4ZPTB

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
DIQMTQTTSSLSASLGDRVTIICRASQDINNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGSDYSLTISNLEQEDIATYFCQQANTLPPTFGAGTKLELRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
total genus 56
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zptB01
2J3SA 3ETBF 3CXDL 3BN3B 3C5JA 3D3VD 2DTSA 1U3HB 5JPNA 1ZANL 2ARWA 2FGWH 1X7QA 5F6IC 1CU4L 4QWWD 2R1YB 1BD2E 1ZVSA 1A3RH 1IGMH 4M1CC 4LSQL 3U0TA 3VGFA 4IOSD 1X5AA 5EOCJ 3HZVA 5IEKA 5FGRA 2AJZA 2J1KA 3WV0A 1YNTA 2XQBH 4YXLL 3MACH 4PGDB 1E27B 1BP3B 4YUEH 4PBVC 3GZKA 1KT2A 4EUPH 3INUH 3HNTL 1A22B 5IHLB 1AD9A 1H3PH 4DGYL 3QEUB 1DCLA 4NHUB 5MP6H 3GI9H 3FFCD 1Y6KR 4K3HA 3GSRB 4LHUB 5DD3H 4L8BA 2GAZB 5TH2A 3MRLB 4R7NA 3WE6A 2VDKH 2JE8A 1IAIL 1U3JA 4XMKL 5DUBA 1AP2B 1MQKL 3EDJA 1P9MA 4APQB 2NY0B 5TQ2L 4GG6A 1MVUB 4DTGH 2B4CL 4I2XE 4PJCA 1YYML 1HYRC 5SWQA 4U6XA 8FABA 2DB8A 5DLML 1PKQB 4Z7QE 1ZT1B 1GH7A 5E2UL 1WT5C 2QADC 3PF2A 4JG0L 5DK2A 1CFTA 4C55A 3PWPA 3FB7B 1PG7H 4ZD3L 1JRHI 4U6VH 3SY0B 3SGDI 5KZCD 2AK4E 4BELD 5EU3A 5IB5B 1FVDA 1QFOA 4UDTA 3VXQA 2W92A 4V2CB 2ZKHL 1IGYB 1SEBB 4WUUE 4OBRA 5D1XA 5IJKA 5DS8A 35C8L 3QI9B 3IRZA 4XMLL 4CVZA 1UJ3B 3IGAB 4PJAB 2CIIB 5I73C 3HE6C 2H2PC 1AKJD 4UIKH 4ZG1A 1E4XH 1F4WL 3MLVL 1GJIA 5IBTH 5I1IH 5D9SB 4PLJC 1E4KA 5C7XH 1WBZA 2GIYA 1K6QL 4YZFE 2CIKB 5HHNB 1MF2L 2X4NB 1OP5K 2ZG2A 3ARZA 3CNKA 1XH3B 4HT1H 4NZTH 2P8PB 4F7TA 2BP3A 4JCLA 5TE6L 5F6HI 4M7ZC 4L8CA 2UWEF 2Y36H 2V2TA 4PUBL 1VFUA 4DKAA 4CVWA 25C8L 5I15H 2A6DB 3SO3C 1EZVY 4LVOB 3JBG7 1KENH 4U1IB 4Y5XB 3C8KB 1MCSA 3DYMA 5DRZB 3JWNC 4K9EL 4L9LA 2XA3A 3ISWA 2ZCKL 1MEXL 1ZHNA 5ADOL 3RDTC 3QIWA 4UV7H 4X6DA 5I8CA 4UTBH 4ZTPH 2IJ0C 4QGYA 2APBA 2QSTA 3O8XC 2BSSA 2AEPH 2BFVH 1OAQH 5E00A 1A6PA 1DFBH 4ZFGH 2MKLC 1JIBA 1BZ9A 3TH2T 3V7MA 4LGRB 3ARFD 4ODHL 5CSGA 2XN9D 2CDGA 4LARL 4XH2B 4GMTH 2H26A 1CLZH 4MVBD 3MRGB 3HKFA 1QSEB 4KI5C 3OKDA 3RPIB 3ES6A 2V17H 3KPNB 1VADB 3Q6GL 2F54B 3W5MA 4JPWL 3MLUL 3ZKSD 2HWZH 3T1FA 1QRNB 4WI5A 1JPSH 4XP6H 4S11A 3VFRB 5J06A 4KFZC 2F8XC 1S7SB 4ZS6D 4NKIH 1NFKA 2VDNH 2BK8A 1XF2B 3QJFB 3SJVA 3U7YL 5TFSH 2VR4A 5I1CL 2VWEC 1U9KA 3FN9A 3FT2A 1A6AB 3T0EC 4JY6A 4DZBB 1JMXA 4GLRI 5TE7L 4R96B 4XPAL 5F89A 1P7QD 1EO8H 2F74B 5HVGB 1X6LA 3RVXD 3EO9H 4D9LL 2OTUA 1A21A 5IUSA 3RY6C 1C1EH 4DUVA 3VXNB 1S7RA 2NY5L 1XGRB 4WI6A 5KTEH 4BYHA 1FNEA 3LSOB 3AREA 5HSFA 4OLZH 3QO0A 5E4EC 1LO2H 4X98A 3VXMD 1B2WL 4JANA 4DKEH 1QG3A 4I0KA 1W2KT 5HI4D 1II4E 3CFKB 5L2KB 3HR5A 3JUYA 3TVMD 1FNHA 4CL7A 4RAVA 4N5ED 4D94A 4UNVA 3T0WA 2Y07H 1AQDB 4OGYH 1PKQE 4JRYB 5ID1A 3ZYOA 5CSBA 4YR6B 1GC1L 5DMIL 3VWJB 4JFED 4NM4H 4AH2A 1NH6A 4UDUB 4G7VH 4LASL 4NRYA 1KOAA 3VH8G 1DLHA 1GZQB 2X1XR 1F11A 1RUQL 1BVLB 2V5RA 4OZHF 5TF0A 4HFUH 1IRAY 5JW4Q 4M62L 5IMOA 4HCRA 5FM4A 4PJAE 2BOBA 4LCCA 4MXWH 1NAML 2H3NB 4I18C 1UZ8B 3SGJA 4MA8H 3N85L 4Q9BA 3ARRA 1SVZA 4MJ5B 2P44B 2VXUH 3GSOA 5FO8B 1G6RB 3GJEA 2J8UA 3IFLH 4ZUVA 4BH8B 3KPRB 3QDGB 1J05A 2H1PL 3DI2B 2JJWA 3D85D 4WFHD 2KBGA 1T2QH 1QZ1A 1U6AH 1L4IA 2CUHA 1IGTA 3HRZB 2WUBL 1CL7L 4HAFA 4QTHA 4M7KL 4P49A 4GW4A 1UM6H 4X6EB 3B4NA 1AIFA 3KYOB 4HCRH 1UXSA 3DV6B 5E8EB 5JOFA 3A0OA 4CW1A 5DJYB 2OCFD 4JQXC 4QRSA 3GSWB 3OG6B 4FTVA 2IADA 3T2PA 4KVNL 3LEYL 4TSAL 5BS0D 4P4KD 5C09A 5IFHL 1ITCA 1R5IB 4XBEL 4PJDF 1UCBH 1UXWB 4LAJH 4UU9B 4S1SH 4F37K 1NLDH 3LHPL 3E3QE 3EYUL 1R3JA 3V0WL 3RL2B 4P48A 3PL6C 1N64H 3RWJA 2AI0L 1XCTA 2DJUA 3HZYB 3DWTA 5SWSB 3FT4B 4M48L 1QO3B 4PG2A 1NAKH 3FFCE 1MHCA 3MRHB 3DI3B 5CGTA 1FZMA 2VC2H 2B2XL 3PP4H 2B1AH 3P11H 1A6VL 3B83A 1QSEE 1FVEB 2AJSL 4RRPG 1P4LB 2F54E 5I74C 4RWHA 1IT9L 4D3CL 1ZWIA 4O5LL 1CBVH 1QRNE 3SE3C 3AB0B 5F72S 5ILTH 5EZOH 2VAJA 4ZS7H 5I1KH 3VWKB 1C12A 3L3OA 4JFXA 4FQCH 4PJFB 1CGUA 2CUIA 4GAYA 3HC0B 4QRQB 4LSUH 4TRPL 4YFEA 1NGPH 3K8LA 5D1QC 5IB4A 5EU4A 3BE1L 1TJHH 2EDFA 3PNWB 2IPTL 4JFZH 4LLYB 4ZXBC 3MRCA 2GK0B 3OF6D 5EB9A 2VYRE 1VGEL 1DBJL 4OCXL 4MNHA 3K2UH 4JFPA 4LLUA 3VCLA 1F58H 2X4QA 3MYZA 1K85A 3BDBA 5GGUA 3O6FC 3ULUF 2EH8H 1S8DA 5FOBB 4OZFB 4PJGA 4ZAKB 1TCRB 1LGVA 2CRMA 4EBQL 4P23D 5C0DA 2Q6WA 1Q72L 2V5SA 5GS1A 1I85A 5CJQH 1VEPA 1I9JL 4PREA 4RGNB 3X3FH 4IS6A 4MLSA 1TMCB 2GT9A 5FF6B 4G6KH 5L8KB 2MMXA 4NKMB 5L2KE 3ULSB 1LK3H 43C9B 3SHSA 2B7DT 1T21B 4S1DC 5EBWB 2ADGB 4JRYE 4NO0B 5TGBB 1AO7E 1OB1A 5FV2A 1RZGA 3NIDE 5T5FH 3RNKA 3W0WB 4K3DH 2R23B 4LLMA 2BX5A 4LQFH 1YQVL 4J3SA 1DDHB 1U58B 2NXZC 4NQVA 1CD1A 2QKIB 3OJMB 1U41A 1KLGA 5DR5H 4R4BA 1FZJB 2CXGA 5FA4B 1IL1A 1VFAB 3ZL4L 5E5MA 3HZKB 5GRJH 1TQCB 2GTWB 4NNYA 3DMMB 2GY5A 3UCRA 1H8OA 3NTCL 3NZ8A 1HI6B 1BQHG 1KPRA 1U93A 4KMLB 2Y23A 2ADIA 1SMOA 1HXYB 3TNNA 1LO3H 1TVDA 1A7BA 1C5BL 3MFGB 4LLAA 4HK0B 1RJZB 3KPRE 1LE9B 3QDGE 4GS7C 3SDYL 4HZLB 1NDMB 4DVBB 2DYPB 3WNLA 3CD4A 6CGTA 5D5MA 2P5EE 1N59A 3P9MB 3DVNA 2VOTA 5E2TL 4X9BA 4KGLA 1DEEB 1HZHL 4JRXA 3UZVB 4KKLC 2H6PA 5D8JH 2VR5A 1EHAA 2XXCB 1N4XH 1P6AB 2DIAA 4NNXB 2VLMD 5T3ZE 3WFCL 4PB9L 2IAMC 5E1HB 5IMMA 5KVDH 3I02A 5EU6B 1ES0B 3AFLA 3QIBC 5CGMA 3H42H 5CP7A 2DMBA 5T33L 2FSEB 3LV3A 5KW9L 1AXTH 5IM7A 3NAAL 3UYPA 5TF1H 1FAIL 4MLIA 1HOCA 4PRID 3F7YB 1BFSA 5ANMB 4CDHA 5H94B 5IVNA 5SWSE 3BSZL 3HMWH 5HDQH 3QCVL 3QEQD 2PO6B 4YO0A 1U8HA 2D0HA 3DUSA 4JZNB 4KZDH 3VFSB 5CBAA 4M7LH 4X7EC 1F3JB 3MNVA 3CIQA 4OB5H 5HDOA 4YX2H 4H8WL 2BHZA 3ZE0E 3IFNL 3QDMD 4I4WB 2X70A 1CFVL 3EJYC 1X5IA 1BWWA 2ZNXA 2X4TB 3HN3A 5MI0C 4QNPF 4R8WH 4F33A 4OF3A 1YEJL 3KPSA 4Y5VC 3CSPA 4PJFE 5E56A 4HXAH 1A0QH 4RAHA 5EORL 1H0DB 4OCYH 2A77H 2WP3O 4HKJB 2FB4H 4GKNA 1WFNA 4ZDHA 3MV7D 2E27L 4HKXA 5IW1A 5IWLC 4RX4D 1XGQB 3QNXB 3CAFA 3QWQB 2OL3A 1Y0LB 5AD0A 1K8IB 3S9DB 3DURB 3EDEA 1NGZB 5C0BD 1L7IL 1NANH 2APFA 2FL5B 1KJ2A 1F2XK 1IC4H 3FQRA 3NFSH 3WFDH 2E7BA 1UZ6F 5EIQA 3G6AA 2VSDA 5T1LA 2CKBA 5EN2B 3VJ6A 1F13A 2NXYC 3FCTB 2CLZB 5JHDB 3EFDH 3EO0A 2NZIA 4RGNE 5IROC 5C1MB 4L1HA 4HWEH 3W39B 4M43H 3M1BB 4OZIB 4FFZL 2BVPB 4YWGL 2Y4SA 4DAGL 4ELKB 2GJZA 1SJEB 4PGZA 2QHLA 1CGYA 3JWDL 3CDFA 4GUPB 2OYPA 3J8F7 2OL3H 3E2HB 4YPJA 4Z5RB 4X5XB 4BQCA 3W0WE 1KJ2H 4FQ2L 1JYNA 1QLFA 5HHMD 2CKBH 2HKFH 1WZ1L 2DLEA 3L9RA 3LS4L 1JHTA 3T2NH 5FB8B 1DR9A 4PS4L 3C9NA 1JHLL 4IRZH 3FB5B 4OV6F 2E8ZA 1TJIL 2BNQA 1R3LB 4M7LT 4WO4D 1E4XI 4MMZC 3FT3B 5EOCL 5MEPB 1N3NB 3WDJA 3W5NA 5EULV 3WN5B 4YDJB 1MCDA 4JPVH 4OJFH 3CLFL 4IMLB 4YGVA 2NW2A 3QAZC 4YIQA 4O2FA 1G7QA 2W1NA 3GM0A 4M7JH 4G5ZL 2WLYA 5JIHA 2V7NA 3WHE0 2NX5A 5E8PA 5C71A 2VLKA 5DO2C 3MV8B 3PHQB 3GHEL 1DQTA 2WINB 3WS3A 1KEML 5KAQF 3VFNA 1LO5A 1TZIB 4YEEA 3LB6D 3WFBH 4UT9H 5EU6E 4QY8A 5ICXA 1V3LA 3QCTH 3V7AE 1NC4B 4NO3A 1ZTXL 2QR0B 2V2WA 5IMKA 5JXED 1JGEA 1MCEA 5BZDA 3C87A 1IGCL 3FOLA 4NZRH 4LP5A 2AV1A 1UFUA 1XZ0A 5LWYH 3BZEA 3G5YA 4M6AA 5ANME 4GKSB 4MDIB 1J0ZA 1SJVA 3V6FA 1CR9H 5FHBH 4EOWH 1CLOL 4YNYB 1RJYB 3I2CH 1S9YA 3M17B 1OAXH 4WWKC 5EUKA 1MHHB 5C0JA 4G8EA 4IDJH 1MHPH 4KDTC 1U8KB 3DUUA 4KUZH 1SM3H 3T2OA 3H0TA 4F58L 2QBWA 4PV8B 1QSVA 5L8LB 1Q94A 3MV9B 2BOCA 1MIMH 3CFEB 3OKEA 1LO4L 3ZKMD 2J6EL 4JFQB 4RSVA 1K4CA 4JGUA 5DJAA 2EDKA 5INCA 1UM5L 1D5ZA 3K1DA 4M61B 4HKZB 4MAYC 3WFEL 1EK3A 1FBIL 3IF1A 3TBTA 4RFNB 3ZDYF 1PW3A 1LDPH 5F9OL 5I17A 5FDWB 2VRAA 3UAJC 4E5XA 3DGCR 4XRCB 3DIFB 1H9VA 1QLEH 1S7VA 1E6OH 1RUMH 3AAZB 1OAZL 4WENB 5DYOB 3UEZA 3C60A 1ZEAL 43CAA 4AQ1B 3O0RL 4HKBA 4Y5YA 2GSGB 5EA0L 5I6XB 3DO7A 4Z0XA 1CICC 1T0MB 2DD8H 5JHDE 3V4UH 1EMTL 4JFDE 3ZO0A 4M6NH 5GZND 4PJ8D 1WEJL 4QRRB 1QEWB 3CH8A 4UV4L 2BMKB 2A73B 3HI1B 32C2A 4OZIE 2M26A 1ETZB 4HJ0C 1QFUH 3DVIA 3EYQD 3H9SD 4L8DA 1HIMH 3QUYC 3RTQA 4IRJD 2GJ6D 2NTSP 5CP3A 3U48A 4UBDC 2VERN 3G6JA 4U1MA 1HDMB 4FXLA 1ZHKA 3D0LB 2DM4A 5EG6C 5I16B 1RULH 4U3CA 2DQHH 2YK1H 1J1XH 1FNSL 4CDGC 3DLQR 3MACL 1KCKA 2CGRL 1SBSH 3N1PC 2BY0A 3KHOA 5LCVL 3LD8B 5A1AA 3BJLA 1YEFH 4PRDB 1CFBA 5DD3L 4ZUWA 3DOSA 3JVGC 2ZCLL 4LKCB 1S5IH 2PXYD 2AEQH 1P4IL 1MRFH 1OTTD 4PD4J 4DQOL 3OKYA 4HJGA 5CP3H 4JZOA 4UT7L 4E42A 3BDXA 4GXUN 4ZFFA 5F21B 4IOIA 1RFDH 5CEYB 3DBXA 2ZSWA 1WBYB 2QQLH 4Y4HC 5D7JB 5E70A 3V5DA 3BEVA 5F9JB 5MENB 5DZLA 4M8QB 4KU1A 1JP5A 1WJ3A 4KMTL 2HT2C 3BN9C 2NW3B 3TYGL 2X40A 2Q3ZA 3MV8E 4OI9A 4Q2ZB 4HBCH 5IEHA 5A3IC 4DW2H 1EEZA 5JDSB 3QCUL 5JDJA 1K2DA 5IVOA 3EJJX 4G3YL 3U9PH 5SWZA 1BFOA 4NQEB 3VFPA 4UQ2B 4EI5A 1YY8B 1KYOK 2OXHA 1XF1A 2DWDB 4G80B 3F12A 3IDMA 1HHKB 1URLA 3GSXA 2NQCA 2FCBA 3LKRA 4OT1L 4UIKL 1NSNL 4N1CA 3DUHA 1RZFH 4KI1A 4YEFA 1ND0A 5IBTL 5I1IL 1XF5A 3BUYA 4JN1H 1FV1B 5F7LB 5HTSA 3JWOH 3PE9A 4LKXA 5CSZA 5CD5D 4YFLI 3PWLA 4NZTL 1PX4A 3CH1B 5F8RC 1QLRB 3RQ3A 1SYVA 2AAVA 4PJXB 5GIRB 3NFPA 4PPTA 4FQHA 1DL7H 3WO3B 4R7DB 5D93C 1NCNA 1EGJA 5I75C 4NUJA 5IBLD 4PGBA 3RZWA 3PV6A 5I1AA 4TNVF 2UV3A 2DM2A 3MV9E 1BQLL 1A4KB 4GOSA 3GK8H 2EIBA 2Q8BH 4F7EB 1TVBA 5DC9B 3V8OA 3BO8A 5JW5A 2V2XA 3B2VL 3PV7A 1U8OB 2WBJC 3B9KA 3BT2H 5KSUB 4QHMB 3KLHC 3QUXB 1FL3A 1JYXA 3WD5H 2D03L 1NEZB 4UV7L 2Z92B 4P59L 3PWPD 2Z0BA 1ZVYA 2P8MA 2QSCH 1EHXA 1FO0L 2RR3A 4OFVA 2AEPL 2BFVL 1E4WL 3KPPB 3TO4A 4ZFGL 2GJJA 2JK5A 3RWHA 1QTYT 4XX1E 3GSNB 1BQUA 4IOFC 3BW9B 1EGJH 4KHTL 5D1XD 3TA3C 3O11B 2Q86A 4PRAB 3MFFB 3F5WB 1UWGL 3O2DL 4XXDA 6FABH 1N8ZB 5SX5H 4P46A 1QBMH 2VNCA 5F9DC 1CLZL 4GBXB 3GIVB 1JGDA 1QHPA 5FKPB 1Z0NA 1UG9A 2HWZL 4NSKA 3LEXB 3UZQA 1JPSL 1YMMA 1EUUA 1Z5LB 2JELL 2OQJA 1LE5A 4ZTOH 2FBJL 2KKQA 1G7PA 1G7HB 1ZHLB 4OD2A 4L5FH 4Q6IB 4GKOA 3DVGA 5BQ7A 4LGSB 1KJMB 5HPMB 3O3BA 4H1LA 2K1MA 4HUWB 5LAXA 3QUZC 2I9LA 1X7QB 3S4SA 3D0VB 3BIKB 3EO9L 5IOPA 1CLCA 2BRRH 2AJZB 1C1EL 5D1ZD 4MA1C 4P5TA 5DF0A 5ADPH 5IW3A 1KT2B 4JFOA 5TDOA 1L7TL 4H1LH 3JV5A 3K0WA 2ZCHL 4DKEL 1RZJC 1M7IB 5TH2B 4R7NB 3WE6B 5EZIL 4XT1C 5MENE 2I26N 3SCMD 4TSBL 2JIXD 1LEKB 5DUBB 1R3IL 5JIIA 3RJDA 3TZVA 3P0YH 3SPVB 5KVEL 2GCYB 4GG6B 2XV6B 1EZVX 1U0QA 4J3OC 5D72L 3N1GC 3KPLA 1Z2KA 3UJJL 4HEPG 4PJCB 4HLJA 1KBGH 1KPVA 1JPGB 8FABB 2VKWA 5IQ9A 3SJVD 3I75A 5KN5B 3KJ4B 5J3HD 5FM8A 4NQEE 2E7LC 4YPGA 1BM3L 4HFUL 2CH8A 4JO4H 2CUMA 5F7FA 4MNQB 4MD0A 3MGOA 1OAKL 2DF3A 4MXWL 5EU3B 4IMKC 2IFFH 5IJVA 1JVKA 1FVDB 3D25A 4UDTB 1R6VA 1MCLA 1T22B 4QCIB 4ZNEA 2VXUL 5CILH 2HLAA 5DS8B 3CLEH 1V5JA 1FL6A 3IFLL 4CVZB 4OFKA 1I8MA 2A6KA 5HD8C 4DGVL 2VIRA 1LNUA 4PJXE 3BD4A 1Y18A 1T2QL 4MDJB 1WBZB 4IRSA 4MAUH 2HKHH 4TNWK 4X6CA 4M93B 1UM6L 4O51A 2JJSA 1I1AC 3IJHB 5FAAA 2AVGA 4M6OL 4Y19A 1F4YH 4L8CB 1J88A 3PDOA 3O9WC 1BIIB 4DOHE 3ZTNH 4FQXA 2VDOL 4J3UA 3SQOH 1RIHH 4X7SH 1QFWH 4PY7B 1FGVL 1ZT7A 2ZG3A 1JWUA 1T5XB 1WLHA 4P9ML 5TQ0L 3MRNA 2CJUH 2PYFA 5LXGH 1FZKA 1ZHNB 2IH3B 3QIWB 4X6DB 4X9FA 5I8CB 3RVVC 2NY1D 2R69H 5BRZA 3WUWB 4UAOB 3D18B 2X4OA 4ONGH 1L9NA 2NY6D 2VC2L 5E6IC 3O4LA 1BZ9B 1DVFC 1DBAH 4POZC 5KSBB 1EH9A 2ESVE 2RHEA 2EDWA 2CDGB 1FE8L 1QNZL 2NR6D 5LBSH 1MFDL 5I1KL 3B9VA 3OKDB 4PBWD 3EKCA 4PRPB 2P48B 2BVOA 4NBYB 5HHXH 3Q1SL 1X9QA 1B0GB 1NGPL 4HK3N 2OK0L 2E9BA 1TJHL 1DANU 5F88A 4Z8FH 4JEGB 3SE4A 4KVCH 5KVFH 3BGMA 5C0IA 3NIGE 2M8XA 4ZOEA 3FONA 2HFFB 4LIQL 2P42B 1F58L 3FT2B 3TT1H 4NFCA 5DVNA 1Y6MR 4LEOA 4OI8A 2HFGH 4NBXB 1WF5A 4HJJL 2IPUG 5DFWH 1V3JA 4Z7NE 2YRLA 3K8MA 2OTUB 4OZIF 5CJQL 1QPPA 4YHYB 1PG7X 4MJ6B 5CEZH 4HIIB 1S7RB 2O5XH 2Y6SD 3OHXB 3AREB 5JOPD 4X98B 3VGDA 5HHOB 1L0XA 3SE8H 4F8TA 5AYUL 4TVSa 4GG6E 1CDBA 5T5FL 2EDTA 1T03L 4K3DL 4PJCE 3HR5B 4LQFL 3L7FA 4URTB 2DBLH 4P2QA 1UCTA 4FXKB 2NLJA 2BSTB 4OF0A 5ID1B 3TYFA 4WHCA 3TIDA 4U3XA 1TJGH 4XNUH 2NY2B 2MKWA 4MNQE 3UJIH 4AH2B 1X44A 2Q76A 3NH7H 1AGEB 4NRYB 1DLHB 2MCPH 4HPOH 2AXHA 5F71A 4CKVX 3NPSB 2V9RA 1MPAH 3EJZD 2XWJA 1GGIL 4R4NC 2XKSA 2BOBB 5C9JA 4LCCB 4XVJH 3L1OL 2AKRA 4P4RA 2HVKA 2F8OA 5CEXB 1X6NA 1MIEL 1NGQH 2BSRA 2Z31C 3NACL 4OD3H 3AU1B 2DICA 1WWCA 4WTXA 3GSOB 2J8UB 4GAFB 4OLYH 5D8JL 1N4XL 3ARTA 3SDCD 2PW1A 1MREL 4C54A 2SEBA 2FECL 4UINL 1IGTB 4QTHB 3OWEA 1XFPA 4GW4B 4TSCH 1FYTD 1L9MA 5BW7A 5HHPA 1FFNA 1DQML 1AIFB 3H42L 5IW6A 2RCSH 5JOFB 4Y2DA 1P4BL 2UY6A 4HIHB 4CW1B 4G6MH 4WDIA 4NC1C 2CLVB 1AXTL 1F6FB 2FX7H 2BY3A 2FJGA 4FTVB 5TF1L 2IADB 1G9EA 1S7UA 4CNIB 3QQ4A 3RJQB 4X6DE 5C09B 4BJLA 4Z0BH 3HMWL 1DQJA 5HDQL 3B9DA 4XCEA 5DVLA 3UTZA 4F9PA 3CFJA 4KZDL 2G2RB 5IT2H 4PIRF 5C2BL 2HVJA 1R3JB 3ARVA 4JO2L 3IDGA 4Y4KA 1GGCL 4JG1H 3RWJB 1XCTB 1CXEA 3GNMH 5IKCB 3HFML 5KSBE 1MHCB 1BX2A 1FZMB 1F00I 4HUNB 2VZVA 2DI8A 5BOPA 4ERSL 2FGZA 4IIQA 3VXSD 2X4PA 2OR8A 4HXAL 1DP0A 4JRXD 5F3HA 4DCQA 5I18H 3TBWA 4FABH 1SQ2N 1C16A 1KIUA 3DHMA 4JM2D 3VXOA 4KKAD 3BESR 3HE6D 1ROWA 2H2PD 1PQZB 3LRSA 1D3CA 4JFXB 4XVTL 4OQTL 4J1UB 4GAYB 4PLJD 2BZDA 3MV01 5CINH 5IB4B 1S3KH 5TDPB 1J0IA 3OJDB 3ARBA 4P2OC 3MRCB 5KJRH 3WFDL 3NFSL 3REWA 2LV4A 1AR1C 5EO9B 2NY4C 3E1F1 4XGZA 2Q8AL 3J7HA 4ODSL 4MNHB 2NYYD 4JFPB 4LLUB 3VCLB 2X4QB 1EHNA 4OLVH 5GGUB 2X09A 3C5ZC 4I0CC 4P3WA 1S8DB 4HWEL 5E24E 4XTRC 1CDYA 2R8SH 1RK1B 5C0DB 3H3KA 2EEBA 4Y89A 3IJSB 3BGFB 5GS1B 2OL3L 2X9XA 5HHOE 3L5XH 4NQCB 3DTXA 1T3FA 4IS6B 1T1ZB 2GT9B 4Y4FA 1GGTA 5ACZA 1IFHL 5IB3B 2VE6A 4NNPH 4NYLA 2IWGA 1S7WA 3OX8A 5D2NB 5LGJA 3NCCB 1E0OB 2EEDA 4X4ZA 4BUHA 1YDPA 2FIKA 5ICZA 1O0VA 1LEIA 4YDIH 1RZGB 3RNKB 4HIXH 5JZ7D 3HPLA 4LLMB 1EAJA 4NQVB 4UILL 1FYHB 4XVUC 5EPMA 5DJZA 1IM9A 3GMQA 4GXVH 1GL4B 2LQRA 1KLGB 1T66C 4R4BB 4JCMA 4EUPG 1IL1B 3ECBA 5E5MB 5GSRB 4D8PA 2WWKO 3DX7B 3RNQA 1VHPA 2WAHA 1KACB 3DECA 1U93B 1T5WA 4N90D 2D4DA 2ADIB 1RUAH 4X8XA 4GQPH 3VRLF 3ZSTA 3TNNB 4HIEA 1QSFD 2R0WL 3UTSA 2J8UE 4IHOA 3N9GL 4YXKL 2MWCA 5M94B 5C0ND 5C0RH 3MUGB 4ODTH 4TUKL 1S9XA 4AYFA 3QIUD 2VXSL 1UVQB 4S2SA 1F90L 1N59B 4NJAL 3P73B 2EDQA 1NCDL 4UT9L 1UACH 2UWEA 1JK8A 1X4ZA 1B0WA 4JB9H 3M8OL 3IKCA 3QG7L 3U36B 3PGDB 3PIQB 1VACB 2GTZA 1C5DA 4RCAA 1CI5A 4FTVE 5IMMB 5LWYL 4PGJA 4U1JB 1J8HA 3PG2A 5C09E 1XIWA 5B8CA 5CP7B 3A6BH 1CR9L 3FO9A 1P7QB 2BNQD 4PY8J 3U6RA 3NA9L 4PJXF 3I2CL 1CGVA 3ARGA 5I1GH 1OT2A 5CIPH 2P24A 1KTDA 1VPOH 2ZUWA 1MHPL 4LOUD 4R2GB 3EDDA 2PKDA 3FO0H 5DUPL 1SM3L 1HOCB 4JQVA 5DEGA 3GMPB 3ARYA 4YHML 4M9PA 4BKLA 3DUSB 1IEHA 2FD6H 3SOBH 1MWAL 4L8SB 4MS8D 1EAPB 3VXPB 3ARQA 4AL8H 4K71B 4F15B 4J12A 2N7AA 1F8TH 5EO1A 1Q0YL 2X70B 4HSQA 4X4MA 5D7SL 1BFVH 4PGEA 1W8NA 1LDPL 2G5BB 4YQXL 5DFVD 2HA1A 1YC7A 3KPSB 1EERB 2B0SL 5IG7A 1A3QA 4TQEH 4X8JB 4GKNB 1A1NA 4ZDHB 2R4RH 3TNMA 4HKXB 5IW1B 3ET9F 4KKCC 3BKMH 3QUML 4ZSOA 3SGKC 5ITBH 5HGHA 3S5LG 1EPFA 2DD8L 4NPYA 3V4UL 5AD0B 3VFMA 2ZUYA 4WUKH 1PZUB 1KJ2B 2P7TA 4J8RA 3HLAA 4PJGE 1QFUL 1RPQA 1A6TA 1EDQA 1T7XA 3G6AB 4JM4H 3ULVC 2CKBB 4YC2B 4G8GA 4L4TA 3VJ6B 1A6UH 3EOTL 5IBUB 4IBLT 3MLWL 2J7LA 4PRHD 2G9HA 3P4OA 2AXFA 2E9IA 3S37L 1A1MB 2HP4A 4ZUTA 5D2NE 3G08A 3KWWA 3QFDB 5DD6A 2YK1L 2D2OA 5KSAA 4RFOH 5FECA 4TPRL 1A02N 4HS8L 2YN3A 4C4KT 3BRFA 3PWUB 3MBEC 4APQC 1YEFL 2ZJSH 3ARDA 4PJ5A 2ARJA 4HAGA 4HGKC 3VD9A 3U1SL 1S5IL 1JHTB 1MRFL 3ZDZE 3C9NB 4AG4L 2O5YH 2C4FU 3MJGX 3LVEA 2Z8VC 5DD5H 4FMKA 4OZHA 2QLVB 2HRPH 5C07D 2YN5A 1FJ1B 5ESQA 3H6JA 1YN7B 2YEZB 2NTFB 1T1YB 1XR8B 4JPIA 3UO1L 1YJDC 1S7QA 1LWRA 1J86A 1BZ7A 2X1WL 4K8RH 4NWUL 1UJ3C 5IR1A 1KFAH 3CZFA 4FHBD 5DUML 5HVFB 4ZXBD 5FK9A 1S9WA 4G6FB 4YIQB 3RTQD 1G7QB 4R0LA 4NRXA 1EVTC 3NCBB 4XNQB 2V7NB 2NX5B 5E8PB 2VLKB 4MGXA 4XBGA 1F3RB 3QJHA 3KR3H 4FFYH 3O6FD 2OLDA 1GRWA 3WS3B 1XF3A 4NZDA 2OMBA 1LO5B 3R0MA 2RFXA 1HEZA 3MLYL 5ICXB 4BFIB 4NO3B 5GJSL 2CR6A 3KLAB 4HUVA 4CN4A 2V2WB 5AYQA 5IMKB 5BZDB 2A1WH 5CJOL 5JPMA 4LSPH 3FOLB 4OSUH 3PJSA 2AV1B 4KJWD 4QWWC 4PJDA 4V1DD 3PWNA 1DL7L 1OPGH 1IGIH 3QDAA 3QXDA 3V6FB 3RA7H 5E4IA 1UH2A 4A6YA 4WW2C 4EXPX 3NBNA 3GK8L 3N0PB 5C0JB 1RZKH 1ZGLA 5HGDA 3E3QC 1FIEA 3KS0H 3DUUB 1WAAE 3UDWC 4LCUA 3RDTA 4AT6A 1BQSA 2M2DA 3FB6A 4TTDC 4H25B 3O8XA 1OD7A 5DK0A 1PDKA 1D5IL 1WGOA 4DK6A 1Q94B 2BOCB 1QFHA 1U8IA 2Q20A 2QSCL 3GI8H 2NY7H 1Q9OB 4W4OC 3JV0A 1KJVB 3KPSE 5INCB 3W9DA 1I9RH 5I66A 1GIGH 1EGJL 4EI5D 2EE3A 1LD9A 1QKZH 3IF1B 3TBTB 4MQTB 5BV7L 3U4BL 4A6YH 3OPZL 3UC0H 5I17B 5LG1A 2P5WA 2J5LC 4E5XB 1QBML 1S7VB 1T4KA 5DJDB 3EZ8A 2PETA 5KSBF 3T2QA 3HE7A 3PQYD 3V6BR 3I9GL 3THML 3C60B 3IFPB 2VL4A 4HKBB 4Y5YB 2R56H 4KKLD 3ALPA 3G5ZA 4LSRL 5ACLA 5ICYA 3L5JA 3FHAA 2O61B 3JV6A 5E6YA 2DQJH 1HCVA 2IAMD 2YC1A 3T0EA 5CMAA 4KRLB 1HWHB 3GMMA 4F57H 1QD0A 4QXUH 3VXRA 2PN5A 2B4CC 4LNRB 32C2B 1IM3B 5IGXH 2DLGA 1GOHA 1NGXA 1MCKA 5DJ8A 4L8DB 5I8OL 3LAFA 4TVPH 5BCAA 4OFYA 3ULVF 3L3KA 4P57A 3G6JB 3RY6A 4U1MB 2ZG1A 4RA0C 5I1LB 1ZHKB 3FQXA 5CWSA 4YH6A 5C0AD 1I4FA 5T1KA 1BBDH 4KTDH 1YYLL 3WFHB 3ULUH 1KN2H 4PJ9B 3UYOD 4UI2A 4ODXA 4MD5A 4KMQA 3MRMA 1UB5A 1YC8A 2FWOA 4ZUWB 3C5SB 4J3TA 1BAFH 3L5WA 4Q9RL 5C3LD 3FN0H 2C3VA 1NCWH 4OF5A 1LO0L 3P0YL 2H41A 2VXVH 1N2RA 2H8PB 4IOIB 3DBXB 2ZSWB 4WEBL 3TJEH 1AHWB 2X4UA 5H2BA 5J13B 3V5DB 5F1IB 1FRGH 2VABB 3ARFC 2NX5E 4FQ1H 2VLKE 2A9NH 3OKOB 3BFOA 5EUOB 5GGQH 4JO4L 3VD7A 4O02H 4MVBC 4K9EC 2A9ML 3CSGA 3VE0B 5LKNA 3BJ91 4ONHA 2ED7A 2IFFL 4OLUH 2CMRH 5F8QC 3G9AB 1NMBL 4BA8A 5SWZB 5INDB 2NXYD 4MA3A 3MRPA 2MPAH 1JFQH 3B9AA 2BSED 5EIVA 4JREC 3F12B 3F6LA 4OKDA 3IDMB 3LKRB 5EC2B 1F4HA 4R26L 5DWUH 3WL9A 1OGAA 2I25N 1JV5A 2FNBA 1XF5B 3MREA 3BUYB 1JI1A 4MAUL 4Q58C 3S98A 2ZZUT 1INDH 3V5HA 4JQXA 2YD6A 3BDYH 4XNYH 3PWLB 1G9MH 1SYVB 3TBYA 4FQHB 1F4YL 2XZAH 2B1HH 3MLSH 3VFVA 3RVXC 3T1WA 3RZCA 2R2BB 1QBLL 4QHNA 3K4ZA 3PV6B 4G43A 4YFLF 3V4VH 4RNRA 4CU8A 1OAYH 1F3DH 1QFWL 3PL6A 4G9FD 3BD3A 2V2XB 4NN6B 1N6QL 2CKNA 3B9KB 1UC6A 2GUOA 4LVHB 4UTAH 5LXGL 5E03A 4JQIL 1DLFH 2P8MB 3CPLA 4N9GA 3MCKA 4UZGA 1V3MA 4NKQB 3TBSA 3GIZH 3TO4B 3TVMC 3V0VA 4K7FB 2JK5B 3RWHB 2X44D 5ETUA 2HTLC 4N5EC 5HY9A 4N8VA 3QUKA 4BZYA 1R3KA 1EEYB 2FJFA 4WO4B 1YEGL 1FP5A 2OR9H 4XXDB 4U1KA 2NY5C 4P46B 5EBMB 3GKWL 4LCWD 2ZOLB 1JGDB 2DQEL 3WJLC 3DYPA 1AFVH 1ITBB 5FUCC 1F2QA 3K4DA 2C4FT 4NSKB 3BH9A 3P0VL 3DX8B 1YMMB 2OQJB 1J12A 5C0EB 1G7PB 3KPMB 4ZAKC 4OD2B 2HN7B 2IC2A 3WS6A 4Z8FL 2CLRA 2F8VA 3NCJH 4KVCL 5KVFL 5BQ7B 3P3YA 3G6JE 4XB8A 4RGNC 4O4YL 1GC1C 5D96B 4Q6YA 5LAXB 2Q87A 3MOAH 2I9LB 4KK6D 2GITA 2F19H 3GRWL 3CK0H 3GB7A 3L5HA 1VGKB 1NFDB 2CRIA 3S4SB 4PGDA 2P4AB 1E27A 1FLRH 2BDNL 4W68A 3HI5L 3V6OE 5IOPB 4PB0H 1R0AH 3UJTH 5KVGH 3QEUA 5BRZD 4NHUA 1F4XH 4NGHH 5C6TL 4AEHH 3GSRA 4PJIF 5F1NB 4P5TB 4Y16D 5CHNA 5IB2B 3TFKD 1CD9B 4ODVH 4HLZH 4C58B 5TDOB 4NT6A 3GSQB 4HPYL 4P4KC 5ENWB 4J3WA 4MAYD 5DJ2A 4KPHH 2MQCA 2Z91A 1GPOH 5HJ3B 2CRZA 1MVUA 4P9HC 4RGOL 4X83A 4NZJA 3UMTA 1OSPL 2DBLL 2ENSA 3LRHA 4NO2B 1Z6JT 4XPFH 4XXCC 5DTFA 5ELIA 3TZVB 1TVHB 4PTTB 2MFNA 4OGXH 4DWHA 1PKQA 5FYJL 1ZT1A 1SYSA 5EUOE 3KPLB 2LU7A 1T83C 2EIDA 4XNUL 2G5RA 5AZ2H 3FB7A 3SY0A 1PLGL 5JA9A 4DFHA 1R5WA 3ALXA 2HMID 4NDMA 4K3JL 2MCPL 3I75B 3NGBC 1HK6A 2EO9A 5SWZE 4AIXA 4W6XB 5JUEH 1SEBA 5AZEH 3QI9A 3WO4B 4MD0B 4HJ0D 5CJ5A 3AXLA 1FORL 4JKPH 4HXBH 4XVJL 2CIIA 3IDJA 3ZZ1A 3HC4L 3OKLA 4OD3L 1NBYA 3QUYD 5FYJD 1GCFA 4UBDD 2HLAB 3OKKA 1KN4H 4S0TD 3VXUB 4JVUA 1FL6B 4TULH 4OLYL 1JYWA 2VIRB 1XH3A 1XCQB 1LNUB 5B4MC 5J56B 1Y18B 1KELH 1U2CA 1ERNA 4IRSB 3QZWB 1VB9A 5DVOA 3H9SB 3SDAC 4X6CB 1U8JA 4TSCL 2A6DA 2R0ZH 2UZIL 1MAMH 3LDBC 4N9OB 4XNMA 3MQIA 4Y5XA 1JNHB 4G6ML 4Y19B 3BZ4A 4P23C 2OJZH 3C8KA 1NC2B 5DRZA 4S0SD 2DQUH 3JUZA 1D9KA 4FQXB 2YBRB 2Z4QA 1Z9SA 4Z0BL 3BPLC 1ZT7B 1NKRA 1YNKL 1JWUB 3P4LA 3CU1A 1KB9J 3MRNB 4YHZH 2PYFB 3KJ6L 4HQQH 1FZKB 3QHFH 1UA6H 3GNML 1EHLL 2XA8L 2L4OA 2HT2D 5KANI 4LSTL 4KRPD 1WAAF 2X4OB 3UZEA 1P53A 2YRPA 1DQDL 3O4LB 1I9IH 1MRDH 4NN7C 1QSEA 1TPXB 1SY6L 5ALBH 2XG4A 4OLWL 4GSDL 1YMME 5C08D 3OAZH 1QRNA 4FABL 4I0PB 3VFRA 1S7SA 5F7MC 3NN8A 2BVOB 5CLTA 2JCCB 3T4AB 1XF2A 3QJFA 4P2RD 5DXWA 1WICA 4K94H 1UQSA 5E9DA 2C26A 4HWUA 3WIIL 3BPOC 1A6AA 4U1LB 1BMGA 5IK3A 4DZBA 5KJRL 1A7RL 1OAUH 1NFDE 3K7UA 4R96A 5C0IB 3QWOB 1K9TA 3UTPD 3IU3A 3FONB 3QG6A 1ZLSL 5JORB 5CZXD 4ZUSB 3T65B 3RAJL 4OLVL 2LABA 4OZ4A 4QXTA 4WU5A 2F58L 2FR4A 3MOBH 1UYWH 3V8CA 4LEOB 3FQNB 1FPTH 4JGJA 2R8SL 2DM3A 1I8KA 1KXTB 3MZTA 4FQJH 3G6DH 1SEQL 1PJ9A 1T7YA 4FN0A 1XGRA 3B5HA 1CFQB 3E6FB 1JNNL 5GGRB 5I1JH 5GHWH 3UTTD 1AQKL 2WQRA 4L4VA 4MXVF 4NNPL 5TE4L 3CFKA 1VFBA 3WKNA 2BJMH 5I71C 2H45A 3TN0B 3P4NA 3Q6FA 5FFLA 1WZKA 4BQ6A 3DROB 4MX7A 1WTLA 1KG0A 3L7FB 4DGIH 3VWJA 5AWNH 4P2QB 3U9UB 3WSQL 4UDUA 3WKML 1GZQA 5H35A 2NLJB 5FGSA 2E9JA 1MCFA 3D39B 3T0BA 4HDIA 2Q76B 5D7KE 1IVLA 3P40A 5I9QC 3RFZC 2H3NA 4K3GA 3AMKA 1J10A 3OV6A 4ZNEE 3L3IA 3VXUE 3WEXB 2XWJB 1G6RA 4D9RE 1RQ5A 1CXFA 5DT1H 4OLXH 2HVKB 2PTTA 1AGBA 1OLZA 3QH3A 1JGUH 3W2DL 2YD1A 4X6CE 1G0XA 4S1QH 1KIRA 3C6LA 4X6EA 2PW1B 1MFAL 4JB9L 4KKNA 4HMCA 4WTWA 4Y19E 4RMRA 1A3LH 4OCMC 2JJTC 2XKUA 5DJYA 3MJ9A 1ZLUK 3GSWA 4WWKA 4H20H 3B3IB 3SDXB 1G6RH 5IW6B 3A6BL 3ZT5A 4Y2DB 1GOFA 2XY1A 5MHSD 4UU9A 2VXTH 2PYEA 1IM9D 2HJFA 1T04B 2ICWJ 5JR1H 3RL2A 1S7UB 5A2LH 3QQ4B 3MRJB 1A7NL 4OTXH 1WITA 1RMFL 3KLSA 1DQJB 2XTJB 5BRZE 5SWSA 4XCEB 3FT4A 2X5PA 1QO3A 3CFJB 3GUTB 3SO5A 2PR4H 3FQUB 2HVJB 3O6MH 3ILPA 3O4LE 3O4OC 2OI9B 2C7UB 4Y4KB 1FVEA 2LTQB 3MJ9H 4JFHD 1CG9A 3DX6B 3HB3C 4N0CD 5BXFB 1F6AA 1ODAA 5CJBA 1OGTB 1BX2B 1N5YL 3HMXA 2O93L 4AMKH 3JWDC 4PJEF 4PRBB 1D7FA 1FNFA 4U0RB 3VWKA 2WK2A 5DD1H 4I9WD 2JCCE 2X4PB 4DCQB 4FQQA 3KYKH 4TQEL 5CEZE 4QRQA 4XNXH 4G6JH 4LLYA 4F8QA 4S10A 1BJ1J 3BKML 3DVFA 1BZQK 5BO1H 2AJ3B 1KULA 1J8HD 1XIWD 2LAAA 2N56A 3ME0A 4ZO6A 3ARGD 3ARBB 3H3PL 3HMXH 5HDBE 4JY5H 5FOBA 3REWB 4JPKH 5GRUL 2VLRA 5D6DC 1TCRA 2AJVH 4RZCA 3LD8C 1JYVA 4N0UA 1JGVL 1EFXD 1HSAA 4XP9H 1QBBA 1UWEH 4TTGA 3JV4A 3NCYP 3AS0A 5JXEC 3MJ7A 1OSZB 3C09B 4O2EA 4RIRB 4XAKE 5DSCA 2X9YA 3MA9L 3ZDXE 1T21A 5DJ0A 2E6PA 2ADGA 2Q3AA 5D70H 3WMSA 4NM8H 2CO7B 4NO0A 4Y4FB 4C56B 3RVVD 2EECA 4LCYA 2VE6B 4KHXL 1S7WB 5KSVA 1ADQA 4P2QE 5LGJB 1MHEA 1U58A 3GMRA 2FIKB 5ICZB 1LEIB 3D39E 4UNUA 3U82B 1FZJA 2EEAA 4OCRH 2OS7A 3HPLB 1JF6A 2A6IB 1E6JL 3CSYA 3ZKMC 3HZKA 1FVCB 4LRIA 3S88L 1FAKT 2IQ9L 3DMMA 4U05A 3STZA 1GHFL 1CQYA 4IJ3B 4F7CA 3B8SA 5J7CC 1BVZA 4J6RH 3ECBB 3RGVB 4KROB 4K8RL 4H1LG 4HK0A 1ED3A 4GRLB 2V6HA 1RJZA 3RNQB 3WJJC 1ADQH 3MLZH 4UB0L 4HWZA 5DHXB 2YA1A 2FH6A 4JVPA 3UTSB 4KZEH 3P9MA 4IHOB 5EUOF 4G9DA 2OR7A 1DEEA 4WV1B 5E94B 3FB8B 3IDYB 3KR3L 1DZBA 1S9XB 3FQWB 1MCOH 4NNXA 4S2SB 4XP4L 3O41A 5GZNC 4K8RD 2W0KA 4YE4H 5EU6A 4XNZB 2UWEB 3SDXE 2X2YA 1ES0A 3ARDD 4W4NA 1PAMA 3V4PH 3IKCB 2FSEA 4LSPL 2GTZB 2EDXA 5K9QI 2XYCA 3BQUB 1C5CH 4BUGA 1OPGL 2DI7A 3RVTD 2XTJE 4XZUA 3U6RB 3ZHKA 5J11B 4PLNC 2PO6A 1LP9B 3NVQA 5L0QB 2P24B 3VFSA 3I50L 3AY4C 4AEIH 4KGJA 3MLRL 1F3JA 5DEGB 5FYKE 1OARH 1ZOXA 4O58L 4RGMB 5EOQH 3UBXG 4BKLB 5JW4N 2AS5M 2VAAA 3BP5A 2V5TA 1GSMA 1YQ2A 2NY7L 5DA4A 5JQ6L 3TA3A 1OTTC 2KDGA 2W60A 3MLXH 2R0LL 4X80L 5JMOC 1JZ6A 2VZ1A 3VG9B 1RJLA 3IDXL 1P84J 1F5WA 4FP8H 2EXYC 4PGEB 3RWDB 1X5XA 4Q6IC 2VZSA 2B8OT 2VDQH 4NUGH 3QNXA 2Z31D 1KCRH 5IG7B 5CD3B 2HAZA 1Y0LA 5D4QA 1K8IA 3ZTJH 1VDGA 3HCVA 1ACYH 1Z9LA 2C9AA 4ZQKA 4WHDA 5JXAH 2FL5A 3NZHL 5HGHB 1KB5L 2DQJL 5EN2A 3QUZA 2ATKB 3VFMB 5F44A 1M05B 2Y72A 4QOKD 4MNGB 4CUCA 2P7TB 5CCKH 1PYWA 1Z3GL 3IU4L 4J8RB 3HLAB 1A6TB 3M1BA 4OZIA 3BP4A 3VFUA 1SJEA 3KYAA 4G8GB 1FG9C 3GFUA 1RY7B 1P5UA 1FN4A 4GUPA 1I3RA 4Z5RA 4X5XA 3P4OB 2DTML 3RRQA 5CD5C 1B4JH 3KGRA 4ZUTB 1BBDL 4KDVA 1NFDF 3RL1B 1JGLL 4Y1AD 4JDZA 4IEFB 5DD6B 5F9WC 3I85A 1HXMA 1BECA 1NUNB 3QXUA 3ULUL 1KN2L 5T5NF 5IBLC 5F93C 1P9MC 1TIUA 4Q0XH 5K9OA 3FB5A 4PJ5B 2ARJB 2P5WD 1MI5B 1AR2A 1R3LA 3O2VH 3SE9H 1I1YB 1CDIA 4U31A 5GJTH 1BAFL 3FT3A 5MEPA 3KJ4C 5KOVC 1N3NA 2VLJB 3FN0L 3RIFF 2C5DC 1NCWL 1YEEH 4WFEE 1A7OL 2VXVL 4WI9A 1YY9D 1UM4H 3X13B 1KC5L 5E99L 1VFOA 3ULUD 2ORBL 4NHCH 2QADB 4B7IA 1M7DA 2EC8A 1S7QB 3UTSE 3VXRD 5D1XC 1T6VN 5IJKC 3DXAA 2A9NL 1IAOB 5IR1B 1F02I 3CZFB 3F6IA 3I3BA 3PHQA 4O02L 4P2OD 1S9WB 2WSKA 4OFYD 2J4WL 2WINA 1E4KC 1A7QH 4R0LB 4NRXB 4OLUL 2CMRL 3CVHA 3O6LH 2VDML 1BD2D 4G6AD 5TPWL 4XBGB 5I73B 2UWEE 4ZFOA 4LLQB 5T1KD 4P3DA 3TIEB 4HH9B 4S1RL 3CC5A 4K7PH 1CDJA 4OCNC 2YD4A 4YHIB 4BH7B 4XTRD 1XF3B 4YDKH 3IFOA 4CVXB 12E8L 2D3VA 1HEZB 2YA0A 2IANB 2XRAL 3QB7C 4GKSA 3MODH 4HUVB 4M7ZB 1CXLA 5BVJB 5JPMB 1LP9E 1XEDA 5D6CB 3M17A 3O9WA 2J88H 3PJSB 2WW8A 4U1GC 2W91A 4PJDB 1CGTA 4L9LC 1T80A 3PWNB 2PTUA 4CGTA 4XWGH 3W11C 3CVHH 3MLSL 3QXDB 3QA3A 4PV8A 4A6YB 3OB0H 1DBBL 4H26B 4UAOC 3MV9A 1ZGLB 5HGDB 4F7MA 4LCUB 3RDTB 4JFQA 3FB6B 2ZPKL 1MRCH 3O8XB 5DC4B 5DK0B 4HKZA 1JZ8A 4X4ME 3R4DA 4UQ3A 2MQ3A 1U8IB 2HYMA 1L0YA 2R29L 1I1RA 1DVFA 4OI7A 2HFEB 3GIZL 2YKLH 1FFQA 3A67L 3VXTA 2AK4D 2DLTA 1NUFA 4XRCA 3W9DB 3I6LE 1LD9B 1MJUH 5DQ9B 4WUUD 3TJHC 4UMGA 3SKJH 4FQIH 5DYOA 3SGEH 2VSCA 3LZFL 4QXGH 3A6CL 3BKYL 3JXAA 3T3MF 1KJ3L 5CUSL 4WI3A 5M7QA 4CU6A 2GY7B 3MGAA 1DQQA 3HE7B 3VGAC 4TNVK 4FFWC 4QRRA 2RAMA 4KTYA 2A73A 3IKKA 1QSFB 4LVNC 2L7UA 4G8GE 3IAGC 4RBPH 4L4TE 4LLDB 2JCCF 4N0RA 3QYCA 4RMWA 3BUTA 3NCJL 2YC1B 3T0EB 5CMAB 2FJHA 3RZCD 2DWEB 3R1GL 3TF7C 5GS2H 3RUGF 4E41A 1HDMA 1UKSA 3C2AL 1YECH 5I16A 4XPTH 1K4DA 2F19L 1HKLH 5DJ8B 4KJYB 2VDLH 3AREC 3LEVH 3L3KB 5B38B 1FLRL 1J1PH 1IARB 3FQXB 4WJ5B 3UJTL 3RWGA 4PJ5E 1LEGA 1F4XL 4PRDA 1MI5E 2VUYA 1TQBB 1LK2B 5I8KL 3WCYA 5E4EB 1WWBX 1JHKH 4W6WB 1M4KA 1I8LC 3DJ9A 1NBVL 1RUKH 1EV2E 3LN5A 2VLJE 4ODXB 4MD5B 2Y5TB 3OMZA 1A4JA 4HV8A 4W70A 4WFFE 2B5IC 2EICA 1F97A 4OZHE 4KAQH 5D7LB 3OZ9H 1GPOL 4Z7WF 5CEYA 3L5WB 1X5JA 1WBYA 1V7NH 4MZ3A 5D7JA 2C3VB 4M03A 2W9LA 4M8QA 2BVUA 4OGXL 2NY1C 1U8LB 1CLYH 1NCBH 1N2RB 4LCCC 2A38A 2F9BT 5F7DA 4H88L 4Q2ZA 2NY6C 4M6MH 3SGJC 1U3HD 3VG0H 2X4UB 5H2BB 3TC9A 4GAGH 1RZ7L 4JDTH 1CE1L 3HG1A 4KKCD 5DGQA 1CGSL 2P46B 1H3GA 5DMYA 4MB5A 3BVNB 4LAQH 4I18B 4NQEA 3ROOB 4UQ2A 1YY8A 4HUXA 3UYRH 2Z9TA 5AZEL 2DWDA 4UUJB 4R3SA 1U8QB 1U36A 2NR6C 3F58H 2IH1A 2K7PA 3WXWH 1AI1L 4ONHB 4B0MM 4JJ5B 2HLFC 2IANE 4RMVA 1DEDA 3MRPB 5C8JA 1EBPA 1AGCB 1KN4L 1FDLL 4OD1L 2DMKA 5TDNB 4LHUD 3SDDA 1UENA 5EZLB 5F1OB 4PJDE 2P43B 5D2LF 1JV5B 4PJXA 4JO3L 5GIRA 3BMVA 4K7PY 3V5HB 2O5ZH 4HWBA 4U3HA 5GISH 2VDRL 3NIFF 1YJDL 3MBED 3ORJA 4M1GL 5JQHC 1ZMYA 3B2UC 4APQD 1RIVH 2NY0D 2K9UA 5CS7A 3TBYB 4M9OA 4BZ2L 2AQ1A 5C0CB 2V5YA 4JY4B 2QQNL 3VFVB 1U8OA 3SDXF 4QHNB 2DQUL 3L7EB 5DRWA 3BP6B 4PG2C 5KSUA 2BNRB 4RNRB 1D5MB 1YEHH 1R3HB 4KK9C 5EWIH 3SKNA 2Z92A 1VENA 3PL6B 1D5BB 2Y6SC 2YWZA 2VISA 4YHZL 4YDVA 4HQQL 3GSNA 3QHFL 3BW9A 3FO1B 5GS0H 1G7MA 4KQ3L 4HWBH 3CPLB 3MRIA 3QI9D 4PRAA 3F5WA 3MCKB 3MFFA 4N9GB 3TGXA 3OBAA 5I74B 3TBSB 2FEDC 4TVPE 2NNAB 1G9NH 3QUKB 4N8VB 1MRDL 4GBXA 4OAWA 4FFVD 4OIIL 5E08L 1R3KB 3GBML 5FCUL 3VH8A 2P45B 5F7EH 1SJXA 4QT5B 5ALBL 3I84A 2MHAA 2IGFH 3L3DA 3LEXA 4WFGE 5SX4H 1G7HA 3QWRA 4Z95H 3S36H 5D1QB 3T0EE 4RMQA 5F3BB 1JZ5A 1GGBH 1WVZA 3GSNH 3VXRE 4DVRH 3EJZC 4GW1A 1KJMA 3BH9B 4K94L 5HPMA 5FXCH 5FV1L 5FUOL 4XAWL 4HUWA 1KCLA 3C08H 2I5YH 2CLRB 4XCYB 5IHZA 1S9KC 2DQTL 5A2FA 1J0YA 2NY3C 2R4SH 5GS1C 3C5ZA 1I85C 2ENYA 3ILQC 3D0VA 3BIKA 1ZS8A 4N0YH 1CZ8H 2GITB 3SDCC 4CVUA 3GB7B 3HAEG 3HI6L 3PWVA 4CJ1A 3MNWB 1XR9A 4FQJL 2I07A 3VFTA 3RX7A 4DKFL 3OAUH 4EN3A 4TTDD 1R24B 3QFJA 5DDHB 4H5SA 1MCHA 4YHKH 5HYIA 1H5BC 5GHWL 1IKNA 4QRPB 5KANG 4FS0A 3LKNB 3QRGH 1M7IA 2APVA 5CHNB 1JNLL 1QSED 3OKMB 1CE6A 2F54D 5E5UB 1OTSD 4NT6B 1LEKA 5AUMB 2NXZB 1QRND 5DJ2B 5IV2B 3BKJL 3RWCB 3SPVA 2ZUQB 3CFIC 2GCYA 2Z91B 3CSBA 3NA4A 1EJOH 2GFBA 3WDHA 5AWNL 2DL2A 2OX5A 4YHLH 1A5FL 1JPGA 2R2EA 4OKVA 5L7XL 5DTFB 5C3TA 5KN5A 2YS4A 3MUJA 2JTDA 1SYSB 2HJKB 4RRPA 3RVUC 2FH8A 3IETB 3U79A 2D7MA 5BVPL 3O3UN 5EH1A 5FUZL 5GGVH 2VZUA 1R5WB 4MNQA 4NDMB 3Q3GB 4RDQG 1ZGLM 1XGYH 3HS0A 1BF8A 3BXNA 4GS7B 5K59E 1T22A 4QCIA 2BCKB 3AXLB 4JM2C 1B4RA 4KKAC 3IDJB 1INEH 4EI6B 1RVFH 1OGAE 1RD6A 4LFHD 4Y2OA 3OKLB 1NBYB 4LU5H 4MDJA 3OKKB 1Y6NR 2AV7A 5L2KD 2NZ9D 1YNLH 3IJHA 1A3LL 1ZGLP 2Y5EA 2VXQL 3QIBB 5C0CE 2FEEI 4MQXD 2NYYC 1UGNA 1UT9A 4JRYD 4H20L 1U8JB 1BIIA 1AO7D 4K2UL 4F2MA 2KZWA 1CDUA 3FO2B 4LSVL 4BZ1H 5FHAL 4XNMB 3QO1A 5T3XH 2ZWLT 3RHWF 3VWJD 3BZ4B 4PY7A 5JO5A 3TCXA 2MQ0A 3WBDA 1ORSA 4KC3B 2QL1A 4FXGB 1D9KB 3KVQA 1T5XA 4QNPE 5JR1L 1A7PH 4LPVA 2FLRT 2Z4QB 2IH3A 2D9CA 1LP9F 4OTXL 4ZOAA 5CKGA 3GMLA 3SN6N 1D6VL 4NQTA 4OM1L 2PR4L 1IQWH 3WUWA 2Y25A 3D18A 1JL8A 3E8UH 4ODUA 3I3EA 1HH6A 1K3IA 5T3ZL 4Q97A 4LPTA 4B5EA 5MI0B 5JZ7C 4QRTA 5KSBA 1W72A 3KPRD 4Y5VB 3QDGD 4AMKL 2Z8WC 1NQBA 3WHXB 5C70A 3QHZH 3BH8B 2P5ED 1UZ6E 3MRRA 4PRPA 1BQHA 4XHQA 1T89C 4PJBB 3ZKNC 1EEUA 1RUPH 1B0GA 2CRYA 4XNXL 5JW3L 4OCSH 3VW3L 2WBWB 2AJYL 1TETH 4TUOA 5DK3A 5GXBB 3PGFL 5T3ZD 5B39G 1FSKC 3NN8B 4DN3L 2ADFH 1PSKH 3QDJB 2HFFA 3MRKA 4O9HH 1UQSB 5E9DB 2HTKD 4U1NB 1KCSL 1T7WA 5C0NC 4H0HB 5IK3B 1W72H 2NXYB 3HMXL 2G60H 3QIUC 5HPOA 3P77B 2VKXA 3IU3B 2D7OA 2AJVL 3QG6B 2BNUA 1SHMA 1MCIA 2CK0H 2D4FA 4TOYH 3D2UA 4OZ4B 4QXTB 4WU5B 4XP9L 2FR4B 5SWSD 5IFAH 4KTEL 4MJ6A 4QRPE 1IEBB 3QPXH 4HIIA 1YUHA 1I8KB 3ROLB 3OHXA 1LMKA 4PRNB 4RMUA 4HUUB 5HHOA 3ULVH 3WXVL 4MJIA 3R8QA 4YBLC 4L4VB 2F5AL 2YMXH 1VFBB 4LOUC 1YN6A 3VWKD 5GGSB 5K9KB 2HTLD 4FXKA 3P4NB 3Q6FB 4OUOA 4NQDA 2BSTA 4MX7B 5L88H 1KG0B 4MS8C 5HYJB 3S34L 3VD5A 3S6CA 1MJ8H 1AGEA 3JTSB 4E0RA 5H35B 1CQKA 4EEEA 3IJYA 5HYSG 2EDRA 1AY1L 1MY7A 2DQGL 3KXFB 1P7HL 3MBXL 2EKJA 3ARSA 5DQJB 2XKNA 3P0GB 4HDIB 2EDJA 3O3DA 4D9QD 3MO1A 1EO5A 1Q1JH 2XZQH 4ZAKD 5DFVC 1ADQL 4FZ8L 3X14A 5CEXA 1G7IA 3L3IB 1JCKA 3AU1A 2R39A 4R4FH 4Y0GA 1J18A 4RGND 5GGTL 1JN6B 4XCCL 4BQ8A 2WBKA 1DBMH 3LRGA 3MOQA 2PTTB 4KQ4H 1AGBB 1I1CA 1MCOL 1KUMA 4JM2F 3QH3B 4P9HL 5J89A 3MYJB 2VH5L 4LMQE 2DS4A 3QEGH 1KIRB 2FATL 1MNUL 3C6LB 2E8YA 2UVEA 4CN1A 3W0WD 3V4PL 3LQAH 4HIHA 2EXWD 2P8LA 4ZNCD 2CLVA 1JRHL 2ICWA 3BAEL 2CDFA 1UH3A 5LGHL 2DQIH 4WWKB 5CJXA 3CFDA 1HHIA 5FYLH 2BRQA 4JHAL 4CNIA 3SGEI 3U2SB 3UDWA 1EVUA 1M6OB 3RKDC 1AXIB 2OZ4A 4JO1H 3ZDYE 3DMMD 2G2RA 2VDPH 2XG5A 2PYEB 2HJFB 2FZ3B 1D6EA 4KK5D 2JJVA 5SV4A 5IKCA 1FQ9C 1A14H 5KBNC 3ILPB 1WFOA 1I3GL 2DYPD 4QTIL 1VKXB 1CG9B 1YPZF 4HHAA 1EUTA 2XIDA 1F6AB 3C60C 4ODWB 3LQMA 4OUUB 4PJBE 4OM0H 1BVKA 4Y5YC 3LQZB 2QQKH 5JTWA 4P3CH 1TZGL 4GG8A 2OZ4H 5EFIA 3I6KB 3CXDH 2AQ2A 2FRGP 1PQZA 3BKCL 1T7ZA 5J6GB 1Z9OA 1QVOA 3LS5H 1FFOA 4KI5F 1ZANH 2GKIA 4FQQB 5EU6D 4J1UA 5E9DE 4J3VA 1CU4H 3T09A 1CICB 1NKOA 5TDPA 3OJDA 4LSQH 5JXAL 2HRLA 1HILB 5B4MD 3RTQC 3OL2A 5EO9A 2XWTA 2MSPA 4JN2B 2YD5A 3RP1A 3BP7A 3EYVB 4YXLH 3SDAD 1QSZA 4HF5L 4F80A 2PO6D 3EOAA 1BGXH 2VLRB 3U4AA 1S5HA 4RZCB 1RK1A 2JF1A 4L9DA 4PJIA 2HT4D 3IJSA 4N0UB 1HSAB 3JV4B 3IDNA 4NQCA 1T1ZA 3MJ7B 2NCMA 4LPCA 1IAIH 3H3BC 4L4VE 4O2EB 4LBEA 4TNWF 1C08A 5IB3A 4KJWC 3KG5A 5DSCB 5D2NA 3RWEA 1CDHA 4WRLA 5DJ0B 4YHNA 5K93A 4LCYB 3O81A 5DLMH 5HYJE 4DFIA 2PNDA 3V52H 5KSVB 5E2UH 1MHEB 4OFPA 4JG0H 5I30L 3GMRB 5GJTL 2W0FB 3FQTB 3CXHJ 4ZUUA 3O45B 3OGCA 1IGFH 2A6JA 1YEEL 4Y4HB 3PUCA 4HG4K 5GSRA 3CSYB 3QP3A 4LGPB 2ZKHH 3DX7A 1EJ6A 4M5ZL 3ARFA 4Z7UB 4G7YL 3STZB 1HQRB 4XMLH 4F7CB 1W0WA 4EI5C 5JHDD 2XN9A 4JFDD 1WSST 2VL5A 1F4WH 3MLVH 2ICES 3X17A 4C59B 1ED3B 4GMSL 3P30L 5T1MA 1MFEL 3B43A 3QQ3B 4MCZA 4Z76B 3MUGA 4HWZB 2EYRA 2LFGA 5CBEB 5BZWB 2DI9A 1UVQA 3O6LL 3KAAA 3VD3A 2EDNA 3F7VB 5TE6H 4G9DB 2QQQA 3P73A 3FL7A 5JNYA 4K7PL 4PUBH 4GAJL 25C8H 4XMPL 3U36A 4LHUG 5FEBA 4YDKL 3PGDA 3PIQA 1VACA 2ZUVA 4JE4B 2R2CA 5K59F 3O41B 4X6FB 4YBQD 5BV7C 3ZKQD 5EOTA 2Z93B 1KIQA 4U1JA 3CX5K 4K9EH 4CRPA 1FCCA 1P7QA 1MEXH 4NC0B 5I75B 5ADOH 3O2WH 4NN6C 4P0DA 2J88L 2PYEE 4LNVA 2OBGA 3KHQA 1AE6L 1AJ7L 5EU5B 3GMPA 4XZUB 1HSBA 5SX4I 2AGJL 3T3PF 2WBJB 4I77L 4Z7OE 4X4XB 4L8SA 1DBKL 3LN4A 3VXMA 1EAPA 3VXPA 4ODHH 1WAAA 4LARH 3UTTB 4BSVB 1AGFA 4K3EH 5KOMC 5I8EA 3LOWA 4ZPVA 2VAAB 3BP5B 3BMWA 3B8YA 4JZJA 4JPWH 3MV8D 4L29A 1A6WH 2YKLL 3TA3B 4O2CA 2G5BA 3QRFM 1DSFL 1T0NA 4XB7A 1CFSA 4ZO9A 4LK4A 4JLRA 2W60B 5HHVH 3QR2A 4JFEA 1JZ4A 1MJUL 1NC4D 1RJLB 3SKJL 4FQIL 4X8JA 3U7YH 4LEXL 5I1CH 3B6SA 4QXGL 3FTGA 3MR9B 2N4IA 2D31B 3VRJA 4ELMF 4XPAH 4XPBL 1CF8L 3HCVB 4ZQKB 1BEYL 3GSUB 4D9QE 3TBVA 4JVWA 2VLRE 3KPQA 4FOMA 4D9LH 4OF6A 1NL0L 2K3TA 4WY7L 1NLBL 3QUZB 4N0UE 3D85A 5I1EH 1KYOJ 1PYWB 4ZMAT 3MV9D 2EE2A 3BP4B 3VFUB 1A1MA 1TNNA 2QJDA 2DRUA 4P5TC 4XPTL 1B2WH 1NJ9B 1U8PB 3QFDA 2W65A 3OJVC 1FN4B 1NAMA 1RAMA 1I3RB 4PV9A 3GO1H 4MA1B 1J1PL 4B7LA 4L3CB 3PWUA 1N6VA 1H15A 1J0KA 4JDZB 5D7IB 1HXMB 3AVEA 1RZIA 5DMIH 3LKOB 3TZVC 4X9HA 4LASH 3HB3D 1RUQH 4K23H 4LHJB 1AC6A 5K9OB 1BIHA 4M62H 4FZEL 5DQDL 1HE7A 4XWOD 1FJ1A 1YN7A 2YEZA 1X5GA 2NTFA 1T1YA 1XR8A 1NAMH 1E28A 3ARWA 3I3DA 5ESVA 3N85H 1NMAL 3WO4C 1QA9A 3VFGL 3E6HA 5J4MA 2GW5A 4M6ML 3U7WL 1DJSA 3MA7A 3MLTB 3VG0L 4N68A 2WUCH 1M7DB 3MXWL 4OCWL 2RBLA 2YD3A 4XNQA 4AY0A 1N7MH 3DXAB 4LAQL 5IHUH 2X4SA 2WUBH 1QOKA 1CL7H 3T77A 4M7KH 3LIZL 4X7CC 1JPTH 3DHJA 3BD5A 1R5VA 1MY5A 4YHPA 4IRSC 1NCAL 3CVHB 1PVHA 4LFHG 3U30C 2H2SD 3OR6A 1J1OL 4ZFOB 1EX0A 3OF6A 4P3DB 1B88A 3CC5B 4BFIA 1HINH 2JJSC 3KLAA 1NGWA 4KKBD 4KVNH 5DD0H 3K2MC 3LEYH 3IFOB 1UEMA 3MRBB 4TSAH 4LRNL 5IFHH 5JMRA 4XBEH 3VA2C 4X7DC 8CGTA 5K9JL 1WK0A 5EU7C 1HYSD 1I1AB 2F5BL 3V0WH 3MNZB 4P23A 4EIZC 4KK6C 2AI0H 1RIVL 3O9WB 4U6HA 4MQ7A 2ZSVB 1F42A 1PBYA 3CZJA 4M48H 5D7JD 3BHBA 5MEND 2DQCL 2B2XH 5KS9F 1A6VH 1S7TA 3CXHK 3QA3B 4H25A 1K5NA 3BPCA 1YEHL 4O5LH 4F7MB 4Y16C 3KPOA 1Q9OA 3TFKC 1KJVA 4PJEA 1KIPB 3HC3L 5DVKA 4NQED 5GS0L 2C1PA 4UQ3B 5L9DL 5E6IB 1DVFB 2YHGA 1CTOA 2D0GA 4LLVA 4TRPH 3VXTB 3GKZA 4X99A 2IPTH 1G9NL 4G8IA 4ISVA 5CZVL 5DJDA 5F7EL 4LLWB 4CN6A 1AD0A 1B90A 1VGEH 2PF6A 1DBJH 3IFPA 2IGFL 1OTUD 4ONFL 1P2CA 3SE4C 2HMIC 2O61A 4Z95L 3S36L 1DQQB 4PJBF 1KGCE 5GS0D 4ORGB 3BIAX 2DIBA 5F7UA 4ACPA 3GSNL 3C8HA 2D7NA 1Q72H 4R9HA 4LF3B 2BVYA 4LNRA 1IM3A 4HH8A 4PGCA 5HYFA 1TTUA 3SBWC 2FGWL 3T4YB 2FJHB 1A3RL 3RPKA 1IGML 3QUXD 4LHQB 4E41B 5MEOA 5I1LA 3UTQA 3H8NA 3V5KB 1I1FA 1CZ8L 4N0YL 1K4DB 3EO1A 5D7IE 4J3XA 1CGWA 2XQBL 3WFHA 1OQXA 3M07A 4NQUA 4PJ9A 4YUEL 2FX8H 4DK3A 3K4AA 3INUL 3RWGB 1PEZA 3V6OA 4F7PB 1H3PL 2MOVA 1LEGB 5MP6L 3GI9L 4JHBA 4PRIA 3C5SA 3ZL4H 4CU7A 3LN5B 3QEQA 2VDKL 3WIHA 4BQBA 4L4JA 2HJLA 1A4JB 4HV8B 4K7PX 1ZA3A 2ESVD 4PJHF 2H8PA 2EXYD 4DTGL 4YXHH 3QWRD 4XI5D 1K3ZA 1ZA6A 1AHWA 3QDMA 5F1IA 3MLPA 1NCCH 2VABA 3DXAE 1WCBB 1AXSA 2J12B 3AMLA 4FNLH 5F7DB 3OKOA 4KRPC 5KG9A 5E2TH 5EUOA 2WWMD 2CSPA 1PG7L 4U6VL 3SKMB 4OZFG 3HG1B 3VE0A 3HR6A 3WIHH 3F7RA 5ECJE 4G8FA 5INDA 1CFNA 3WFCH 4PB9H 3SKOA 3QXWA 4GFTB 4HUXB 4RX4A 4U1HB 3QDHA 3QNZB 4R3SB 3DRQA 2IH1B 5C0FA 4BK5A 5E8NA 4FMFA 2A83A 5EC2A 3UPRA 1INEL 5ESAA 5C0BA 1E4XL 1QR1B 2IPKA 3VDAA 5C8JB 3MRDB 2DN7A 5BW7C 5C7XL 2YWYA 4Y2DC 2JJTA 1FAIH 2DJSA 2YD7A 3SDDB 4HT1L 4XCFH 2UUDH 2ICWI 2AABH 4L3EB 3D6GA 1WFUA 5CZXC 3QNYA 4HWNA 4B53A 3QULA 2Y36L 2R2BA 5I15L 3QXAA 2VZ3A 4F9PC 1KENL 3I6GB 4H8WH 5IVXF 3IFNH 2OI9C 3U46B 5ITFB 3REVB 5E7FA 2ZUUA 3DYOA 1CXKA 2F53B 5CGYD 5ERWA 4JJHA 4Y1AB 5DRWB 3K74B 1KB5B 1H8NA 4U0QB 1YEJH 3SKNB 4NOBA 3ALWA 4UTBL 4ZTPL 2EDYA 4MNQD 5EORH 4U0RC 1IQWL 2ZUSA 4OFIA 1OAQL 5L2JA 2YPLB 1DFBL 3E8UL 4IIQC 2C3XA 4K7FA 4PFEA 2VISB 4YDVB 2E27H 1G7MB 1EEYA 4WO4A 4Z7OF 2DJ4A 3MRIB 1JF5A 3ZE1F 3FRPG 2J2ZA 5EBMA 4GMTL 1T6WA 1J0JA 1TTGA 3MUZ1 4OAWB 2ZOLA 4GKZB 3QHZL 3VH8B 2V17L 4H0GA 4FQPA 4QRRE 2MHAB 3L3DB 1IAII 2CD0A 3WYRA 3ARBC 3DX8A 4XP5H 4XP6L 3V7AG 5C0EA 4QF1A 3KPMA 4U7MA 2LVEA 2HN7A 4NKIL 4FFZH 4YWGH 4DAGH 4HFWB 2FHFA 2VDNL 4AENA 2ADFL 4GW1B 5TFSL 3JWDH 2A2QT 4E41E 1S7XB 5I2IA 2NY4B 4U2YA 3D87B 5CAYB 4GRMA 5IHZB 2G60L 5HVWA 2OSLA 3MPCA 1VGKA 1NFDA 3C5ZB 1G7LA 5JXEA 2CK0L 4FQ2H 1K8DB 1EO8L 4ALAH 3W11D 3QIWD 1ZS8B 4D0BA 5DMGD 4X4YB 3ZTJG 4JFFB 4PS4H 1JHLH 3PWVB 3QPXL 1XR9B 5F1NA 2I07B 2Y7QA 2GQHA 3VFTB 5IB2A 4EN3B 5KTEL 3WUZA 4OLZL 3QFJB 5EOCH 1LO2L 2AJXH 2FYYB 3GSQA 4JDVB 4H5SB 5ENWA 4HMDA 3CMGA 5HJ3A 2YMXL 1BBJA 5I1HH 1CE6B 3LMJH 3CLFH 3CUPB 4NO2A 4DN4H 2Y07L 4OGYL 1JZ2A 3VRLE 2X7LB 1TVHA 4PTTA 3LKQA 4WW1A 3TJHD 4UNTA 5L88L 2GFBB 4U7SA 1MFCH 3HG1E 4NM4L 1MJ8L 4G7VL 1HH9A 2R2EB 4OKVB 4NCDA 5F70A 4N0CC 1KEMH 1MLCB 3IDYC 4FFWD 4Z7UF 3TLRA 3V6ZA 1CD8A 1OW0A 3H7BA 1TNMA 3HS0B 4MA8L 1H3WM 3BXNB 2QEJA 4XNZC 3GMOB 4R4FL 3ZKXC 3VXUA 2VTFA 4MSWA 3ZYIA 1XCQA 4MHHI 1CLOH 4L3EE 4PJ8A 5E2WH 3GSVA 1IZJA 4JKKA 1U6AL 3ARED 2NMSA 3GDBA 4U7KA 3F62A 1XIWC 5B8CC 5HHOD 3QZWA 5J11C 1AGDA 3H9SA 3QEGL 3ARGC 2AV7B 4IRJA 5L0QC 1DUZA 4MYWB 4HCRL 2MNUA 1IZKA 1JNHA 2F53E 5GSVB 4JQVC 1NC2A 1CT8A 5DFTA 4WHTA 3PGCB 1OT1A 1S78C 5I0ZA 2YBRA 4F2MB 3L3GB 1G7JA 1KNOB 4AQOA 3QO1B 1UM5H 2FBOJ 3OR7A 2NY2D 1UCBL 3S36X 3WFEH 1FBIH 4S1SL 1BJ8A 5JO5B 1NLDL 2YPLE 1N0LA 2VDPL 1ORSB 3CVIH 1A2YB 5F9OH 1N64L 5I1DA 1G6VK 3GMLB 2YSSA 5GZOD 2IBBA 2PXYA 1A14L 1NAKL 4CMHB 1OAZH 4ODUB 3PP4L 2B1AL 3P11L 2X4RB 1HH6B 3O0RH 1JPFA 4QHLB 5EA0H 3T08A 5ALCH 1RU9H 4Z78A 2X10A 5FYKU 2D7QA 1I8IB 1CBVL 3NCFB 2R2HA 4OM0L 4QRTB 2UZYB 1W72B 5ILTL 2QQKL 2Q1EA 5EZOL 4I0PA 4ZS7L 1GGYA 1WEJH 2OZ4L 3OJ2C 3VI4F 4UV4H 1IGJA 4QO1A 4WI8A 2AXGB 3B5GA 5IIEB 1WTGT 2H9GB 3MRRB 5DRXB 2HLFD 5BOZG 3LS5L 1BQHB 4NCC1 2JCCA 4FQCL 3T4AA 2A0LD 4XHJD 3ZYZA 3GMNB 4LSUL 4RQQB 5J1AA 4NZUH 4JFZL 4TUOB 1XF4A 4U1LA 3RUGA 2UYLB 4MXQD 4P5KB 5EBLA 4D0CB 3NMEA 3QWOA 4FTVD 1TLKA 5JORA 3MRKB 3WLWC 3MJ8A 1FNSH 3AM8A 3K2UL 4ZUSA 3T65A 5C09D 3L5IA 1VEOA 2CGRH 4JFFE 3F7QA 5LCVH 3B2UD 2EH8L 3FQNA 3Q0HA 1BGXL 5KSAC 5DHYA 2VQ1A 2BNUB 2X42A 1E4JA 4K8RC 5HGBA 1M1SA 3D2UB 3QFJE 3HUJF 2ZCLH 3G5XA 1ZLVH 1CFQA 5EIIA 3E6FA 3X3FL 3ARDC 1P4IH 4DQOH 1JZ7A 1O7VA 5GGRA 1BWMA 4KK9D 4UT7H 4G6KL 1M7XA 1YUHB 1LK3L 1T2XA 3MBEB 5ISZB 1NUGA 4NKOB 3STBA 4Z7WA 3RKPA 3TV3H 1A9BB 4XX1G 3RVTC 3TN0A 5DURB 1CL7I 4MJIB 5D7IF 1A9EB 3RI5F 3DROA 5E1AB 4YDLC 3V52L 1YN6B 4KMTH 3TYGH 2HFTA 2FEDD 3U9UA 1WWAX 4XVSH 3VI3F 4NQDB 3QCUH 4LDLB 5DR5L 1IGFL 4C83B 3D39A 4G3YH 3PWJB 2ITCB 3DNKA 5GRJL 2J8HA 4X5WB 4R0LC 4E0RB 1HKFA 3IJYB 5DHVA 5C92A 4OT1H 4DEPB 1NSNH 1LO3L 1DQLH 3WEXA 4DZ8B 2XKNB 5HYQB 1MFNA 5T3XE 1RZKC 3O3DB 3MO1B 3P9LB 1MCWW 3OAYH 4XC1H 2B39A 3X14B 2X1PA 1FO0A 1G7IB 2NY3D 5D2LA 4NQCD 3ILQD 3S5LA 5F9AC 2A74A 5JW4M 4E9LA 3R06B 3O2DA 3EYSH 3L3JB 1BQLH 2RGSA 4MCYA 3D3VB 5DHVH 4QHKI 5KVDL 5H37H 1NFIA 3V79C 5DJXB 3B2VH 2AK1H 3B3IA 3SDXA 4U6YA 1BOGA 4X7FC 5F7KC 2P8LB 3MV11 2D03H 3O2WL 5ID0A 2ICWB 4P59H 2CDFB 2J8OA 2QHRH 1V05A 4N8CH 1FO0H 4WW2B 2ITDB 1T04A 3CFDB 1HHIB 4RFEA 1E4WH 3LPWA 5D1ZA 3MRJA 5JHLH 3MGTB 3S96A 1HN1A 4KHTH 4RWYH 4NO5B 4KUCF 4G42A 3GUTA 3FQUA 4M7LL 1UWGH 3O2DH 4GRWF 3HNVH 1MCBA 2C7UA 3FFCB 1NMCC 1IKFH 1D6EB 2FIRT 4GW5A 5L6YH 1NGYA 4OB5L 3DX6A 4K3EL 1ZVHA 5BXFA 2UUDK 5FCSH 4YX2L 3ESVF 3RVUD 3EW3B 4R97B 1OGTA 3SCMA 3ARXA 2JIXA 1C8PA 4JRWA 2JELH 4PRBA 1PKOA 2R1WB 1A6WL 2ERJC 4BM7A 1BFTA 2FBJH 4HHAB 1EBAA 3HE7C 4PRPE 4R8WL 2Z8RA 5HHVL 2J5LB 3F7PC 1BVKB 1A0QL 4X0KA 4OCYL 1MCPH 1YY9C 2A77L 4GG8B 3EIFA 3BPNC 2FB4L 5L8JB 5EFIB 5LVEA 3ULUC 1P1ZB 1V8HA 5I76A 1QVOB 1FFOB 2UY7A 1KF9B 2AJ3A 4J4PA 1KTLA 2XNAB 1GOGA 5KZCB 3ULVE 5FYKH 1IILE 4I48B 4GQ9H 1HHGA 1IC4L 4PP2B 3EHBC 4RDQF 2XWTB 2IPUK 4R2GD 5GRXG 4G6AC 4Y8AA 5SX5K 1AKJB 3BP7B 3EFDL 3WNPA 15C8H 5I1EL 1YMHA 2FLBT 4WNQB 3MXVH 1TQBC 3EOAB 4M43L 1NEZG 1L7TH 5HI3C 1OSZA 1XGUA 2YPVH 1T20A 1S5HB 1J9CT 1H3UA 4F3FB 4RIRA 5ISZE 2ZCHH 3ELAT 4M02A 4PJIB 1GVIA 5EZIH 3PHOA 3IDNB 4NBZB 3GO1L 4MJIE 4TSBH 1I8LA 2E6JA 3TEUA 1N6UA 1IC5H 4LBEB 1R3IH 4C56A 4JAMA 3DARA 1C08B 1KJ2L 5KVEH 1AO7B 3RWEB 3UROR 5D72H 3KPSD 2CKBL 2HKFL 3UJJH 5A43C 2OXGA 4YHNB 1C7TA 4NQDE 3T2NL 3FOMB 3NABH 2COQA 4UT6H 2IMMA 2W0PA 5E0QA 4K23L 4IRZL 5IB1A 2A6IA 1BM3H 2W59A 4PP1C 1OOAA 1FVCA 4JKWA 3TP4A 3PP3H 1OAKH 2YPKA 4LPXA 4MJ4A 4ZUUB 4CADB 3OGCB 1JUFA 4PJ7F 3W82A 2A6JB 1G9MC 2KUTA 3RGVA 3ZKND 1HWGB 4JPVL 4OJFL 4V2BA 2CR3A 4GRLA 3ARFB 5K33A 1JPST 2DLFH 5T1LD 3TESA 1CCZA 3VGHA 2D0FA 2WUCL 4DGVH 1W0WB 2XN9B 1AH1A 5FYLE 4QEGA 5GGRY 2VL5B 3RWFA 4M7JL 3ZT7A 1N7ML 2P5EB 5T1MB 5IHUL 1U42A 4LPWA 4MCZB 4WV1A 5E94A 3FB8A 4PG9B 1JPTL 1U91B 2EYRB 3FQWA 2Y9RT 4WTZA 3D3VE 1XT5A 3MUY1 1DTUA 4JREB 3WFBL 4M6OH 2VITB 5JNYB 3QCTL 5BMFH 4QLRA 3HPJB 1HINL 2GSIA 4OV5A 2VDOH 5DD0L 3B9EA 1W0YT 4NZRL 3N1FC 4A2MA 3RZCC 3CCHA 5EOTB 1XMWA 2UZXB 3RIFK 3BQUA 1FGVH 1KIQB 4P9MH 5TQ0H 3T0DA 2IBGA 5FHBL 4EOWL 4EDXB 4TUJA 1OAXL 1JE6A 1LP9A 3EGSA 4YK4C 4IDJL 1INQB 2R15A 2XT1B 4KUZL 5J1SC 1CK0H 3OB8A 3RIAF 1NDGA 1HSBB 2RIKA 1TZHB 4PR5A 2RB8A 1MIML 3LN4B 3VXMB 4G6FD 1FE8H 1AGFB 5T1DH 1QNZH 1OCWH 4ZODA 1MFDH 3V95A 2NX5D 5I8EB 2VLKD 4ZPVB 3TVMB 4JZJB 2I9TB 5J12B 3RWDA 4L29B 3Q1SH 1FL5B 2OK0H 4O2CB 3EFFB 4N5UA 1T0NB 1CFSB 3GJFA 4JLRB 1QLEL 4JFEB 1OM3H 1E6OL 1RUML 3N06B 5CD3A 2WM0A 3D5OF 4LIQH 3B6SB 1WIOA 3WS6C 1U3HC 3FTGB 2ID5A 1ZSDA 3VRJB 4WI4A 5DEFB 1JTTA 4MD4A 2ATKA 4M6NL 4HJJH 1M05A 4MNGA 3QSKB 3VDBA 3TBVB 1IBGH 3KPQB 1TITA 2Z35A 4PLOB 4JHZA 1HIML 4PJIE 2MCG1 3GJFH 1WIUA 3D85B 1O5DT 3DGGA 4RAUA 4NQCE 3SDCA 5E2VH 1U2HA 3BWUC 1RULL 3RKDD 3RL1A 5C0GA 3EUUA 3WUWG 5AYUH 3NCMA 2DQHL 1FYTA 2W65B 3MRFB 1J1XL 5HDLA 1T03H 3AS1A 1NAMB 3MUHL 4PV9B 1SBSL 3QXVA 5FA3B 1H5BA 2FX8L 1RK0A 3VD4A 2ZUQC 5DMKA 1NCUA 1H15B 2NY0C 3H2WA 4EJ1C 1MI5A 5BS0B 1I7ZB 4P4KB 1RZIB 1I1YA 2AQ3A 3GBNH 2GYSA 2AEQL 2P49B 1UWXH 3BOVA 3V9FA 2V9QA 3LPFA 2VLJA 1U8MB 3C60D 1D5XA 1FFRA 4C4KO 4PLKC 1U92A 3X13A 4ZPTA 3P9WB 1GGIH 1ZLVK