4ZOYA

Crystal structure of the chaetomium thermophilum sqt1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
487
structure length
406
Chain Sequence
b'ENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISAATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDANPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAGSHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sqt1
molecule tags Chaperone
source organism Chaetomium thermophilum
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
total genus 106
structure length 406
sequence length 487
ec nomenclature
pdb deposition date 2015-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zoyA00
2OK6A 1ERJA 4BL0A 1K32A 3OKWA 5FKSA 2EBSA 2YNOA 4H5JA 5EMLB 5EM2A 4Y5RD 2IWKA 5EALA 4O1QD 4J81A 3I7HA 4GGCA 2P9NC 2W18A 4FA4D 1PI6A 1FWXA 3RN1D 4A0AA 2QXVA 1L0QA 5IGQA 2AH0A 2HJBA 4OWRA 4JSVC 3VA6A 3FM0A 4CZYA 3SVWD 3JRPA 3L4OD 5I5JA 2AGYA 3F3GA 3FGBA 2IUQA 3BG0A 5FLXg 1TBGA 3I7PA 3NVNA 4X3EA 4E5ZB 2PM9B 3SBQA 3EI4A 3OTTA 4CI2A 5I5MA 2Q7QA 5HE0B 3V9FA 4A09A 2CE8A 4J87A 2I0TA 4J8GA 5GSAA 2AGZA 3CFVA 5CYKB 4Z8LA 3SWSD 3UVKA 2H6KA 1P22A 3I8CA 3ODTA 4CY5A 1A0RB 4ESGA 4J84A 3JAMg 2G99A 2I0RA 2XL2A 4X61B 4YVDA 2OVQB 4EWRA 3C99A 3MKQA 1MDAH 4QQEA 5IC7A 2PM6B 2YBAA 5CXBA 3PXWD 3SBPA 4JSPC 3OKTA 2OVRB 4A11B 2OJYA 3C5MA 4FWWA 3PSLA 4CI8A 4JXMA 4LGNA 4LG8A 4NSXA 3RMZD 5H14A 3VGZA 3I7KA 2GNQA 4ZOXA 5HE3B 3ULEC 4E54B 4O3UB 4KFMB 2I0SA 4N14A 5H17A 4J86A 2GC4A 1TYQC 2CO0A 4JT6C 2B4EA 4GM8A 4Y7RA 3ZWLB 2P9LC 3I7LA 1VYHC 5EAMA 2OVPB 4JSNC 5THAA 2MTAH 3DXMC 4GMBA 4CY2A 4FA5D 4FA9D 3C75H 1PBYB 2Z2PA 4BUJC 4U7AA 3MXXA 2H6QA 4J0XA 1Q47A 3NVQA 3SFZA 3I7OA 2H9LA 5JWZA 5A2Qg 4A11A 3V5WB 2AGLA 2G9AA 2XU7A 3IIWA 5FXYA 3OL2B 1N6DA 1B9XA 3SCYA 3GFCA 4A0BB 5HYNB 2AQ5A 1NR0A 2B5MA 3EI1A 4BH6A 3U4YA 1K8KC 4A09B 3J80g 4J73A 4ERYA 1JOFA 4J77A 5C9ZB 3MZLA 2IUVA 3I89A 4PBZA 3SBRA 3AL8B 4CC9A 3MMYA 4ES0A 2H6NA 5IT9g 5EMKB 4O45A 4PXWA 5IJ7E 1NEXB 5TEEA 4PSWB 2XL3A 3L4MD 4QT8A 4IMMA 2H9MA 2I3TA 4AOWA 3CFSB 3K26A 2Z2NA 4HDJA 1MG3A 5HE1B 3B7FA 5CXBB 3EWEA 5GMKn 4CY1A 5FA5B 1QNIA 3SLED 5TDHB 3RFGA 2YNPA 4FB1D 2IWFA 4FAVD 2Z2OA 4GM3A 4LG9A 3I2NA 4H5IA 4OZUA 2J55H 1JMZB 4GGDA 2P9KC 1U4CA 4I79A 2QC5A 2H14A 3I8EA 3KRXB 4CI3A 3RFHA 3UVNA 3IIYA 3SJLD 3E0CA 4CZVA 3PVWB 3EU7A 3NVXA 4XEIC 5HE2B 5IGOA 3DXKC 5GXIA 5K19A 3P4FA 3OL2A 3OKYB 5HQGA 5C2WB 3EI2A 5EM2B 1SQ9A 4K3JB 4GQBB 2H3XA 2CNXA 5FQDA 1GG2B 3N0DA 2YMUA 2HKMA 4X60B 4JT5C 2BBKH 5TF2A 5EARA 5EAPA 3HFQA 3FRXA 2AH1A 3EI1B 1R5MA 3SMRA 3A0FA 2YNNA 3IJ1A 3VH0A 2YB8B 2H9PA 2CE9A 4A2LA 2BCJB 3V7DB 2GC7A 2H13A 4GM9A 4E5ZA 2IURA 2AGXA 3RN0D 4TZ4A 3UKUC 3IJ0A 4O9DA 5IJ8E 2H9NA 2B5NA 4PSXB 4ZOVA 4J0WA 4J78A 5KDOB 4AEZA 5GXHA 1JJUB 5FKTA 5EMMB 3OKYA 2P9UC 3AFCA 4PBYA 3N0EA 1JMXB 4A08B 3IKOA 2HXCA 3CIKB 1N6EA 2J57G 4U1EI 4CZXA 3JZHA 2TRCB 3UKRC 4R7AB 4QRJA 1GXRA 1N6FA 2UZYB 5TEFA 2HKRA 2PM9A 4XYIA 2CN2A 5EMJB 3AL9A 4A0AB 5CYKA 1XHMA 3J81g 3DWLC 3RSEC 2XYIA 3DM0A 3F3FA 2J56H 3PVUB 2IUPA 4UI9R 2CO0C 2H68A 3PXTD 4J82A 4ZOYA 2HESX 4QL1A 3DSMA 1XKSA 2HYEA 5H1MA 2CN3A 1U2VC 3KRWB 2OIZA 4MK0B 4JSXC 3OW8A 3SXTD 2HJ4A 4D6VA 4L3HD 4PNKB 5C2VB 4X63B 4K3ID 2IAAA 4CY3A 1MG2A 3PXSD 4FHLA 3JZNA 2PBIB 4E54A 3MZKA 3EI3A 4J8BA 1RI6A 4L1QD 2H47A 5AFU3 1XIPA 3JROA 1B9YA 2PM7B 3UVMA 4FAND 5CXCA 3K27A 1GP2B 1GOTB 3MKSB 3BWSA 3RRMC 5K1CC 1S4UX 2UZXB 2O9KA 2OK4A 1PEVA 5AJAA 3C9CA 4ZOZA 5AMSA 1SQJA 5FKQA 1YFQA 4A2MA 4CI1A 5FKRA 5I5IA 4GGAA 3IJCA 3BG1A 3EI4B 3EMHA 3SHFA 3GREA 3JZGA 3UR4A 3SN6B 2P9SC 3EI3B 4G56B 4XYHA 3UVLA 4JD2C 4PC0A 4ERZA 3AH8B 5SXMA 2P9PC 4GQ1A 4J79A 3PSCB 3JB9L 1PGUA 4L3GD 3AL8A 3W15A 3ORVD 4O3TB 4ERQA 4D0KA 2I3SA 4A7JA 3RLMD 2AGWA 2B5LA 3PE7A 5B4WA 3I7NA 3UVOA 3JPXA 1OMWB 3F3PA 4FA1D 4IA9A 4ZN4A 4GZ8A 4GQ2P 1OLZA 4A0BA 2P9IC 1SHYB 4L9OA 4A08A 3EG6A 3EI2B 5CXCB
chains in the Genus database with same CATH superfamily
2OK6A 2BKLA 1ERJA 2VDQA 4BL0A 1K32A 2VDKA 3OKWA 4QAMA 5FKSA 2EBSA 2YNOA 4NC4A 4H5JA 5EMLB 5EM2A 2QZPA 4Y5RD 2IWKA 1T2XA 5EALA 4O1QD 4J81A 3I7HA 4NENA 1U8CA 4GGCA 2P9NC 2W18A 5HDBA 1PI6A 4FA4D 1FWXA 3RN1D 4A0AA 2QXVA 1L0QA 5IGQA 2AH0A 2HJBA 3K6SA 4OWRA 3ZE0A 1A12A 4JSVC 3VA6A 1I2MB 3FM0A 4CZYA 3SVWD 3JRPA 3L4OD 5I5JA 2AGYA 2XDWA 3F3GA 2IUQA 3FGBA 3BG0A 4WK4A 5FLXg 4AMYA 1TBGA 3I7PA 3NVNA 4X3EA 4E5ZB 2PM9B 1M1XA 4UM9A 3SBQA 3EI4A 3OTTA 4CI2A 5I5MA 2Q7QA 5HE0B 3V9FA 4A09A 2CE8A 2EIDA 4J87A 2I0TA 5M5RA 4J8GA 5GSAA 2AGZA 3CFVA 5CYKB 4Z8LA 3SWSD 3UVKA 3ZDYA 2H6KA 1P22A 3I8CA 3ODTA 4CY5A 1A0RB 4ESGA 4J84A 3JAMg 2G99A 2I0RA 5C92A 2XL2A 4X61B 4YVDA 2OVQB 4EWRA 3C99A 3MKQA 1MDAH 4QQEA 5IC7A 2PM6B 2VZ3A 2YBAA 5CXBA 3PXWD 3SBPA 1H2YA 3FCUA 4JSPC 3OKTA 2OVRB 4A11B 2OJYA 3C5MA 4FWWA 3PSLA 4CI8A 4JXMA 1C9IA 1K3IA 4LGNA 4NAAA 4LG8A 5FFGA 4NSXA 3RMZD 5H14A 3VGZA 3I7KA 2GNQA 4ZOXA 5HE3B 3ULEC 4E54B 4O3UB 2HU7A 4KFMB 2I0SA 4N14A 4RE6A 5H17A 4WJKA 4J86A 5M5UA 2GC4A 1TYQC 2CO0A 4JT6C 2B4EA 1BPOA 4GM8A 4Y7RA 3ZWLB 3IUMA 3IURA 2P9LC 4BCBA 3I7LA 1VYHC 2EIEA 2OVPB 5EAMA 4JSNC 5THAA 2MTAH 3DXMC 4GMBA 4CY2A 4FA5D 4Z7OA 4FA9D 3C75H 5FFOA 5C86A 1PBYB 2Z2PA 4BUJC 4U7AA 4UM8A 3MXXA 3NIDA 2H6QA 4J0XA 1Q47A 3NVQA 3SFZA 3I7OA 2H9LA 5JWZA 4MMYA 5M61A 5A2Qg 4A11A 3V5WB 2AGLA 2G9AA 1VZ2A 2XU7A 3IIWA 5FXYA 4BCCA 3OL2B 3GC3B 1N6DA 3MUNA 1B9XA 3SCYA 3GFCA 4A0BB 5HYNB 2AQ5A 1NR0A 2B5MA 3EI1A 4BH6A 3U4YA 1K8KC 4A09B 3J80g 3EQ8A 4J73A 4ERYA 1JOFA 4J77A 5C9ZB 3OF7A 3MZLA 1VE6A 2IUVA 2XZGA 4L1MA 3I89A 4PBZA 3SBRA 3AL8B 3O4HA 3MMYA 1GOFA 4CC9A 2H6NA 4ES0A 5IT9g 4DNVA 5EMKB 1UTCA 4O45A 4PXWA 2JKXA 5IJ7E 1NEXB 5TEEA 4PSWB 3O4IA 2XL3A 3L4MD 4QT8A 4IMMA 2VC2A 2H9MA 1H2ZA 2VZ1A 2I3TA 4AOWA 3CFSB 3K26A 2Z2NA 4HDJA 1MG3A 5HE1B 3B7FA 4AMZA 5CXBB 3EWEA 5GMKn 4CY1A 5FA5B 1E8MA 3IVMA 3K72A 1QNIA 3SLED 4NBMA 5TDHB 2YNPA 3RFGA 2IWFA 3T3PA 4FB1D 3IJEA 2Z2OA 4FAVD 4GM3A 2HU5A 4LG9A 1O6GA 3I2NA 4JHPC 3ZE1A 4H5IA 4OZUA 2J55H 1JMZB 4GGDA 2P9KC 1U4CA 4I79A 3IUQA 2QC5A 2H14A 3I8EA 3KRXB 4CI3A 3RFHA 1E8NA 4RE5A 3UVNA 3DDUA 2VDPA 3IIYA 3SJLD 3E0CA 4CZVA 3PVWB 3EU7A 3NVXA 4XEIC 1YR2A 5HE2B 5IGOA 3DXKC 4AN1A 5GXIA 2WQ8A 5K19A 3P4FA 3OL2A 3OKYB 5HQGA 5C2WB 3EI2A 4Z7QA 5EM2B 3K71A 1SQ9A 4K3JB 4GQBB 2H3XA 2CNXA 4AN0A 5FQDA 1GG2B 1JTDB 3N0DA 2YMUA 2HKMA 4X60B 4JT5C 2BBKH 5TF2A 5EARA 5EAPA 3HFQA 3FRXA 3NIFA 3V4VA 2AH1A 2XE4A 3EI1B 1R5MA 3SMRA 3A0FA 2YNNA 3IJ1A 3VH0A 2YB8B 2H9PA 3ZE2A 2CE9A 4A2LA 2BCJB 3V7DB 2GC7A 2H13A 4GM9A 4E5ZA 2IURA 2AGXA 3RN0D 4TZ4A 3UKUC 3IJ0A 4O9DA 5IJ8E 3GD1I 2H9NA 1L5GA 2B5NA 4PSXB 3MVDK 4ZOVA 4J0WA 4J78A 2QR5A 5KDOB 4G55A 4AEZA 5GXHA 1JJUB 5E6UA 5FKTA 4G1MA 5EMMB 4BP9A 3QHYB 3OKYA 1UOOA 2P9UC 3AFCA 4PBYA 3N0EA 1JMXB 4DNWA 5M5TA 2VDNA 4A08B 3O4JA 4WK0A 3IKOA 2HXCA 3CIKB 1N6EA 2J57G 4U1EI 4CZXA 3JZHA 2TRCB 3UKRC 4R7AB 4QRJA 1GXRA 1N6FA 2UZYB 5TEFA 2HKRA 2PM9A 2CN2A 4XYIA 5EMJB 3AL9A 4A0AB 5CYKA 1XHMA 1H2WA 4WK2A 3J81g 1GOGA 3DWLC 3RSEC 3PVUB 2XYIA 3DM0A 3F3FA 2J56H 3FCSA 4BCDA 2IUPA 4UI9R 3VI3A 2CO0C 2H68A 3PXTD 4J82A 3EQ9A 3QI0A 2EICA 4ZOYA 2HESX 4QL1A 4AX4A 3DSMA 3ZDXA 1XKSA 4G1EA 3NIGA 4MMXA 3V4PA 4O02A 2HYEA 5H1MA 1UOQA 2CN3A 1U2VC 3KRWB 2OIZA 4MK0B 4JSXC 3OW8A 3SXTD 2HJ4A 4D6VA 1C9LA 4L3HD 4PNKB 3IUNA 4IRZA 5C2VB 1O6FA 5E6SA 1QFMA 4X63B 4K3ID 2IAAA 3T3MA 4CY3A 1MG2A 3PXSD 4FHLA 3JZNA 2PBIB 3IUJA 4E54A 3MZKA 4Z7NA 4JHNA 4DNUA 2VDMA 3EI3A 4J8BA 1RI6A 1VZ3A 4L1QD 2H47A 4BP8A 5E6RA 5AFU3 1XIPA 5M5VA 3JROA 1JV2A 1B9YA 2PM7B 1H2XA 3UVMA 4FAND 4MMZA 1VE7A 3K27A 5CXCA 1GP2B 1GOTB 3MKSB 3BWSA 3RRMC 5K1CC 1UOPA 2VDOA 2VDRA 2VDLA 1S4UX 2UZXB 2O9KA 2OK4A 3ZDZA 1PEVA 5AJAA 3C9CA 4ZOZA 5AMSA 1SQJA 5FKQA 4D9SA 1YFQA 4A2MA 4CI1A 5FKRA 5I5IA 4GGAA 3IJCA 3BG1A 3EI4B 3EMHA 3SHFA 3GREA 3JZGA 1GOHA 3UR4A 3SN6B 2P9SC 3EI3B 4G56B 4XYHA 3UVLA 4JD2C 2EIBA 4PC0A 4ERZA 5M5SA 3AH8B 5SXMA 3O4GA 2P9PC 4GQ1A 3KCIA 1TYEA 4J79A 3PSCB 3JB9L 1PGUA 4L3GD 3AL8A 3W15A 3ORVD 4O3TB 4ERQA 3EQ7A 2HU8A 4D0KA 2I3SA 1E5TA 4A7JA 3MUOA 3RLMD 3PE7A 2AGWA 2B5LA 1QFSA 5B4WA 3I7NA 3UVOA 3IULA 3JPXA 1OMWB 3F3PA 4FA1D 4IA9A 4ZN4A 4GZ8A 4GQ2P 1OLZA 4A0BA 2P9IC 1SHYB 4L9OA 4O2WA 4A08A 3EG6A 3EI2B 5CXCB 3VI4A
chains in the Genus database with same CATH topology
2OK6A 1ERJA 4BL0A 1K32A 3OKWA 5FKSA 2EBSA 2YNOA 4H5JA 5EMLB 5EM2A 4Y5RD 2IWKA 5EALA 4O1QD 4J81A 3I7HA 4GGCA 2P9NC 2W18A 4FA4D 1PI6A 1FWXA 3RN1D 4A0AA 2QXVA 1L0QA 5IGQA 2AH0A 2HJBA 4OWRA 4JSVC 3VA6A 3FM0A 4CZYA 3SVWD 3JRPA 3L4OD 5I5JA 2AGYA 3F3GA 3FGBA 2IUQA 3BG0A 5FLXg 1TBGA 3I7PA 3NVNA 4X3EA 4E5ZB 2PM9B 3SBQA 3EI4A 3OTTA 4CI2A 5I5MA 2Q7QA 5HE0B 3V9FA 4A09A 2CE8A 4J87A 2I0TA 4J8GA 5GSAA 2AGZA 3CFVA 5CYKB 4Z8LA 3SWSD 3UVKA 2H6KA 1P22A 3I8CA 3ODTA 4CY5A 1A0RB 4ESGA 4J84A 3JAMg 2G99A 2I0RA 2XL2A 4X61B 4YVDA 2OVQB 4EWRA 3C99A 3MKQA 1MDAH 4QQEA 5IC7A 2PM6B 2YBAA 5CXBA 3PXWD 3SBPA 4JSPC 3OKTA 2OVRB 4A11B 2OJYA 3C5MA 4FWWA 3PSLA 4CI8A 4JXMA 4LGNA 4LG8A 4NSXA 3RMZD 5H14A 3VGZA 3I7KA 2GNQA 4ZOXA 5HE3B 3ULEC 4E54B 4O3UB 4KFMB 2I0SA 4N14A 5H17A 4J86A 2GC4A 1TYQC 2CO0A 4JT6C 2B4EA 4GM8A 4Y7RA 3ZWLB 2P9LC 3I7LA 1VYHC 5EAMA 2OVPB 4JSNC 5THAA 2MTAH 3DXMC 4GMBA 4CY2A 4FA5D 4FA9D 3C75H 1PBYB 2Z2PA 4BUJC 4U7AA 3MXXA 2H6QA 4J0XA 1Q47A 3NVQA 3SFZA 3I7OA 2H9LA 5JWZA 5A2Qg 4A11A 3V5WB 2AGLA 2G9AA 2XU7A 3IIWA 5FXYA 3OL2B 1N6DA 1B9XA 3SCYA 3GFCA 4A0BB 5HYNB 2AQ5A 1NR0A 2B5MA 3EI1A 4BH6A 3U4YA 1K8KC 4A09B 3J80g 4J73A 4ERYA 1JOFA 4J77A 5C9ZB 3MZLA 2IUVA 3I89A 4PBZA 3SBRA 3AL8B 4CC9A 3MMYA 4ES0A 2H6NA 5IT9g 5EMKB 4O45A 4PXWA 5IJ7E 1NEXB 5TEEA 4PSWB 2XL3A 3L4MD 4QT8A 4IMMA 2H9MA 2I3TA 4AOWA 3CFSB 3K26A 2Z2NA 4HDJA 1MG3A 5HE1B 3B7FA 5CXBB 3EWEA 5GMKn 4CY1A 5FA5B 1QNIA 3SLED 5TDHB 3RFGA 2YNPA 4FB1D 2IWFA 4FAVD 2Z2OA 4GM3A 4LG9A 3I2NA 4H5IA 4OZUA 2J55H 1JMZB 4GGDA 2P9KC 1U4CA 4I79A 2QC5A 2H14A 3I8EA 3KRXB 4CI3A 3RFHA 3UVNA 3IIYA 3SJLD 3E0CA 4CZVA 3PVWB 3EU7A 3NVXA 4XEIC 5HE2B 5IGOA 3DXKC 5GXIA 5K19A 3P4FA 3OL2A 3OKYB 5HQGA 5C2WB 3EI2A 5EM2B 1SQ9A 4K3JB 4GQBB 2H3XA 2CNXA 5FQDA 1GG2B 3N0DA 2YMUA 2HKMA 4X60B 4JT5C 2BBKH 5TF2A 5EARA 5EAPA 3HFQA 3FRXA 2AH1A 3EI1B 1R5MA 3SMRA 3A0FA 2YNNA 3IJ1A 3VH0A 2YB8B 2H9PA 2CE9A 4A2LA 2BCJB 3V7DB 2GC7A 2H13A 4GM9A 4E5ZA 2IURA 2AGXA 3RN0D 4TZ4A 3UKUC 3IJ0A 4O9DA 5IJ8E 2H9NA 2B5NA 4PSXB 4ZOVA 4J0WA 4J78A 5KDOB 4AEZA 5GXHA 1JJUB 5FKTA 5EMMB 3OKYA 2P9UC 3AFCA 4PBYA 3N0EA 1JMXB 4A08B 3IKOA 2HXCA 3CIKB 1N6EA 2J57G 4U1EI 4CZXA 3JZHA 2TRCB 3UKRC 4R7AB 4QRJA 1GXRA 1N6FA 2UZYB 5TEFA 2HKRA 2PM9A 4XYIA 2CN2A 5EMJB 3AL9A 4A0AB 5CYKA 1XHMA 3J81g 3DWLC 3RSEC 2XYIA 3DM0A 3F3FA 2J56H 3PVUB 2IUPA 4UI9R 2CO0C 2H68A 3PXTD 4J82A 4ZOYA 2HESX 4QL1A 3DSMA 1XKSA 2HYEA 5H1MA 2CN3A 1U2VC 3KRWB 2OIZA 4MK0B 4JSXC 3OW8A 3SXTD 2HJ4A 4D6VA 4L3HD 4PNKB 5C2VB 4X63B 4K3ID 2IAAA 4CY3A 1MG2A 3PXSD 4FHLA 3JZNA 2PBIB 4E54A 3MZKA 3EI3A 4J8BA 1RI6A 4L1QD 2H47A 5AFU3 1XIPA 3JROA 1B9YA 2PM7B 3UVMA 4FAND 5CXCA 3K27A 1GP2B 1GOTB 3MKSB 3BWSA 3RRMC 5K1CC 1S4UX 2UZXB 2O9KA 2OK4A 1PEVA 5AJAA 3C9CA 4ZOZA 5AMSA 1SQJA 5FKQA 1YFQA 4A2MA 4CI1A 5FKRA 5I5IA 4GGAA 3IJCA 3BG1A 3EI4B 3EMHA 3SHFA 3GREA 3JZGA 3UR4A 3SN6B 2P9SC 3EI3B 4G56B 4XYHA 3UVLA 4JD2C 4PC0A 4ERZA 3AH8B 5SXMA 2P9PC 4GQ1A 4J79A 3PSCB 3JB9L 1PGUA 4L3GD 3AL8A 3W15A 3ORVD 4O3TB 4ERQA 4D0KA 2I3SA 4A7JA 3RLMD 2AGWA 2B5LA 3PE7A 5B4WA 3I7NA 3UVOA 3JPXA 1OMWB 3F3PA 4FA1D 4IA9A 4ZN4A 4GZ8A 4GQ2P 1OLZA 4A0BA 2P9IC 1SHYB 4L9OA 4A08A 3EG6A 3EI2B 5CXCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK6 A;  1ERJ A;  4BL0 A;  1K32 A;  3OKW A;  5FKS A;  2EBS A;  2YNO A;  4H5J A;  5EML B;  5EM2 A;  4Y5R D;  2IWK A;  5EAL A;  4O1Q D;  4J81 A;  3I7H A;  4GGC A;  2P9N C;  2W18 A;  4FA4 D;  1PI6 A;  1FWX A;  3RN1 D;  4A0A A;  2QXV A;  1L0Q A;  5IGQ A;  2AH0 A;  2HJB A;  4OWR A;  4JSV C;  3VA6 A;  3FM0 A;  4CZY A;  3SVW D;  3JRP A;  3L4O D;  5I5J A;  2AGY A;  3F3G A;  3FGB A;  2IUQ A;  3BG0 A;  5FLX g;  1TBG A;  3I7P A;  3NVN A;  4X3E A;  4E5Z B;  2PM9 B;  3SBQ A;  3EI4 A;  3OTT A;  4CI2 A;  5I5M A;  2Q7Q A;  5HE0 B;  3V9F A;  4A09 A;  2CE8 A;  4J87 A;  2I0T A;  4J8G A;  5GSA A;  2AGZ A;  3CFV A;  5CYK B;  4Z8L A;  3SWS D;  3UVK A;  2H6K A;  1P22 A;  3I8C A;  3ODT A;  4CY5 A;  1A0R B;  4ESG A;  4J84 A;  3JAM g;  2G99 A;  2I0R A;  2XL2 A;  4X61 B;  4YVD A;  2OVQ B;  4EWR A;  3C99 A;  3MKQ A;  1MDA H;  4QQE A;  5IC7 A;  2PM6 B;  2YBA A;  5CXB A;  3PXW D;  3SBP A;  4JSP C;  3OKT A;  2OVR B;  4A11 B;  2OJY A;  3C5M A;  4FWW A;  3PSL A;  4CI8 A;  4JXM A;  4LGN A;  4LG8 A;  4NSX A;  3RMZ D;  5H14 A;  3VGZ A;  3I7K A;  2GNQ A;  4ZOX A;  5HE3 B;  3ULE C;  4E54 B;  4O3U B;  4KFM B;  2I0S A;  4N14 A;  5H17 A;  4J86 A;  2GC4 A;  1TYQ C;  2CO0 A;  4JT6 C;  2B4E A;  4GM8 A;  4Y7R A;  3ZWL B;  2P9L C;  3I7L A;  1VYH C;  5EAM A;  2OVP B;  4JSN C;  5THA A;  2MTA H;  3DXM C;  4GMB A;  4CY2 A;  4FA5 D;  4FA9 D;  3C75 H;  1PBY B;  2Z2P A;  4BUJ C;  4U7A A;  3MXX A;  2H6Q A;  4J0X A;  1Q47 A;  3NVQ A;  3SFZ A;  3I7O A;  2H9L A;  5JWZ A;  5A2Q g;  4A11 A;  3V5W B;  2AGL A;  2G9A A;  2XU7 A;  3IIW A;  5FXY A;  3OL2 B;  1N6D A;  1B9X A;  3SCY A;  3GFC A;  4A0B B;  5HYN B;  2AQ5 A;  1NR0 A;  2B5M A;  3EI1 A;  4BH6 A;  3U4Y A;  1K8K C;  4A09 B;  3J80 g;  4J73 A;  4ERY A;  1JOF A;  4J77 A;  5C9Z B;  3MZL A;  2IUV A;  3I89 A;  4PBZ A;  3SBR A;  3AL8 B;  4CC9 A;  3MMY A;  4ES0 A;  2H6N A;  5IT9 g;  5EMK B;  4O45 A;  4PXW A;  5IJ7 E;  1NEX B;  5TEE A;  4PSW B;  2XL3 A;  3L4M D;  4QT8 A;  4IMM A;  2H9M A;  2I3T A;  4AOW A;  3CFS B;  3K26 A;  2Z2N A;  4HDJ A;  1MG3 A;  5HE1 B;  3B7F A;  5CXB B;  3EWE A;  5GMK n;  4CY1 A;  5FA5 B;  1QNI A;  3SLE D;  5TDH B;  3RFG A;  2YNP A;  4FB1 D;  2IWF A;  4FAV D;  2Z2O A;  4GM3 A;  4LG9 A;  3I2N A;  4H5I A;  4OZU A;  2J55 H;  1JMZ B;  4GGD A;  2P9K C;  1U4C A;  4I79 A;  2QC5 A;  2H14 A;  3I8E A;  3KRX B;  4CI3 A;  3RFH A;  3UVN A;  3IIY A;  3SJL D;  3E0C A;  4CZV A;  3PVW B;  3EU7 A;  3NVX A;  4XEI C;  5HE2 B;  5IGO A;  3DXK C;  5GXI A;  5K19 A;  3P4F A;  3OL2 A;  3OKY B;  5HQG A;  5C2W B;  3EI2 A;  5EM2 B;  1SQ9 A;  4K3J B;  4GQB B;  2H3X A;  2CNX A;  5FQD A;  1GG2 B;  3N0D A;  2YMU A;  2HKM A;  4X60 B;  4JT5 C;  2BBK H;  5TF2 A;  5EAR A;  5EAP A;  3HFQ A;  3FRX A;  2AH1 A;  3EI1 B;  1R5M A;  3SMR A;  3A0F A;  2YNN A;  3IJ1 A;  3VH0 A;  2YB8 B;  2H9P A;  2CE9 A;  4A2L A;  2BCJ B;  3V7D B;  2GC7 A;  2H13 A;  4GM9 A;  4E5Z A;  2IUR A;  2AGX A;  3RN0 D;  4TZ4 A;  3UKU C;  3IJ0 A;  4O9D A;  5IJ8 E;  2H9N A;  2B5N A;  4PSX B;  4ZOV A;  4J0W A;  4J78 A;  5KDO B;  4AEZ A;  5GXH A;  1JJU B;  5FKT A;  5EMM B;  3OKY A;  2P9U C;  3AFC A;  4PBY A;  3N0E A;  1JMX B;  4A08 B;  3IKO A;  2HXC A;  3CIK B;  1N6E A;  2J57 G;  4U1E I;  4CZX A;  3JZH A;  2TRC B;  3UKR C;  4R7A B;  4QRJ A;  1GXR A;  1N6F A;  2UZY B;  5TEF A;  2HKR A;  2PM9 A;  4XYI A;  2CN2 A;  5EMJ B;  3AL9 A;  4A0A B;  5CYK A;  1XHM A;  3J81 g;  3DWL C;  3RSE C;  2XYI A;  3DM0 A;  3F3F A;  2J56 H;  3PVU B;  2IUP A;  4UI9 R;  2CO0 C;  2H68 A;  3PXT D;  4J82 A;  4ZOY A;  2HES X;  4QL1 A;  3DSM A;  1XKS A;  2HYE A;  5H1M A;  2CN3 A;  1U2V C;  3KRW B;  2OIZ A;  4MK0 B;  4JSX C;  3OW8 A;  3SXT D;  2HJ4 A;  4D6V A;  4L3H D;  4PNK B;  5C2V B;  4X63 B;  4K3I D;  2IAA A;  4CY3 A;  1MG2 A;  3PXS D;  4FHL A;  3JZN A;  2PBI B;  4E54 A;  3MZK A;  3EI3 A;  4J8B A;  1RI6 A;  4L1Q D;  2H47 A;  5AFU 3;  1XIP A;  3JRO A;  1B9Y A;  2PM7 B;  3UVM A;  4FAN D;  5CXC A;  3K27 A;  1GP2 B;  1GOT B;  3MKS B;  3BWS A;  3RRM C;  5K1C C;  1S4U X;  2UZX B;  2O9K A;  2OK4 A;  1PEV A;  5AJA A;  3C9C A;  4ZOZ A;  5AMS A;  1SQJ A;  5FKQ A;  1YFQ A;  4A2M A;  4CI1 A;  5FKR A;  5I5I A;  4GGA A;  3IJC A;  3BG1 A;  3EI4 B;  3EMH A;  3SHF A;  3GRE A;  3JZG A;  3UR4 A;  3SN6 B;  2P9S C;  3EI3 B;  4G56 B;  4XYH A;  3UVL A;  4JD2 C;  4PC0 A;  4ERZ A;  3AH8 B;  5SXM A;  2P9P C;  4GQ1 A;  4J79 A;  3PSC B;  3JB9 L;  1PGU A;  4L3G D;  3AL8 A;  3W15 A;  3ORV D;  4O3T B;  4ERQ A;  4D0K A;  2I3S A;  4A7J A;  3RLM D;  2AGW A;  2B5L A;  3PE7 A;  5B4W A;  3I7N A;  3UVO A;  3JPX A;  1OMW B;  3F3P A;  4FA1 D;  4IA9 A;  4ZN4 A;  4GZ8 A;  4GQ2 P;  1OLZ A;  4A0B A;  2P9I C;  1SHY B;  4L9O A;  4A08 A;  3EG6 A;  3EI2 B;  5CXC B; 
#chains in the Genus database with same CATH topology
 2OK6 A;  2BKL A;  1ERJ A;  2VDQ A;  4BL0 A;  1K32 A;  2VDK A;  3OKW A;  4QAM A;  5FKS A;  2EBS A;  2YNO A;  4NC4 A;  4H5J A;  5EML B;  5EM2 A;  2QZP A;  4Y5R D;  2IWK A;  1T2X A;  5EAL A;  4O1Q D;  4J81 A;  3I7H A;  4NEN A;  1U8C A;  4GGC A;  2P9N C;  2W18 A;  5HDB A;  1PI6 A;  4FA4 D;  1FWX A;  3RN1 D;  4A0A A;  2QXV A;  1L0Q A;  5IGQ A;  2AH0 A;  2HJB A;  3K6S A;  4OWR A;  3ZE0 A;  1A12 A;  4JSV C;  3VA6 A;  1I2M B;  3FM0 A;  4CZY A;  3SVW D;  3JRP A;  3L4O D;  5I5J A;  2AGY A;  2XDW A;  3F3G A;  2IUQ A;  3FGB A;  3BG0 A;  4WK4 A;  5FLX g;  4AMY A;  1TBG A;  3I7P A;  3NVN A;  4X3E A;  4E5Z B;  2PM9 B;  1M1X A;  4UM9 A;  3SBQ A;  3EI4 A;  3OTT A;  4CI2 A;  5I5M A;  2Q7Q A;  5HE0 B;  3V9F A;  4A09 A;  2CE8 A;  2EID A;  4J87 A;  2I0T A;  5M5R A;  4J8G A;  5GSA A;  2AGZ A;  3CFV A;  5CYK B;  4Z8L A;  3SWS D;  3UVK A;  3ZDY A;  2H6K A;  1P22 A;  3I8C A;  3ODT A;  4CY5 A;  1A0R B;  4ESG A;  4J84 A;  3JAM g;  2G99 A;  2I0R A;  5C92 A;  2XL2 A;  4X61 B;  4YVD A;  2OVQ B;  4EWR A;  3C99 A;  3MKQ A;  1MDA H;  4QQE A;  5IC7 A;  2PM6 B;  2VZ3 A;  2YBA A;  5CXB A;  3PXW D;  3SBP A;  1H2Y A;  3FCU A;  4JSP C;  3OKT A;  2OVR B;  4A11 B;  2OJY A;  3C5M A;  4FWW A;  3PSL A;  4CI8 A;  4JXM A;  1C9I A;  1K3I A;  4LGN A;  4NAA A;  4LG8 A;  5FFG A;  4NSX A;  3RMZ D;  5H14 A;  3VGZ A;  3I7K A;  2GNQ A;  4ZOX A;  5HE3 B;  3ULE C;  4E54 B;  4O3U B;  2HU7 A;  4KFM B;  2I0S A;  4N14 A;  4RE6 A;  5H17 A;  4WJK A;  4J86 A;  5M5U A;  2GC4 A;  1TYQ C;  2CO0 A;  4JT6 C;  2B4E A;  1BPO A;  4GM8 A;  4Y7R A;  3ZWL B;  3IUM A;  3IUR A;  2P9L C;  4BCB A;  3I7L A;  1VYH C;  2EIE A;  2OVP B;  5EAM A;  4JSN C;  5THA A;  2MTA H;  3DXM C;  4GMB A;  4CY2 A;  4FA5 D;  4Z7O A;  4FA9 D;  3C75 H;  5FFO A;  5C86 A;  1PBY B;  2Z2P A;  4BUJ C;  4U7A A;  4UM8 A;  3MXX A;  3NID A;  2H6Q A;  4J0X A;  1Q47 A;  3NVQ A;  3SFZ A;  3I7O A;  2H9L A;  5JWZ A;  4MMY A;  5M61 A;  5A2Q g;  4A11 A;  3V5W B;  2AGL A;  2G9A A;  1VZ2 A;  2XU7 A;  3IIW A;  5FXY A;  4BCC A;  3OL2 B;  3GC3 B;  1N6D A;  3MUN A;  1B9X A;  3SCY A;  3GFC A;  4A0B B;  5HYN B;  2AQ5 A;  1NR0 A;  2B5M A;  3EI1 A;  4BH6 A;  3U4Y A;  1K8K C;  4A09 B;  3J80 g;  3EQ8 A;  4J73 A;  4ERY A;  1JOF A;  4J77 A;  5C9Z B;  3OF7 A;  3MZL A;  1VE6 A;  2IUV A;  2XZG A;  4L1M A;  3I89 A;  4PBZ A;  3SBR A;  3AL8 B;  3O4H A;  3MMY A;  1GOF A;  4CC9 A;  2H6N A;  4ES0 A;  5IT9 g;  4DNV A;  5EMK B;  1UTC A;  4O45 A;  4PXW A;  2JKX A;  5IJ7 E;  1NEX B;  5TEE A;  4PSW B;  3O4I A;  2XL3 A;  3L4M D;  4QT8 A;  4IMM A;  2VC2 A;  2H9M A;  1H2Z A;  2VZ1 A;  2I3T A;  4AOW A;  3CFS B;  3K26 A;  2Z2N A;  4HDJ A;  1MG3 A;  5HE1 B;  3B7F A;  4AMZ A;  5CXB B;  3EWE A;  5GMK n;  4CY1 A;  5FA5 B;  1E8M A;  3IVM A;  3K72 A;  1QNI A;  3SLE D;  4NBM A;  5TDH B;  2YNP A;  3RFG A;  2IWF A;  3T3P A;  4FB1 D;  3IJE A;  2Z2O A;  4FAV D;  4GM3 A;  2HU5 A;  4LG9 A;  1O6G A;  3I2N A;  4JHP C;  3ZE1 A;  4H5I A;  4OZU A;  2J55 H;  1JMZ B;  4GGD A;  2P9K C;  1U4C A;  4I79 A;  3IUQ A;  2QC5 A;  2H14 A;  3I8E A;  3KRX B;  4CI3 A;  3RFH A;  1E8N A;  4RE5 A;  3UVN A;  3DDU A;  2VDP A;  3IIY A;  3SJL D;  3E0C A;  4CZV A;  3PVW B;  3EU7 A;  3NVX A;  4XEI C;  1YR2 A;  5HE2 B;  5IGO A;  3DXK C;  4AN1 A;  5GXI A;  2WQ8 A;  5K19 A;  3P4F A;  3OL2 A;  3OKY B;  5HQG A;  5C2W B;  3EI2 A;  4Z7Q A;  5EM2 B;  3K71 A;  1SQ9 A;  4K3J B;  4GQB B;  2H3X A;  2CNX A;  4AN0 A;  5FQD A;  1GG2 B;  1JTD B;  3N0D A;  2YMU A;  2HKM A;  4X60 B;  4JT5 C;  2BBK H;  5TF2 A;  5EAR A;  5EAP A;  3HFQ A;  3FRX A;  3NIF A;  3V4V A;  2AH1 A;  2XE4 A;  3EI1 B;  1R5M A;  3SMR A;  3A0F A;  2YNN A;  3IJ1 A;  3VH0 A;  2YB8 B;  2H9P A;  3ZE2 A;  2CE9 A;  4A2L A;  2BCJ B;  3V7D B;  2GC7 A;  2H13 A;  4GM9 A;  4E5Z A;  2IUR A;  2AGX A;  3RN0 D;  4TZ4 A;  3UKU C;  3IJ0 A;  4O9D A;  5IJ8 E;  3GD1 I;  2H9N A;  1L5G A;  2B5N A;  4PSX B;  3MVD K;  4ZOV A;  4J0W A;  4J78 A;  2QR5 A;  5KDO B;  4G55 A;  4AEZ A;  5GXH A;  1JJU B;  5E6U A;  5FKT A;  4G1M A;  5EMM B;  4BP9 A;  3QHY B;  3OKY A;  1UOO A;  2P9U C;  3AFC A;  4PBY A;  3N0E A;  1JMX B;  4DNW A;  5M5T A;  2VDN A;  4A08 B;  3O4J A;  4WK0 A;  3IKO A;  2HXC A;  3CIK B;  1N6E A;  2J57 G;  4U1E I;  4CZX A;  3JZH A;  2TRC B;  3UKR C;  4R7A B;  4QRJ A;  1GXR A;  1N6F A;  2UZY B;  5TEF A;  2HKR A;  2PM9 A;  2CN2 A;  4XYI A;  5EMJ B;  3AL9 A;  4A0A B;  5CYK A;  1XHM A;  1H2W A;  4WK2 A;  3J81 g;  1GOG A;  3DWL C;  3RSE C;  3PVU B;  2XYI A;  3DM0 A;  3F3F A;  2J56 H;  3FCS A;  4BCD A;  2IUP A;  4UI9 R;  3VI3 A;  2CO0 C;  2H68 A;  3PXT D;  4J82 A;  3EQ9 A;  3QI0 A;  2EIC A;  4ZOY A;  2HES X;  4QL1 A;  4AX4 A;  3DSM A;  3ZDX A;  1XKS A;  4G1E A;  3NIG A;  4MMX A;  3V4P A;  4O02 A;  2HYE A;  5H1M A;  1UOQ A;  2CN3 A;  1U2V C;  3KRW B;  2OIZ A;  4MK0 B;  4JSX C;  3OW8 A;  3SXT D;  2HJ4 A;  4D6V A;  1C9L A;  4L3H D;  4PNK B;  3IUN A;  4IRZ A;  5C2V B;  1O6F A;  5E6S A;  1QFM A;  4X63 B;  4K3I D;  2IAA A;  3T3M A;  4CY3 A;  1MG2 A;  3PXS D;  4FHL A;  3JZN A;  2PBI B;  3IUJ A;  4E54 A;  3MZK A;  4Z7N A;  4JHN A;  4DNU A;  2VDM A;  3EI3 A;  4J8B A;  1RI6 A;  1VZ3 A;  4L1Q D;  2H47 A;  4BP8 A;  5E6R A;  5AFU 3;  1XIP A;  5M5V A;  3JRO A;  1JV2 A;  1B9Y A;  2PM7 B;  1H2X A;  3UVM A;  4FAN D;  4MMZ A;  1VE7 A;  3K27 A;  5CXC A;  1GP2 B;  1GOT B;  3MKS B;  3BWS A;  3RRM C;  5K1C C;  1UOP A;  2VDO A;  2VDR A;  2VDL A;  1S4U X;  2UZX B;  2O9K A;  2OK4 A;  3ZDZ A;  1PEV A;  5AJA A;  3C9C A;  4ZOZ A;  5AMS A;  1SQJ A;  5FKQ A;  4D9S A;  1YFQ A;  4A2M A;  4CI1 A;  5FKR A;  5I5I A;  4GGA A;  3IJC A;  3BG1 A;  3EI4 B;  3EMH A;  3SHF A;  3GRE A;  3JZG A;  1GOH A;  3UR4 A;  3SN6 B;  2P9S C;  3EI3 B;  4G56 B;  4XYH A;  3UVL A;  4JD2 C;  2EIB A;  4PC0 A;  4ERZ A;  5M5S A;  3AH8 B;  5SXM A;  3O4G A;  2P9P C;  4GQ1 A;  3KCI A;  1TYE A;  4J79 A;  3PSC B;  3JB9 L;  1PGU A;  4L3G D;  3AL8 A;  3W15 A;  3ORV D;  4O3T B;  4ERQ A;  3EQ7 A;  2HU8 A;  4D0K A;  2I3S A;  1E5T A;  4A7J A;  3MUO A;  3RLM D;  3PE7 A;  2AGW A;  2B5L A;  1QFS A;  5B4W A;  3I7N A;  3UVO A;  3IUL A;  3JPX A;  1OMW B;  3F3P A;  4FA1 D;  4IA9 A;  4ZN4 A;  4GZ8 A;  4GQ2 P;  1OLZ A;  4A0B A;  2P9I C;  1SHY B;  4L9O A;  4O2W A;  4A08 A;  3EG6 A;  3EI2 B;  5CXC B;  3VI4 A; 
#chains in the Genus database with same CATH homology
 2OK6 A;  1ERJ A;  4BL0 A;  1K32 A;  3OKW A;  5FKS A;  2EBS A;  2YNO A;  4H5J A;  5EML B;  5EM2 A;  4Y5R D;  2IWK A;  5EAL A;  4O1Q D;  4J81 A;  3I7H A;  4GGC A;  2P9N C;  2W18 A;  4FA4 D;  1PI6 A;  1FWX A;  3RN1 D;  4A0A A;  2QXV A;  1L0Q A;  5IGQ A;  2AH0 A;  2HJB A;  4OWR A;  4JSV C;  3VA6 A;  3FM0 A;  4CZY A;  3SVW D;  3JRP A;  3L4O D;  5I5J A;  2AGY A;  3F3G A;  3FGB A;  2IUQ A;  3BG0 A;  5FLX g;  1TBG A;  3I7P A;  3NVN A;  4X3E A;  4E5Z B;  2PM9 B;  3SBQ A;  3EI4 A;  3OTT A;  4CI2 A;  5I5M A;  2Q7Q A;  5HE0 B;  3V9F A;  4A09 A;  2CE8 A;  4J87 A;  2I0T A;  4J8G A;  5GSA A;  2AGZ A;  3CFV A;  5CYK B;  4Z8L A;  3SWS D;  3UVK A;  2H6K A;  1P22 A;  3I8C A;  3ODT A;  4CY5 A;  1A0R B;  4ESG A;  4J84 A;  3JAM g;  2G99 A;  2I0R A;  2XL2 A;  4X61 B;  4YVD A;  2OVQ B;  4EWR A;  3C99 A;  3MKQ A;  1MDA H;  4QQE A;  5IC7 A;  2PM6 B;  2YBA A;  5CXB A;  3PXW D;  3SBP A;  4JSP C;  3OKT A;  2OVR B;  4A11 B;  2OJY A;  3C5M A;  4FWW A;  3PSL A;  4CI8 A;  4JXM A;  4LGN A;  4LG8 A;  4NSX A;  3RMZ D;  5H14 A;  3VGZ A;  3I7K A;  2GNQ A;  4ZOX A;  5HE3 B;  3ULE C;  4E54 B;  4O3U B;  4KFM B;  2I0S A;  4N14 A;  5H17 A;  4J86 A;  2GC4 A;  1TYQ C;  2CO0 A;  4JT6 C;  2B4E A;  4GM8 A;  4Y7R A;  3ZWL B;  2P9L C;  3I7L A;  1VYH C;  5EAM A;  2OVP B;  4JSN C;  5THA A;  2MTA H;  3DXM C;  4GMB A;  4CY2 A;  4FA5 D;  4FA9 D;  3C75 H;  1PBY B;  2Z2P A;  4BUJ C;  4U7A A;  3MXX A;  2H6Q A;  4J0X A;  1Q47 A;  3NVQ A;  3SFZ A;  3I7O A;  2H9L A;  5JWZ A;  5A2Q g;  4A11 A;  3V5W B;  2AGL A;  2G9A A;  2XU7 A;  3IIW A;  5FXY A;  3OL2 B;  1N6D A;  1B9X A;  3SCY A;  3GFC A;  4A0B B;  5HYN B;  2AQ5 A;  1NR0 A;  2B5M A;  3EI1 A;  4BH6 A;  3U4Y A;  1K8K C;  4A09 B;  3J80 g;  4J73 A;  4ERY A;  1JOF A;  4J77 A;  5C9Z B;  3MZL A;  2IUV A;  3I89 A;  4PBZ A;  3SBR A;  3AL8 B;  4CC9 A;  3MMY A;  4ES0 A;  2H6N A;  5IT9 g;  5EMK B;  4O45 A;  4PXW A;  5IJ7 E;  1NEX B;  5TEE A;  4PSW B;  2XL3 A;  3L4M D;  4QT8 A;  4IMM A;  2H9M A;  2I3T A;  4AOW A;  3CFS B;  3K26 A;  2Z2N A;  4HDJ A;  1MG3 A;  5HE1 B;  3B7F A;  5CXB B;  3EWE A;  5GMK n;  4CY1 A;  5FA5 B;  1QNI A;  3SLE D;  5TDH B;  3RFG A;  2YNP A;  4FB1 D;  2IWF A;  4FAV D;  2Z2O A;  4GM3 A;  4LG9 A;  3I2N A;  4H5I A;  4OZU A;  2J55 H;  1JMZ B;  4GGD A;  2P9K C;  1U4C A;  4I79 A;  2QC5 A;  2H14 A;  3I8E A;  3KRX B;  4CI3 A;  3RFH A;  3UVN A;  3IIY A;  3SJL D;  3E0C A;  4CZV A;  3PVW B;  3EU7 A;  3NVX A;  4XEI C;  5HE2 B;  5IGO A;  3DXK C;  5GXI A;  5K19 A;  3P4F A;  3OL2 A;  3OKY B;  5HQG A;  5C2W B;  3EI2 A;  5EM2 B;  1SQ9 A;  4K3J B;  4GQB B;  2H3X A;  2CNX A;  5FQD A;  1GG2 B;  3N0D A;  2YMU A;  2HKM A;  4X60 B;  4JT5 C;  2BBK H;  5TF2 A;  5EAR A;  5EAP A;  3HFQ A;  3FRX A;  2AH1 A;  3EI1 B;  1R5M A;  3SMR A;  3A0F A;  2YNN A;  3IJ1 A;  3VH0 A;  2YB8 B;  2H9P A;  2CE9 A;  4A2L A;  2BCJ B;  3V7D B;  2GC7 A;  2H13 A;  4GM9 A;  4E5Z A;  2IUR A;  2AGX A;  3RN0 D;  4TZ4 A;  3UKU C;  3IJ0 A;  4O9D A;  5IJ8 E;  2H9N A;  2B5N A;  4PSX B;  4ZOV A;  4J0W A;  4J78 A;  5KDO B;  4AEZ A;  5GXH A;  1JJU B;  5FKT A;  5EMM B;  3OKY A;  2P9U C;  3AFC A;  4PBY A;  3N0E A;  1JMX B;  4A08 B;  3IKO A;  2HXC A;  3CIK B;  1N6E A;  2J57 G;  4U1E I;  4CZX A;  3JZH A;  2TRC B;  3UKR C;  4R7A B;  4QRJ A;  1GXR A;  1N6F A;  2UZY B;  5TEF A;  2HKR A;  2PM9 A;  4XYI A;  2CN2 A;  5EMJ B;  3AL9 A;  4A0A B;  5CYK A;  1XHM A;  3J81 g;  3DWL C;  3RSE C;  2XYI A;  3DM0 A;  3F3F A;  2J56 H;  3PVU B;  2IUP A;  4UI9 R;  2CO0 C;  2H68 A;  3PXT D;  4J82 A;  4ZOY A;  2HES X;  4QL1 A;  3DSM A;  1XKS A;  2HYE A;  5H1M A;  2CN3 A;  1U2V C;  3KRW B;  2OIZ A;  4MK0 B;  4JSX C;  3OW8 A;  3SXT D;  2HJ4 A;  4D6V A;  4L3H D;  4PNK B;  5C2V B;  4X63 B;  4K3I D;  2IAA A;  4CY3 A;  1MG2 A;  3PXS D;  4FHL A;  3JZN A;  2PBI B;  4E54 A;  3MZK A;  3EI3 A;  4J8B A;  1RI6 A;  4L1Q D;  2H47 A;  5AFU 3;  1XIP A;  3JRO A;  1B9Y A;  2PM7 B;  3UVM A;  4FAN D;  5CXC A;  3K27 A;  1GP2 B;  1GOT B;  3MKS B;  3BWS A;  3RRM C;  5K1C C;  1S4U X;  2UZX B;  2O9K A;  2OK4 A;  1PEV A;  5AJA A;  3C9C A;  4ZOZ A;  5AMS A;  1SQJ A;  5FKQ A;  1YFQ A;  4A2M A;  4CI1 A;  5FKR A;  5I5I A;  4GGA A;  3IJC A;  3BG1 A;  3EI4 B;  3EMH A;  3SHF A;  3GRE A;  3JZG A;  3UR4 A;  3SN6 B;  2P9S C;  3EI3 B;  4G56 B;  4XYH A;  3UVL A;  4JD2 C;  4PC0 A;  4ERZ A;  3AH8 B;  5SXM A;  2P9P C;  4GQ1 A;  4J79 A;  3PSC B;  3JB9 L;  1PGU A;  4L3G D;  3AL8 A;  3W15 A;  3ORV D;  4O3T B;  4ERQ A;  4D0K A;  2I3S A;  4A7J A;  3RLM D;  2AGW A;  2B5L A;  3PE7 A;  5B4W A;  3I7N A;  3UVO A;  3JPX A;  1OMW B;  3F3P A;  4FA1 D;  4IA9 A;  4ZN4 A;  4GZ8 A;  4GQ2 P;  1OLZ A;  4A0B A;  2P9I C;  1SHY B;  4L9O A;  4A08 A;  3EG6 A;  3EI2 B;  5CXC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...