4ZOYA

Crystal structure of the chaetomium thermophilum sqt1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
487
structure length
406
Chain Sequence
ENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISAATSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDANPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLQAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGTAGPSGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEAGSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Chaperone
molecule keywords Sqt1
total genus 106
structure length 406
sequence length 487
ec nomenclature
pdb deposition date 2015-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zoyA00
3ORVD 3JZHA 3OTTA 4OWRA 5I5MA 3EI2A 3RSEC 3KRXB 5KDOB 4CI2A 3SVWD 4A0AB 3V7DB 5EAMA 5FQDA 3RN1D 1N6FA 4R7AB 3DSMA 4ZOYA 3IJ1A 5SXMA 3I7HA 2QXVA 3UKRC 3K27A 4E54B 4FA4D 2EBSA 3VGZA 2AGYA 4PBYA 3SWSD 5HYNB 5A2Qg 3SCYA 1S4UX 4CY1A 4FA5D 1R5MA 3F3PA 4X61B 5EMJB 2YMUA 3ZWLB 5CXCB 4JSPC 5FKTA 2P9SC 1FWXA 3NVXA 3IIWA 4LG8A 3OKTA 2OVRB 2AGLA 3I7KA 3AH8B 3JROA 3SMRA 4JT5C 4J79A 4O1QD 1ERJA 1GP2B 2XL3A 2H6NA 2H47A 5H14A 1GXRA 1N6DA 3EI4A 5CYKB 5IC7A 3RFHA 3FRXA 5TEEA 5EMLB 2IUPA 4PBZA 4A08B 3DM0A 1PBYB 4PSXB 3ODTA 3IJCA 3N0EA 4CI8A 3IJ0A 4FA1D 3DXKC 5HE3B 4E5ZA 2I3SA 3EWEA 2IWKA 2PBIB 1JMZB 3BG0A 2Z2NA 3EG6A 5EMKB 4XYIA 2H9LA 4GQ1A 2B5NA 4H5JA 4CZVA 4U1EI 1PI6A 2PM6B 3C5MA 1XIPA 4JXMA 1U2VC 5CXBB 4ZOZA 2XU7A 5IGOA 2I0RA 5H17A 5GSAA 1OLZA 4LG9A 3PE7A 4JSXC 2GC4A 2OVQB 3JAMg 3CFVA 2P9NC 4U7AA 3MMYA 5GXHA 4KFMB 4L9OA 4NSXA 4ESGA 4XEIC 3V5WB 2B5LA 5EALA 4JSVC 4G56B 4K3JB 3RN0D 4A0BA 3OW8A 3MXXA 4Y5RD 5K19A 4GGAA 3AL8A 4JD2C 2IAAA 5I5JA 3SXTD 4ZOXA 2YNNA 3JZNA 3OKWA 3PXTD 4GZ8A 2PM9A 3UVMA 3F3FA 3FGBA 5CYKA 3C99A 4FHLA 4ZOVA 4J82A 1GG2B 2H6KA 2HESX 5HE0B 2TRCB 2G9AA 2HYEA 2AGZA 3JB9L 1B9XA 4ERYA 2Z2OA 2GNQA 2P9IC 3JZGA 1PEVA 3CFSB 4A2MA 5FKSA 3P4FA 4Y7RA 4BL0A 3MKQA 1SHYB 4IA9A 3SBRA 2W18A 4AEZA 5HE2B 2UZXB 2H6QA 4QRJA 3L4MD 4GMBA 3KRWB 1MG2A 3B7FA 1L0QA 5IJ8E 3I7NA 2IWFA 5EM2A 2J56H 2AH1A 3EI1A 2P9KC 4L3GD 5THAA 4O3TB 2B5MA 3SHFA 1N6EA 3AL9A 3EI2B 3PSLA 2QC5A 5FXYA 5C2VB 3IIYA 3K26A 2G99A 2P9UC 1K32A 4GQ2P 5GMKn 5FKRA 4A09A 4IMMA 5EARA 4CY2A 5K1CC 3IKOA 2OIZA 4ES0A 4CY3A 3GREA 4GQBB 1VYHC 2J55H 1NR0A 3UVLA 2AGXA 4J0XA 3JRPA 2BBKH 4GGCA 2PM9B 2YB8B 3FM0A 4ZN4A 2CN3A 4GM8A 5I5IA 4CZYA 4FAND 4FA9D 4J0WA 5CXCA 3PXSD 3BWSA 4J77A 4FB1D 4PXWA 4L1QD 3SBQA 4A11B 3SLED 3RLMD 2HKMA 2CE9A 4QL1A 3RMZD 4O9DA 2CE8A 2GC7A 2AH0A 3I8CA 1MDAH 5CXBA 2H3XA 2IUVA 3DWLC 5AJAA 3AL8B 2OK4A 3EI3A 1OMWB 3SFZA 5EAPA 5FKQA 3UR4A 1MG3A 4X3EA 4LGNA 4CZXA 4E5ZB 4JSNC 4ERZA 3HFQA 2OJYA 2OK6A 3U4YA 5GXIA 3MZKA 4E54A 4EWRA 2UZYB 4PC0A 3PXWD 3RRMC 5HE1B 3PVUB 3L4OD 1B9YA 2CN2A 5TF2A 2I3TA 1P22A 4D0KA 3I7LA 2HJBA 4JT6C 3UVKA 1XKSA 3PSCB 2CO0A 2IURA 3MZLA 4TZ4A 2AGWA 2OVPB 3C75H 3RFGA 2H68A 2XYIA 2HKRA 3A0FA 3OL2B 5H1MA 1TBGA 1SQJA 4K3ID 4X63B 4A08A 2YBAA 4AOWA 2XL2A 3EU7A 3I7PA 1RI6A 1QNIA 5B4WA 4CI1A 1JMXB 2CNXA 3JPXA 4A0AA 1NEXB 4PSWB 5AMSA 3EMHA 3SBPA 4GM3A 4UI9R 1JJUB 3BG1A 3I89A 2H9MA 4FWWA 3ULEC 4CY5A 3EI1B 2BCJB 3EI3B 3NVQA 3OKYB 2HXCA 2Q7QA 3I2NA 2J57G 4BH6A 2H9NA 3C9CA 1K8KC 4PNKB 2I0SA 5FLXg 2H14A 2P9PC 5IT9g 3F3GA 4J86A 4ERQA 4A11A 4J81A 1XHMA 2P9LC 2YNOA 5FA5B 4A2LA 5IGQA 4Z8LA 3UKUC 2IUQA 1YFQA 2I0TA 2CO0C 4QQEA 3EI4B 2AQ5A 4J8BA 4XYHA 4J78A 2PM7B 1A0RB 4A0BB 3MKSB 5TDHB 4HDJA 4GGDA 3I8EA 1Q47A 5IJ7E 2O9KA 1JOFA 4L3HD 5HQGA 5C2WB 3NVNA 4CI3A 2H13A 3J81g 4J8GA 4BUJC 4J87A 2B4EA 3SJLD 4N14A 4FAVD 4D6VA 4O45A 3SN6B 4X60B 2HJ4A 4YVDA 4A09B 3I7OA 3VH0A 4GM9A 1U4CA 5C9ZB 2H9PA 3AFCA 4I79A 2Z2PA 3N0DA 4J73A 3UVNA 1GOTB 4O3UB 5TEFA 3W15A 1PGUA 3DXMC 3UVOA 4J84A 4A7JA 5EMMB 2MTAH 4H5IA 3J80g 4MK0B 3V9FA 4CC9A 5AFU3 3OKYA 2YNPA 4OZUA 5EM2B 3GFCA 4QT8A 3VA6A 3E0CA 3OL2A 5JWZA 1SQ9A 3CIKB 1TYQC 3PVWB
chains in the Genus database with same CATH superfamily
1VZ2A 3ORVD 4RE5A 3JZHA 3OTTA 1L5GA 4OWRA 5I5MA 3EI2A 3RSEC 3KRXB 5KDOB 3ZE1A 4CI2A 3SVWD 4A0AB 3V7DB 5EAMA 5FQDA 3RN1D 3DDUA 1N6FA 3EQ8A 4R7AB 3DSMA 4ZOYA 5FFOA 3IJ1A 5SXMA 3I7HA 2QXVA 3UKRC 3K27A 4E54B 4FA4D 2EBSA 3VGZA 1C9IA 4WK2A 2AGYA 4PBYA 4WK0A 3SWSD 5C92A 5HYNB 5A2Qg 3SCYA 1S4UX 4CY1A 4FA5D 1R5MA 3F3PA 4X61B 5EMJB 2YMUA 3ZWLB 5CXCB 4JSPC 5FKTA 3O4IA 2P9SC 1FWXA 3EQ7A 3NVXA 3IIWA 4DNUA 4BCDA 4LG8A 3OKTA 2OVRB 2AGLA 3I7KA 3AH8B 3FCUA 1JTDB 3JROA 3SMRA 1GOGA 4J79A 4JT5C 1ERJA 4O1QD 1GP2B 2XL3A 2H6NA 2H47A 4IRZA 5H14A 1GXRA 1N6DA 3EI4A 5CYKB 5IC7A 3VI3A 5M5UA 1QFSA 3RFHA 3FRXA 5TEEA 5EMLB 4AMYA 2IUPA 4PBZA 1H2ZA 4A08B 3DM0A 1PBYB 3ODTA 4PSXB 3IJCA 3N0EA 4CI8A 3IJ0A 4G1MA 5E6RA 4FA1D 5M5VA 3DXKC 5HE3B 4E5ZA 2I3SA 5HDBA 3EWEA 2IWKA 2PBIB 1JMZB 3BG0A 2Z2NA 3EG6A 5EMKB 1T2XA 2VDQA 4XYIA 2H9LA 5E6SA 2HU8A 2B5NA 4GQ1A 4H5JA 4CZVA 4UM9A 4U1EI 3NIGA 1PI6A 2PM6B 1TYEA 3C5MA 1XIPA 2EIEA 4JXMA 1U2VC 5CXBB 4ZOZA 2XU7A 3ZE2A 2JKXA 4AMZA 5IGOA 2I0RA 5H17A 5GSAA 1OLZA 1GOFA 4LG9A 3PE7A 4JSXC 2GC4A 2OVQB 3IVMA 3JAMg 3CFVA 2P9NC 1UOOA 4QAMA 4U7AA 3MMYA 2VDRA 2VDKA 4WJKA 5GXHA 4KFMB 4L9OA 1M1XA 4NSXA 4ESGA 3IUJA 4MMXA 4XEIC 4BCBA 3V5WB 2B5LA 5EALA 4JSVC 4G56B 4K3JB 3RN0D 4A0BA 3OW8A 3MXXA 4Y5RD 5K19A 4GGAA 3AL8A 4JD2C 3IUQA 2IAAA 5I5JA 3SXTD 4ZOXA 4BCCA 2YNNA 1QFMA 3JZNA 3OKWA 3PXTD 4GZ8A 2PM9A 3UVMA 3F3FA 3FGBA 5CYKA 3C99A 4FHLA 4ZOVA 4J82A 1YR2A 1GG2B 2H6KA 2HESX 3IULA 5HE0B 2TRCB 2G9AA 3GD1I 3NIFA 2HYEA 2AGZA 3JB9L 1B9XA 4ERYA 2Z2OA 3K71A 2VDLA 2GNQA 2P9IC 2VC2A 3JZGA 4Z7QA 4G55A 1PEVA 3CFSB 4A2MA 5FKSA 3P4FA 4Y7RA 4BL0A 3MKQA 1SHYB 4IA9A 3SBRA 2W18A 4AEZA 5HE2B 2UZXB 2H6QA 4QRJA 3L4MD 4GMBA 3KRWB 1MG2A 3B7FA 1L0QA 5IJ8E 3I7NA 2IWFA 5EM2A 4Z7NA 3GC3B 3IUMA 2J56H 2AH1A 3EI1A 1UOPA 2P9KC 4L3GD 5THAA 4O3TB 2B5MA 3IUNA 3SHFA 3IURA 1N6EA 3AL9A 3EI2B 3PSLA 2QC5A 5FXYA 5C2VB 3IIYA 3K26A 2G99A 2P9UC 1K32A 4GQ2P 5GMKn 2VDPA 5FKRA 4A09A 4IMMA 5EARA 4CY2A 5K1CC 3IKOA 3V4VA 2OIZA 4ES0A 4CY3A 3GREA 4GQBB 1VYHC 2J55H 1NR0A 3UVLA 2AGXA 2XE4A 4J0XA 3JRPA 2BBKH 4MMYA 4GGCA 2PM9B 2VDOA 2YB8B 3FM0A 2HU5A 4ZN4A 2CN3A 4GM8A 1VE6A 5I5IA 4CZYA 4FAND 4FA9D 3K72A 4J0WA 5CXCA 3PXSD 3BWSA 1E8MA 4J77A 5FFGA 4FB1D 4PXWA 4L1QD 3MUNA 3SBQA 4A11B 3SLED 3RLMD 2HKMA 2CE9A 4UM8A 4QL1A 1E5TA 3RMZD 2VDNA 4NAAA 4O9DA 2CE8A 2GC7A 2AH0A 3I8CA 1MDAH 5CXBA 4NBMA 2QZPA 1H2XA 2H3XA 2IUVA 3KCIA 1H2YA 3DWLC 5AJAA 3AL8B 2OK4A 4Z7OA 3EI3A 1OMWB 3SFZA 1VZ3A 5EAPA 5FKQA 3UR4A 5M5SA 1MG3A 4X3EA 3T3PA 4D9SA 3QI0A 4LGNA 2WQ8A 4CZXA 4E5ZB 4JSNC 4ERZA 3HFQA 4JHNA 3NIDA 2OJYA 4NC4A 2OK6A 3U4YA 5GXIA 3MZKA 4E54A 4EWRA 2UZYB 4PC0A 3PXWD 3RRMC 5HE1B 3PVUB 3L4OD 1B9YA 2CN2A 5TF2A 1A12A 2I3TA 1P22A 4O2WA 4D0KA 3I7LA 1I2MB 2HJBA 4JT6C 1H2WA 3UVKA 1XKSA 3PSCB 2CO0A 2IURA 3MZLA 1GOHA 4TZ4A 2AGWA 2OVPB 3C75H 3RFGA 2H68A 3EQ9A 4DNVA 2XYIA 2EIDA 5M5RA 1O6GA 2HKRA 5M5TA 3A0FA 3OL2B 5H1MA 1TBGA 1SQJA 4AN0A 4K3ID 4X63B 4A08A 3O4JA 2YBAA 1JV2A 2XL2A 4AOWA 3EU7A 2BKLA 3I7PA 1RI6A 4O02A 4MMZA 1QNIA 5B4WA 4CI1A 1JMXB 3IJEA 2CNXA 2VZ1A 3JPXA 4A0AA 3O4HA 1NEXB 4PSWB 5AMSA 3EMHA 3SBPA 4G1EA 4GM3A 4UI9R 1JJUB 3T3MA 3BG1A 3I89A 1UOQA 3ZDZA 2H9MA 4AN1A 4FWWA 3ULEC 4CY5A 3EI1B 4BP9A 2BCJB 1BPOA 3EI3B 3NVQA 3OKYB 2HXCA 2Q7QA 3I2NA 2J57G 1O6FA 5M61A 4BH6A 2H9NA 3C9CA 1K8KC 4PNKB 2I0SA 5E6UA 5FLXg 2H14A 2P9PC 3O4GA 5IT9g 2EICA 3F3GA 1U8CA 2HU7A 4J86A 4ERQA 3MVDK 4A11A 4J81A 1XHMA 2P9LC 2YNOA 5FA5B 4A2LA 5IGQA 2XZGA 4JHPC 4Z8LA 3UKUC 2IUQA 3FCSA 1YFQA 2I0TA 2CO0C 3QHYB 4QQEA 3EI4B 2AQ5A 4J8BA 1UTCA 4BP8A 4XYHA 4J78A 1C9LA 2PM7B 1A0RB 4A0BB 3MKSB 5TDHB 4HDJA 4GGDA 4L1MA 3I8EA 1Q47A 2VDMA 5IJ7E 2O9KA 1JOFA 4L3HD 5HQGA 5C2WB 3NVNA 2XDWA 3ZDYA 4CI3A 5C86A 2H13A 4AX4A 3J81g 4J8GA 4BUJC 4J87A 2B4EA 3SJLD 4N14A 4FAVD 4D6VA 4O45A 3SN6B 4X60B 2HJ4A 3MUOA 4YVDA 4A09B 3I7OA 3VH0A 4GM9A 1U4CA 3ZE0A 5C9ZB 3VI4A 2H9PA 4WK4A 3AFCA 4I79A 2Z2PA 3N0DA 4J73A 3UVNA 1E8NA 1GOTB 4O3UB 5TEFA 3W15A 1PGUA 3DXMC 4NENA 3UVOA 4J84A 4A7JA 5EMMB 3K6SA 1K3IA 2MTAH 4H5IA 3J80g 4MK0B 3V9FA 4CC9A 5AFU3 3OKYA 2YNPA 4OZUA 2QR5A 2EIBA 3V4PA 3ZDXA 5EM2B 3GFCA 4QT8A 3VA6A 3E0CA 2VZ3A 1VE7A 3OL2A 5JWZA 1SQ9A 3CIKB 1TYQC 3PVWB 3OF7A 4RE6A 4DNWA
chains in the Genus database with same CATH topology
3ORVD 3JZHA 3OTTA 4OWRA 5I5MA 3EI2A 3RSEC 3KRXB 5KDOB 4CI2A 3SVWD 4A0AB 3V7DB 5EAMA 5FQDA 3RN1D 1N6FA 4R7AB 3DSMA 4ZOYA 3IJ1A 5SXMA 3I7HA 2QXVA 3UKRC 3K27A 4E54B 4FA4D 2EBSA 3VGZA 2AGYA 4PBYA 3SWSD 5HYNB 5A2Qg 3SCYA 1S4UX 4CY1A 4FA5D 1R5MA 3F3PA 4X61B 5EMJB 2YMUA 3ZWLB 5CXCB 4JSPC 5FKTA 2P9SC 1FWXA 3NVXA 3IIWA 4LG8A 3OKTA 2OVRB 2AGLA 3I7KA 3AH8B 3JROA 3SMRA 4JT5C 4J79A 4O1QD 1ERJA 1GP2B 2XL3A 2H6NA 2H47A 5H14A 1GXRA 1N6DA 3EI4A 5CYKB 5IC7A 3RFHA 3FRXA 5TEEA 5EMLB 2IUPA 4PBZA 4A08B 3DM0A 1PBYB 4PSXB 3ODTA 3IJCA 3N0EA 4CI8A 3IJ0A 4FA1D 3DXKC 5HE3B 4E5ZA 2I3SA 3EWEA 2IWKA 2PBIB 1JMZB 3BG0A 2Z2NA 3EG6A 5EMKB 4XYIA 2H9LA 4GQ1A 2B5NA 4H5JA 4CZVA 4U1EI 1PI6A 2PM6B 3C5MA 1XIPA 4JXMA 1U2VC 5CXBB 4ZOZA 2XU7A 5IGOA 2I0RA 5H17A 5GSAA 1OLZA 4LG9A 3PE7A 4JSXC 2GC4A 2OVQB 3JAMg 3CFVA 2P9NC 4U7AA 3MMYA 5GXHA 4KFMB 4L9OA 4NSXA 4ESGA 4XEIC 3V5WB 2B5LA 5EALA 4JSVC 4G56B 4K3JB 3RN0D 4A0BA 3OW8A 3MXXA 4Y5RD 5K19A 4GGAA 3AL8A 4JD2C 2IAAA 5I5JA 3SXTD 4ZOXA 2YNNA 3JZNA 3OKWA 3PXTD 4GZ8A 2PM9A 3UVMA 3F3FA 3FGBA 5CYKA 3C99A 4FHLA 4ZOVA 4J82A 1GG2B 2H6KA 2HESX 5HE0B 2TRCB 2G9AA 2HYEA 2AGZA 3JB9L 1B9XA 4ERYA 2Z2OA 2GNQA 2P9IC 3JZGA 1PEVA 3CFSB 4A2MA 5FKSA 3P4FA 4Y7RA 4BL0A 3MKQA 1SHYB 4IA9A 3SBRA 2W18A 4AEZA 5HE2B 2UZXB 2H6QA 4QRJA 3L4MD 4GMBA 3KRWB 1MG2A 3B7FA 1L0QA 5IJ8E 3I7NA 2IWFA 5EM2A 2J56H 2AH1A 3EI1A 2P9KC 4L3GD 5THAA 4O3TB 2B5MA 3SHFA 1N6EA 3AL9A 3EI2B 3PSLA 2QC5A 5FXYA 5C2VB 3IIYA 3K26A 2G99A 2P9UC 1K32A 4GQ2P 5GMKn 5FKRA 4A09A 4IMMA 5EARA 4CY2A 5K1CC 3IKOA 2OIZA 4ES0A 4CY3A 3GREA 4GQBB 1VYHC 2J55H 1NR0A 3UVLA 2AGXA 4J0XA 3JRPA 2BBKH 4GGCA 2PM9B 2YB8B 3FM0A 4ZN4A 2CN3A 4GM8A 5I5IA 4CZYA 4FAND 4FA9D 4J0WA 5CXCA 3PXSD 3BWSA 4J77A 4FB1D 4PXWA 4L1QD 3SBQA 4A11B 3SLED 3RLMD 2HKMA 2CE9A 4QL1A 3RMZD 4O9DA 2CE8A 2GC7A 2AH0A 3I8CA 1MDAH 5CXBA 2H3XA 2IUVA 3DWLC 5AJAA 3AL8B 2OK4A 3EI3A 1OMWB 3SFZA 5EAPA 5FKQA 3UR4A 1MG3A 4X3EA 4LGNA 4CZXA 4E5ZB 4JSNC 4ERZA 3HFQA 2OJYA 2OK6A 3U4YA 5GXIA 3MZKA 4E54A 4EWRA 2UZYB 4PC0A 3PXWD 3RRMC 5HE1B 3PVUB 3L4OD 1B9YA 2CN2A 5TF2A 2I3TA 1P22A 4D0KA 3I7LA 2HJBA 4JT6C 3UVKA 1XKSA 3PSCB 2CO0A 2IURA 3MZLA 4TZ4A 2AGWA 2OVPB 3C75H 3RFGA 2H68A 2XYIA 2HKRA 3A0FA 3OL2B 5H1MA 1TBGA 1SQJA 4K3ID 4X63B 4A08A 2YBAA 4AOWA 2XL2A 3EU7A 3I7PA 1RI6A 1QNIA 5B4WA 4CI1A 1JMXB 2CNXA 3JPXA 4A0AA 1NEXB 4PSWB 5AMSA 3EMHA 3SBPA 4GM3A 4UI9R 1JJUB 3BG1A 3I89A 2H9MA 4FWWA 3ULEC 4CY5A 3EI1B 2BCJB 3EI3B 3NVQA 3OKYB 2HXCA 2Q7QA 3I2NA 2J57G 4BH6A 2H9NA 3C9CA 1K8KC 4PNKB 2I0SA 5FLXg 2H14A 2P9PC 5IT9g 3F3GA 4J86A 4ERQA 4A11A 4J81A 1XHMA 2P9LC 2YNOA 5FA5B 4A2LA 5IGQA 4Z8LA 3UKUC 2IUQA 1YFQA 2I0TA 2CO0C 4QQEA 3EI4B 2AQ5A 4J8BA 4XYHA 4J78A 2PM7B 1A0RB 4A0BB 3MKSB 5TDHB 4HDJA 4GGDA 3I8EA 1Q47A 5IJ7E 2O9KA 1JOFA 4L3HD 5HQGA 5C2WB 3NVNA 4CI3A 2H13A 3J81g 4J8GA 4BUJC 4J87A 2B4EA 3SJLD 4N14A 4FAVD 4D6VA 4O45A 3SN6B 4X60B 2HJ4A 4YVDA 4A09B 3I7OA 3VH0A 4GM9A 1U4CA 5C9ZB 2H9PA 3AFCA 4I79A 2Z2PA 3N0DA 4J73A 3UVNA 1GOTB 4O3UB 5TEFA 3W15A 1PGUA 3DXMC 3UVOA 4J84A 4A7JA 5EMMB 2MTAH 4H5IA 3J80g 4MK0B 3V9FA 4CC9A 5AFU3 3OKYA 2YNPA 4OZUA 5EM2B 3GFCA 4QT8A 3VA6A 3E0CA 3OL2A 5JWZA 1SQ9A 3CIKB 1TYQC 3PVWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ORV D;  3JZH A;  3OTT A;  4OWR A;  5I5M A;  3EI2 A;  3RSE C;  3KRX B;  5KDO B;  4CI2 A;  3SVW D;  4A0A B;  3V7D B;  5EAM A;  5FQD A;  3RN1 D;  1N6F A;  4R7A B;  3DSM A;  4ZOY A;  3IJ1 A;  5SXM A;  3I7H A;  2QXV A;  3UKR C;  3K27 A;  4E54 B;  4FA4 D;  2EBS A;  3VGZ A;  2AGY A;  4PBY A;  3SWS D;  5HYN B;  5A2Q g;  3SCY A;  1S4U X;  4CY1 A;  4FA5 D;  1R5M A;  3F3P A;  4X61 B;  5EMJ B;  2YMU A;  3ZWL B;  5CXC B;  4JSP C;  5FKT A;  2P9S C;  1FWX A;  3NVX A;  3IIW A;  4LG8 A;  3OKT A;  2OVR B;  2AGL A;  3I7K A;  3AH8 B;  3JRO A;  3SMR A;  4JT5 C;  4J79 A;  4O1Q D;  1ERJ A;  1GP2 B;  2XL3 A;  2H6N A;  2H47 A;  5H14 A;  1GXR A;  1N6D A;  3EI4 A;  5CYK B;  5IC7 A;  3RFH A;  3FRX A;  5TEE A;  5EML B;  2IUP A;  4PBZ A;  4A08 B;  3DM0 A;  1PBY B;  4PSX B;  3ODT A;  3IJC A;  3N0E A;  4CI8 A;  3IJ0 A;  4FA1 D;  3DXK C;  5HE3 B;  4E5Z A;  2I3S A;  3EWE A;  2IWK A;  2PBI B;  1JMZ B;  3BG0 A;  2Z2N A;  3EG6 A;  5EMK B;  4XYI A;  2H9L A;  4GQ1 A;  2B5N A;  4H5J A;  4CZV A;  4U1E I;  1PI6 A;  2PM6 B;  3C5M A;  1XIP A;  4JXM A;  1U2V C;  5CXB B;  4ZOZ A;  2XU7 A;  5IGO A;  2I0R A;  5H17 A;  5GSA A;  1OLZ A;  4LG9 A;  3PE7 A;  4JSX C;  2GC4 A;  2OVQ B;  3JAM g;  3CFV A;  2P9N C;  4U7A A;  3MMY A;  5GXH A;  4KFM B;  4L9O A;  4NSX A;  4ESG A;  4XEI C;  3V5W B;  2B5L A;  5EAL A;  4JSV C;  4G56 B;  4K3J B;  3RN0 D;  4A0B A;  3OW8 A;  3MXX A;  4Y5R D;  5K19 A;  4GGA A;  3AL8 A;  4JD2 C;  2IAA A;  5I5J A;  3SXT D;  4ZOX A;  2YNN A;  3JZN A;  3OKW A;  3PXT D;  4GZ8 A;  2PM9 A;  3UVM A;  3F3F A;  3FGB A;  5CYK A;  3C99 A;  4FHL A;  4ZOV A;  4J82 A;  1GG2 B;  2H6K A;  2HES X;  5HE0 B;  2TRC B;  2G9A A;  2HYE A;  2AGZ A;  3JB9 L;  1B9X A;  4ERY A;  2Z2O A;  2GNQ A;  2P9I C;  3JZG A;  1PEV A;  3CFS B;  4A2M A;  5FKS A;  3P4F A;  4Y7R A;  4BL0 A;  3MKQ A;  1SHY B;  4IA9 A;  3SBR A;  2W18 A;  4AEZ A;  5HE2 B;  2UZX B;  2H6Q A;  4QRJ A;  3L4M D;  4GMB A;  3KRW B;  1MG2 A;  3B7F A;  1L0Q A;  5IJ8 E;  3I7N A;  2IWF A;  5EM2 A;  2J56 H;  2AH1 A;  3EI1 A;  2P9K C;  4L3G D;  5THA A;  4O3T B;  2B5M A;  3SHF A;  1N6E A;  3AL9 A;  3EI2 B;  3PSL A;  2QC5 A;  5FXY A;  5C2V B;  3IIY A;  3K26 A;  2G99 A;  2P9U C;  1K32 A;  4GQ2 P;  5GMK n;  5FKR A;  4A09 A;  4IMM A;  5EAR A;  4CY2 A;  5K1C C;  3IKO A;  2OIZ A;  4ES0 A;  4CY3 A;  3GRE A;  4GQB B;  1VYH C;  2J55 H;  1NR0 A;  3UVL A;  2AGX A;  4J0X A;  3JRP A;  2BBK H;  4GGC A;  2PM9 B;  2YB8 B;  3FM0 A;  4ZN4 A;  2CN3 A;  4GM8 A;  5I5I A;  4CZY A;  4FAN D;  4FA9 D;  4J0W A;  5CXC A;  3PXS D;  3BWS A;  4J77 A;  4FB1 D;  4PXW A;  4L1Q D;  3SBQ A;  4A11 B;  3SLE D;  3RLM D;  2HKM A;  2CE9 A;  4QL1 A;  3RMZ D;  4O9D A;  2CE8 A;  2GC7 A;  2AH0 A;  3I8C A;  1MDA H;  5CXB A;  2H3X A;  2IUV A;  3DWL C;  5AJA A;  3AL8 B;  2OK4 A;  3EI3 A;  1OMW B;  3SFZ A;  5EAP A;  5FKQ A;  3UR4 A;  1MG3 A;  4X3E A;  4LGN A;  4CZX A;  4E5Z B;  4JSN C;  4ERZ A;  3HFQ A;  2OJY A;  2OK6 A;  3U4Y A;  5GXI A;  3MZK A;  4E54 A;  4EWR A;  2UZY B;  4PC0 A;  3PXW D;  3RRM C;  5HE1 B;  3PVU B;  3L4O D;  1B9Y A;  2CN2 A;  5TF2 A;  2I3T A;  1P22 A;  4D0K A;  3I7L A;  2HJB A;  4JT6 C;  3UVK A;  1XKS A;  3PSC B;  2CO0 A;  2IUR A;  3MZL A;  4TZ4 A;  2AGW A;  2OVP B;  3C75 H;  3RFG A;  2H68 A;  2XYI A;  2HKR A;  3A0F A;  3OL2 B;  5H1M A;  1TBG A;  1SQJ A;  4K3I D;  4X63 B;  4A08 A;  2YBA A;  4AOW A;  2XL2 A;  3EU7 A;  3I7P A;  1RI6 A;  1QNI A;  5B4W A;  4CI1 A;  1JMX B;  2CNX A;  3JPX A;  4A0A A;  1NEX B;  4PSW B;  5AMS A;  3EMH A;  3SBP A;  4GM3 A;  4UI9 R;  1JJU B;  3BG1 A;  3I89 A;  2H9M A;  4FWW A;  3ULE C;  4CY5 A;  3EI1 B;  2BCJ B;  3EI3 B;  3NVQ A;  3OKY B;  2HXC A;  2Q7Q A;  3I2N A;  2J57 G;  4BH6 A;  2H9N A;  3C9C A;  1K8K C;  4PNK B;  2I0S A;  5FLX g;  2H14 A;  2P9P C;  5IT9 g;  3F3G A;  4J86 A;  4ERQ A;  4A11 A;  4J81 A;  1XHM A;  2P9L C;  2YNO A;  5FA5 B;  4A2L A;  5IGQ A;  4Z8L A;  3UKU C;  2IUQ A;  1YFQ A;  2I0T A;  2CO0 C;  4QQE A;  3EI4 B;  2AQ5 A;  4J8B A;  4XYH A;  4J78 A;  2PM7 B;  1A0R B;  4A0B B;  3MKS B;  5TDH B;  4HDJ A;  4GGD A;  3I8E A;  1Q47 A;  5IJ7 E;  2O9K A;  1JOF A;  4L3H D;  5HQG A;  5C2W B;  3NVN A;  4CI3 A;  2H13 A;  3J81 g;  4J8G A;  4BUJ C;  4J87 A;  2B4E A;  3SJL D;  4N14 A;  4FAV D;  4D6V A;  4O45 A;  3SN6 B;  4X60 B;  2HJ4 A;  4YVD A;  4A09 B;  3I7O A;  3VH0 A;  4GM9 A;  1U4C A;  5C9Z B;  2H9P A;  3AFC A;  4I79 A;  2Z2P A;  3N0D A;  4J73 A;  3UVN A;  1GOT B;  4O3U B;  5TEF A;  3W15 A;  1PGU A;  3DXM C;  3UVO A;  4J84 A;  4A7J A;  5EMM B;  2MTA H;  4H5I A;  3J80 g;  4MK0 B;  3V9F A;  4CC9 A;  5AFU 3;  3OKY A;  2YNP A;  4OZU A;  5EM2 B;  3GFC A;  4QT8 A;  3VA6 A;  3E0C A;  3OL2 A;  5JWZ A;  1SQ9 A;  3CIK B;  1TYQ C;  3PVW B; 
#chains in the Genus database with same CATH topology
 1VZ2 A;  3ORV D;  4RE5 A;  3JZH A;  3OTT A;  1L5G A;  4OWR A;  5I5M A;  3EI2 A;  3RSE C;  3KRX B;  5KDO B;  3ZE1 A;  4CI2 A;  3SVW D;  4A0A B;  3V7D B;  5EAM A;  5FQD A;  3RN1 D;  3DDU A;  1N6F A;  3EQ8 A;  4R7A B;  3DSM A;  4ZOY A;  5FFO A;  3IJ1 A;  5SXM A;  3I7H A;  2QXV A;  3UKR C;  3K27 A;  4E54 B;  4FA4 D;  2EBS A;  3VGZ A;  1C9I A;  4WK2 A;  2AGY A;  4PBY A;  4WK0 A;  3SWS D;  5C92 A;  5HYN B;  5A2Q g;  3SCY A;  1S4U X;  4CY1 A;  4FA5 D;  1R5M A;  3F3P A;  4X61 B;  5EMJ B;  2YMU A;  3ZWL B;  5CXC B;  4JSP C;  5FKT A;  3O4I A;  2P9S C;  1FWX A;  3EQ7 A;  3NVX A;  3IIW A;  4DNU A;  4BCD A;  4LG8 A;  3OKT A;  2OVR B;  2AGL A;  3I7K A;  3AH8 B;  3FCU A;  1JTD B;  3JRO A;  3SMR A;  1GOG A;  4J79 A;  4JT5 C;  1ERJ A;  4O1Q D;  1GP2 B;  2XL3 A;  2H6N A;  2H47 A;  4IRZ A;  5H14 A;  1GXR A;  1N6D A;  3EI4 A;  5CYK B;  5IC7 A;  3VI3 A;  5M5U A;  1QFS A;  3RFH A;  3FRX A;  5TEE A;  5EML B;  4AMY A;  2IUP A;  4PBZ A;  1H2Z A;  4A08 B;  3DM0 A;  1PBY B;  3ODT A;  4PSX B;  3IJC A;  3N0E A;  4CI8 A;  3IJ0 A;  4G1M A;  5E6R A;  4FA1 D;  5M5V A;  3DXK C;  5HE3 B;  4E5Z A;  2I3S A;  5HDB A;  3EWE A;  2IWK A;  2PBI B;  1JMZ B;  3BG0 A;  2Z2N A;  3EG6 A;  5EMK B;  1T2X A;  2VDQ A;  4XYI A;  2H9L A;  5E6S A;  2HU8 A;  2B5N A;  4GQ1 A;  4H5J A;  4CZV A;  4UM9 A;  4U1E I;  3NIG A;  1PI6 A;  2PM6 B;  1TYE A;  3C5M A;  1XIP A;  2EIE A;  4JXM A;  1U2V C;  5CXB B;  4ZOZ A;  2XU7 A;  3ZE2 A;  2JKX A;  4AMZ A;  5IGO A;  2I0R A;  5H17 A;  5GSA A;  1OLZ A;  1GOF A;  4LG9 A;  3PE7 A;  4JSX C;  2GC4 A;  2OVQ B;  3IVM A;  3JAM g;  3CFV A;  2P9N C;  1UOO A;  4QAM A;  4U7A A;  3MMY A;  2VDR A;  2VDK A;  4WJK A;  5GXH A;  4KFM B;  4L9O A;  1M1X A;  4NSX A;  4ESG A;  3IUJ A;  4MMX A;  4XEI C;  4BCB A;  3V5W B;  2B5L A;  5EAL A;  4JSV C;  4G56 B;  4K3J B;  3RN0 D;  4A0B A;  3OW8 A;  3MXX A;  4Y5R D;  5K19 A;  4GGA A;  3AL8 A;  4JD2 C;  3IUQ A;  2IAA A;  5I5J A;  3SXT D;  4ZOX A;  4BCC A;  2YNN A;  1QFM A;  3JZN A;  3OKW A;  3PXT D;  4GZ8 A;  2PM9 A;  3UVM A;  3F3F A;  3FGB A;  5CYK A;  3C99 A;  4FHL A;  4ZOV A;  4J82 A;  1YR2 A;  1GG2 B;  2H6K A;  2HES X;  3IUL A;  5HE0 B;  2TRC B;  2G9A A;  3GD1 I;  3NIF A;  2HYE A;  2AGZ A;  3JB9 L;  1B9X A;  4ERY A;  2Z2O A;  3K71 A;  2VDL A;  2GNQ A;  2P9I C;  2VC2 A;  3JZG A;  4Z7Q A;  4G55 A;  1PEV A;  3CFS B;  4A2M A;  5FKS A;  3P4F A;  4Y7R A;  4BL0 A;  3MKQ A;  1SHY B;  4IA9 A;  3SBR A;  2W18 A;  4AEZ A;  5HE2 B;  2UZX B;  2H6Q A;  4QRJ A;  3L4M D;  4GMB A;  3KRW B;  1MG2 A;  3B7F A;  1L0Q A;  5IJ8 E;  3I7N A;  2IWF A;  5EM2 A;  4Z7N A;  3GC3 B;  3IUM A;  2J56 H;  2AH1 A;  3EI1 A;  1UOP A;  2P9K C;  4L3G D;  5THA A;  4O3T B;  2B5M A;  3IUN A;  3SHF A;  3IUR A;  1N6E A;  3AL9 A;  3EI2 B;  3PSL A;  2QC5 A;  5FXY A;  5C2V B;  3IIY A;  3K26 A;  2G99 A;  2P9U C;  1K32 A;  4GQ2 P;  5GMK n;  2VDP A;  5FKR A;  4A09 A;  4IMM A;  5EAR A;  4CY2 A;  5K1C C;  3IKO A;  3V4V A;  2OIZ A;  4ES0 A;  4CY3 A;  3GRE A;  4GQB B;  1VYH C;  2J55 H;  1NR0 A;  3UVL A;  2AGX A;  2XE4 A;  4J0X A;  3JRP A;  2BBK H;  4MMY A;  4GGC A;  2PM9 B;  2VDO A;  2YB8 B;  3FM0 A;  2HU5 A;  4ZN4 A;  2CN3 A;  4GM8 A;  1VE6 A;  5I5I A;  4CZY A;  4FAN D;  4FA9 D;  3K72 A;  4J0W A;  5CXC A;  3PXS D;  3BWS A;  1E8M A;  4J77 A;  5FFG A;  4FB1 D;  4PXW A;  4L1Q D;  3MUN A;  3SBQ A;  4A11 B;  3SLE D;  3RLM D;  2HKM A;  2CE9 A;  4UM8 A;  4QL1 A;  1E5T A;  3RMZ D;  2VDN A;  4NAA A;  4O9D A;  2CE8 A;  2GC7 A;  2AH0 A;  3I8C A;  1MDA H;  5CXB A;  4NBM A;  2QZP A;  1H2X A;  2H3X A;  2IUV A;  3KCI A;  1H2Y A;  3DWL C;  5AJA A;  3AL8 B;  2OK4 A;  4Z7O A;  3EI3 A;  1OMW B;  3SFZ A;  1VZ3 A;  5EAP A;  5FKQ A;  3UR4 A;  5M5S A;  1MG3 A;  4X3E A;  3T3P A;  4D9S A;  3QI0 A;  4LGN A;  2WQ8 A;  4CZX A;  4E5Z B;  4JSN C;  4ERZ A;  3HFQ A;  4JHN A;  3NID A;  2OJY A;  4NC4 A;  2OK6 A;  3U4Y A;  5GXI A;  3MZK A;  4E54 A;  4EWR A;  2UZY B;  4PC0 A;  3PXW D;  3RRM C;  5HE1 B;  3PVU B;  3L4O D;  1B9Y A;  2CN2 A;  5TF2 A;  1A12 A;  2I3T A;  1P22 A;  4O2W A;  4D0K A;  3I7L A;  1I2M B;  2HJB A;  4JT6 C;  1H2W A;  3UVK A;  1XKS A;  3PSC B;  2CO0 A;  2IUR A;  3MZL A;  1GOH A;  4TZ4 A;  2AGW A;  2OVP B;  3C75 H;  3RFG A;  2H68 A;  3EQ9 A;  4DNV A;  2XYI A;  2EID A;  5M5R A;  1O6G A;  2HKR A;  5M5T A;  3A0F A;  3OL2 B;  5H1M A;  1TBG A;  1SQJ A;  4AN0 A;  4K3I D;  4X63 B;  4A08 A;  3O4J A;  2YBA A;  1JV2 A;  2XL2 A;  4AOW A;  3EU7 A;  2BKL A;  3I7P A;  1RI6 A;  4O02 A;  4MMZ A;  1QNI A;  5B4W A;  4CI1 A;  1JMX B;  3IJE A;  2CNX A;  2VZ1 A;  3JPX A;  4A0A A;  3O4H A;  1NEX B;  4PSW B;  5AMS A;  3EMH A;  3SBP A;  4G1E A;  4GM3 A;  4UI9 R;  1JJU B;  3T3M A;  3BG1 A;  3I89 A;  1UOQ A;  3ZDZ A;  2H9M A;  4AN1 A;  4FWW A;  3ULE C;  4CY5 A;  3EI1 B;  4BP9 A;  2BCJ B;  1BPO A;  3EI3 B;  3NVQ A;  3OKY B;  2HXC A;  2Q7Q A;  3I2N A;  2J57 G;  1O6F A;  5M61 A;  4BH6 A;  2H9N A;  3C9C A;  1K8K C;  4PNK B;  2I0S A;  5E6U A;  5FLX g;  2H14 A;  2P9P C;  3O4G A;  5IT9 g;  2EIC A;  3F3G A;  1U8C A;  2HU7 A;  4J86 A;  4ERQ A;  3MVD K;  4A11 A;  4J81 A;  1XHM A;  2P9L C;  2YNO A;  5FA5 B;  4A2L A;  5IGQ A;  2XZG A;  4JHP C;  4Z8L A;  3UKU C;  2IUQ A;  3FCS A;  1YFQ A;  2I0T A;  2CO0 C;  3QHY B;  4QQE A;  3EI4 B;  2AQ5 A;  4J8B A;  1UTC A;  4BP8 A;  4XYH A;  4J78 A;  1C9L A;  2PM7 B;  1A0R B;  4A0B B;  3MKS B;  5TDH B;  4HDJ A;  4GGD A;  4L1M A;  3I8E A;  1Q47 A;  2VDM A;  5IJ7 E;  2O9K A;  1JOF A;  4L3H D;  5HQG A;  5C2W B;  3NVN A;  2XDW A;  3ZDY A;  4CI3 A;  5C86 A;  2H13 A;  4AX4 A;  3J81 g;  4J8G A;  4BUJ C;  4J87 A;  2B4E A;  3SJL D;  4N14 A;  4FAV D;  4D6V A;  4O45 A;  3SN6 B;  4X60 B;  2HJ4 A;  3MUO A;  4YVD A;  4A09 B;  3I7O A;  3VH0 A;  4GM9 A;  1U4C A;  3ZE0 A;  5C9Z B;  3VI4 A;  2H9P A;  4WK4 A;  3AFC A;  4I79 A;  2Z2P A;  3N0D A;  4J73 A;  3UVN A;  1E8N A;  1GOT B;  4O3U B;  5TEF A;  3W15 A;  1PGU A;  3DXM C;  4NEN A;  3UVO A;  4J84 A;  4A7J A;  5EMM B;  3K6S A;  1K3I A;  2MTA H;  4H5I A;  3J80 g;  4MK0 B;  3V9F A;  4CC9 A;  5AFU 3;  3OKY A;  2YNP A;  4OZU A;  2QR5 A;  2EIB A;  3V4P A;  3ZDX A;  5EM2 B;  3GFC A;  4QT8 A;  3VA6 A;  3E0C A;  2VZ3 A;  1VE7 A;  3OL2 A;  5JWZ A;  1SQ9 A;  3CIK B;  1TYQ C;  3PVW B;  3OF7 A;  4RE6 A;  4DNW A; 
#chains in the Genus database with same CATH homology
 3ORV D;  3JZH A;  3OTT A;  4OWR A;  5I5M A;  3EI2 A;  3RSE C;  3KRX B;  5KDO B;  4CI2 A;  3SVW D;  4A0A B;  3V7D B;  5EAM A;  5FQD A;  3RN1 D;  1N6F A;  4R7A B;  3DSM A;  4ZOY A;  3IJ1 A;  5SXM A;  3I7H A;  2QXV A;  3UKR C;  3K27 A;  4E54 B;  4FA4 D;  2EBS A;  3VGZ A;  2AGY A;  4PBY A;  3SWS D;  5HYN B;  5A2Q g;  3SCY A;  1S4U X;  4CY1 A;  4FA5 D;  1R5M A;  3F3P A;  4X61 B;  5EMJ B;  2YMU A;  3ZWL B;  5CXC B;  4JSP C;  5FKT A;  2P9S C;  1FWX A;  3NVX A;  3IIW A;  4LG8 A;  3OKT A;  2OVR B;  2AGL A;  3I7K A;  3AH8 B;  3JRO A;  3SMR A;  4JT5 C;  4J79 A;  4O1Q D;  1ERJ A;  1GP2 B;  2XL3 A;  2H6N A;  2H47 A;  5H14 A;  1GXR A;  1N6D A;  3EI4 A;  5CYK B;  5IC7 A;  3RFH A;  3FRX A;  5TEE A;  5EML B;  2IUP A;  4PBZ A;  4A08 B;  3DM0 A;  1PBY B;  4PSX B;  3ODT A;  3IJC A;  3N0E A;  4CI8 A;  3IJ0 A;  4FA1 D;  3DXK C;  5HE3 B;  4E5Z A;  2I3S A;  3EWE A;  2IWK A;  2PBI B;  1JMZ B;  3BG0 A;  2Z2N A;  3EG6 A;  5EMK B;  4XYI A;  2H9L A;  4GQ1 A;  2B5N A;  4H5J A;  4CZV A;  4U1E I;  1PI6 A;  2PM6 B;  3C5M A;  1XIP A;  4JXM A;  1U2V C;  5CXB B;  4ZOZ A;  2XU7 A;  5IGO A;  2I0R A;  5H17 A;  5GSA A;  1OLZ A;  4LG9 A;  3PE7 A;  4JSX C;  2GC4 A;  2OVQ B;  3JAM g;  3CFV A;  2P9N C;  4U7A A;  3MMY A;  5GXH A;  4KFM B;  4L9O A;  4NSX A;  4ESG A;  4XEI C;  3V5W B;  2B5L A;  5EAL A;  4JSV C;  4G56 B;  4K3J B;  3RN0 D;  4A0B A;  3OW8 A;  3MXX A;  4Y5R D;  5K19 A;  4GGA A;  3AL8 A;  4JD2 C;  2IAA A;  5I5J A;  3SXT D;  4ZOX A;  2YNN A;  3JZN A;  3OKW A;  3PXT D;  4GZ8 A;  2PM9 A;  3UVM A;  3F3F A;  3FGB A;  5CYK A;  3C99 A;  4FHL A;  4ZOV A;  4J82 A;  1GG2 B;  2H6K A;  2HES X;  5HE0 B;  2TRC B;  2G9A A;  2HYE A;  2AGZ A;  3JB9 L;  1B9X A;  4ERY A;  2Z2O A;  2GNQ A;  2P9I C;  3JZG A;  1PEV A;  3CFS B;  4A2M A;  5FKS A;  3P4F A;  4Y7R A;  4BL0 A;  3MKQ A;  1SHY B;  4IA9 A;  3SBR A;  2W18 A;  4AEZ A;  5HE2 B;  2UZX B;  2H6Q A;  4QRJ A;  3L4M D;  4GMB A;  3KRW B;  1MG2 A;  3B7F A;  1L0Q A;  5IJ8 E;  3I7N A;  2IWF A;  5EM2 A;  2J56 H;  2AH1 A;  3EI1 A;  2P9K C;  4L3G D;  5THA A;  4O3T B;  2B5M A;  3SHF A;  1N6E A;  3AL9 A;  3EI2 B;  3PSL A;  2QC5 A;  5FXY A;  5C2V B;  3IIY A;  3K26 A;  2G99 A;  2P9U C;  1K32 A;  4GQ2 P;  5GMK n;  5FKR A;  4A09 A;  4IMM A;  5EAR A;  4CY2 A;  5K1C C;  3IKO A;  2OIZ A;  4ES0 A;  4CY3 A;  3GRE A;  4GQB B;  1VYH C;  2J55 H;  1NR0 A;  3UVL A;  2AGX A;  4J0X A;  3JRP A;  2BBK H;  4GGC A;  2PM9 B;  2YB8 B;  3FM0 A;  4ZN4 A;  2CN3 A;  4GM8 A;  5I5I A;  4CZY A;  4FAN D;  4FA9 D;  4J0W A;  5CXC A;  3PXS D;  3BWS A;  4J77 A;  4FB1 D;  4PXW A;  4L1Q D;  3SBQ A;  4A11 B;  3SLE D;  3RLM D;  2HKM A;  2CE9 A;  4QL1 A;  3RMZ D;  4O9D A;  2CE8 A;  2GC7 A;  2AH0 A;  3I8C A;  1MDA H;  5CXB A;  2H3X A;  2IUV A;  3DWL C;  5AJA A;  3AL8 B;  2OK4 A;  3EI3 A;  1OMW B;  3SFZ A;  5EAP A;  5FKQ A;  3UR4 A;  1MG3 A;  4X3E A;  4LGN A;  4CZX A;  4E5Z B;  4JSN C;  4ERZ A;  3HFQ A;  2OJY A;  2OK6 A;  3U4Y A;  5GXI A;  3MZK A;  4E54 A;  4EWR A;  2UZY B;  4PC0 A;  3PXW D;  3RRM C;  5HE1 B;  3PVU B;  3L4O D;  1B9Y A;  2CN2 A;  5TF2 A;  2I3T A;  1P22 A;  4D0K A;  3I7L A;  2HJB A;  4JT6 C;  3UVK A;  1XKS A;  3PSC B;  2CO0 A;  2IUR A;  3MZL A;  4TZ4 A;  2AGW A;  2OVP B;  3C75 H;  3RFG A;  2H68 A;  2XYI A;  2HKR A;  3A0F A;  3OL2 B;  5H1M A;  1TBG A;  1SQJ A;  4K3I D;  4X63 B;  4A08 A;  2YBA A;  4AOW A;  2XL2 A;  3EU7 A;  3I7P A;  1RI6 A;  1QNI A;  5B4W A;  4CI1 A;  1JMX B;  2CNX A;  3JPX A;  4A0A A;  1NEX B;  4PSW B;  5AMS A;  3EMH A;  3SBP A;  4GM3 A;  4UI9 R;  1JJU B;  3BG1 A;  3I89 A;  2H9M A;  4FWW A;  3ULE C;  4CY5 A;  3EI1 B;  2BCJ B;  3EI3 B;  3NVQ A;  3OKY B;  2HXC A;  2Q7Q A;  3I2N A;  2J57 G;  4BH6 A;  2H9N A;  3C9C A;  1K8K C;  4PNK B;  2I0S A;  5FLX g;  2H14 A;  2P9P C;  5IT9 g;  3F3G A;  4J86 A;  4ERQ A;  4A11 A;  4J81 A;  1XHM A;  2P9L C;  2YNO A;  5FA5 B;  4A2L A;  5IGQ A;  4Z8L A;  3UKU C;  2IUQ A;  1YFQ A;  2I0T A;  2CO0 C;  4QQE A;  3EI4 B;  2AQ5 A;  4J8B A;  4XYH A;  4J78 A;  2PM7 B;  1A0R B;  4A0B B;  3MKS B;  5TDH B;  4HDJ A;  4GGD A;  3I8E A;  1Q47 A;  5IJ7 E;  2O9K A;  1JOF A;  4L3H D;  5HQG A;  5C2W B;  3NVN A;  4CI3 A;  2H13 A;  3J81 g;  4J8G A;  4BUJ C;  4J87 A;  2B4E A;  3SJL D;  4N14 A;  4FAV D;  4D6V A;  4O45 A;  3SN6 B;  4X60 B;  2HJ4 A;  4YVD A;  4A09 B;  3I7O A;  3VH0 A;  4GM9 A;  1U4C A;  5C9Z B;  2H9P A;  3AFC A;  4I79 A;  2Z2P A;  3N0D A;  4J73 A;  3UVN A;  1GOT B;  4O3U B;  5TEF A;  3W15 A;  1PGU A;  3DXM C;  3UVO A;  4J84 A;  4A7J A;  5EMM B;  2MTA H;  4H5I A;  3J80 g;  4MK0 B;  3V9F A;  4CC9 A;  5AFU 3;  3OKY A;  2YNP A;  4OZU A;  5EM2 B;  3GFC A;  4QT8 A;  3VA6 A;  3E0C A;  3OL2 A;  5JWZ A;  1SQ9 A;  3CIK B;  1TYQ C;  3PVW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...