4ZPTB

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTIICRASQDINNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGSDYSLTISNLEQEDIATYFCQQANTLPPTFGAGTKLELRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
molecule tags Viral protein/immune system
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
total genus 56
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptB01
4LRNH 2IPUK 1JZ5A 5JHLL 1OAUL 2BVQA 3BZDA 4MXQC 1GZQA 5DQ9B 4Z76B 3MV7D 3H3PH 3F5WB 2BSTA 5FDWB 3ARTA 3IU3A 3QDJB 4LCIL 4NUJB 4GAJL 5IM7B 3E2HC 1S9XA 1WLHA 3BKJL 1EZVX 3K81A 4XPAL 2DQEL 4PY8I 4OIAA 2C3GA 3HNVL 4OQ1A 4AEFA 3U4BH 5IJVB 3TT3H 5I8OH 1JNLH 4NKOB 1F3DH 3ARFA 1S9YA 1BD2D 1OL0A 3V6FA 1FNEA 3SJVA 4D9QE 3QHZH 4TNVF 1IQDB 1BJMA 4PJBE 4E42A 5IB3A 1RHFA 2GJZB 5DVNA 5DZLA 3H3BC 5BS0E 1F4AA 2NY1C 3FFDB 4K2UL 1NBZB 5CEZH 4ONGL 2IG2L 3S7GA 1V8HA 2DDQH 4KKBD 2Y4SA 5ACZA 5J1SC 5CJQH 2R2BB 1K8IA 3DI3B 4B50A 4DK6A 1T66D 1NKRA 2YXMA 3UJIL 2AK1H 3MXWH 5M7QA 2BY3A 2GSGB 4XP6H 3HS0A 4QGYA 1HQRA 1I8IA 1G6RA 3QIBB 5I1JL 4CL7A 3T09A 1TVHA 1D6VL 4D3CH 5FO8B 1KB5L 4LASH 5IHBA 2P4AB 1RHHA 3EOYG 3HI1B 3O4OC 3SGKA 1WAAE 2OR7A 3LPFA 5EFIA 4YE4H 3ROOA 3OXRB 1I1YA 3RDTB 2ADIB 4KDTC 3FQWA 3O11B 4NN6C 2LV4A 2NZ9C 1NAMH 2E9JA 4GBXC 4WJ5A 4XP4H 5GGRB 1F6FB 2H1PL 3VFVA 4JDTL 5ANME 4RZCB 4OKVB 4MWFA 1U8NB 3MA9H 1ADQA 4WUKL 3AROA 4FRWA 5E4EC 4PUBL 1T0MB 2CQVA 4BJLA 3ZLQC 3WUWG 2F58L 4XP9H 3AY4C 3CVHA 4JFXA 1AGEB 5GRJH 3TYGL 3O8XD 4Y4HB 4L29B 4ZQKA 1DLHA 2DM2A 1P84J 1DP0A 2BNUA 1E4WH 2YRLA 2P8MA 4QOKD 4ZD3L 4MD4B 4EN3C 2X1PA 1ZWIA 3CLFL 4LGRB 2XZQH 3IRPX 2PXYC 4R2GD 1QSEE 4G7VL 3BH9B 1U8IB 1E4XH 4JFED 3VXUA 4AH2B 4ERSL 5IEKB 4LPWA 5D1QB 3RI5K 3SBWA 3MYJB 3MRQB 1MCWW 1UXSB 2DYPD 1TJHL 3O6LL 3X11A 1L0XA 4HFWB 4JN1H 1MCLA 2B4CC 2X4SA 1YNKH 1WUNT 2R69H 1BOGB 2UWEA 5DURD 3WXWL 1PQZB 4IRSA 4PJBB 4N0CD 4PRPD 1AD9B 1LILA 1G7MB 5JORA 1ONQB 3HZKA 4H1LH 5EU5A 1UM6H 5E9DA 1V5JA 4L8SA 4NM8H 4GW5A 4GXVL 1U2CA 3HMWH 4M4PA 3C60B 4WY7L 3WFDH 3E8UH 1YUHA 2XRAL 3MX0A 2DN7A 5E8OB 5DD5H 4UT9L 3REVA 5C7XL 3X3FL 1AFVL 4JFZH 2E7HA 1DBKL 3RRQA 1R5IB 1AR2A 1CD9B 2E7BA 4ZUVA 3ARRA 3QIWD 4RQQA 3MRCA 1ZA3B 4KKAC 1CE1L 1ZANH 1B6UA 2GAZB 4XMPL 4PGCA 3DO7A 4KV5F 4X5XB 2GT9B 1LK2B 1AR1C 3EJZD 3KXFA 3B43A 5DEFB 2QQLL 3SKNB 1VPOL 2HAZA 4ORGB 1UH2A 2DM4A 4RMSA 3TJEL 1E27B 1WT5C 2Q87A 3BKYH 3DTXA 3O6FD 1X5LA 2Q20A 2BSED 4HAGA 5F93C 4NC1E 2GCYA 2HLFC 2NY5H 1KTLB 2QQNL 4NZTH 1EEZA 3SE8L 1I3UA 3IDGB 4HUMB 4ZUTA 1X5IA 1UENA 3SGDI 3WXVL 1ZLUH 4UNVA 1S9VB 2FO1A 3E6FB 1KBGH 4NNPH 1CFQA 2EYRA 1AKJA 1MI5B 5I66A 3WIFA 1Q9WB 5IMOA 1GIGL 1AY1H 3IFLH 2AV1A 2PYEA 2X4RA 4X6DF 1F3DJ 2VDML 1NH6A 3DYMA 3WNMA 4WV1B 5I2IB 4J3TA 1FO0A 3C5JA 5B38A 2IPKA 4UDUA 3EJZC 2XA8L 4TUJB 3CFBB 1VADA 4K7PL 4PGDA 2IAND 5EUKA 5HYEA 1GC1H 2VABA 2F53A 4KI5D 2VDRH 5D9SA 4CVWA 2PCPA 3NCFB 2GQHA 4HXAH 4C83B 2CLVA 4XXDA 4MQ7B 4X5XA 4PJXF 4ISVA 1NCDL 4YR6A 3QCVH 2EE2A 1GVIA 5E6IA 1MAML 4UZGA 4CDHA 3G5YB 3L5XL 4OF0A 3OG6B 4S1RH 1XFPA 3DHJA 3RPIB 2PN5A 5SV3A 3S6CA 4OCLC 4Q0XH 2XI9A 1F4XL 4L1DA 4NT6B 2Q3ZA 1RZ7L 5GRUL 1DBJL 2IMNA 2FIKB 3TM6A 5F7NC 3ZHKA 1AH1A 2NX5E 2YWZA 5I1JH 2DKSA 1ETZB 2MKLC 3BE1H 5DEGB 3CDFA 3QQ4B 5J8OA 1KFAL 4U0RB 4MDIA 1ZHBB 2YPVL 1JZ6A 1JPFB 3N85L 2H45A 4WTWA 1H8NA 1B6DA 3TIEA 2Y23A 2EXYC 2UWEB 1SJEA 2X1QA 1MUJB 1IM3A 1ZT7A 1KXVC 4XP4L 4ZDHA 2IPUG 3CX2A 1YMMA 1N6QH 2NXZC 1A7NL 3OKYA 1PG7L 4G6MH 2IAMB 5A2JH 1I1FA 4C83A 3NMEA 4X6FB 5CGTA 2XKNA 3A6BH 4I3RL 1XR8A 3WFHA 4H26B 43CAB 3VXSD 4KVCH 3LN9A 4JO1L 2VOTA 1U8JB 1OAXL 3MJ9L 4GH7B 4UV4H 1FYTB 4BZ2L 2ZCKH 3C5JB 5B38B 1FO0B 5C07E 1SQ2N 4JPIB 4WDIB 5GSVA 1CICC 1FIGL 1AXTH 3DMMB 5IROC 3TN0B 1T21A 2H3NB 2HT2C 2Z8RA 4ERSH 4MXWH 3WIFB 1UB5A 1U91B 2YXFA 2H41A 4PLKC 3DBXB 2XPGA 5DSCA 3UC0L 3V5KB 2YWYA 1RFDL 3CX5J 5CINH 1Q94A 2IMMA 3G08A 2IBGA 1TQCB 4PRDA 2VC2H 4P46A 1H3XA 2ZSVB 2VN7A 3H7BB 2IH1A 1PLGL 1DUZA 1RZFH 2A77H 4PB0L 4B41A 3DX9B 4PTUB 1ZGLP 1MHCA 3RVWC 3UTSE 4W68A 4Y2DC 3AVEA 3HMWL 5A2LH 1MJJA 4NUGL 1JNNL 5FYLH 3F7YB 4I5BB 3RZWA 2Q76A 1EFXD 1I9JL 2FSEA 4N5UA 4QEGA 1CGXA 1DBKH 3MLXL 5IVXA 1AGFB 3EOTL 2VDOH 4NP4L 4NO3A 4ODTL 1PFCA 4YIQA 2MPAH 3ZTNH 4KRPC 1JZ4A 3BPLC 5CAYB 5E5RB 2DS4A 5CIPA 1BZ9A 3FQUB 2BNRA 3MA7B 2LFGA 4W70A 1ED3A 3MCKB 1WFNA 2GJZA 5T1LA 5HDLA 3RNKB 3ET9F 2VLKA 5DJXA 2R1WA 1ZOXA 2A2QT 2CK0L 4JFPA 2VMFA 2WUCL 5CUSL 1T6WA 2YC1B 4PRBA 1JI1A 4M9OA 4NHCL 3OGCB 3SQOL 3ORJA 1FFPA 3EDEA 1OP5K 4EQ3A 5MEOB 3NIFF 4CMMB 3OKEB 4C56E 4KKCD 3NIGF 3JWDH 4DUXA 4TUKL 2J8UB 4L8BB 4LOUD 1NGPL 3QHTC 4X8JB 5D1ZC 1AO7B 4M62H 4U05A 1MFBL 4I48B 2DQIL 4KY1L 4F3FA 1CGUA 2Q8BL 4RMRA 1WWBX 5DMKB 1TZHB 2C26A 1WEJH 4J6RH 3GNMH 4OZHB 4LPYA 1MLCA 4TSCL 4QGTA 5I74C 2BY0A 3WJLC 3O9WB 3P11H 3HC3H 1OARL 5DMGD 4IRJA 1FYTE 4KQ3L 1HHHB 4U0RC 5HYJA 4NJAH 3H0TB 3RBSA 3EO9H 5I1LB 1FH5L 4OV5B 1CFVL 5FA3B 1AD0B 1IKNA 1IE5A 3V7AG 5IEHB 3L7FA 5IW1A 3SPVA 2YMXL 4JZJB 3RTQB 4LRIC 2HFFB 4FQPA 4GSDL 5DJDA 1U8OB 1WBZA 1H15A 1PY4A 4N8VG 4G9DB 2IF7A 4X9BA 1H3TA 1LK3L 1RZIB 1A7RH 2X4OA 5MI0B 5CD5C 4LL9A 2A9NL 4ZUWA 1VGEH 3GK8L 1CBVL 3W0WB 1JPSH 2DI8A 4PJIE 3ZSTA 1IGYA 1CDBA 3PNWB 5C09B 3ILPB 4HKJB 2HLFD 5FHAH 1Q1JH 1KN4L 2HG5A 2ICES 2VAJA 3HB3D 3U7YL 2HFFA 2AI0L 2VXUH 2P7TA 1KFAH 5SV4A 1CDUA 4PJHB 5D7LE 3MLUL 4P5TC 1KENH 3Q3GA 2FBJH 2DQFB 2EO9A 2OTUA 3M8OL 1YPZA 3O9WA 4JHWL 2EH8L 3BQUD 4XNQA 4Y2DB 5DJ6B 4YAQA 2NPLX 4ZFFB 3D48R 1C5BH 1N6QL 1A7OL 1KOAA 3BZFB 4AEIL 1A0QH 4LQFL 4NWTH 2Z93A 3U83A 3KLHC 1JUFB 5E8OA 4Y4FC 4JFDE 5BVPL 4GUPA 1IL1A 1IAII 1QFWM 2HTKC 1T3FB 3RTQD 4GKZA 3Q0HA 4ZS6C 2MCPL 1IILE 3IF1A 5IFAH 3WS3B 3OKEA 2AXFA 3VD7A 3MLTB 3MOAH 5EU6E 1EO5A 3T0XA 1CFNB 3NN8B 5I75B 5DVKA 2W60A 1HXMA 4PRAB 1T1WA 3TN0C 5D7JB 3RBGA 2ZOLA 3S4SG 2BSRA 4I2XE 4GG6E 5CZXD 4F80A 4CKVX 4F9PA 3IKCB 4F2MB 2OI9C 4ODHH 3TH3T 4OCSH 4HCRL 4FXKA 3F62A 4R97C 2P5WA 4FXLA 4FZEH 4XHJD 5D1QA 4Y19B 5C8JA 5HHOB 5GZND 4AH2A 3EHBD 4NQVB 4YXHH 1G9ML 1TNNA 5CSZB 4JKMA 2VISB 2P1YA 3V9FA 3HG1B 4FNLH 3T0EB 2R4SH 3ZDYF 4Z7UE 4D8PB 1MJJB 1X6LA 3FHQA 3BSZH 4I0KA 4IJ3B 3NPSC 2ZOLB 4KTEL 1U6AL 1CXFA 5J0BA 3RVUC 2R1YA 5EIVA 5KSBA 4XC1H 5KVFH 4GRWF 2I60H 1YEHL 3GI9L 2OLDA 2X05A 4DVBB 2A6JB 3HHRB 3HI6H 3MLWH 5ISZD 1CQYA 3QPQD 5DD0H 3B8SA 1A3LH 4G6JL 1UWEH 2GJJA 4JPVL 2ADJA 1BREA 1G84A 1OCWL 4WWKD 1G9MC 1IGTB 3QXVA 2IANB 3ZKSD 1EBPA 2RJMA 5D1QC 3FO0H 4Z7VF 3ARUA 4JY5H 1MFAH 1U91A 1OM3H 1KEML 3UBXG 4YXKH 4F7CB 2ICCA 3O3AB 3QDAA 2H3NA 2IBBA 2BOCB 4BQ9A 1HOCB 4PIRF 5C6TH 2ITDA 4N0FA 4YHML 2YPLD 2Z8VC 4KPHL 1SYVA 4JPIA 1BX2B 1NJ9B 1Z9MA 4X5WA 5DFTA 1ORQA 4H25B 4PREA 5E7BA 1WAAA 1T66C 3NAAL 4JCMA 5D5MB 3DX6A 3LKOA 1LO4L 3OKDB 5TQ2H 1MEXH 3FO9B 4X6FA 4GMTL 4F58H 1Z6JT 5LVEA 1I4FB 5MHSD 1FLRL 2HT4D 3EW3B 3DXAB 4OQTH 3C5ZA 1VEOA 3GIZH 2W1NA 3TYFA 1C5CL 1AXSB 2M1KA 5E6IC 3T0WA 2BY1A 2ORBH 2P5EE 3L5HA 2AKRB 1KT2B 3J7HA 2H32B 3RIAF 4WENB 1NDMA 4O2FA 5TH2A 3BGFB 3RWHB 2X4OB 3VI3E 1CD0A 2HJFA 1CE6B 1AGCA 3B9KD 3LKPB 3FN0L 5I75C 2EDHA 1FZKA 1MCFA 1A6VH 2DTML 1U8OA 1SJHA 5ICZA 2FGWH 4NUJA 1K8DA 3QIBD 4OTXL 1MCPH 3OR7B 3WMSA 3KR3L 1P4BH 4IIQB 2CRZA 3I9GL 2X1OA 3QRGH 3V6OC 3HNVH 3CSYA 3FQXB 1FN4B 2X5PA 4Y4FB 5HYJB 1P53A 1QHOA 3BESR 3OL2A 4NT6A 5DMGC 4YNYB 1T20B 3RX5A 2J6EA 3KLAB 4UIMA 5D7KE 2FZ3A 3BW9B 3RDTD 5KSVB 3ARWA 1NAKH 5JHDB 3BGFC 4M5YL 3MACH 4R2GB 1OWWA 3ULVE 1TJIL 5JO5B 3VXNB 4GRLC 1P84K 1EHXA 3RVXD 1ZA6B 1D5IH 1MRCL 5E6IB 5I16B 1UEYA 2DJUA 2Z0BA 1YEEL 4LSVL 3UJTL 4DZBB 4PRID 1YY9C 4PR5A 2ZUYA 3V6ZB 4LSQH 3EUUA 3EYQC 4P23B 4TVPE 5E4IA 8FABA 5F1IB 1YEKL 3STBA 2C1PB 1KCSL 2NTFB 4PRHB 3UTSB 5HHPB 2V7HB 4X6CE 1K3IA 2NY4B 3I6LE 5MEOA 1U36A 5BOZG 5D7LD 2VKWA 5MP6H 5D7IF 2AVGA 1YYLL 4G8GD 1ND0A 4LMQI 5HD8C 3IFNH 1NLDL 5HXMA 4L4TE 5BVJB 1MVUB 3GJEA 5E8PA 1QSED 1U8QB 2VDPH 4HFUH 4NYLA 2R2EB 4QHUA 4PLJC 1A0QL 3A0OA 4JFEE 5C71A 3VXPB 1N5YH 4U6VL 4HWZA 4HX1A 3VFGH 3FO1B 1WSST 4PGBB 4GS7C 1BZ9B 2Y07L 3MNWA 5F21B 1UCBL 3E6FA 3UTPE 4Y5XA 2KH2B 3ULVL 1UZ6E 1XF3A 2GSIB 4LSSH 5GQBA 4KI1A 4XWGH 3FB5A 4WUKH 2AS5M 3SBWC 1CCZA 3GKWH 2CRMA 4J1UA 5EZIH 5I18L 5HHNA 4U2YA 1MCDA 5C0IA 3MRLA 3CPLA 3RWIA 4L8CB 4UTBL 2DLFL 4YX2L 4X7FC 4QHKI 1CDJA 4QXUL 2UVEA 2HKHH 2P8PB 3QIUB 4P2QE 4RAUB 5A40E 4M7ZC 5C0EA 1G9NL 1FCGA 1S7UA 2JE8A 4O9HH 3LD8B 4IJ3C 3W2DH 3GGWB 3PQYA 3X12B 5D7IA 2DKMA 1K3ZA 4HLJA 5DRWA 5J06A 5B8CA 4WWKB 4M6NH 3SGDH 4RQQB 3L6FB 3MGTA 5A2FA 5TGBA 3EIFA 4HJJL 2VLRB 3DX8A 4WW2B 4PRNA 1DBAH 1U58A 4HS8L 5BQ7A 1N6UA 4R97B 4OM0H 4Y5XC 4P4KB 4XCEA 2DYPB 2OI9B 4XCYB 4ZYKA 4MQTB 3C5SA 4AG4H 2CDGB 4BFIA 1FG9C 4JDVB 3F7PC 4RMWA 5DDHA 2VE6A 3VXPA 1DVFC 3M17B 3IS0X 2RB8A 1H0DA 1ZLVH 2WBWB 4HGWA 4R0LB 4FFWC 3DMMA 2PYED 3ARED 1AD9A 1K5NA 2WUBH 6CGTA 4NRYB 3STLB 1MH5A 1IEAB 1QR1B 2CIIB 5IQ7L 2BOBA 3NCCB 3QUML 2DIBA 2ZNXA 3FRPA 4S1DC 2D7QA 4HIJA 4ZFOL 1F4YH 5K9JH 4JHBA 2DQGL 2JJUA 1XGTA 3FZUD 4OCYL 1KXTB 3FHAA 3O8XB 3INUH 3MRFA 5B8CC 3IXAB 3HZYA 5IIEA 3X14A 1L0YA 5D1XB 3X3FH 1BHGA 4GT7A 5BZDA 1QLRB 3LRSA 1LO2H 3L3OB 1MCOH 3LEXA 4RBPK 4MA1B 3W81A 1LE9B 4GO6B 2F5AL 1Q9KA 4JLRB 3QPXL 4RDQG 1FYTD 3VFTB 4K9EC 1JL8A 1H3GA 4XMPH 3JZ7A 4P9HH 3FJTA 3DARA 2BOBB 4UU9B 2YD8A 5K9KA 3CH1B 3OKKB 3CMGA 1BD2B 2GHWB 3G9AB 1RZJC 3OWEA 2R9HD 5J6GB 1FBIL 2I25N 1ZS8B 5D7SH 3SE9L 2XXMB 4HKBB 3QA3B 1TQCC 4LRIA 5HYSG 3GRWL 3QJFA 1FZOB 3VGDA 4HKXB 4KKLC 5ALCL 3E2HB 5DUML 1KPRB 2J6EL 5EBMA 3SO5A 5BV7L 1MHEA 2WBJB 1HZHL 5HGDB 5F9OH 1AGCB 4WI7A 5ILTL 1KBGL 1A21A 2BVTA 4JO4L 3FQWB 5GGQH 5C0AA 3RWDB 3U0PB 2JB6B 2R8SL 2VLRE 4XPBH 3OTTA 4MVBD 3LPWA 4P59H 1X5XA 2JK5B 3C6SB 3OPZH 4KI5F 4MGXA 1B0RB 4AIOA 3T65B 5F6IB 1IM9D 3RTQC 4U6YB 4L4VD 3PHOA 1KJ3L 3AREC 1ZTXL 2VLJA 4JQXC 3RWJB 2YPLE 1D5MB 2V17H 1XF5A 4JM4L 2NXZB 5IVXF 3RL2A 3KHQA 5T1DL 3PGCB 2EDBA 4ELMB 5TDNB 1FORH 1NBZA 1WFUA 1D5IL 4NGHH 1ZV5A 3JUYA 5I1AA 1ROWA 1Z9SA 1KIRA 3UP1A 3BD3A 4M61A 1T4KA 4X6BB 5IBLC 1URLA 1AJ7H 4L9DA 4UB0L 3V4PH 1S9VA 2AXJA 4KZEL 2A1WH 2G5BB 1D5ZB 2VL5B 1J10A 3GHBL 3EYVB 3GSNL 3PWVB 5ALBH 1XGRA 4HUWA 3ROLA 5CEZD 3DHMA 4F15B 5I1HH 1MAKA 3F5WA 5C3LD 4PJFE 43C9A 1CG9A 3O2DL 4HKZB 2NNAA 2Z4QB 1I1CA 1BZ7A 2FHBA 5GJSL 3VXSA 4R26L 2BC4A 2CLRA 3FAWA 5IK3A 3BGMB 3E6HA 4IMKC 3QUXA 4Q9RL 4TRPL 5F88A 3LH2L 5IUSA 3W9DA 4WTXA 3FFCE 5CSZA 4MDJA 5DJ2A 1DCLA 2DQHH 2OBGA 4LLQA 5EORH 4I18A 1KLGB 2E6QA 3FQXA 4H0IA 1BIIA 1WIPA 5IT2H 1N7MH 4RDQF 4Y8DC 4KVCL 2VJXA 4UUJA 3MV7B 4U31A 3U1SL 7FABL 3FCTB 4JKKA 3LMJH 1S7RA 4NRXA 4OQTA 1EH9A 5E9DB 2H8PA 1WBXA 2FJHA 3IGAA 4NIKB 1RU9L 4QTIH 1OQOA 2CXKA 2V5RA 3LV3B 3FB7A 1RUPH 1ZLWH 1UWGH 4MD5A 2JJTA 2X4SB 4Z8FH 1MI5D 4DGYH 3UC0H 4JM2B 2EDDA 1OWRM 1A5FL 4MXVF 2XA3A 3SDCB 4JRXB 1XGPB 1G7IA 1R5VA 3MLVL 2V5SA 4WHYG 1EGJA 4N5ED 4FTVE 5F89A 3QZWA 4O2CA 3SDAB 3FQNA 3LN5A 3IFOA 4PD4K 3OR6A 2VO5A 4MQXC 2D9CA 3V0VA 5CEXA 2WWKT 2YD9A 3VWJC 5BRZD 4OKDA 5IBUB 2P47B 5I30L 1WZ1L 2DL2A 1Y18B 3PIQA 3O3AA 4HKZA 4KRPD 1AIFA 1ACYH 2I26N 3DROA 2NY6C 4YHZL 2RCSH 4EDXB 3QXDA 4HIEA 1FAIL 1S7SB 3JVGC 3BMVA 2F53E 3S3SA 2XG5A 1IEBA 3EYVA 1MAMH 3TJHD 1JHLL 2FX9H 2VKXA 1JPTL 2XG4A 1FG2A 1QYGH 5DSCB 4LKXB 2XPGB 4Q2ZA 1J8HE 1I1YB 2PO6D 1T1XB 2CK0H 5EU7E 4LHQB 5L2KB 1LMKA 3JTSA 4YQXL 1DQTA 4I0CC 5GRUH 5I1AB 3GSRA 2CDFA 1KTDA 5EG6C 1H15B 3FFCB 2AJXH 2B1HL 1CGVA 3EGSB 2XICA 1NCAL 4UV7L 3MUJA 5I1DA 2GIYA 1TCMA 2PTTB 1WK0A 2YBRA 1FVCB 4QOKA 1QBLH 2QL1A 2XOTA 1NFKA 1UB6B 4DZ8B 2EDQA 1ZLSH 1ORSB 5IHUH 5ACZB 3MBXL 3BQUB 1MFBH 1DSFH 5K9QG 4GRMA 3HFML 4NNYB 3SN6N 5KSUB 4F2MA 5K9OA 4XP5L 3ULUE 5ID0B 4FQHA 2V9QA 4OZHA 1TTGA 4ZO7A 2DB8A 1MCSA 2BXYA 4E42B 5BS0B 2BNQB 1WZLA 3OMZA 5IB3B 1QLEL 2EDXA 1T5XA 3GBMH 1V3LA 1J18A 4GAYB 5I8KL 4HUUA 3S37X 1GAFL 3GMQA 4WFHE 3FB7B 4KQ3H 3SDXE 1JN6A 5I17B 3SEPA 4K8RD 5LXGL 2VDKH 1DLFH 5KTEH 2DAVA 5IQ9A 4HWBL 4IOFD 3WS6A 5A2KH 4JDZB 4BSWA 4RWYL 4PRPA 4XPGL 1N8ZB 4JEGB 5HHVL 3D1MC 2YUVA 5BMFL 1U92B 4FTVB 2QQKL 1K4CB 4RAHA 2ATKB 4F9LC 3OB0H 5JNYB 3GSWB 5HI3C 2DD8L 5EULV 2BNRE 3RPIA 2HVJA 3GSUA 1ED3B 1BJ1H 2AEPH 4BZ1L 1RURL 4WCYH 2XN9A 2GTZA 4FQXC 4G8FA 4RISL 3SKMA 1UH4A 2M2DA 3VCLB 1AKJD 2NY3D 1OPGH 4WW1A 2YD3A 3DETD 5CEZE 4U6XB 2P5ED 2AQ3A 3CMOH 1GGBL 4MMXC 2W0FA 1A7QH 5E08H 4KKCC 4M7LT 4K94L 4OD1H 5C0FB 5IJKA 5KSAA 3O2VH 5IW6B 5FYLE 2CIIA 5IGXL 4FQXD 3VFRB 4X6EA 4LKXA 4OIIL 5DT1L 2C9AA 3OF6A 1I7RB 4TNWK 1JTTA 1F58H 4NHUA 4OZIE 3PHQA 5F1SA 1WC7A 4DGIH 2JKXA 4UINL 2D31A 1H3UA 1JP5A 3PJSB 4N9GB 1JGVH 2CO7B 1S7XA 4M1GH 2H2SD 4O2EB 1MFEL 5GGTH 2D7MA 2R4RL 3BQUC 2PO6A 3K2MC 5AZ2L 5D1ZA 5ANMA 3FB8B 4UBDD 2YK1H 3I3DA 1BP3B 3G6JE 3GI8L 2F8VA 1A4KA 2VLKD 5KVEL 1RZKL 1CXKA 4LEOA 3ZKMD 5J11B 1T04B 4PJXE 2YKLH 1XGPA 4AMKL 3K80A 4XBPB 2DLTA 2QR0B 3FT4B 2J4WL 1IKNC 1A64A 4UIKH 5HHOD 1PKQB 2HKFH 3MJGX 4JM2D 1HDMA 1A6AA 4MLIA 3ULVC 1K2DA 1SBSL 1T03H 1U3HA 4G7YH 3OAZK 4N90E 4BM7A 3BSZL 5IKCA 2YPLB 4A2MA 3NFPB 4X7SL 4XMLL 4WI2A 4IEFB 5JHLH 2HFGH 3I2CH 5CP7A 1AI1L 1AP2A 1F4HA 4DCQB 1T5WA 4M6MH 4EZMA 3I50L 4S2SA 4BQ6A 3L5IA 4NO2A 5E4EB 4FQ1H 3MREB 1YN6B 3C6LB 5A43C 4OLUH 4Y5VC 2P24A 4ELKA 2A9NH 1D6EB 5AEAA 1XIWC 2NW2A 5L6YH 5GS1B 3L3IA 4G9FB 2X70B 4F8TA 1EHAA 4DZBA 2VDQL 5F88B 5KSBE 3VXRA 4LLWB 3S98A 3BZ4A 1QFUL 4JGMA 5DHVA 5T3ZH 4EIGB 3O3UN 1MFNA 3KDMB 2XQBH 3PWPD 1JV5B 1FPTH 1FGVH 3TZVC 1OGAE 2CK2A 1YEIL 3RWCB 1NCUA 3Q6FA 4OLXL 3UJIH 1VFAB 4NQDA 2F74B 3LY6A 2FLBT 3NAAH 5C07B 4K7FB 1JYXA 2ZCLH 3OB0K 5IHUL 3EOBB 1HKLH 1IBGH 2KPNA 3W82A 4QHNB 1G9NC 5BRZB 4DVRL 2ZUVA 3P0VH 3BO8B 1FZKB 4K3EH 1TITA 3QULA 1MHHA 5IMOB 4PRNB 4LFHG 5EOTA 1FRGH 2Z31D 1NDMB 4O2FB 4QRRE 1VB9A 3CFJB 2W65B 1BAFH 3MROA 3DSNA 3BIAX 4L3ED 3OXRA 3PGCA 3ROOB 4ZG1A 4ALAL 4UQ3B 1H3PH 2YRZA 2B0SH 4LIQH 4N0UA 3I75B 3C8KA 5F96H 2FEEL 4POUB 2R1XB 5GXBB 1AC0A 5B38G 1PKQE 3ULUL 4PBWD 4I1NB 3RWIB 3KXFB 5F7WC 2UZXB 1ZLUK 3ZT7A 1IAIH 3MRIA 1R3JB 2EIEA 2OTWB 3EJYD 3LKSA 3OKNA 2CO6B 2ZNWA 3FKUS 3SKMB 5JXAH 3JV0A 4UOW0 3T04D 3MROB 3CX5K 3VRJB 3KPSE 4HF5L 5I6XB 1IM3B 3BPCB 2UUDK 3QZWG 4X4MA 1BECA 3STZA 3HE6D 1MRFH 4YHLH 2EYSA 3MO1B 1MHEB 5FK9A 2SEBA 4NBYB 4M02A 1A3RH 3ZE2E 3SDDB 5C0BE 3W5MA 1K4CA 2EKSA 2Y5TB 4OCMC 2ZCHH 3MNVA 1AQKH 3V5DB 3QUYB 3BD5A 3KS0H 5EO1B 1EGJL 1KJVB 4JDZA 3WXWH 1S9XB 1MQ8A 1R3IL 4H1LG 2V7NB 3BPOC 1YEFH 2G60L 2A6KA 3Q6FB 3OZ9L 5HHQB 1CLZL 1JN6B 5I17A 5KSBB 4BQBA 1JF1B 4RBPH 4WEMB 2R0ZL 3ZE0E 5I6XC 4KVNL 4R9HA 5C70A 1DQJB 1TLKA 5J12B 1RJLA 5F7EL 3CCHA 5DD5L 4X6DE 2WIMA 3RGVD 4TSAL 3MRQA 1RJYA 2AJYH 4YXKL 5HGAA 3QUZD 1Q0YH 3C6LA 5IMKA 4LFHD 1N64H 4LGPB 5E2VH 4QXUH 1ZWIB 4IIQA 3ES6A 4QOKB 3AS0A 3DRTA 4P2QB 5IHZB 2GFBB 5DQJA 3VWJA 5EUOA 4WRLA 5MEPA 1P1ZA 5D96C 3EGSA 1LVEA 4ETQA 3WIHL 5IWLC 2EDKA 3S88L 2GITB 2XZAL 3SCMC 1Z0NA 25C8H 2NY7H 4MB3A 1N2RA 2X9WA 1EEUA 4HBQA 1LE5B 3D39B 1N59B 1LEKB 2PTVA 2H9GA 3UMTA 1I1AC 3CFDA 4HMEA 4LLUB 1QVOB 2R2CA 2E3VA 4YK4B 2DICA 2HRPH 1OB1A 3QO0A 1TENA 4G7YL 3CXHJ 3O6KH 1D3CA 3RNQB 3TNNB 3QXUA 1M05B 1LO5B 2B1AH 4G5ZL 4YHIB 1B90A 4NQUA 4ODVH 4B5EA 3GIVA 3RIAK 4YAQB 1BJ8A 2EEDA 3QCTH 3OAYH 5I0DA 1G7LA 3D9AL 3UTTA 1BWMA 1JZ8A 2EH7L 1GOFA 4QWWD 2PR4L 3DI2B 5LBSH 4EJ1C 5B21A 5EBLB 3TO2B 1HWGB 4WWID 1T2JA 4R7NB 6FABH 1TJIH 2ESVD 4R90H 4N0YL 3TNNA 1JPGA 1X6NA 4DKAA 1HN1A 4P2OD 4ZPVA 4OLZL 1MFDL 4HMDA 1F97A 2AEQL 5DFWH 3DUUB 5GS3A 4XVTH 1NLBL 2Z35B 4KTYA 1LEKA 5JW4R 1ERNA 4G8IB 1S9YB 2E6PA 4L8SC 3O3EA 3GJFH 1A47A 1KCSH 4LP4A 2QV2A 4G9DA 2X89A 4D0BB 1G1CA 4AENA 3IDJA 5EBGA 2GFBA 3IFNL 5FDWA 3QWOB 3QUYC 3HRZA 4ZAKC 3X11B 1MY7A 1GPOH 4O02L 2DIAA 2VYRE 1EXUA 3AREB 1TZIA 5JOFA 1QFWL 2W0KA 4QRQB 4MAUL 4G8FB 1O0VA 1Y6KR 1M6OB 4NBZB 4P2OC 1MLCB 1GGTA 4B0MM 3R1GL 1IKFL 4GS7B 5JPNA 3E6HB 4MAYB 2FZ3B 3BW9A 4KHTH 3IVKB 1ZHNA 1DQJA 1KN2H 4O5LH 3AB0C 4J23A 2ICWB 4PRIA 4NZJA 1C5DB 5IB2A 2W60B 1DQDL 1R5WA 3VXUD 3HRZB 1AGEA 1RUAL 4MQXD 4PP1C 3RU8H 4O9HL 1XGQA 1CVRA 4OB5H 1YMME 1KGCD 4RZCA 3QUYA 4KUZH 4L3CB 2EC9T 3D25B 4L4JA 4NQEB 1Z9LA 4I8DA 1S5HA 4P46C 1T5XB 4PB9H 1L7TL 2I07B 3DUUA 1T4KB 1S9WA 3NFNA 1X5JA 3I02B 1KSRA 3QFJA 5I15H 3H42L 1A3RL 2AK4A 5ABDE 5JW4N 5TE6L 5MEND 4IDJL 4R2GC 2BRRH 3X3GH 3QG7L 2A6DB 3KPQA 3BIKB 4H0HB 3AFLA 4WNQA 3BRDA 1FL6B 3OKDA 1HHGB 5FYJE 2WLZA 4YHPB 4O58H 1R3IH 4PBXA 1BQLL 1MPAL 1CN4A 4PJHA 3GSXA 3S5LG 4JVPA 3LSOB 3MBEC 5DK2B 5I1DB 5AUMA 1JYVA 1P9MA 1CD1B 1HOCA 3T0EE 4QOKE 1KTDB 4ONFH 2FX8L 3GIVB 5IB4A 4ZS6D 1AGDA 4W4OA 3QFJB 1FJ1B 2VDNH 2E27H 4Z5RB 1OAUH 4R0LC 3RGVC 3EOTH 2GI7A 2O5XL 3BJ91 1OB1B 5GS1C 1XIWB 2AJUH 5IJVA 1TVBA 4YC2B 1I7TB 1WBZB 2IGFH 4FP8H 1QOKA 5DEZA 1SEQL 3HRPA 3IDXH 1XR9B 1DE4A 5SX4I 2Z92B 4V2BA 4YPGA 3VW3H 5DJCA 5IBUG 2Z8WC 3WN5B 4LDOB 3UTSD 5I1LA 5HYSA 1BD2A 4OJFH 1NKOA 2RFXA 4FMFA 3ARGB 3SE9H 5HYJD 5GGVL 3WIIH 4NQXA 3PP3H 35C8H 1W0WA 2ED9A 3T0EA 1FYTA 4ELME 5HBBA 3DV6A 3JV5A 5DLML 4PJIB 1CLYL 5E6ID 2F54B 1LE9A 5SX4H 3VFUB 4NZUH 3BEVB 3TA3D 3IETA 3SDCA 4ONHB 5AWNL 4OUUB 2IFFH 4LQ1A 4MNQD 1I1FB 3HE6C 3UZQA 2X9XA 5E94B 4G5ZH 4F8QA 4OFYD 5F44A 3VFOA 4GXUN 1RUQL 2AABH 3K3QA 3KPNA 5CWSA 3MREA 2LU7A 5DMYA 5CIPH 1CICA 3AC0A 4RA0C 2UY6A 1U8PA 5D7LB 3MTRA 5D7JA 3MRNB 3ZTJG 2CJUL 3BXNB 4D0BA 2IQAA 3OGCA 5FUOL 3CAFA 5HHQA 5FGBC 3CFEA 2DIJA 5TDPA 5IB5A 5BZWB 2W07A 3CVHL 4P2YA 4G8IA 5DI8B 3T77B 3LKNA 2H8PB 4TOYL 3MV8D 3LS5H 4U6TA 1VFBB 1W0VA 1N0XH 1FNLA 2JCCF 2PYFA 3MCKA 1X5GA 3MRRA 4MVBC 4LVHC 3GMMB 4WI6A 3FQTA 2BJML 2QSCL 2MJWA 5H94A 3DV4B 2FX9L 1U58B 1MJUL 1CGSL 1TNMA 2NY6B 2FL5B 3MOBH 4LHUB 1N5AB 2CGRH 3HAEH 5ERWB 4WHYH 1PG7W 3NCEB 3VRJA 1OSPH 2FJGA 4R7DB 5HY9B 1DBML 5IVXE 4TQEH 1DTUA 1IGIH 2Y36H 3T2NH 4ODUA 5E24E 3FRUB 3P3YA 3MRPA 3P4LA 2FO4B 3Q3GB 1WBYB 3TBSB 3QUXC 5HI5D 1NMBH 1ZK9A 5E56A 1VKXB 1LWRA 5KW9L 3P9LB 4UT6H 3T0DA 3KGRA 2KUTA 3BIBX 4AIZB 2HG5B 5I19H 1ZLWK 4IOFC 4KC3B 4Z7WF 2FWOB 5DGRA 4KK9D 1YNTB 3N1GC 3PGFH 3EDFA 3VE0B 2IH3B 5I2IA 4TRPH 1QVOA 4XP5H 5F71A 2G5BA 4LPTA 4JPWL 3ECBB 3MGAA 5L8JB 2UY7A 4ZUWB 1I3GH 3PJSA 2OZ4H 1CU4H 3G6DL 3RAJL 5CJXA 3HMXH 5B39G 2DQHL 3KPRE 4V1DD 2RBLA 5FO9B 3L3HA 2VQ1B 1Z9OA 3MLPA 4U1HA 1HNGA 3TN0A 2PW2B 3NIFE 5BVJA 2A83A 1DLFL 5KTEL 1XF5B 4LSPL 5CJOH 5FECA 5J6HB 4RIRB 2I9LB 3KYMB 4QTIL 3VGEA 2COQA 2H6PA 2FYYA 4PYGA 5L2KD 3K0WA 5EWIH 3QUZB 3VI4F 4C54A 1HINL 1DVFD 3D69A 1LNUB 2QEJA 5IJKC 1UADC 2CLZB 1MLBA 5D72L 1JYNA 1EERB 3NZ8B 4OF7A 1HCVA 5EBWB 1BFTA 2WZPD 1TZHA 2NXYD 3D85D 5DMKA 4RA3A 1OP3K 1EUTA 1JGUH 1UQSB 3S8WA 2X70A 1X5YA 4LCWA 3VMPA 4ZS7L 1N5AA 1O5DT 3KJ6H 4E5XB 4QRUB 3TIEB 4DWHA 4J4PA 4PJ7A 1UACL 2VTFA 1YNLL 4EI5B 3CMOL 4JZOB 1GGBH 3U2SA 1RD6A 5C2UB 2VITB 5SWZD 1D5XB 1OAYL 1J1XH 5JOPE 3B5HA 4GKSB 4WUUA 1U93A 1E4KC 4RGMC 1F4WL 3KVQA 2O5ZL 3H3KA 1WTLA 1YJDH 2VH5H 5DRNB 4XT1C 2C3HA 2YD1A 4LVOC 3ULVF 2G75A 1HI6B 4PJBA 4XB8A 3BXNA 5E5MB 1X44A 1OD9A 2MKWA 1A14L 1U3HB 4JG1H 2FR4B 4L5FH 2EDRA 5D6DC 5IFHL 5IESL 1I1AA 3KPLA 4E41E 2BVOB 5AD0B 1HDMB 1QFPA 1MNUL 5IVXB 4PJBF 4XH2A 4Q6IC 1W8OA 4BELD 5L0QC 3FO0L 3MMEB 5I1GH 2CLVB 4XBEL 5GRJL 3HCVB 2VDLL 1OM3L 1MVFA 5KJRH 4JHZA 2C5DC 5C0CA 3P30L 3F6IA 5EOQH 3OKLA 4YDVA 2I27N 3AY4A 1R3HB 1CXLA 3Q6GL 1GYAA 1OSZA 2IC2A 5CEYB 1JTOA 2B7DT 2V5TA 3C8KB 3GI8H 1CYGA 1H8OA 3DOSA 5FECB 5J6HA 5LGHL 1SY6A 5I1KL 1K5NB 3LKRB 3IU4H 2BOCA 1HYSC 4W4NA 2XFXA 4QRSB 4OZGE 1XH3A 1H0DB 3BN3B 4XP1H 1MEXL 2PO6B 3F58H 4JFFA 2V9RA 3V7AE 3D2UD 3G08B 5FGCB 4YGVA 3TBYB 3UCRA 1IAIM 5LQBL 1ZVHA 4XCEB 2OL3L 4TVPL 1YY9D 1TJHH 2NZIA 3P73A 4QRTA 3QFDA 2E9WA 4O2EA 5I8CB 4KROB 3TNMB 1A7BA 1DANT 3NABL 2NR6C 4U6HB 1QLEH 1KTRL 3U7WL 3WLWD 5ID1A 3FAXA 5EO0B 4KDVA 1H5BA 1DR9A 2R69L 2CSPA 3VXQA 2AQ2A 1ZSDA 1MSPA 3O6FA 5GJTH 4JJ5A 5D71H 3DROB 3QDGE 3GGWA 4I4WA 3PQYD 3E1F1 1VKXA 5K93A 5HDQL 1AI1H 1CVSC 2X40A 3UO1H 3PWJA 5L88L 3C08L 2PNDA 4M6ML 3FONA 4MJIA 4PV8B 3I9GH 5LCVH 4G6ML 3GRWA 3GUTA 4IBLT 4P5TB 4TULH 3VXRB 5C08A 4Z78B 2DLEA 1Y6MR 4JFQB 3EFFA 2XN9E 2X6MA 1IGML 5C9JA 3U4EA 5HYIA 4K9EH 4BFBD 1FLTX 3KYKH 4AM0B 2LU4A 3NH7L 5T1MA 3I02A 3S5LA 2PUQT 4X7CC 4ODWB 3WBDA 1FGVL 3RA7H 4KRMB 5D2LB 1I8MB 1ZT1B 1CXEA 1BQUA 3K8KA 1D5BB 1YMMD 4XNZB 3HE7B 3WHXB 3Q2CA 3VFSA 1Q0XH 5C0CD 3EFDH 2CMRL 5DFVD 2X42A 4ZNEE 1HKLL 1IBGL 3LQAL 4PJ7B 4NRXB 4ZNCD 2C1PA 1OAQH 4M03A 5A3IC 1JWMB 3S37L 1UYWL 4NKDA 3QUKA 4DAGH 4Q9QH 1MCWM 5SX5H 4OUUA 5L0QB 5T3XE 2LABA 4PLKD 4LLQB 3E3QC 3NACH 1TPXC 3MRGB 4NRZA 1BVKB 2W0LA 5DTFA 1M71B 1MFEH 1S7WA 4MJ2A 2OS7A 4LHUG 2O5YL 5E99L 3HA0A 1H3PL 3QFJD 1TPXB 2NY5C 1BVZA 2AAVA 5AZ2H 4YNYA 5FYLL 1RSFA 3UJJL 4DZ8A 5JMRA 4OLWH 1VADB 1DJSA 1YDPA 3TO4B 5ANMB 5D1ZB 4KV5E 4KZDH 3QEQD 4OF3A 5DJCB 1FVCA 3WNKA 5FB8A 2APFA 1PEWA 5F9WB 1DQQB 2WAHA 4MSWB 5F1OB 2AV7A 3FT3B 1S7TA 4PP2B 4Z0XA 1IGCL 4PG9B 4MA7H 1BBDL 4U1MB 5DMJB 1D9KA 2HYMA 1U2HA 4Y4KA 2PF6A 5I73B 5KAQF 4HIHA 3DVFA 5LGJA 3WJJA 5CUSH 2C1OA 4S1RL 4QHLA 1TVDA 4J3WA 5LWYL 4MYWB 5HHMD 4RMTA 5GHWH 4JRYD 4DKEL 4ZFOB 3JV6B 4XVUD 2WBJC 4JHAL 1IEBB 4XCFL 5IB4B 1KELH 3IDIA 1J8HB 3AAZA 3BPLB 4ELMA 4EXKA 3Q5TA 3UYRH 4FQCL 3DUSA 3DVNB 4FZ8H 3TO2A 3P9LA 4HD9A 5MHSE 5DMIH 5HPMB 4E41A 4KTDL 1WBYA 4U6YA 1WEJL 1SYVB 1KIQB 4KU1A 1FL5A 2H2PD 1RY7B 4H8WL 5B4MC 4M5ZH 4GRLB 1C12B 3KPOB 4NKIL 3SCMA 1KYOJ 4MAYD 4YHIA 1VCAA 5CS7A 1CLOL 1A2YA 3J8F7 3N1FC 3PV6B 2YZ8A 3KLHD 1KNOB 4DOHB 1PAMA 3QDJE 1P2CA 4NWUL 1G9EA 3N50A 4POYA 5GGRY 4V1DB 5CLWA 1JGEA 3SOBH 4PJ7E 5HTSA 4KROC 2A6JA 3ZKXB 5IBTL 4YFLI 1PJ9A 1R3LB 4P57A 3X13B 3RY6A 4PS4H 1ONQA 5KS9E 2BSTB 2VLLA 4HSQA 1A7RL 4LCYB 4Z7UB 3C6LD 5DVOA 3UZEA 4FQJH 3GMQB 2F15A 5E0QA 1JK8B 4EXPX 1MQKH 4G6KL 1I3RB 4UOW1 1EJ6A 4JB9L 3VRIA 5DUMH 4P48A 5CINL 3SKJH 5CD3B 1GZPB 5DD1L 1M6OA 3O0RL 5CKAA 5ILTH 3U4AA 2XKSA 4CW1A 1CDIA 4P2RA 4W81A 3RQ3A 3L1OL 5HHXH 1HILA 3GBNL 3L3JB 1SY6H 1REIA 5EC2B 3QDGD 2BSRB 2IWGA 2J12B 4U1KB 4NN7B 5E5UB 3EBAA 2D0FA 4NCC2 4KK6C 3BT2H 3MRDB 3QIUC 4XMKH 1JNNH 5LBSL 1R6VA 5CP3A 4W6XB 2Q86B 3MLYH 3WS3A 4U49A 1R3LA 4P57B 4DN3L 2X89D 3G04A 4YDKH 4WU5B 5HDBE 1VESA 4PRPE 4N0YH 4LCUB 2ZUTA 4PJ9A 2VL5A 3BZEB 3MOAL 2NLJA 2BCKA 3KYKL 4KK5C 3RWFB 1C1EL 3NCYS 4P4KA 2Z93B 3KPSB 4QYOB 1FCCA 2VLRD 4NNXB 1EZVY 4YHOL 2CUMA 3SO3B 2EEBA 1IQWH 5IFJB 3B2UC 3FOMA 4FABH 5ENWA 3VXTA 4UILH 3A67L 1YEGL 5HGGS 5GSRB 4OZHE 1HKFA 3FL7A 2HH0H 1Q9LB 2GSGA 4DEPC 2A0LD 3D0LB 4G3YL 4KAQL 4Y4HC 2OR8A 4YHPA 4FQIH 3TV3H 4Y7MA 3QUZC 1P7KA 1XR8B 1R24B 5KS9A 5EU7C 3I75A 1QPXA 3ILPA 1HWHB 4HKJA 3UAJD 1NBQA 4HPOL 3QO0B 2B5IB 5D7KD 4DQOH 1RZKC 3WSQL 4PJ5B 12E8H 4NZTL 3SE8H 3V2AR 4X0KA 1IAMA 4YFLF 3WNPA 3S3PA 1XIWD 4WEBH 4QHKJ 4EVNA 1KIUA 1ES0B 5BS0D 5ICYB 4LSRH 1IC4L 3BI9X 3VGAC 1N7ML 2L7UA 3MRHB 5T1KA 1F11A 4Z0XB 3QQ3A 4GXVH 3IJSB 5L9DH 4N8CH 3ZKXC 2MTPA 3IDMA 4HC1A 3MODL 3QHZL 1T83C 2DQEH 5TE7H 4K7FA 2I5YL 4NN5B 2APWA 4D9RE 1QEWB 1E6OL 4EOWL 4O51B 4NBXB 2CR3A 4C4KT 4GBXD 1XGYL 4WFGE 1RJYB 1F6AA 2YEZA 1SMOA 5EU3B 2IQ9H 3FFCD 4HXAL 1JZ2A 4JFEB 2C4FT 3MRGA 5FUZH 4LLWA 4AEEA 4R6UA 4ONGH 1YQVL 3A6OA 4FXGB 5MENB 5DZOA 4APQC 1QLRA 3LRSB 4M7JH 1MCKA 5BZDB 5TQ0H 2Z31A 1NPUA 2NW2B 1OAKL 1CI5A 1A1NA 2V5MA 3QAZB 4I77L 4GMTH 2ZUSA 3CXHK 4MJ6A 4ZUSB 4LK4A 2VXQL 1HNFA 1NFDF 1MH5B 5EA0L 5EZOL 4NCC1 5FCUL 3GMRB 2FX8H 3DRQA 1HSAB 1Y0LB 3PXHA 2A6IA 1C7TA 2W0PA 4OZFG 1AY1L 2AXHA 1T22A 5INCA 4AQOA 2ZG1A 4WU7B 3SE3C 4CUCA 5ITBL 1CFQB 3HN3A 5HVWA 3F12A 4HT1L 2AKRA 4PBVC 4HQQL 3S35H 3SDAD 1BOYA 4PJ5A 4I3SH 3U4EB 4JJHA 2IGFL 4HHAA 3UTQB 4JQVA 2JJSA 3N0PB 4JKPL 3DX7B 5INDB 3ZDZF 2DMBA 4FTVD 5E1HB 5TGBB 3TBTA 3ZL4H 4BYHA 2VXTL 3FOLB 5GRVL 2P46B 4Z7OE 3U36B 4Y4HD 5FYKH 2AJXL 4GW1B 3BJLA 5I74B 2BVEA 1CWVA 2Q7YA 4MQSB 3MRKA 3LZFL 3QI9D 4GLRH 2FO4A 3ARGC 3QP3A 3T4AA 3O6FB 1ZSDB 4OFYA 4CVUA 4P5MB 2NY0B 3FB8A 3OF6D 3P9WB 5JOPD 2GTWB 4Z18A 4J1UB 4H88L 2XWTA 4LLVA 1GGCL 4LHUA 4QF1B 3C8HA 1OTTD 2IFFL 4IS6B 2IADB 4QYOA 3KPSA 4LSTL 3TFKC 3LQAC 1JNHA 3FQTB 5KSAD 4PY8J 4MJ5A 1FZOA 2D31B 2QSQA 1VFOA 2ED7A 2EIBA 3EOBA 3VGBA 3NCJL 1I7RA 4NN6B 1T21B 3N85H 1KXQE 3OV6A 3CFKB 5JORB 3RDTC 1NBYA 1LP9A 5BZWA 2I60L 1PGRB 3I3EA 5DQJB 3MV9E 2HJKA 2XWJA 4KMTL 4Z77A 3GDBA 1KACB 1EHLL 1M7XA 1YECH 3LS5L 3VFTA 3HI6L 1VGKA 4LSSL 1W72B 3TT3L 5I8OL 2W9EH 4U1GB 4Y16B 3QIBC 2R0LH 1FFRA 4Z95H 4JRYA 2HTLC 5CWSB 3CSGA 4XPFH 3WL9A 4S1SH 3T4YB 2N4IA 1IAKB 3AXLB 2RQ8A 4NQCB 3C9NA 3ZDXF 3VH8B 3X14B 1EO8H 4M1DL 2CGRL 1A1MB 1TIUA 5IEKA 4X4XB 1UM4L 5JPMA 2GTZB 5CEZL 1ZT7B 3WV0A 3VXNA 5JO5A 1F6AB 2P49B 3HLAB 1A6TB 2HJKB 3Q48A 2C3VA 5CZVL 3RWGA 3ZDXE 1JK8A 4X9FA 5M95B 1U93B 1KCUH 4PJXB 2AJVL 3HNSH 4G8GB 3O6MH 4JDVA 3OJDA 3TIDA 1X4XA 3NIGE 1AR1D 1OGTB 1QFWI 3BH8B 5FHBH 3WSQH 1IC1A 1QRND 1U95B 1UM5L 1ES0A 4QKXB 2PO6C 1I9IH 4I9WE 1U3HD 2QR0A 2DI9A 2PTUA 2E5EA 3VFMB 3HPJB 3EYSH 3PGDA 1YMHB 4MAYC 4RWHA 2JLLA 5I73C 1ZEAL 1AGDB 5K9JL 1RZJH 2YD4A 4NPYA 3GSQA 4PUBH 4LARH 4DW2L 2NY2C 5K9OB 1ADQH 3QEHB 4ESKA 3MLRH 5KS9B 2VDRL 1DQLH 5GGSY 5SWZB 1CD1A 3UTTD 1NCBL 1BJ1J 2XA8H 5FM4A 1YPZB 2VABB 4E0RB 5F9WC 1E4WL 5KVMC 3P11L 3QJHB 4OJFL 1GSMA 4ZOCA 5EB9A 5C0IB 1XF1A 1FSKC 3K4AA 1BEYH 4PFEA 3MRMA 3B3IB 2F8OA 1HHGA 1QLFA 5DXWA 5C1MB 2MSPA 2HJLB 3UYOD 3VXTB 2CDFB 5LG1A 4X4ZA 2UYLB 2A74B 4AMKH 3CIQA 5F72S 1WC7B 4X8XA 3BKCL 1R3KB 3KPMB 2G2RA 4LVOB 1H9VA 2HP4A 4OCNC 4S0TD 4OGZA 3KPSD 1QA9B 3V6FB 5BCAA 2AABL 3HC4H 5BRZA 2W91A 1JGDA 2DWDA 4P2CG 2LAAA 1S7SA 2VXSH 3L9RA 3GMNA 3SGEI 2AV7B 4IRSC 5DVLA 2G9HA 3I2CL 3RL1A 2Q8AH 4F7MB 4UAOB 1JWSA 4YWGL 3KPPA 4U1KA 2MQ3A 4OD3H 1NC4A 4L8DB 4IRJB 1J0ZA 4FXGA 1HHIA 5MENA 3DVIA 3I50H 4J6RL 4WY7H 5E00B 3FO2B 1HIML 4HGMA 2H26B 3FRUA 4K71C 3EO0B 3VWKC 4ZFGL 1ZA6A 4AEHH 5KN5A 2BSSB 2VISA 5C7XH 3U0WL 3CGTA 4JFZL 3U0TB 2FEDC 2D0HA 1FH5H 5JOFB 4F3FB 5EO9A 3QRFM 5LAXA 1OP5H 5HDOA 4HZAA 5J9PB 4MD0B 1S7QB 2J8UA 1NGYA 3IDMB 4LPUA 5T1LD 1LDPL 1YY8A 1NCCL 3IDJB 3LZFH 3L5WA 1AHWA 3MRJB 3BX7C 1QSFD 1UH3A 5I1KH 1XCQB 4QCIA 4PRAA 4JQIL 2WWMD 1MWAH 5GRXG 4ZTOL 4YBHA 1WFOA 4KZEH 5ETUB 3ZKMC 1U8PB 3VXOB 3MJ7A 4JN2B 3GHBH 1MCCA 3E0GA 1NGYB 4WGVB 3THMH 1JGEB 4JPWH 5B39A 5JHDD 1F13A 4F9PC 3QO1B 2PXYA 4JR9L 3WUWA 1EJOL 1Q8MA 2NY1D 5D2LE 1XEDA 3WDIA 1FGNH 4G8EA 1H3WM 5DRZA 3V95A 2HRLA 3JTTB 5BOPA 1YPZE 4U7MA 3RKDC 1BQHA 2B20A 5JW5A 2C4FU 1WICA 1OGAD 5J12C 2J8UE 2WBKA 4P3CL 4QRRA 4Q9RH 2ATPB 3ME0A 2C3XA 1HHIB 4OCYH 1NAMA 1I8KB 3QXAA 1BZ7B 4AL8L 2DQJL 2CDEB 2G9HB 3FOMB 3MYZA 5IFJA 3K2UH 4G43A 1A1OB 4MCYB 4BZYA 2V2WB 3H7BA 5EPMA 3W9EB 4BSVA 5T1KD 5ADPL 1VEMA 4HBCH 3BHBA 4GAGL 1J8HA 5FKPA 2ADFL 3UYPA 4U1SB 1GHFL 3DGGA 3QI9B 2IAMC 3MBED 4CAGA 4F7TA 2NR6D 5L7XH 4MNHB 3C60C 3S35X 4H8WC 2JJWA 1GGYA 3ZYOA 5IMMA 3V5KA 1FFQA 3O11A 4ZOEA 2VZUA 4AK1A 5EC1A 3RA7L 1UACH 2A74A 3N9GH 2UYLA 3PIQB 1QR4A 3D3VA 5J11C 3KWWA 1I8KA 1D9KB 2FH8A 4M93B 4U1MA 5KSAB 3LKRA 4RGMB 1A7PH 1EBAA 5JXED 3BE1L 3FN9A 5FYKE 3O41B 5KZCB 1FVDA 2XT1B 5DWUH 2DQIH 1BM3L 3SDYH 4WFGD 1YDPB 3TO4A 4HEME 5DJAA 3T1FA 5IR1A 1RZ8A 3S34L 1OAZH 2R2BA 4Y19D 2AK1L 4WNQB 4J7RA 3LVEA 5FGCE 2WV3A 3BWAA 1IGFH 1QSZA 3VRLF 4WVRA 3TWCH 1N4XL 1FZMB 3GHEH 5ITFB 1M71A 2R56H 5B39B 3GSUB 3B9KC 4G42A 5I30H 4LARL 4DW2H 3JUZA 2XY2A 4PLOB 2YD7A 1X5ZA 5FUCC 1QD0A 4UQ2B 4NOBA 4X8JA 4GAJH 2P5EA 4JPKH 4NJAL 1OAXH 1JPFA 4XPAH 4LCYA 5J89A 4LPVA 5FOJA 1BEYL 1NGZB 3U4BL 3QJFB 4XAWH 3LQZA 1T7YA 3OJDB 4YC2C 3MV7A 2F58H 1IZKA 4K8RH 1IL1B 4GBXB 1HE7A 3D0VA 4JZOA 3U2SB 1KLGA 2SEBB 25C8L 2KQNA 3LAFA 4YQXH 5FK9B 4B53A 5D2NB 4G42B 1RIHL 2VLKB 1CF8L 1JTPA 1CBVH 5T1MB 2DDQL 3V5HB 4LLMA 2X09A 3MJ8B 1HHKA 4ZFFA 4GRLA 3MLSL 1FL3B 3HC0A 3PL6B 4X9IA 1CFSA 3OG4B 4ZFZA 1B9ZA 4XCFH 5JQ6H 4FOMA 5FYJH 3BWUC 5D1QD 1Q1JL 2QQQA 2QJDA 1YN7A 3AREA 3OB8A 4LSVH 2FHFA 2MOVA 3KPPB 1JWSB 3U7YH 3S97C 1NUNB 1BFVH 5I1CL 1CG9B 5DVMA 3QPQC 4U3CA 43C9B 5HI4D 4QRPB 3BN9C 4RGOL 2FB4L 5EUKB 2DQUL 1CL7L 1W72A 3F8UB 3C08H 5F7YC 4OFKA 2W92A 4XNYL 3ARDC 3BUYB 5ADOL 1HHJB 2WINB 4HV8B 1JWUB 4OM1L 2XWJB 4MZ3A 4JJ5B 2QHRH 2XY1A 1NLDH 3IRZA 2AJ3A 4P46B 4X6BA 1UA6L 4RMUA 1KLUA 3FN0H 3ZE1F 5ID1B 4R4FL 4XX1E 1RZIA 4D0DB 3MOQA 3VFGL 2ARWA 1N26A 5E8DL 1CZ8H 3OAUL 5GRWA 4YFEA 3CDCA 3RVVD 3DX8B 4JZJA 4WW2A 1LD9A 1UVQA 2W9DH 2GTWA 4XWGL 2ERJB 5C07A 2XFXB 4OGXH 2ZJSH 4LSUH 4FQJL 5L2JA 5DR5H 1S5IH 1WWCA 3MV11 3AS3A 4OCSL 2OMNA 4HS3A 2BY2A 3IAGC 2BK8A 2JK5A 2JB5H 3KDMA 4PD4J 2JCCA 1MCRA 3H9SA 2MQ0A 3JSSA 4PJ8C 4ODUB 4G8EB 4CU6A 1LO5A 1DDHA 2X7LA 1VPOH 4OF6A 3MRLB 4LCWD 2NY2D 4HIIB 2K3TA 4Z7QF 5INDA 3DX7A 5IV2B 2IAMA 2FATH 3DXAD 2VR5A 4XH2B 1ZT4A 1E6JL 3FB5B 4Z0BH 3M1BB 4XCNA 1EMTH 2NW3A 1EX0A 2CPCA 3QDMA 4U3XA 4DKFH 4OI8A 2M26A 4CVZB 5KG9A 4WU7A 5KVFL 2O61B 4AY0A 4KKNA 1ZS8A 1U41A 1NFDA 1U6AH 3PWNB 2G5RA 4L8SB 4BK5A 3RHWF 3SKOB 4AL8H 2NX5A 5EDXA 5E2JA 4P9ML 1GCFA 3GI9H 1J05B 1RUAH 2MHAA 2XRAH 4ODWA 3WN5C 3WD5H 3MPCA 4J8RB 4P5TD 2K9UA 4PJ5E 4MA7L 3G6AB 2BNRB 3MA7A 4CVZA 1AGBA 4RGND 2HFEB 3MV8E 1Q9KB 4XBGB 5DD0L 1FC2D 5C0GA 2Y6SC 2UZIH 3M1BA 1A1NB 4CU8A 5TFSL 5D5MF 3ARFC 3SHSA 4NUGH 1S8DB 1CE1H 3V0AC 5DQDH 3F7YA 2YD6A 2HKHL 4KPHH 5KN5B 4AT6A 4MA8L 5IMLA 3O8XA 4Y89A 4JHAH 4PJEA 2BC4B 2CLRB 3BH9A 1PX3A 3P9MA 5IOPB 4WO4D 3FONB 4LMQE 4PGZA 4WHCA 1N6VA 3VD5A 1MLBB 2W38A 5JHDA 3ZTJH 4KK8C 1W0WB 5J13C 4U1IB 1IEAA 1V7MH 4X6CB 4P9HL 1TFHA 1OTSD 1P7QB 1EA9C 4HJJH 5HYSB 1E0OB 2YPKA 2I9LA 1CT8A 2HLAA 4MB4A 3OR7A 3QNXB 1ZAGA 2OQJB 3G6JB 4L9LB 1DSFL 4H8WH 2Z92A 1XGUB 3CXDH 3QYCA 2R29L 3QIWC 1A7OH 1KCRL 4XAKD 3BP7A 1PSKH 2ZOKB 1I7TA 4AEIH 5BQ7B 2AEIT 5JIKA 5FO9A 4G6FD 2HJFB 1NGQH 1V3KA 1UB5B 3GBML 4ZOAA 3RVTD 5BVPH 2HVKA 1QSFA 4OZIA 1PZ5B 4O4YL 1B0GA 2H1PH 3C8DA 1IC4H 3KPRD 1VERA 1D7FA 4K71B 4V1DE 3B9KB 4LLYA 3PQYB 3CZFA 5FYJD 3DXAA 1J5OL 1YQ2A 4KK8D 5EU4B 3MV8A 2C7UB 1A7NH 1OHQA 1UFUA 1DEDA 1QKZL 5AUMB 4NO0D 4BQCA 3SKNA 4F15C 3C09B 3AB0B 4XNUH 2FECL 4OCXL 1NFDE 4HHAB 3MRPB 4L4VE 4HWNA 1YMHA 3SKJL 3BIKA 3L5XH 4U1JB 1QRNA 3QIWA 2HTLD 4ODHL 1FNGA 2XN9B 1QSFB 4OZIB 3FFDA 4XVUC 2MCG1 1YEKH 5EZLB 3UJTH 1LO0H 2FL5A 4M7JL 3SE3A 5D2NA 5EZJB 5TF1L 3K74B 2PXYD 5IB1A 1SY6L 4GQPH 4I9WD 5CBEA 1NANH 4GW5B 4NO0A 1CTNA 3DYOA 2ZKHL 1EDQA 2F74A 5T33L 4X6CA 1JE6A 4GQ9H 2VWEE 3WFCH 2A38A 1XT5A 3P0GB 3T3ME 3T3PE 3ARPA 3MRNA 3ULVH 3G5YA 3JWOH 1UQSA 1EEYA 5EH1A 2AQ1A 4D0CA 4NOFA 4IHOA 5KVDH 2XIDA 4UINH 4PJEB 5EZIL 2IALB 3S36X 1JGVL 1A1MA 3NZ8A 3VXUE 1EHNA 3EO1B 4OT1H 5FA4A 1K6QL 1YYMH 3B9DA 3MBEA 1ORSA 2LTQB 3FB6B 1KCVH 5CCKH 3ARZA 2Y36L 4NO2B 4JM2C 3PXJA 1FVDB 3FT2B 2FECI 5F8QC 3CFCL 1JZ3A 4LNRA 3OHXA 4MJID 1QNZH 4FQIL 4M8QA 1CR9H 5SWQA 4N1EA 2GJ6D 3WN5A 4LEXL 4F7PA 3TLRA 2DJ4A 3NN8A 4PJFB 3Q1SH 1SM3L 2JJTC 3WYRA 1QFOA 1T0MA 1J7VR 4H88H 5F3BA 5H37G 2KZ1B 1E6JH 1MCEA 4Z0BL 2OTPA 2AK4D 5DYOA 2CD0A 4RSVA 1W2KT 4QNPE 1P2CB 4E9LA 1MREH 2ARJA 4HAFA 4PG2A 2APXA 3L3DA 3ARDD 1BWWA 1NC2D 3O2DH 4BSVB 3D2UA 3T0ED 4LSRL 1KC5L 2EDWA 3KYNA 5D5MA 5T3ZE 4TPRH 1CK0L 4GMSH 4LU5L 3ZKNC 4ZTPH 2IPTL 2NYYC 4POZD 5TPWL 1L7IH 4IMLA 5IF0B 2CKBA 2BRQA 2DTSA 2P8PA 3C2AH 2ATPA 2DQGH 1JFQH 3UPAA 1NDGB 2W9EL 3SDAA 1GC1L 3TO4D 3V6OA 3U6RB 5ERWA 4Y16D 1K8IB 2APTA 2ENYA 3KYNB 4U1LB 5GZNC 4JKWA 2F5AH 4WHDA 4XC1L 3NCYP 5IW3A 3BP4A 5KOVC 3B2UD 1YUHB 3JV6A 2D4FA 3QPXH 1I1AD 4GKNB 4K7PY 2WUCH 2DBLH 4JFDB 2ZUWA 1JHLH 2MQCA 4OZ4B 5SWSB 4PGEB 4KK5D 1Y0LA 3BEWA 4X6EB 1LEGB 4NQEA 1F4XH 5CSBA 3UTTE 5C9KA 4Y4KB 4WFEE 3BPOB 3WNLA 3MRJA 3O6ML 5MEPB 4OLEA 3OHXB 5EA0H 4QRPA 1S7RB 2MWCA 2B1HH 4KI5C 3GMLB 4EI6A 1S7QA 4HFWA 1WCBB 3NA4A 5EIIB 2ICWA 2VXUL 4PRIB 1RK0B 1CIUA 1QQDA 3MLUH 4PV9A 1I8LC 5TF0A 3H9ZA 4S10A 1U8IA 3NIDE 2P5WE 1RI8A 2XXCB 3IKCA 3IYLW 4KJWD 3WO4B 4ZXBD 2KQMA 2VRAA 5TE4L 3ZSSA 4JKPH 4O51A 4IHOB 4R4BA 3VG0H 3PG2A 4HMCA 1ZLVK 5F7MC 4I3RH 1NCNA 4HPYH 3GSVA 4U3HA 1HXMB 3C09C 1J8KA 3V52H 5EUOE 5HGBB 1CQKA 1V3MA 4U33A 3VD4A 1GAFH 4ZO9A 2V7NA 4BSWB 2QKIB 1OQXA 2NY0D 3ABZA 1CD8A 1HQ4B 4NO0B 4GKZB 5J57B 5E9DE 5MERB 3AS1A 4WJ5B 2YC1A 1J9CT 4UB0H 3V4PL 1WJ3A 2IAMD 5D2LA 5C0AD 4EUPG 1IVLA 4Z7WE 1KT2A 1DBAL 4JFDA 2G2RB 1A6ZA 5C08E 1UEMA 3FQUA 4Z7WA 4H20L 5GZOD 5FV1L 5C0BB 1J0HA 3QIWB 2V5YA 1I9RL 2AGJL 5C6WH 3TA3A 3RL2B 2WNGA 3N1MC 4HCRH 2E8ZA 3S36H 4WO4B 3S4SA 4NN5C 4I5BA 4Y2OA 3VWKD 4H5SA 1JZ7A 2P7TB 4UTAL 1EHLH 3EYFB 4QY8A 4XTRC 5GS0L 1AC6A 5GSRA 3TZVB 4FQXB 4BUGA 3ALWA 5F7FA 5E08L 4PTUA 4XRCB 2WM0A 2AK4B 2B4CH 4LQFH 4P3DB 4N0CC 4KMQA 4YHYB 1I9JH 3HPJA 3NTCL 2NX5D 4ODXB 1HH9B 4J4PC 5EN2B 2HVKB 3BPNB 5IMMB 5EOCL 4CMHB 2ESVA 3ARFB 1F58L 1UJ3A 4KQ4L 5FKPB 3C6LC 4XPTH 4DVBA 4I18C 4HIXH 1A9EA 4XPGH 2GW5A 2Q86A 3QXDB 3MV01 2FJFB 1LDPH 2VSDA 1DQQA 4UNUA 4Z76A 4F7PB 3LIZL 4R8WH 1R5WB 4X9HA 2YD5A 4G80A 4L3AA 3QXAB 2GK2A 5D1XD 3TVMA 4S0SD 4NQDB 2GUOA 1P5UA 1ZHKB 1GGIH 3V0VB 4QRRB 1SM3H 1INEH 5BRZE 1RURH 4WCYL 3FT2A 4EIZC 1E28B 3W39B 4JFHD 4YO0A 3FQRA 3PE9A 1EAPA 1BD2E 1P4LA 4HUXB 3JWDL 3TN0D 4JLRA 5DJYA 5J3HD 4U2ZA 4DGYL 1QHPA 4LDLB 2Q8BH 2QADB 2CIKA 3HMXA 4FXKB 3EO1A 5GGQL 2R4SL 3MMEA 3RJDA 1B4JL 5EIIA 3HZYB 1JWMA 5IIEB 4KUCF 4NQCA 4WFHD 2IALA 4Y1AD 1FLRH 1NQBA 4K94C 5C0DB 4TSCH 4XBGA 4JN2A 5TPWH 1MIMH 1XGTB 3WXVH 3RWEB 1DQMH 2OR9H 1NBVL 1ACYL 5IGXH 3MFFB 1JMXA 4Z7VB 5C0CE 5KAQG 5DJ8A 3IB4A 5JUEH 2R0KL 1Z3GL 2NX5B 4LCCB 4FQ2H 4KDTA 3QNYA 4JM4H 5D5ME 5FYKU 4R4ND 5AYUH 1I3VA 3W5NA 3FN3A 4GAGH 4MJ5B 4EI5A 4EQ2A 1EFQA 3RUGB 3QDMB 4HH9A 3DSFH 5JOEA 1J11A 5T3XD 2VZTA 1KEMH 2I24N 2KKQA 3QRGL 5HPOA 4O00A 3VMOA 2IADA 3F7QA 4Y5VA 4FA8A 4U1LA 4GKOA 3EFFB 1IC7L 5E8EA 2Y06H 2X7LB 1NEUA 3QFJE 2LU3A 5JR1L 4XTRD 1G0XA 3D5OF 4D9LL 2AJSH 1CLCA 1KPVA 1G7JA 2ZPKH 4FFYL 2PCPB 4BA8A 1MY5A 4F33B 1CIDA 5CP3H 1LNUA 4XZUA 3LEYH 4OCWH 3W11C 3QHFH 1NC2A 3FOLA 4OD3L 3OJ2C 4GW4B 2FBJL 1RULH 4N0UB 3GIZL 3QWQB 1J1PL 5HHMB 2ORBL 4MXQD 4AEHL 3PDDA 3HFMH 1NL0L 3GKZA 5E6ZA 2VXVL 1Q94B 3MCLH 1I7ZB 1QA9A 4NKIH 1BVLB 1IKFH 3PL6C 1DL7L 4QHLB 4L3EB 1J87A 4M61B 2X44D 2J6EH 5LXGH 4OFPA 1MCBA 4O5LL 5D2NC 3KPTA 2AJ3B 5I8KH 4M8QB 3VI3F 3GM0A 5JW4M 1DQDH 1HSAA 4NM8L 3FT3A 4JPKL 5HHVH 3VFRA 2CH8A 4XVJH 5EOCJ 2B5IC 4OGYL 3SE4C 4L9LA 3SPVB 5C86A 4HWBH 3DNKA 1X4YA 3BUYA 1PZUB 3WS6C 2B0SL 2V7HA 3ARGD 5BW7A 4K8RL 4P9HC 3VA6A 1UWGL 1MJ7L 2EIZB 4H26A 5DA0B 43CAA 2DLFH 3EYQD 1FNFA 4NQED 1DN0B 4BFEA 1NMCB 2F54E 4I2XA 1JI2A 2DQTL 5JQHC 4UV4L 2GAZA 4JR9H 1NMAL 3PL6A 2EDTA 3VFMA 4I48A 2BMKA 1BF2A 5J1AB 4UAOC 3TJEH 1SVCP 5FAAA 3IJYA 3DVGA 5HI3D 3B9EA 2A6KB 1KPUB 4JY6B 2ZCLL 1JHKH 2J2ZA 5MP6L 1FN4A 4ZXBB 2AXGA 4PJAA 2PYFB 5EO1A 4JZJC 2OP4H 3PUCA 2CKBH 5GGUA 1J05A 4PRBB 4IRZH 4MX7B 4U1NB 3GSNH 1ZT1A 3WJJC 5IQ9B 1I8MA 3RAJH 4OSUL 2ZUQB 3SDDA 3OKKA 4XWOD 5KSAC 2ENSA 4XMKL 4Y5YA 2RCSL 1YPZF 4XXCA 5I1HL 4PRHE 3FZUC 4OIIH 3O2DA 4LCWB 5F7DB 4HG4K 1BIHA 1Q9OA 3RVWD 1QBML 3U9UA 4XHQA 4XI5D 1J0JA 1VACA 3DXAE 5ESAA 1SJVA 4XCNB 3AUVA 1OCWH 1AGFA 3CU1A 4XGZB 4FS0A 3SDXB 3HKFA 5E94A 4FP8L 5C0AE 2R4RH 4YR6B 4ISVB 3QI9C 1IJ9A 4RFEA 3ZE2F 2CLZA 4N8VB 2P42B 1G0DA 1NEZB 2X4TA 4Z78A 5C08B 3BQUA 5D9SB 1RZKH 1UXWB 4JRYB 5LGJB 2X9YA 2JCCB 3H9SB 4PJIA 2R1XA 1YEGH 4MJIB 1T1YA 3QCVL 3TBWB 4KHXL 4N90D 4LEOB 3KYMA 4RIRA 4L4VA 1SBBA 2YBRB 4XNZC 5ISZB 2HWZL 3B9KA 1UGNA 1LP9B 2ITDB 1RZGA 4N0FB 7FABH 3QNZA 1YEJL 4JY4B 2J4WH 3VXQB 3S34H 1HH6B 5JDSB 3SDAC 3S9DB 4G80B 5E2UH 4A6YB 4OGAC 5DHXB 4HS8H 1J88A 1RU9H 1LD9B 3MR9B 1T1XA 2FJFA 4M6OH 1EFXA 2NY7L 3SDCC 1V3JA 2YA0A 1XAUA 3RWFA 3IDYC 3RZCC 9CGTA 1AQKL 3LQMA 4ZUTB 2D7TH 3CLEH 4KDWA 2O5ZH 3IAPA 3FMGL 4A6YA 2VH5L 3OZ9H 5C92A 4EDXA 3NBNA 4KY1H 1A6VL 4G43B 2YR3A 3OQ3B 4HV8A 1HHJA 1RHHB 4LBEA 1OVZA 3CJJA 1U8MB 3W0WE 4OTXH 5C0EB 3VWJD 3WD5L 3SGKC 1D6VH 3RX8A 4D3CL 4X9GA 1N3NB 5TE7L 5DK2A 3OKLB 4YDVB 4H5SB 4AT6B 4EDWL 5JZ7D 4K3DL 1I75A 3K4DA 5E8EB 3QDME 3HR5A 1A9BA 1FFOA 1CFVH 4NQVA 1P7HL 3VCLA 4JANB 3HG1E 2BVOA 5AD0A 1F6LL 4GG8A 2YMXH 1I85C 3MZGB 3UX9B 3CC5B 5A16A 1KEGH 1HHKB 3MJ8A 5DS8A 32C2B 4S2SB 4J8RA 3V4UL 15C8H 4NGHL 4P4RA 2VIRA 4QRPD 3TCLA 3MJ7B 1PVHA 1E4JA 2Q6WB 4BH7B 5MI0C 3GMRA 4ACPA 1A7QL 1FNHA 4Z7UF 4IRSB 1PQZA 1L4IA 1HQ4A 1CFNA 1RULL 1RFDH 4N9OB 1Q72H 3PWUB 1WBXB 2FJHB 3IGAB 3RIFK 3MUZ1 3B4NA 4PRHA 1MIEH 5HHPA 5DURB 1YY8B 2XZQL 4MJ6B 5FCUH 4ZUSA 1KB5B 1FRGL 1QTYT 1PKQA 3QR2A 4IOIA 1NGWB 3GSVB 3O81A 4JO3H 1UXSA 4K3EL 4GAYA 2NY3B 1OP3H 1RUKH 3WEXA 2DQDL 4Q6IB 4JFYA 4YBLC 5DHYA 1FVEB 5DO2D 1JVKA 3O9WC 3T0AA 3VFUA 3K4ZA 3MLZH 5DJYB 1BFOA 5DRXA 2WQRA 1A22B 3OPZL 1FQ9C 4HC1L 4OZGB 4TTDC 4NNYA 4M7ZB 1KJ3H 4ZPTA 3KLAA 4UIMB 4Y1AB 2EIZA 3FO2A 3QB7C 2DQFA 3ZL4L 2X2YA 8CGTA 5IR1B 3V4VH 1R0AH 1EXUB 3ULUH 5HVFB 3QUMB 1GJIA 3O41A 3ZTNL 1KG0A 5F6IC 1V05A 3U1SH 4XNUL 4KGLA 3QQ3B 4XC3L 5F7UA 4NM4L 4N9GA 1DEEB 4HK0B 3O4LD 5EC1B 2OJEA 3C60D 2NXYB 1JGUL 3D85B 3HR6A 4LHJB 4NHUB 3EJJX 3KS0J 4JO2H 4KROD 4MA3A 4Z8FL 1FNSH 3VH8G 4DKFL 4XRCA 3DGGB 3QI9A 5IW6A 3LQAH 2HJLA 4NQTA 1WF5A 2NY4C 5DJDB 2NY4D 1LEIA 4MZ2A 2JF1A 5DUBA 4M3KB 3S37H 4JRXD 4Q74A 1K9TA 1BFSA 2CDEA 3CVIH 4POZC 4JFHE 4YDJA 1X3DA 3DIFB 1QUNA 3MQIA 1Q9LA 1QRKA 4PGCB 4ZPTB 1G7LB 1B0RA 3JWOL 2D3VA 3LN5B 5ENWB 4Z7WB 4WFFD 4X4YB 4MA1C 4LRNL 3CDYA 3DV4A 5IT2L 3LB6C 4JFYB 4Q6IA 4HH9B 3RUGA 3NPZB 2BCKB 5J56B 3UROR 3WE6A 5D1ZD 1QG3A 4R96A 1QFHA 1IGCH 3GO1H 2W9LA 1IAOB 4KJYB 3LKNB 3T77A 5LGHH 5C08D 5EIQA 4M1GL 2HT3C 1RUPL 3VGAB 4YHNA 3IDXL 2GITA 1G7PA 3WIHH 2BHZA 5FV2A 1KCUL 5ACLA 3KNBB 1X5AA 1MHPL 2XKUA 1CICB 1IRAY 5GHWL 1F00I 3EDKA 1I1RA 2R1WB 1DVFB 4MAYA 3S5LB 2J88L 2X4PB 5FHBL 4QXGL 4F7EB 1UM5H 5B3JE 4M7KH 5EO9B 5D4QA 3U7WH 4HH8A 4RAVB 4GG8B 4CJ0A 4ODVL 5HHOA 3LDBB 1H3VA 4JCLA 2OZ4A 1ZGLA 1JF6A 5AWNH 2WW8A 5DD6B 3G5ZA 3A6CH 3MJ6A 4EI6B 4DEPB 4IRSD 1WZ1H 3ZYIA 1T2QL 1ZHKA 4Y16A 3WL9B 1GGUA 2BERA 3NFSH 4GFTB 3LD8C 1CGWA 1NC4B 1U3HC 4L8DA 4CN1A 3K1DA 4Y2DD 5LCVL 2X4NA 2YSSB 2Z4QA 5DK0B 5H35B 3I6KB 4CDGC 3SO3C 2CJUH 2Y5EA 5ICXB 3CFKA 1KJ2A 1L9MA 5GRZA 1T6VN 3QDMD 1FG2B 4M7LL 5MEQB 1FDLH 2X4QA 3T8XB 4ZPVB 3VXRD 4XVTL 1P5VA 1FORL 1A6WH 3LEVH 5D7IE 3ULVD 4BUHA 4XPHL 1B3JA 4YJZL 1HH9A 4OLZH 5EN2A 3PV6A 2ICEB 3TBYA 1UZ8B 3LHPL 5DUPH 1A1OA 1PKOA 1OT1A 3QEQA 7CGTA 1MQKL 3IS1X 3WIIL 1NAMB 4XVSL 4JB9H 4WDIA 5GSVB 3GM8A 4QRRD 1G6RB 2BFVH 1HQRB 1I8IB 3QIBA 4OLYL 1MRCH 2OTWA 3VWKA 1RIVL 3NCMA 2UZYB 5T5FL 5JW5B 1YEEH 4MS8C 2AEWA 4QWWC 4PJCA 3RZCD 4Y1AE 4Z7OF 3K46A 1FIGH 2F54D 1KIPB 3DVNA 5KBNC 3LDBC 5FYKD 5FM5O 1OT2A 5DUBB 3QAZC 3RX7A 1C8PA 1NCWL 4MHHG 5C0BA 4D9RD 3C6SA 1YEDA 4DN4H 3AS2A 3GSQB 2OK0L 4ZFGH 4JM2A 1KN2L 4PJ9D 3I85A 3U0WH 4ZDHB 4MA3B 3KPLB 5M94B 5A3ID 3U9UB 5GRVK 1U42A 3IAQA 2Q3AA 2X10A 2AJYL 4G9FD 3BVNA 1LE5A 3D85A 1CTOA 1DANU 1YEHH 3ZYZA 2BVPA 4M1CC 4MNGA 1XCQA 3VGFA 4RWYH 5I9QC 5J1TC 3CUPB 3LS4L 5DQ9A 4UT7H 4QRPE 4G8GA 4MD0A 3DWTA 3OAZH 1CR9L 3L3KA 1OTUC 3O2WL 4LEXH 1MWAA 1WFTA 3REWA 4JY6A 2FCBA 4R4BB 3F6LA 4M4RA 4A6YL 5FKAA 1TMCB 3OJMB 4IDJH 3HLAA 4HLZG 3MUHL 5C0RH 3L95B 5LWYH 5DZNA 3QG7H 4UDTA 2NY1B 4DJMA 5I1IH 4KJWC 2BSSA 2FDBP 4PTTB 1G9NH 4YHMH 1RJLB 3H42H 3WLBB 5D72H 2HN7A 4O58L 5I16A 1A5FH 4AJ0A 4JFEA 3LEXB 1BLNB 4G9FA 1MRDL 2KBGA 4Q97A 1J0IA 2V2TB 4LASL 1WT5A 3B2VL 3L3KB 4GOSA 3D39D 3PWUA 5FO7B 3HZVA 2PKDA 3C2AL 5GS2D 1ZE3C 4YE4L 5BO1H 4X7TA 2BDNH 1QR1A 2EH7H 4JRWA 5ICZB 1CU4L 4DKDC 5T1KB 3MRHA 4CNIA 5HYJE 4K8RC 2PYEB 2OSLA 1T0NB 1UG9A 4P4RB 4JFFD 3MXVH 5FCSH 3SQBA 2CDGA 3C5SB 4F57H 3RIFF 2DLHA 4N8CL 1ZGLM 3BP4B 4XP9L 5IHLB 1F4YL 4KQ4H 4NQEE 3O4LB 5H37H 1B4RA 2DBLL 4XPTL 4FQ1L 4PJIF 3WNNA 1DBBH 2GKIA 5IP4A 3HE6B 4H1LA 2YK1L 4HZLA 3G5VB 4KFZC 1HYRC 2OMBA 3TO4C 3LIZH 2E7CA 3W0WD 5F9JA 1E27A 4RFOH 4EN3A 3QEHA 4LCIH 5T3XH 35C8L 3WDHA 1DUZB 5HYFA 5H2BA 3HNTH 1JRHH 1WZMA 5D7JD 4HS6A 3T0EC 5FM8A 3O0RH 1EUUA 5HHNB 1T7ZA 3IDNA 4HJ0D 4Q0XL 4XB7A 4JZNB 5HGDA 3QT2A 2BNQD 1JPSL 4YZFE 4PRIE 4LCWE 5H94B 3MRBB 3RY6C 1YYLH 1L6ZA 5AYQA 4PGBA 5AAMA 2XZZA 1S3KH 2OQJA 3QNXA 3G6JA 4MHHI 5J6GA 4DK3A 5CJQL 2YPVH 4HFUL 5F7HA 2AI0H 4ZUUB 1KJ2B 2FD6H 4DGVH 5D7JC 1P1ZB 3D3VE 4OLVL 3CVHH 2E9IA 3WDJA 2VLMD 5FGSA 1J1OH 2DMCA 3ZT5A 4CGTA 4L5FL 5GISH 1NUGA 4LAJH 1EVTC 2C4XA 4DUWA 3P9MB 5IOPA 1DUYA 1CDYA 1PEZA 2MFNA 3HCVA 1JBJA 4KUCD 2P45B 1FNAA 2JIXB 1ZANL 1RMFL 3UTOA 3GEWB 1D6EA 3ESVF 5I15L 5K59E 4XHJC 4NCDA 3WO3B 5C8JB 1J12A 2FR4A 4UT6L 3IU4L 5CZXC 2AJSL 2VR9A 2G75B 1JJUA 4P2QD 2GUOB 4OF5A 4OFIA 3ULUC 4CVXB 5IROA 3CSYB 4UTAH 3WFBL 4MX7A 1NFDB 3BKMH 3PWNA 3T2QA 3M17A 2MMXA 3G5XB 4WEUD 1KB9J 2VITA 5IKCB 3O4LE 3VFPA 4RMVA 2EO1A 1XR9A 3DPBA 3MLTA 2DYPA 4XCYA 2OK0H 1U8NA 4MWFB 3TESA 2E27L 2HTKD 3STZB 2BVPB 4QLRA 1B2WH 4CN4A 2XWTB 4LLVB 5TDOB 2NZ9D 5TH2B 3R4DA 4HIIA 1AQDA 2O5XH 4ODXA 3L3GA 3SJVD 1A2YB 3DMMC 2FBOJ 4M62L 5IQ7H 3B8YA 3TYFB 4LIQL 1FJ1A 1C08B 4ZSOA 1P6FA 4P2OA 3SGJC 3OAUH 4JRXE 5ID0A 1FZMA 1SEQH 3KLDA 3BGAA 3C87A 5CFHA 1HINH 4LGSB 4RAUA 4WUUD 2XZCL 1IARB 3GJFA 4PJCE 2YD2A 4K3HA 3LSOA 1NCTA 1UB6A 4L8CA 4OGXL 5EU6A 5T5NG 3ZKQD 2DWEA 2K7QA 4C56B 4QXWA 3G5VA 1UVQB 4KGJA 2MPAL 5JA8B 2PTTA 3H7LA 5F8RC 3HB3C 5C0RL 4LLYB 2J3SA 2WWKO 3O3DA 1LEIB 4HF5H 2IQ9L 1G7HA 3WKML 3QEQE 4JPVH 4Y5YC 3D3VB 4NZUL 3ARBD 3V7MA 1FZJB 1UT9A 3S96A 4F7CA 4PJEE 1YQVH 2GJ6B 3NFNB 4S11A 4KUZL 3W0WA 5TQ0L 4YBLB