4ZOYA

Crystal structure of the chaetomium thermophilum sqt1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
487
structure length
406
Chain Sequence
ENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISAATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDANPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAGSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sqt1
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Chaperone
total genus 106
structure length 406
sequence length 487
ec nomenclature
pdb deposition date 2015-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zoyA00
3EG6A 5IJ7E 4ZOZA 5TEEA 2B5MA 2AQ5A 5GXHA 2HYEA 2IUQA 4PXWA 3CFVA 3HFQA 4O3UB 2PM7B 5FQDA 3I7NA 4O45A 1FWXA 3OTTA 2YNPA 3IKOA 3KRWB 4CI3A 3UKUC 3SBPA 2Z2NA 3I7HA 3OL2A 5SXMA 1ERJA 3IJ1A 4GQBB 3RFHA 1MG2A 3AL8A 4CY1A 4FA4D 3PSLA 4J82A 2B5LA 5B4WA 1TBGA 3I8CA 4PBZA 4ZN4A 5EALA 5K19A 3GFCA 2H68A 3SVWD 3GREA 5TF2A 5EMJB 4J81A 3V5WB 1PGUA 5EMLB 3BG0A 4GM9A 4ZOVA 4ZOYA 4JT5C 3PXWD 4J8GA 4GQ1A 4HDJA 1SQJA 2P9SC 4QT8A 2UZYB 4IA9A 2EBSA 4PNKB 2Z2OA 3UVLA 4A0BA 1K32A 2P9KC 5HE0B 2H6QA 4X63B 3EU7A 2TRCB 4E5ZB 1N6EA 5GMKn 1JOFA 2YB8B 5EAMA 3OKTA 5IC7A 2HKRA 1NR0A 4ES0A 4O1QD 3IIWA 5CXCB 2J56H 4A0AB 4CY2A 3JRPA 5IJ8E 3B7FA 5K1CC 1XHMA 4J0XA 1B9XA 2BCJB 4BH6A 3EI4B 5HE1B 3SN6B 4CY5A 3SBRA 4A11B 5C9ZB 2AH1A 5AFU3 2CNXA 3RN1D 4X61B 5TDHB 3RFGA 5FKQA 2CE9A 2PM9A 4A09B 3I7KA 1QNIA 4JSNC 4CZVA 3JZGA 5TEFA 3F3FA 5EM2A 2OVQB 4D0KA 4GZ8A 3AH8B 5A2Qg 2MTAH 4A2LA 4ERQA 5I5JA 3V9FA 1R5MA 5CXBA 1SQ9A 3MKSB 1TYQC 1P22A 3FGBA 1JMXB 5GXIA 5IGOA 3I8EA 3V7DB 4J78A 4U7AA 1OMWB 3OKYB 2O9KA 5H17A 1JMZB 4G56B 2P9IC 2I0SA 2BBKH 3EI3B 1L0QA 3ORVD 3EI2A 2AGZA 4J87A 3DWLC 4E54A 2AGLA 2XU7A 2H9MA 5I5MA 3JB9L 4CY3A 3PVUB 2XYIA 3OKWA 3KRXB 5GSAA 3DXKC 3N0EA 5IT9g 1U2VC 4PSXB 3OW8A 4EWRA 4FWWA 2QXVA 4CZXA 1N6DA 1PI6A 3MXXA 2I3SA 2I3TA 2IURA 4O3TB 4FB1D 4AEZA 3J81g 3EWEA 3DM0A 3EMHA 3E0CA 1GOTB 4E5ZA 2W18A 2AH0A 4LGNA 4XEIC 3SFZA 3AFCA 4R7AB 2P9LC 2Q7QA 4ERZA 2H14A 3C9CA 4J79A 3OL2B 4XYHA 2QC5A 3UKRC 1JJUB 3FRXA 4CI8A 3AL8B 3RN0D 2OK6A 3PSCB 4JSVC 5FKTA 5HE3B 2H9LA 3RSEC 4AOWA 1B9YA 1GG2B 4PSWB 5CYKA 4A08A 3RLMD 4PBYA 3ODTA 2H47A 4CZYA 3IJCA 3NVQA 3U4YA 2I0RA 1MG3A 4PC0A 3SWSD 3MZLA 3J80g 3CFSB 2UZXB 1OLZA 2OVPB 4A0BB 4JSXC 1Q47A 4D6VA 2GNQA 5HQGA 3L4OD 4CI2A 4A2MA 1XIPA 4A7JA 5EARA 2H6NA 5AMSA 1MDAH 2GC7A 5I5IA 4ERYA 3DXMC 3EI1A 4FA9D 2CO0A 2J57G 4IMMA 4BUJC 3I2NA 2H13A 3L4MD 4GGDA 4JD2C 4K3JB 5AJAA 2AGWA 3C75H 5EAPA 4H5JA 4CC9A 4N14A 5THAA 3PE7A 4LG8A 4KFMB 3SHFA 3SBQA 5HE2B 5C2VB 2IAAA 3JZNA 4L1QD 5HYNB 2PM9B 3UR4A 2P9PC 2P9UC 3SMRA 4O9DA 4JSPC 5FKRA 2HJBA 3SCYA 5EM2B 3PVWB 4CI1A 4J8BA 3BG1A 2CN3A 2HJ4A 5H1MA 4ESGA 4Y5RD 2PM6B 4MK0B 5CXBB 3UVKA 5EMKB 3W15A 3ULEC 4K3ID 3ZWLB 3UVNA 3PXTD 4QQEA 1U4CA 3JROA 3VH0A 2B4EA 2HESX 2YBAA 3IIYA 1XKSA 3P4FA 3PXSD 3C99A 2OJYA 4XYIA 4QL1A 2AGXA 3BWSA 3FM0A 3JPXA 2HXCA 3EI2B 2CE8A 4GGAA 5FLXg 1SHYB 2IWFA 1A0RB 3MKQA 4LG9A 4E54B 2YMUA 2H6KA 4U1EI 4J73A 3SLED 4X3EA 1RI6A 3MZKA 2YNNA 5H14A 5CXCA 4H5IA 4A0AA 3F3PA 5FXYA 1N6FA 3UVMA 1GXRA 3K27A 4FAND 5JWZA 2G99A 4GGCA 1S4UX 3UVOA 2B5NA 2OIZA 5IGQA 3SXTD 3EI4A 3RRMC 1NEXB 4TZ4A 2YNOA 2I0TA 4I79A 4OWRA 4A11A 4BL0A 4JT6C 2Z2PA 4UI9R 2OVRB 4OZUA 2IWKA 4A09A 4FA5D 1GP2B 3I89A 3JZHA 4L3GD 5EMMB 4Z8LA 4GM3A 4FA1D 4ZOXA 2HKMA 3F3GA 3NVXA 1PEVA 2H3XA 3CIKB 1K8KC 2CN2A 4QRJA 2AGYA 1VYHC 5FKSA 3NVNA 4L9OA 3K26A 3AL9A 3I7LA 1YFQA 4GQ2P 3C5MA 4L3HD 4NSXA 2H9NA 2PBIB 2P9NC 4FHLA 5CYKB 4A08B 3OKYA 2IUVA 4J0WA 4YVDA 1PBYB 3RMZD 2G9AA 2XL3A 3EI3A 4X60B 4J77A 3JAMg 2CO0C 2GC4A 2OK4A 4GMBA 3I7PA 4JXMA 3VA6A 3MMYA 5FA5B 3N0DA 2J55H 3A0FA 5KDOB 4GM8A 2H9PA 3IJ0A 4J84A 3DSMA 4J86A 3I7OA 5C2WB 4FAVD 3EI1B 2XL2A 2IUPA 3VGZA 4Y7RA 3SJLD
chains in the Genus database with same CATH superfamily
3EG6A 5IJ7E 4ZOZA 5TEEA 2B5MA 2AQ5A 1E8MA 5GXHA 2HYEA 2IUQA 3GD1I 4PXWA 3CFVA 3HFQA 4G55A 1K3IA 4O3UB 2PM7B 5FQDA 3IVMA 3VI4A 1QFSA 3I7NA 4O45A 1FWXA 3OTTA 2YNPA 3IKOA 3KRWB 3QI0A 4CI3A 3UKUC 3SBPA 2Z2NA 3I7HA 3OL2A 2VDOA 5SXMA 1ERJA 3IJ1A 4GQBB 3RFHA 1U8CA 1MG2A 4WK2A 3AL8A 4CY1A 3T3MA 4FA4D 3PSLA 4J82A 2B5LA 2XZGA 5B4WA 1TBGA 3I8CA 4PBZA 4ZN4A 5EALA 5K19A 3GFCA 2H68A 3SVWD 3GREA 5TF2A 5EMJB 4J81A 3V5WB 3KCIA 1PGUA 4BCDA 5C86A 5EMLB 3BG0A 4GM9A 4ZOVA 4ZOYA 4JT5C 3PXWD 3ZDYA 4J8GA 4BP8A 4GQ1A 4HDJA 1SQJA 2P9SC 4QT8A 2UZYB 4IA9A 2EBSA 4MMYA 4PNKB 2Z2OA 3UVLA 2VC2A 4A0BA 1K32A 2P9KC 2VDNA 5HE0B 2H6QA 4X63B 4MMZA 3EU7A 3NIFA 2TRCB 4E5ZB 1UOOA 1N6EA 5M5TA 5GMKn 1JOFA 2YB8B 5EAMA 3OKTA 1VZ3A 2HKRA 4UM8A 5IC7A 1NR0A 4ES0A 4O1QD 3IIWA 5CXCB 1O6FA 2J56H 3IUMA 4A0AB 4CY2A 3JRPA 5IJ8E 3O4IA 3B7FA 2JKXA 5K1CC 1M1XA 1XHMA 4J0XA 3EQ9A 1B9XA 2BCJB 4BH6A 1GOGA 2EICA 3EI4B 5HE1B 3SN6B 4CY5A 4DNVA 3SBRA 4A11B 5C9ZB 4JHPC 2VDMA 2AH1A 5AFU3 5M5UA 2CNXA 3RN1D 4X61B 3IURA 5TDHB 3RFGA 5FKQA 2CE9A 2PM9A 3ZE2A 4A09B 3EQ8A 3I7KA 4BCCA 1QNIA 4JSNC 4CZVA 3JZGA 5TEFA 3F3FA 2HU7A 4WK4A 5EM2A 2OVQB 1VE7A 4D0KA 4Z7OA 4GZ8A 4JHNA 2XE4A 3AH8B 3V4PA 5A2Qg 2MTAH 4A2LA 4ERQA 5I5JA 3V9FA 1R5MA 5CXBA 1SQ9A 3MKSB 5C92A 1TYQC 1P22A 2QZPA 5M5SA 1H2XA 3FGBA 1JMXB 1H2WA 5GXIA 5IGOA 4AMZA 3DDUA 1UOPA 3I8EA 3V7DB 4J78A 4U7AA 3V4VA 1OMWB 3VI3A 3OKYB 2O9KA 5H17A 1JMZB 4G56B 2P9IC 5M5RA 2I0SA 2BBKH 3EI3B 1L0QA 4AN0A 3ORVD 3EI2A 2AGZA 1A12A 4J87A 3DWLC 2BKLA 4O2WA 3FCSA 4E54A 2AGLA 2XU7A 2H9MA 5E6RA 5I5MA 3JB9L 4CY3A 3K6SA 3PVUB 2XYIA 3OKWA 3KRXB 5GSAA 1E8NA 3DXKC 3O4GA 4DNUA 3N0EA 5IT9g 1U2VC 4PSXB 3OW8A 4EWRA 4FWWA 2QXVA 4CZXA 1N6DA 1PI6A 1O6GA 3MXXA 2I3SA 2I3TA 4QAMA 2IURA 4O3TB 4FB1D 4AEZA 4NBMA 3K71A 3FCUA 3J81g 3EWEA 4NENA 3DM0A 1JTDB 1I2MB 3EMHA 3E0CA 1GOTB 4E5ZA 2W18A 2AH0A 4LGNA 4XEIC 3SFZA 3AFCA 4R7AB 2P9LC 2Q7QA 4BCBA 4ERZA 2H14A 3C9CA 4J79A 3OL2B 4XYHA 2QC5A 3UKRC 2VDLA 1JJUB 3FRXA 1H2ZA 4CI8A 3AL8B 3RN0D 4Z7QA 2OK6A 3PSCB 4JSVC 5FKTA 4BP9A 5HE3B 2WQ8A 4G1MA 2H9LA 3RSEC 4AOWA 1B9YA 1GG2B 4PSWB 5CYKA 4A08A 3RLMD 4PBYA 3ODTA 4WJKA 2H47A 4CZYA 3IJCA 3IULA 1C9LA 3NVQA 3MUNA 4Z7NA 1BPOA 3U4YA 2I0RA 2EIDA 1MG3A 4PC0A 3SWSD 4DNWA 2HU8A 3MZLA 3J80g 4IRZA 3CFSB 2XDWA 2UZXB 4RE5A 1OLZA 3MVDK 2OVPB 4A0BB 4JSXC 1Q47A 4D6VA 2GNQA 5HQGA 3L4OD 3IJEA 4CI2A 3IUJA 3NIGA 4A2MA 1XIPA 4A7JA 5EARA 1GOHA 2H6NA 5AMSA 1MDAH 2GC7A 2EIEA 5I5IA 4ERYA 3DXMC 3EI1A 4FA9D 4G1EA 1E5TA 2CO0A 2J57G 4IMMA 4BUJC 2VDKA 3I2NA 2H13A 3L4MD 4GGDA 4JD2C 4K3JB 5AJAA 5E6UA 4AX4A 2AGWA 3C75H 5EAPA 4H5JA 4CC9A 4N14A 5THAA 3PE7A 4KFMB 4LG8A 3SHFA 3SBQA 5HE2B 1UOQA 5C2VB 2IAAA 3JZNA 4L1QD 5HYNB 2PM9B 4NC4A 3UR4A 2P9PC 2P9UC 3SMRA 4O9DA 4JSPC 5FKRA 2HJBA 2HU5A 3SCYA 5EM2B 3PVWB 4CI1A 4J8BA 3BG1A 2CN3A 2HJ4A 5H1MA 4ESGA 4Y5RD 2PM6B 4MK0B 5CXBB 3UVKA 3ZE1A 5EMKB 4NAAA 3W15A 3ULEC 4K3ID 1L5GA 3ZWLB 3UVNA 3PXTD 5M61A 2EIBA 4QQEA 4RE6A 1U4CA 4AN1A 3O4JA 3JROA 3VH0A 2B4EA 2HESX 5FFGA 2YBAA 3K72A 1C9IA 3IIYA 1XKSA 3P4FA 3PXSD 3C99A 2OJYA 4XYIA 4QL1A 2AGXA 3OF7A 3BWSA 3FM0A 3JPXA 2HXCA 3EI2B 2CE8A 1TYEA 2VZ3A 4GGAA 2VDPA 5FLXg 3T3PA 1SHYB 2IWFA 1A0RB 3IUNA 3MKQA 4LG9A 4E54B 2YMUA 2H6KA 4U1EI 4J73A 3SLED 1T2XA 4X3EA 1RI6A 3MZKA 4L1MA 2YNNA 4MMXA 5H14A 5CXCA 4H5IA 2VZ1A 4A0AA 1VE6A 3F3PA 5FXYA 3NIDA 1N6FA 3UVMA 1GXRA 3K27A 4FAND 5JWZA 2G99A 1GOFA 4GGCA 1S4UX 3UVOA 1QFMA 2B5NA 2OIZA 5IGQA 3SXTD 3EI4A 3RRMC 1NEXB 1YR2A 4TZ4A 2YNOA 2I0TA 4I79A 4OWRA 4A11A 4BL0A 4JT6C 3ZDXA 2Z2PA 3O4HA 4UI9R 2OVRB 4OZUA 2IWKA 2VDRA 4O02A 4A09A 4FA5D 1GP2B 3I89A 3JZHA 4L3GD 5EMMB 4Z8LA 5HDBA 4GM3A 4FA1D 4ZOXA 2HKMA 1JV2A 3F3GA 3ZDZA 3NVXA 1PEVA 2H3XA 3CIKB 1K8KC 2CN2A 4QRJA 2AGYA 4UM9A 1VYHC 2VDQA 4D9SA 5FKSA 3NVNA 4WK0A 4L9OA 3K26A 3AL9A 3I7LA 1YFQA 4GQ2P 5E6SA 3C5MA 4L3HD 4NSXA 2H9NA 2PBIB 2P9NC 4FHLA 5CYKB 4A08B 3OKYA 3IUQA 2IUVA 4J0WA 4YVDA 1PBYB 3EQ7A 3RMZD 2G9AA 2XL3A 3EI3A 4X60B 1UTCA 4J77A 3JAMg 5FFOA 2CO0C 2GC4A 1H2YA 2OK4A 4GMBA 3I7PA 4JXMA 3GC3B 4AMYA 3VA6A 3MMYA 5FA5B 3N0DA 2J55H 3A0FA 5KDOB 3ZE0A 2QR5A 4GM8A 2H9PA 3IJ0A 3QHYB 4J84A 3DSMA 4J86A 3I7OA 5C2WB 5M5VA 4FAVD 3EI1B 2XL2A 1VZ2A 2IUPA 3VGZA 4Y7RA 3SJLD 3MUOA
chains in the Genus database with same CATH topology
3EG6A 5IJ7E 4ZOZA 5TEEA 2B5MA 2AQ5A 5GXHA 2HYEA 2IUQA 4PXWA 3CFVA 3HFQA 4O3UB 2PM7B 5FQDA 3I7NA 4O45A 1FWXA 3OTTA 2YNPA 3IKOA 3KRWB 4CI3A 3UKUC 3SBPA 2Z2NA 3I7HA 3OL2A 5SXMA 1ERJA 3IJ1A 4GQBB 3RFHA 1MG2A 3AL8A 4CY1A 4FA4D 3PSLA 4J82A 2B5LA 5B4WA 1TBGA 3I8CA 4PBZA 4ZN4A 5EALA 5K19A 3GFCA 2H68A 3SVWD 3GREA 5TF2A 5EMJB 4J81A 3V5WB 1PGUA 5EMLB 3BG0A 4GM9A 4ZOVA 4ZOYA 4JT5C 3PXWD 4J8GA 4GQ1A 4HDJA 1SQJA 2P9SC 4QT8A 2UZYB 4IA9A 2EBSA 4PNKB 2Z2OA 3UVLA 4A0BA 1K32A 2P9KC 5HE0B 2H6QA 4X63B 3EU7A 2TRCB 4E5ZB 1N6EA 5GMKn 1JOFA 2YB8B 5EAMA 3OKTA 5IC7A 2HKRA 1NR0A 4ES0A 4O1QD 3IIWA 5CXCB 2J56H 4A0AB 4CY2A 3JRPA 5IJ8E 3B7FA 5K1CC 1XHMA 4J0XA 1B9XA 2BCJB 4BH6A 3EI4B 5HE1B 3SN6B 4CY5A 3SBRA 4A11B 5C9ZB 2AH1A 5AFU3 2CNXA 3RN1D 4X61B 5TDHB 3RFGA 5FKQA 2CE9A 2PM9A 4A09B 3I7KA 1QNIA 4JSNC 4CZVA 3JZGA 5TEFA 3F3FA 5EM2A 2OVQB 4D0KA 4GZ8A 3AH8B 5A2Qg 2MTAH 4A2LA 4ERQA 5I5JA 3V9FA 1R5MA 5CXBA 1SQ9A 3MKSB 1TYQC 1P22A 3FGBA 1JMXB 5GXIA 5IGOA 3I8EA 3V7DB 4J78A 4U7AA 1OMWB 3OKYB 2O9KA 5H17A 1JMZB 4G56B 2P9IC 2I0SA 2BBKH 3EI3B 1L0QA 3ORVD 3EI2A 2AGZA 4J87A 3DWLC 4E54A 2AGLA 2XU7A 2H9MA 5I5MA 3JB9L 4CY3A 3PVUB 2XYIA 3OKWA 3KRXB 5GSAA 3DXKC 3N0EA 5IT9g 1U2VC 4PSXB 3OW8A 4EWRA 4FWWA 2QXVA 4CZXA 1N6DA 1PI6A 3MXXA 2I3SA 2I3TA 2IURA 4O3TB 4FB1D 4AEZA 3J81g 3EWEA 3DM0A 3EMHA 3E0CA 1GOTB 4E5ZA 2W18A 2AH0A 4LGNA 4XEIC 3SFZA 3AFCA 4R7AB 2P9LC 2Q7QA 4ERZA 2H14A 3C9CA 4J79A 3OL2B 4XYHA 2QC5A 3UKRC 1JJUB 3FRXA 4CI8A 3AL8B 3RN0D 2OK6A 3PSCB 4JSVC 5FKTA 5HE3B 2H9LA 3RSEC 4AOWA 1B9YA 1GG2B 4PSWB 5CYKA 4A08A 3RLMD 4PBYA 3ODTA 2H47A 4CZYA 3IJCA 3NVQA 3U4YA 2I0RA 1MG3A 4PC0A 3SWSD 3MZLA 3J80g 3CFSB 2UZXB 1OLZA 2OVPB 4A0BB 4JSXC 1Q47A 4D6VA 2GNQA 5HQGA 3L4OD 4CI2A 4A2MA 1XIPA 4A7JA 5EARA 2H6NA 5AMSA 1MDAH 2GC7A 5I5IA 4ERYA 3DXMC 3EI1A 4FA9D 2CO0A 2J57G 4IMMA 4BUJC 3I2NA 2H13A 3L4MD 4GGDA 4JD2C 4K3JB 5AJAA 2AGWA 3C75H 5EAPA 4H5JA 4CC9A 4N14A 5THAA 3PE7A 4LG8A 4KFMB 3SHFA 3SBQA 5HE2B 5C2VB 2IAAA 3JZNA 4L1QD 5HYNB 2PM9B 3UR4A 2P9PC 2P9UC 3SMRA 4O9DA 4JSPC 5FKRA 2HJBA 3SCYA 5EM2B 3PVWB 4CI1A 4J8BA 3BG1A 2CN3A 2HJ4A 5H1MA 4ESGA 4Y5RD 2PM6B 4MK0B 5CXBB 3UVKA 5EMKB 3W15A 3ULEC 4K3ID 3ZWLB 3UVNA 3PXTD 4QQEA 1U4CA 3JROA 3VH0A 2B4EA 2HESX 2YBAA 3IIYA 1XKSA 3P4FA 3PXSD 3C99A 2OJYA 4XYIA 4QL1A 2AGXA 3BWSA 3FM0A 3JPXA 2HXCA 3EI2B 2CE8A 4GGAA 5FLXg 1SHYB 2IWFA 1A0RB 3MKQA 4LG9A 4E54B 2YMUA 2H6KA 4U1EI 4J73A 3SLED 4X3EA 1RI6A 3MZKA 2YNNA 5H14A 5CXCA 4H5IA 4A0AA 3F3PA 5FXYA 1N6FA 3UVMA 1GXRA 3K27A 4FAND 5JWZA 2G99A 4GGCA 1S4UX 3UVOA 2B5NA 2OIZA 5IGQA 3SXTD 3EI4A 3RRMC 1NEXB 4TZ4A 2YNOA 2I0TA 4I79A 4OWRA 4A11A 4BL0A 4JT6C 2Z2PA 4UI9R 2OVRB 4OZUA 2IWKA 4A09A 4FA5D 1GP2B 3I89A 3JZHA 4L3GD 5EMMB 4Z8LA 4GM3A 4FA1D 4ZOXA 2HKMA 3F3GA 3NVXA 1PEVA 2H3XA 3CIKB 1K8KC 2CN2A 4QRJA 2AGYA 1VYHC 5FKSA 3NVNA 4L9OA 3K26A 3AL9A 3I7LA 1YFQA 4GQ2P 3C5MA 4L3HD 4NSXA 2H9NA 2PBIB 2P9NC 4FHLA 5CYKB 4A08B 3OKYA 2IUVA 4J0WA 4YVDA 1PBYB 3RMZD 2G9AA 2XL3A 3EI3A 4X60B 4J77A 3JAMg 2CO0C 2GC4A 2OK4A 4GMBA 3I7PA 4JXMA 3VA6A 3MMYA 5FA5B 3N0DA 2J55H 3A0FA 5KDOB 4GM8A 2H9PA 3IJ0A 4J84A 3DSMA 4J86A 3I7OA 5C2WB 4FAVD 3EI1B 2XL2A 2IUPA 3VGZA 4Y7RA 3SJLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG6 A;  5IJ7 E;  4ZOZ A;  5TEE A;  2B5M A;  2AQ5 A;  5GXH A;  2HYE A;  2IUQ A;  4PXW A;  3CFV A;  3HFQ A;  4O3U B;  2PM7 B;  5FQD A;  3I7N A;  4O45 A;  1FWX A;  3OTT A;  2YNP A;  3IKO A;  3KRW B;  4CI3 A;  3UKU C;  3SBP A;  2Z2N A;  3I7H A;  3OL2 A;  5SXM A;  1ERJ A;  3IJ1 A;  4GQB B;  3RFH A;  1MG2 A;  3AL8 A;  4CY1 A;  4FA4 D;  3PSL A;  4J82 A;  2B5L A;  5B4W A;  1TBG A;  3I8C A;  4PBZ A;  4ZN4 A;  5EAL A;  5K19 A;  3GFC A;  2H68 A;  3SVW D;  3GRE A;  5TF2 A;  5EMJ B;  4J81 A;  3V5W B;  1PGU A;  5EML B;  3BG0 A;  4GM9 A;  4ZOV A;  4ZOY A;  4JT5 C;  3PXW D;  4J8G A;  4GQ1 A;  4HDJ A;  1SQJ A;  2P9S C;  4QT8 A;  2UZY B;  4IA9 A;  2EBS A;  4PNK B;  2Z2O A;  3UVL A;  4A0B A;  1K32 A;  2P9K C;  5HE0 B;  2H6Q A;  4X63 B;  3EU7 A;  2TRC B;  4E5Z B;  1N6E A;  5GMK n;  1JOF A;  2YB8 B;  5EAM A;  3OKT A;  5IC7 A;  2HKR A;  1NR0 A;  4ES0 A;  4O1Q D;  3IIW A;  5CXC B;  2J56 H;  4A0A B;  4CY2 A;  3JRP A;  5IJ8 E;  3B7F A;  5K1C C;  1XHM A;  4J0X A;  1B9X A;  2BCJ B;  4BH6 A;  3EI4 B;  5HE1 B;  3SN6 B;  4CY5 A;  3SBR A;  4A11 B;  5C9Z B;  2AH1 A;  5AFU 3;  2CNX A;  3RN1 D;  4X61 B;  5TDH B;  3RFG A;  5FKQ A;  2CE9 A;  2PM9 A;  4A09 B;  3I7K A;  1QNI A;  4JSN C;  4CZV A;  3JZG A;  5TEF A;  3F3F A;  5EM2 A;  2OVQ B;  4D0K A;  4GZ8 A;  3AH8 B;  5A2Q g;  2MTA H;  4A2L A;  4ERQ A;  5I5J A;  3V9F A;  1R5M A;  5CXB A;  1SQ9 A;  3MKS B;  1TYQ C;  1P22 A;  3FGB A;  1JMX B;  5GXI A;  5IGO A;  3I8E A;  3V7D B;  4J78 A;  4U7A A;  1OMW B;  3OKY B;  2O9K A;  5H17 A;  1JMZ B;  4G56 B;  2P9I C;  2I0S A;  2BBK H;  3EI3 B;  1L0Q A;  3ORV D;  3EI2 A;  2AGZ A;  4J87 A;  3DWL C;  4E54 A;  2AGL A;  2XU7 A;  2H9M A;  5I5M A;  3JB9 L;  4CY3 A;  3PVU B;  2XYI A;  3OKW A;  3KRX B;  5GSA A;  3DXK C;  3N0E A;  5IT9 g;  1U2V C;  4PSX B;  3OW8 A;  4EWR A;  4FWW A;  2QXV A;  4CZX A;  1N6D A;  1PI6 A;  3MXX A;  2I3S A;  2I3T A;  2IUR A;  4O3T B;  4FB1 D;  4AEZ A;  3J81 g;  3EWE A;  3DM0 A;  3EMH A;  3E0C A;  1GOT B;  4E5Z A;  2W18 A;  2AH0 A;  4LGN A;  4XEI C;  3SFZ A;  3AFC A;  4R7A B;  2P9L C;  2Q7Q A;  4ERZ A;  2H14 A;  3C9C A;  4J79 A;  3OL2 B;  4XYH A;  2QC5 A;  3UKR C;  1JJU B;  3FRX A;  4CI8 A;  3AL8 B;  3RN0 D;  2OK6 A;  3PSC B;  4JSV C;  5FKT A;  5HE3 B;  2H9L A;  3RSE C;  4AOW A;  1B9Y A;  1GG2 B;  4PSW B;  5CYK A;  4A08 A;  3RLM D;  4PBY A;  3ODT A;  2H47 A;  4CZY A;  3IJC A;  3NVQ A;  3U4Y A;  2I0R A;  1MG3 A;  4PC0 A;  3SWS D;  3MZL A;  3J80 g;  3CFS B;  2UZX B;  1OLZ A;  2OVP B;  4A0B B;  4JSX C;  1Q47 A;  4D6V A;  2GNQ A;  5HQG A;  3L4O D;  4CI2 A;  4A2M A;  1XIP A;  4A7J A;  5EAR A;  2H6N A;  5AMS A;  1MDA H;  2GC7 A;  5I5I A;  4ERY A;  3DXM C;  3EI1 A;  4FA9 D;  2CO0 A;  2J57 G;  4IMM A;  4BUJ C;  3I2N A;  2H13 A;  3L4M D;  4GGD A;  4JD2 C;  4K3J B;  5AJA A;  2AGW A;  3C75 H;  5EAP A;  4H5J A;  4CC9 A;  4N14 A;  5THA A;  3PE7 A;  4LG8 A;  4KFM B;  3SHF A;  3SBQ A;  5HE2 B;  5C2V B;  2IAA A;  3JZN A;  4L1Q D;  5HYN B;  2PM9 B;  3UR4 A;  2P9P C;  2P9U C;  3SMR A;  4O9D A;  4JSP C;  5FKR A;  2HJB A;  3SCY A;  5EM2 B;  3PVW B;  4CI1 A;  4J8B A;  3BG1 A;  2CN3 A;  2HJ4 A;  5H1M A;  4ESG A;  4Y5R D;  2PM6 B;  4MK0 B;  5CXB B;  3UVK A;  5EMK B;  3W15 A;  3ULE C;  4K3I D;  3ZWL B;  3UVN A;  3PXT D;  4QQE A;  1U4C A;  3JRO A;  3VH0 A;  2B4E A;  2HES X;  2YBA A;  3IIY A;  1XKS A;  3P4F A;  3PXS D;  3C99 A;  2OJY A;  4XYI A;  4QL1 A;  2AGX A;  3BWS A;  3FM0 A;  3JPX A;  2HXC A;  3EI2 B;  2CE8 A;  4GGA A;  5FLX g;  1SHY B;  2IWF A;  1A0R B;  3MKQ A;  4LG9 A;  4E54 B;  2YMU A;  2H6K A;  4U1E I;  4J73 A;  3SLE D;  4X3E A;  1RI6 A;  3MZK A;  2YNN A;  5H14 A;  5CXC A;  4H5I A;  4A0A A;  3F3P A;  5FXY A;  1N6F A;  3UVM A;  1GXR A;  3K27 A;  4FAN D;  5JWZ A;  2G99 A;  4GGC A;  1S4U X;  3UVO A;  2B5N A;  2OIZ A;  5IGQ A;  3SXT D;  3EI4 A;  3RRM C;  1NEX B;  4TZ4 A;  2YNO A;  2I0T A;  4I79 A;  4OWR A;  4A11 A;  4BL0 A;  4JT6 C;  2Z2P A;  4UI9 R;  2OVR B;  4OZU A;  2IWK A;  4A09 A;  4FA5 D;  1GP2 B;  3I89 A;  3JZH A;  4L3G D;  5EMM B;  4Z8L A;  4GM3 A;  4FA1 D;  4ZOX A;  2HKM A;  3F3G A;  3NVX A;  1PEV A;  2H3X A;  3CIK B;  1K8K C;  2CN2 A;  4QRJ A;  2AGY A;  1VYH C;  5FKS A;  3NVN A;  4L9O A;  3K26 A;  3AL9 A;  3I7L A;  1YFQ A;  4GQ2 P;  3C5M A;  4L3H D;  4NSX A;  2H9N A;  2PBI B;  2P9N C;  4FHL A;  5CYK B;  4A08 B;  3OKY A;  2IUV A;  4J0W A;  4YVD A;  1PBY B;  3RMZ D;  2G9A A;  2XL3 A;  3EI3 A;  4X60 B;  4J77 A;  3JAM g;  2CO0 C;  2GC4 A;  2OK4 A;  4GMB A;  3I7P A;  4JXM A;  3VA6 A;  3MMY A;  5FA5 B;  3N0D A;  2J55 H;  3A0F A;  5KDO B;  4GM8 A;  2H9P A;  3IJ0 A;  4J84 A;  3DSM A;  4J86 A;  3I7O A;  5C2W B;  4FAV D;  3EI1 B;  2XL2 A;  2IUP A;  3VGZ A;  4Y7R A;  3SJL D; 
#chains in the Genus database with same CATH topology
 3EG6 A;  5IJ7 E;  4ZOZ A;  5TEE A;  2B5M A;  2AQ5 A;  1E8M A;  5GXH A;  2HYE A;  2IUQ A;  3GD1 I;  4PXW A;  3CFV A;  3HFQ A;  4G55 A;  1K3I A;  4O3U B;  2PM7 B;  5FQD A;  3IVM A;  3VI4 A;  1QFS A;  3I7N A;  4O45 A;  1FWX A;  3OTT A;  2YNP A;  3IKO A;  3KRW B;  3QI0 A;  4CI3 A;  3UKU C;  3SBP A;  2Z2N A;  3I7H A;  3OL2 A;  2VDO A;  5SXM A;  1ERJ A;  3IJ1 A;  4GQB B;  3RFH A;  1U8C A;  1MG2 A;  4WK2 A;  3AL8 A;  4CY1 A;  3T3M A;  4FA4 D;  3PSL A;  4J82 A;  2B5L A;  2XZG A;  5B4W A;  1TBG A;  3I8C A;  4PBZ A;  4ZN4 A;  5EAL A;  5K19 A;  3GFC A;  2H68 A;  3SVW D;  3GRE A;  5TF2 A;  5EMJ B;  4J81 A;  3V5W B;  3KCI A;  1PGU A;  4BCD A;  5C86 A;  5EML B;  3BG0 A;  4GM9 A;  4ZOV A;  4ZOY A;  4JT5 C;  3PXW D;  3ZDY A;  4J8G A;  4BP8 A;  4GQ1 A;  4HDJ A;  1SQJ A;  2P9S C;  4QT8 A;  2UZY B;  4IA9 A;  2EBS A;  4MMY A;  4PNK B;  2Z2O A;  3UVL A;  2VC2 A;  4A0B A;  1K32 A;  2P9K C;  2VDN A;  5HE0 B;  2H6Q A;  4X63 B;  4MMZ A;  3EU7 A;  3NIF A;  2TRC B;  4E5Z B;  1UOO A;  1N6E A;  5M5T A;  5GMK n;  1JOF A;  2YB8 B;  5EAM A;  3OKT A;  1VZ3 A;  2HKR A;  4UM8 A;  5IC7 A;  1NR0 A;  4ES0 A;  4O1Q D;  3IIW A;  5CXC B;  1O6F A;  2J56 H;  3IUM A;  4A0A B;  4CY2 A;  3JRP A;  5IJ8 E;  3O4I A;  3B7F A;  2JKX A;  5K1C C;  1M1X A;  1XHM A;  4J0X A;  3EQ9 A;  1B9X A;  2BCJ B;  4BH6 A;  1GOG A;  2EIC A;  3EI4 B;  5HE1 B;  3SN6 B;  4CY5 A;  4DNV A;  3SBR A;  4A11 B;  5C9Z B;  4JHP C;  2VDM A;  2AH1 A;  5AFU 3;  5M5U A;  2CNX A;  3RN1 D;  4X61 B;  3IUR A;  5TDH B;  3RFG A;  5FKQ A;  2CE9 A;  2PM9 A;  3ZE2 A;  4A09 B;  3EQ8 A;  3I7K A;  4BCC A;  1QNI A;  4JSN C;  4CZV A;  3JZG A;  5TEF A;  3F3F A;  2HU7 A;  4WK4 A;  5EM2 A;  2OVQ B;  1VE7 A;  4D0K A;  4Z7O A;  4GZ8 A;  4JHN A;  2XE4 A;  3AH8 B;  3V4P A;  5A2Q g;  2MTA H;  4A2L A;  4ERQ A;  5I5J A;  3V9F A;  1R5M A;  5CXB A;  1SQ9 A;  3MKS B;  5C92 A;  1TYQ C;  1P22 A;  2QZP A;  5M5S A;  1H2X A;  3FGB A;  1JMX B;  1H2W A;  5GXI A;  5IGO A;  4AMZ A;  3DDU A;  1UOP A;  3I8E A;  3V7D B;  4J78 A;  4U7A A;  3V4V A;  1OMW B;  3VI3 A;  3OKY B;  2O9K A;  5H17 A;  1JMZ B;  4G56 B;  2P9I C;  5M5R A;  2I0S A;  2BBK H;  3EI3 B;  1L0Q A;  4AN0 A;  3ORV D;  3EI2 A;  2AGZ A;  1A12 A;  4J87 A;  3DWL C;  2BKL A;  4O2W A;  3FCS A;  4E54 A;  2AGL A;  2XU7 A;  2H9M A;  5E6R A;  5I5M A;  3JB9 L;  4CY3 A;  3K6S A;  3PVU B;  2XYI A;  3OKW A;  3KRX B;  5GSA A;  1E8N A;  3DXK C;  3O4G A;  4DNU A;  3N0E A;  5IT9 g;  1U2V C;  4PSX B;  3OW8 A;  4EWR A;  4FWW A;  2QXV A;  4CZX A;  1N6D A;  1PI6 A;  1O6G A;  3MXX A;  2I3S A;  2I3T A;  4QAM A;  2IUR A;  4O3T B;  4FB1 D;  4AEZ A;  4NBM A;  3K71 A;  3FCU A;  3J81 g;  3EWE A;  4NEN A;  3DM0 A;  1JTD B;  1I2M B;  3EMH A;  3E0C A;  1GOT B;  4E5Z A;  2W18 A;  2AH0 A;  4LGN A;  4XEI C;  3SFZ A;  3AFC A;  4R7A B;  2P9L C;  2Q7Q A;  4BCB A;  4ERZ A;  2H14 A;  3C9C A;  4J79 A;  3OL2 B;  4XYH A;  2QC5 A;  3UKR C;  2VDL A;  1JJU B;  3FRX A;  1H2Z A;  4CI8 A;  3AL8 B;  3RN0 D;  4Z7Q A;  2OK6 A;  3PSC B;  4JSV C;  5FKT A;  4BP9 A;  5HE3 B;  2WQ8 A;  4G1M A;  2H9L A;  3RSE C;  4AOW A;  1B9Y A;  1GG2 B;  4PSW B;  5CYK A;  4A08 A;  3RLM D;  4PBY A;  3ODT A;  4WJK A;  2H47 A;  4CZY A;  3IJC A;  3IUL A;  1C9L A;  3NVQ A;  3MUN A;  4Z7N A;  1BPO A;  3U4Y A;  2I0R A;  2EID A;  1MG3 A;  4PC0 A;  3SWS D;  4DNW A;  2HU8 A;  3MZL A;  3J80 g;  4IRZ A;  3CFS B;  2XDW A;  2UZX B;  4RE5 A;  1OLZ A;  3MVD K;  2OVP B;  4A0B B;  4JSX C;  1Q47 A;  4D6V A;  2GNQ A;  5HQG A;  3L4O D;  3IJE A;  4CI2 A;  3IUJ A;  3NIG A;  4A2M A;  1XIP A;  4A7J A;  5EAR A;  1GOH A;  2H6N A;  5AMS A;  1MDA H;  2GC7 A;  2EIE A;  5I5I A;  4ERY A;  3DXM C;  3EI1 A;  4FA9 D;  4G1E A;  1E5T A;  2CO0 A;  2J57 G;  4IMM A;  4BUJ C;  2VDK A;  3I2N A;  2H13 A;  3L4M D;  4GGD A;  4JD2 C;  4K3J B;  5AJA A;  5E6U A;  4AX4 A;  2AGW A;  3C75 H;  5EAP A;  4H5J A;  4CC9 A;  4N14 A;  5THA A;  3PE7 A;  4KFM B;  4LG8 A;  3SHF A;  3SBQ A;  5HE2 B;  1UOQ A;  5C2V B;  2IAA A;  3JZN A;  4L1Q D;  5HYN B;  2PM9 B;  4NC4 A;  3UR4 A;  2P9P C;  2P9U C;  3SMR A;  4O9D A;  4JSP C;  5FKR A;  2HJB A;  2HU5 A;  3SCY A;  5EM2 B;  3PVW B;  4CI1 A;  4J8B A;  3BG1 A;  2CN3 A;  2HJ4 A;  5H1M A;  4ESG A;  4Y5R D;  2PM6 B;  4MK0 B;  5CXB B;  3UVK A;  3ZE1 A;  5EMK B;  4NAA A;  3W15 A;  3ULE C;  4K3I D;  1L5G A;  3ZWL B;  3UVN A;  3PXT D;  5M61 A;  2EIB A;  4QQE A;  4RE6 A;  1U4C A;  4AN1 A;  3O4J A;  3JRO A;  3VH0 A;  2B4E A;  2HES X;  5FFG A;  2YBA A;  3K72 A;  1C9I A;  3IIY A;  1XKS A;  3P4F A;  3PXS D;  3C99 A;  2OJY A;  4XYI A;  4QL1 A;  2AGX A;  3OF7 A;  3BWS A;  3FM0 A;  3JPX A;  2HXC A;  3EI2 B;  2CE8 A;  1TYE A;  2VZ3 A;  4GGA A;  2VDP A;  5FLX g;  3T3P A;  1SHY B;  2IWF A;  1A0R B;  3IUN A;  3MKQ A;  4LG9 A;  4E54 B;  2YMU A;  2H6K A;  4U1E I;  4J73 A;  3SLE D;  1T2X A;  4X3E A;  1RI6 A;  3MZK A;  4L1M A;  2YNN A;  4MMX A;  5H14 A;  5CXC A;  4H5I A;  2VZ1 A;  4A0A A;  1VE6 A;  3F3P A;  5FXY A;  3NID A;  1N6F A;  3UVM A;  1GXR A;  3K27 A;  4FAN D;  5JWZ A;  2G99 A;  1GOF A;  4GGC A;  1S4U X;  3UVO A;  1QFM A;  2B5N A;  2OIZ A;  5IGQ A;  3SXT D;  3EI4 A;  3RRM C;  1NEX B;  1YR2 A;  4TZ4 A;  2YNO A;  2I0T A;  4I79 A;  4OWR A;  4A11 A;  4BL0 A;  4JT6 C;  3ZDX A;  2Z2P A;  3O4H A;  4UI9 R;  2OVR B;  4OZU A;  2IWK A;  2VDR A;  4O02 A;  4A09 A;  4FA5 D;  1GP2 B;  3I89 A;  3JZH A;  4L3G D;  5EMM B;  4Z8L A;  5HDB A;  4GM3 A;  4FA1 D;  4ZOX A;  2HKM A;  1JV2 A;  3F3G A;  3ZDZ A;  3NVX A;  1PEV A;  2H3X A;  3CIK B;  1K8K C;  2CN2 A;  4QRJ A;  2AGY A;  4UM9 A;  1VYH C;  2VDQ A;  4D9S A;  5FKS A;  3NVN A;  4WK0 A;  4L9O A;  3K26 A;  3AL9 A;  3I7L A;  1YFQ A;  4GQ2 P;  5E6S A;  3C5M A;  4L3H D;  4NSX A;  2H9N A;  2PBI B;  2P9N C;  4FHL A;  5CYK B;  4A08 B;  3OKY A;  3IUQ A;  2IUV A;  4J0W A;  4YVD A;  1PBY B;  3EQ7 A;  3RMZ D;  2G9A A;  2XL3 A;  3EI3 A;  4X60 B;  1UTC A;  4J77 A;  3JAM g;  5FFO A;  2CO0 C;  2GC4 A;  1H2Y A;  2OK4 A;  4GMB A;  3I7P A;  4JXM A;  3GC3 B;  4AMY A;  3VA6 A;  3MMY A;  5FA5 B;  3N0D A;  2J55 H;  3A0F A;  5KDO B;  3ZE0 A;  2QR5 A;  4GM8 A;  2H9P A;  3IJ0 A;  3QHY B;  4J84 A;  3DSM A;  4J86 A;  3I7O A;  5C2W B;  5M5V A;  4FAV D;  3EI1 B;  2XL2 A;  1VZ2 A;  2IUP A;  3VGZ A;  4Y7R A;  3SJL D;  3MUO A; 
#chains in the Genus database with same CATH homology
 3EG6 A;  5IJ7 E;  4ZOZ A;  5TEE A;  2B5M A;  2AQ5 A;  5GXH A;  2HYE A;  2IUQ A;  4PXW A;  3CFV A;  3HFQ A;  4O3U B;  2PM7 B;  5FQD A;  3I7N A;  4O45 A;  1FWX A;  3OTT A;  2YNP A;  3IKO A;  3KRW B;  4CI3 A;  3UKU C;  3SBP A;  2Z2N A;  3I7H A;  3OL2 A;  5SXM A;  1ERJ A;  3IJ1 A;  4GQB B;  3RFH A;  1MG2 A;  3AL8 A;  4CY1 A;  4FA4 D;  3PSL A;  4J82 A;  2B5L A;  5B4W A;  1TBG A;  3I8C A;  4PBZ A;  4ZN4 A;  5EAL A;  5K19 A;  3GFC A;  2H68 A;  3SVW D;  3GRE A;  5TF2 A;  5EMJ B;  4J81 A;  3V5W B;  1PGU A;  5EML B;  3BG0 A;  4GM9 A;  4ZOV A;  4ZOY A;  4JT5 C;  3PXW D;  4J8G A;  4GQ1 A;  4HDJ A;  1SQJ A;  2P9S C;  4QT8 A;  2UZY B;  4IA9 A;  2EBS A;  4PNK B;  2Z2O A;  3UVL A;  4A0B A;  1K32 A;  2P9K C;  5HE0 B;  2H6Q A;  4X63 B;  3EU7 A;  2TRC B;  4E5Z B;  1N6E A;  5GMK n;  1JOF A;  2YB8 B;  5EAM A;  3OKT A;  5IC7 A;  2HKR A;  1NR0 A;  4ES0 A;  4O1Q D;  3IIW A;  5CXC B;  2J56 H;  4A0A B;  4CY2 A;  3JRP A;  5IJ8 E;  3B7F A;  5K1C C;  1XHM A;  4J0X A;  1B9X A;  2BCJ B;  4BH6 A;  3EI4 B;  5HE1 B;  3SN6 B;  4CY5 A;  3SBR A;  4A11 B;  5C9Z B;  2AH1 A;  5AFU 3;  2CNX A;  3RN1 D;  4X61 B;  5TDH B;  3RFG A;  5FKQ A;  2CE9 A;  2PM9 A;  4A09 B;  3I7K A;  1QNI A;  4JSN C;  4CZV A;  3JZG A;  5TEF A;  3F3F A;  5EM2 A;  2OVQ B;  4D0K A;  4GZ8 A;  3AH8 B;  5A2Q g;  2MTA H;  4A2L A;  4ERQ A;  5I5J A;  3V9F A;  1R5M A;  5CXB A;  1SQ9 A;  3MKS B;  1TYQ C;  1P22 A;  3FGB A;  1JMX B;  5GXI A;  5IGO A;  3I8E A;  3V7D B;  4J78 A;  4U7A A;  1OMW B;  3OKY B;  2O9K A;  5H17 A;  1JMZ B;  4G56 B;  2P9I C;  2I0S A;  2BBK H;  3EI3 B;  1L0Q A;  3ORV D;  3EI2 A;  2AGZ A;  4J87 A;  3DWL C;  4E54 A;  2AGL A;  2XU7 A;  2H9M A;  5I5M A;  3JB9 L;  4CY3 A;  3PVU B;  2XYI A;  3OKW A;  3KRX B;  5GSA A;  3DXK C;  3N0E A;  5IT9 g;  1U2V C;  4PSX B;  3OW8 A;  4EWR A;  4FWW A;  2QXV A;  4CZX A;  1N6D A;  1PI6 A;  3MXX A;  2I3S A;  2I3T A;  2IUR A;  4O3T B;  4FB1 D;  4AEZ A;  3J81 g;  3EWE A;  3DM0 A;  3EMH A;  3E0C A;  1GOT B;  4E5Z A;  2W18 A;  2AH0 A;  4LGN A;  4XEI C;  3SFZ A;  3AFC A;  4R7A B;  2P9L C;  2Q7Q A;  4ERZ A;  2H14 A;  3C9C A;  4J79 A;  3OL2 B;  4XYH A;  2QC5 A;  3UKR C;  1JJU B;  3FRX A;  4CI8 A;  3AL8 B;  3RN0 D;  2OK6 A;  3PSC B;  4JSV C;  5FKT A;  5HE3 B;  2H9L A;  3RSE C;  4AOW A;  1B9Y A;  1GG2 B;  4PSW B;  5CYK A;  4A08 A;  3RLM D;  4PBY A;  3ODT A;  2H47 A;  4CZY A;  3IJC A;  3NVQ A;  3U4Y A;  2I0R A;  1MG3 A;  4PC0 A;  3SWS D;  3MZL A;  3J80 g;  3CFS B;  2UZX B;  1OLZ A;  2OVP B;  4A0B B;  4JSX C;  1Q47 A;  4D6V A;  2GNQ A;  5HQG A;  3L4O D;  4CI2 A;  4A2M A;  1XIP A;  4A7J A;  5EAR A;  2H6N A;  5AMS A;  1MDA H;  2GC7 A;  5I5I A;  4ERY A;  3DXM C;  3EI1 A;  4FA9 D;  2CO0 A;  2J57 G;  4IMM A;  4BUJ C;  3I2N A;  2H13 A;  3L4M D;  4GGD A;  4JD2 C;  4K3J B;  5AJA A;  2AGW A;  3C75 H;  5EAP A;  4H5J A;  4CC9 A;  4N14 A;  5THA A;  3PE7 A;  4LG8 A;  4KFM B;  3SHF A;  3SBQ A;  5HE2 B;  5C2V B;  2IAA A;  3JZN A;  4L1Q D;  5HYN B;  2PM9 B;  3UR4 A;  2P9P C;  2P9U C;  3SMR A;  4O9D A;  4JSP C;  5FKR A;  2HJB A;  3SCY A;  5EM2 B;  3PVW B;  4CI1 A;  4J8B A;  3BG1 A;  2CN3 A;  2HJ4 A;  5H1M A;  4ESG A;  4Y5R D;  2PM6 B;  4MK0 B;  5CXB B;  3UVK A;  5EMK B;  3W15 A;  3ULE C;  4K3I D;  3ZWL B;  3UVN A;  3PXT D;  4QQE A;  1U4C A;  3JRO A;  3VH0 A;  2B4E A;  2HES X;  2YBA A;  3IIY A;  1XKS A;  3P4F A;  3PXS D;  3C99 A;  2OJY A;  4XYI A;  4QL1 A;  2AGX A;  3BWS A;  3FM0 A;  3JPX A;  2HXC A;  3EI2 B;  2CE8 A;  4GGA A;  5FLX g;  1SHY B;  2IWF A;  1A0R B;  3MKQ A;  4LG9 A;  4E54 B;  2YMU A;  2H6K A;  4U1E I;  4J73 A;  3SLE D;  4X3E A;  1RI6 A;  3MZK A;  2YNN A;  5H14 A;  5CXC A;  4H5I A;  4A0A A;  3F3P A;  5FXY A;  1N6F A;  3UVM A;  1GXR A;  3K27 A;  4FAN D;  5JWZ A;  2G99 A;  4GGC A;  1S4U X;  3UVO A;  2B5N A;  2OIZ A;  5IGQ A;  3SXT D;  3EI4 A;  3RRM C;  1NEX B;  4TZ4 A;  2YNO A;  2I0T A;  4I79 A;  4OWR A;  4A11 A;  4BL0 A;  4JT6 C;  2Z2P A;  4UI9 R;  2OVR B;  4OZU A;  2IWK A;  4A09 A;  4FA5 D;  1GP2 B;  3I89 A;  3JZH A;  4L3G D;  5EMM B;  4Z8L A;  4GM3 A;  4FA1 D;  4ZOX A;  2HKM A;  3F3G A;  3NVX A;  1PEV A;  2H3X A;  3CIK B;  1K8K C;  2CN2 A;  4QRJ A;  2AGY A;  1VYH C;  5FKS A;  3NVN A;  4L9O A;  3K26 A;  3AL9 A;  3I7L A;  1YFQ A;  4GQ2 P;  3C5M A;  4L3H D;  4NSX A;  2H9N A;  2PBI B;  2P9N C;  4FHL A;  5CYK B;  4A08 B;  3OKY A;  2IUV A;  4J0W A;  4YVD A;  1PBY B;  3RMZ D;  2G9A A;  2XL3 A;  3EI3 A;  4X60 B;  4J77 A;  3JAM g;  2CO0 C;  2GC4 A;  2OK4 A;  4GMB A;  3I7P A;  4JXM A;  3VA6 A;  3MMY A;  5FA5 B;  3N0D A;  2J55 H;  3A0F A;  5KDO B;  4GM8 A;  2H9P A;  3IJ0 A;  4J84 A;  3DSM A;  4J86 A;  3I7O A;  5C2W B;  4FAV D;  3EI1 B;  2XL2 A;  2IUP A;  3VGZ A;  4Y7R A;  3SJL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...