DP9A 2XYPA 3I45A 3QF7A 4P4NA 3Q9UA 3TR5A 3VR5A 3K2EA 1ZYUA 2D2IA 2C3OA 3AF0A 5H3CA 4Q4HA 4ND8A 3V8PA 2QP3A 4Y2UA 5C7OO 1XRPA 3RGGA 2PD4A 4D4LA 4RDXA 2P2YA 1PX2A 1RACA 5TVGA 3AB8A 1KRWA 5LKAA 2BFMA 2HIAA 3DYBA 3H99A 1W94A 3IOBA 2VZ9A 4OHPA 1WP4A 2B34A 2NO4A 1QGOA 3HSKA 1O87A 4TQAA 2VT6A 1NU8A 3Q8LA 3A4IA 4LN1A 5BOSB 2XE6A 2JK0A 3KLMX 5LQSA 5CCXA 2II6A 5IZ4A 3WXMA 4E6EA 1UF9A 2CCKA 2JLQA 4MS3B 1QIFA 4XWTA 3CUEF 3AQ4A 1CCWA 4YDQA 3QU2A 3KL4A 1MD9A 2HF2A 3AUTA 3CKYA 4PVDA 4EHKA 3OC6A 4QUBA 1PZGA 4E5DA 2PWZA 1V0JA 1KVRA 4FN4A 4YDRA 4IOKA 4IDGA 3HGQA 3TIGA 1DX9A 3TIXB 1X7GA 3LHDA 3PXEA 3EVTA 3I01M 1ISPA 2XCOA 1RPAA 2ETXA 3R3XA 2C82A 4H35A 4MIEA 5T6MA 1EFHA 1NSTA 5JHHB 5AM5A 3HU3A 3QBEA 4RC9A 4C0AC 1F4PA 1NW3A 1OZAA 2W37A 4IXTA 2QMHA 1HYBA 1ONOA 3EAQA 1I4TD 3F90A 1WMSA 1EFUA 2ONJA 5IULC 5KVQA 1E7MA 2HCFA 2XEXA 3PUIA 5F2EA 2NXWA 1KI6A 1T8RA 4G4SO 4EJSC 5BSEA 4E4YA 1HKUA 2E0IA 3PL1A 4KIGA 3W8DA 4W1RA 3I6ZA 2JJ2A 2CT8A 2XYHA 3UJDA 1B76A 1JYFA 4XDZA 2O8DB 4QPNA 2XWBF 4QUIA 4IFBA 3HYNA 2B2CA 3JS5A 4G5HA 5LDGA 1T2AA 1UZLA 1MC8A 1U9CA 2IY8A 4O5AA 3AY6A 2GNPA 2VTKA 2WWHA 3QLJA 4FR2A 2AXQA 3OZGA 3ZCVA 3H17A 4M0FA 1O5TA 3NJ8A 1MABA 1C1DA 3NRCA 1TMKA 2G0TA 2VG8A 3HVIA 3QXSA 4MVJG 5LXTF 4KK3A 1G9XA 1DJOA 3QPBA 2W6QA 4FM9A 4LRWA 1EWKA 3UOAB 4QLBA 5KVAA 2P8JA 2IYWA 3T7TA 3IE2A 3EDMA 2VPWA 3NDRA 1G98A 3FVWA 5GOZA 1E1QD 1DCTA 2IYZA 4DR1B 1NXTA 2WZQA 4P9NA 3N7TA 3TW8A 4GKJB 2XZOA 4IVQA 4DREA 4ZTUB 3B9BA 3RE1A 2BGRA 2J7PA 4F1JA 1SZPA 4B75A 3M3HA 2OLKA 2DM6A 4WEQA 1FS4A 1WV1A 4W5RA 1RM5A 3H04A 1ADGA 2OO5C 3IUYA 3N8NA 3IVXA 3OZ7A 3WZMA 4GPBA 5BXQC 5H68A 6ADHA 4GDFA 4NVRA 5F51A 1PR0A 1LS6A 3G5MA 3VR6H 2NTYC 3VR4D 3RU2A 4WHMA 4IIJB 1MW8X 3DONA 3NTQA 2X6TA 3HRHA 5BN5A 1V25A 3GVHA 1RP7A 4PAOA 2OHJA 2PBRA 3FB4A 3VBCA 1NVUQ 3HKDA 2UZAA 2A92A 5J59A 3FFWA 4FOLA 4CIBA 3ITDA 3FUCA 4L0QA 3RQIA 2CEKA 4XCVA 2PGXA 5IYZA 3PEVA 3QEJA 2E21A 2FKAA 2FOLA 1MV8A 3ANSA 5T67A 2ZR0A 4I99A 1SA0A 2XNDA 4DRXB 4EFDA 1SKMA 3JW8A 1XRSB 1E6UA 2Q9UA 3ACBA 4ZVNA 4ZHQB 2WAMA 1I2MA 1OLUA 1ZL2A 4Q3EA 3HGTA 2FI1A 3ESBA 3LNCA 3FTNA 4G1BA 2FGJA 2XDQB 4GX1A 3NC0C 5EZSA 1G20B 5IYZB 2AFHE 2ZVQX 4JR0A 4ISCA 1Y7IA 2ACKA 2E4AA 2HQRA 2JNWA 3NV9A 4G8CA 5LVAA 2VN8A 2OAP1 1VJ0A 3EVDA 3DMRA 3GJSA 2PH1A 4PZEA 4LXIA 1BS9A 4EJ2A 5IDQA 2MYNA 5KJ6A 3DJFA 5DYGA 4Y2RA 4DNQA 1FU8A 3GDGA 4JOSA 2I91A 2PXHA 3H5OA 2FK8A 1GCOA 3RBVA 4IDBA 2I55A 3DCNA 1DWPA 1UC4B 1KI2A 3EZNA 3R3JA 4IMIB 1YUMA 4D8UA 4DIUA 1V1RA 1VI5A 1LY1A 1O58A 2WWVD 1NLUA 4AN4A 1PWXA 2P9TA 4JEMA 1A9XB 8MHTA 2W2OA 4F4DA 4DV6B 2CV2A 1ZDMA 1YKGA 2OCYC 1TJPB 3IT3A 3KLPX 1WLSA 4RDIA 1UAGA 4AN1A 4BN4A 1AQNA 4YI5A 2XYVA 1ZW1A 3SM3A 2E4YA 4IINA 4GOKA 1T9HA 2UZ1B 3QY9A 3W4JA 2QROA 3WBBA 2W2NA 3KSAC 1FRVA 2IJGX 4JJ7A 2CVZA 1WCIB 1JG2A 3I92A 5AI0A 3R09A 1BCRB 4A8TA 2W2QA 1F3OA 4MV6A 4YYEA 2C8JA 2O7VA 3KPUA 1BJKA 3ZQ4A 3NHYA 2H54A 4KXWA 1AMNA 1P80A 3NIDB 4ZI7B 4KIFA 2ZYAA 4KODA 4Q21A 4V0RA 2GM5A 4M49A 5EHXA 1FB5A 2BONA 1YS2X 4ER7A 2FJPA 3BSFA 4ENUA 3L8YA 5GONF 3A1TA 4HT3B 1CQJB 5BORA 1HDEA 1MNQA 2D5IA 4WLEA 5E7MA 2FF7A 3MTAA 1TVCA 1N1EA 3UJ7A 1LA2A 1SQ6A 5IC6A 5IBCA 3FVQA 1AM4D 2A9QA 4M1ZA 3TTTA 3UAXA 2BMFA 1D5CA 3AF3A 4DMLA 3C7KA 3R7WB 3GCGA 1Q0HA 2H2IA 2PM8A 4DWWA 4EPVA 4BJ3A 4RD2A 1NATA 2QWXA 3B2EA 1RR6A 4V1CB 3WQBA 4U2DA 1EFRD 3AINA 1RWVA 3OY7A 4OGFA 3UV3A 1H6CA 4FCVA 1EJ0A 2VR1A 1ACJA 3BKXA 2Q0XA 1IBLB 3A25A 3ZDQA 5B12A 3G0BA 1I6MA 1IULA 2WQ6A 5I8PA 1AZSC 3BILA 3ADCA 1A8QA 1C2TA 4MV1A 1YXMA 3KR1A 2DSNA 3BYZA 1OW3B 4KFTA 5CDHA 2HJGA 5KVCA 1YIDA 5B3AA 5EMKA 5U1PA 4PZDA 4Q9NA 2F67A 4UE2A 4Z4HA 3BWEA 3ZLTA 1KJ9A 4YV1A 1EFRA 2H1RA 3PR3A 1HV8A 3IV6A 4ZPXA 1Z2DA 4AJIA 3ZWBA 2XJ9A 1WTCA 2E1RA 3S7ZA 3BMOA 3HZRA 1TL7C 1PJAA 3G8BA 3QU7A 4QXPA 1SQGA 1BH2A 1EM8B 2J09A 4JOBA 4TLDA 4XUDA 1AH2A 4FZ5A 3GP8A 4G6ZA 1AKTA 1A9ZA 5ALWA 3LP6A 4M88A 2QJRA 3BL5A 3DZGA 3O4RA 1IQ0A 3L2OB 4KZPA 5DLEA 3W7AA 4ZYVA 1NBMD 3E7FA 1LPPA 1A5ZA 1E6KA 3ROEA 2ZBDA 2CJXA 2WSBA 3H8SA 3IMFA 4RVGA 4CNQA 4MV7A 3EJWA 3D5EA 4MV0A 1G7RA 4Q3DA 2YIVX 4U2BA 2JFXA 4DLAA 1B6GA 5AK5A 5FR1A 1C3VA 5FL3A 4OHKA 1B7GO 2DUJA 5BQ3A 1XQ9A 1TKBA <