4ZPVB

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DIQMTQTTSSLSASLGDRVTIICRASQDINNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGSDYSLTISNLEQEDIATYFCQQANTLPPTFGAGTKLELRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
molecule keywords D12 Fab Heavy chain
total genus 45
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zpvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zpvB01
3QUMB 3KR3L 5ETUB 4Y0GA 1T7VA 1WZMA 5TDPA 3V6OE 4M7ZC 4G6FD 4LLUB 4A2LA 4ODTH 3QWRD 2PTVA 5IF0B 3BPLB 2VB5A 4QCIB 2ORBH 4DTGL 1I3VA 4TRPL 3MLWH 4JPVL 4YO0B 4OCRH 5IEKA 5E6IC 4IOFD 5KSVA 3SDAD 3FB5A 4L3CA 1FZKA 3SCMC 2FEDC 1JPFB 4NQXB 1ZTXH 4L8SA 4MNQB 1UZ6F 4ZTPL 2BMKA 4QXGH 3MA7A 1D9KB 3QAZC 3B3IB 2WBKA 1G7JA 1EZVX 2W9LA 2GUOB 2Z35A 3L5IA 4Y4KB 4DKFL 5LWYL 1D5ZA 2EC8A 4GG8B 2R0ZL 2YXFA 3IF1A 5E94B 3SDDC 1W0WA 2Y36H 3BP7B 3AREA 4Y5VC 2F58L 4NZDA 1A6UL 1ZA3A 4PRID 1UQSA 2VDQH 4LPYA 4YXLH 2VABB 3V0AC 4DN4H 3M07A 4LGRB 4Z7UF 3UBXA 2WIIA 3RUGA 3VRLE 4HFWB 2R8SH 3IDIA 4EOWH 2BXYA 3IDYC 4BSVB 4BFIA 2DQHL 5I0ZA 5FYJU 3SE8L 2HVKA 3D0VB 1DN2A 3RNKA 4BQBA 5KSBB 5GJSL 3NN8A 1KLUA 2BHYA 4NM8L 4OZFG 1MCOH 2BOCA 1QBAA 1FZOA 3ZE1F 3UTPD 1NUFA 1LO2L 1OSZA 1MFBH 1ZLVK 4Y88A 4QF1A 1BIIA 2R69H 2EDRA 2EYTB 1I3UA 4EN3C 4RCAA 2EKJA 5D93B 3CFJB 3FJTA 5EIIA 2OQJB 5I15H 4IIQB 2JELL 5GZND 1RUAH 3AM8C 5DJZA 3ZO0A 3IJHA 2DBLL 2EYTA 4L5FH 3TO2A 3O41A 1JRHH 3DX6A 5CD5C 2XQBL 3LEVL 1WK0A 2A74B 5TPWH 4UNUA 3WHE0 3HTLX 2D3VA 4XVTL 4H25B 2VH5L 3UJJL 5LXGH 5IWLA 4JQVA 4MD0B 4EI5D 3GJEB 3GJFK 2BFVH 4F37K 1P2CB 2ZWLT 1NC4A 3TZVA 3GGWB 2Z8SA 4D8PA 5KVGL 2XRAH 1MFAH 5K9KB 1KIRB 5H2BB 4W68A 3MRBB 5D2NB 5FYJE 5T1LB 1OCWH 5C09D 1LILA 2BRRH 5C0DB 3QDAA 3J8F7 5DVKA 1VFBB 5I76B 1NBYB 5F9JA 1A4JA 2A6JB 1YZZA 3AAZA 4M6MH 1ZS8A 1CR9H 4POZC 4FFYH 4MJIE 3P4LA 3M8OH 3I84A 3K2UL 4KVNL 4MQTB 4ORGA 4I0PA 4AENB 3Q3GA 3BE1H 2P5EE 4G8GD 4RFNB 5IJKA 4Q58C 2DQDL 3QDME 4S10A 2LTQC 3PWJB 5KSBA 4P9HH 2PNDA 3NGBB 3VGBA 4NPYB 3DECA 1DBJL 1MWAH 3DOSA 3QO1A 1QHOA 1QSEA 1QFWL 4KRPD 4JB9H 5BVJA 5ALBL 2BVTA 4BSJA 4F58H 4YJZL 1YEEH 2OR9H 2UYLB 4Z5RA 2EC9U 4V1DA 1GC1C 1H3VA 2HJKB 2NY0D 3DROA 4DCQB 3L6FA 1A6ZA 1JV5B 3JWOL 2JJSA 1E4XH 1OAYL 1V5JA 1WBYB 4N0YH 1L9MA 5AWNL 3ILQC 3MA9L 1V05A 4JFEB 5IQ7L 5GS0C 3RTQA 4R4FH 1ZT7B 4OZHF 4JM2C 4FFZH 1KPRB 2PETA 3TO4C 5I1EH 1G7JB 2GY5A 3HKFA 3NGBC 1JUFA 4OCMC 4P99A 3MV7D 2OX5A 4M6NH 4LVHB 1ODAA 5DI8A 4X98A 2YD4A 1CGVA 1KIQB 1NCBH 2E27H 4HT1L 3VFNB 2IBZY 1R5VA 3O6FD 5BW7C 1EAPB 4IRSB 5HHOD 1EHLH 3G6JE 4MAUH 1KC5H 4GKSB 3TCXA 1RUMH 2HLAA 2VISA 3WXVH 1HKFA 5DUBA 3QQ3A 3BD4A 1IMHC 3VFWA 4R8WH 1WBXB 1BJ1J 4JN1L 4WCYH 2HJFA 2Z91A 4NNPH 1R5IB 4HH9B 4K9EL 1FIEA 2BOCB 2OCFD 5DK2A 2WBJC 4J3OC 2H2SD 5DD6A 3CK0L 4E42A 4BZ1L 3DGGB 5D1XA 1A22B 2IANA 4PJIB 4APQB 4FXKB 3WNMA 4MJ5A 2CDEB 2H3NA 4WHDA 5J1AA 4HUWA 3JBG7 2F9BT 1TPXB 2CRIA 4YDKL 1IAOA 4QHNB 3QUZA 3MLTA 2QADD 2VABA 3ZTJG 5HJ3A 4KQ3L 4HWZB 3CFEB 1LWRA 5HI5C 1HIMH 1NFDE 1NC2B 1IC4H 1FG2A 3IFLH 3IDMB 1NDMA 3CD4A 4AQOA 2PW1A 3HFML 5C6TL 5FGBC 2AS5M 3C60C 4X9FA 3PP4L 4UU9A 1U8NA 1NCBL 4ELMA 3ULUD 2FR4A 1HOCA 3O6KL 4HUWB 4N9OB 1J0YA 4MNQE 2A1WL 1GHFL 4LCCA 1AJ7L 4UNTA 5INCB 4M5ZH 4WY7L 2A6IB 3OKEA 3ALWA 2WANA 3BQUC 5EC2A 4L3CB 1BX2B 1DE4B 2DYPA 1L7IH 4ZFOL 3QUXC 1Q9OB 3GB7A 4XP9L 3GHEL 2AV7A 4HCRA 2FJHB 5EBMA 1FCGA 3MLYH 3OR7A 3WNKA 3MLPA 2BC4B 1JPST 5LCVH 4JPIA 3NPSB 3K46A 3OAYH 5DRWB 4KJYB 3C8HA 4HDIA 2GJJA 3CVIH 4XNZC 5FF6B 1EXUB 3ARPA 3O6MH 4XMKH 3UBXG 1T1YA 2IPTL 4TUOA 2D03H 3QIUC 3UMTA 1YJDC 2Q7YA 1RSFA 1OD9A 2MPAH 4S11A 1RJYB 4RWHA 3GMPA 5DURD 5EFIB 5T1DL 4JR9H 3MOAL 1T80A 2HT3C 4RIRA 1C12B 4PREB 4KKCC 3NN8B 2NW2A 4P2OC 1NBZA 2X4PB 2D7TL 1G7QB 1E6OH 5I17B 5J11C 3P4MB 5T1KB 3TH3T 2EE3A 1HI6A 5EORL 5I1JL 3GJFB 5J4MA 3LZFL 3HE7B 4U1JB 4X7SH 3C08L 1WEJL 2KZWA 2VNCA 1CR9L 5C0CD 3QUYD 1MEXH 3QXAA 3MRHA 3KPRA 4G9DB 4CN1A 4NP4L 3T8XB 1IM9A 2OP4H 4QTHB 4EDXB 2QSCH 3LIZL 3OJMB 2WLYA 2NY3D 4XWOD 1L7TH 1NAMA 3UYOD 5HI4D 4F37F 5HSFA 5FOBB 3TA3C 1B90A 1RD6A 3I02A 1DQQB 2GSGB 4NQUA 4RA0C 3V8OA 5E56A 2DLTA 3ARBB 1J1XL 4NZTL 5KZCD 4MA3A 1IE5A 4NHCH 5EBLB 2VKWA 1XZ0A 3QCVH 1IEBB 3BAEL 4GXVH 3VXRA 1FN4B 4ZSOE 1CT8B 3NCFB 1MEXL 1MQ8A 3WO3B 4UT6L 3A6CH 1CD1A 3RA7L 3CFCL 1HQ4B 3VFMA 3DTXA 4WU5A 5L8KB 4JG0L 3ZSTA 4YQXL 2A6JA 4WO4B 3R8BB 4EN3D 4PRIE 4PLOB 4F2MA 5C7XL 4Y4FA 1JHTA 1Z2KA 3QUMA 1FDLH 4JRXD 2APBA 4R96A 5JA9A 1OTUC 1KCVL 3UJTL 4OJFH 3V52H 3T0BA 1E4JA 3MLVL 4C58B 2MPAL 1CGWA 4PGEB 1ED3A 4M1CC 1QR1B 2CR3A 4DVRH 3WIHH 5GGRB 5ID0B 4W81A 3JV6A 4L4TA 1S9XA 2APFA 1H8SA 4I9WE 1KTLB 4F9PA 1AQDA 5F96L 4KJQC 3V8CA 1AGCB 2YC1A 5LCVL 3WEXA 4N8VA 4ODHL 4PLKC 1HE7A 4GAFB 1NSNL 3ZE0E 3S97C 5C2BL 3PL6B 4WUUE 4JZJA 2FX9H 4YEFA 4TOYL 3OWEA 5JQ6H 3EYVB 1I3RA 1UM4H 2NTFB 3UPRA 2NXZB 3LHPH 3WN5B 2FECI 2R9HC 1HEZA 2F58H 3OG4B 1UXWB 1KCRL 3HNVH 2QQNH 1M7IB 3RVTD 5HI3D 4NZUL 5EU3B 2VDML 3S5LB 4S1SH 2OTPA 3MACH 5KAQF 4I18A 5MEOB 5FUZL 3TIDA 2IADB 4XI5C 2DQTL 1GGIL 4UV4H 2OMNA 3HZVB 3O2DH 4EI6B 2Y06L 3CFDB 4JFPA 3ZHDA 4HS8L 4XPFH 5C8JB 1I9RL 1J0KA 3SQBA 1I3RB 3P30H 3SDCC 4ORZC 3W2DH 4FFVC 1KPVB 3KG5A 4XP9H 2PN5A 1NKOA 1KUMA 3RAJH 1QLFB 1R24B 4HIHB 4NQCB 3TPUB 2ITCA 4YDKH 2AK4E 3VA2C 5IW6A 2EDQA 1SJHA 2XG5A 3DX9A 3P77A 5IP4A 3V6OA 4J1UA 4EQ2A 5KJRL 3VCLB 4UAOC 3RWHA 3OJVC 3PQYD 3U46B 1A1MB 1RI8A 2AABL 1CLYL 1FFNA 1QFOA 5CMAA 3LDBC 1I9IL 4YPJA 1T83A 1CZ8L 1WZKA 3WNNA 1RHFA 1I8LA 2YPVH 5CGMA 1IKNA 1NGYB 1HNGA 3FQTA 1S8DB 4K94H 2B39A 2Z8RA 3AS0A 1LK2B 3G6AB 1NJ9A 4LFHD 4PG2C 5DK0A 3HB3C 4KQ3H 3WHE1 2BCKB 2Z31A 4PR5A 4ONFL 3L3KB 1PYWB 4NO0D 1KC5L 4R2GC 2WUBL 3L3JA 3FOLA 3EAKA 4PJXB 2X2YA 4YO0A 1HH6A 4I8DA 1MRDL 1BF8A 2QR0B 1IGJA 2I5YH 3AXLA 3ULVH 3TBSB 4PPTA 4XCFH 4GAYA 1I1YA 4HC1A 3V4VH 1DQQA 4KUZL 2CKBA 3PXJA 1EEYB 1WT5A 5D7KE 1CFNA 1WUNT 4TYUA 4GW4A 2P24A 3TPKA 5AWNH 5I73B 4IMKA 3RI5F 3JWOH 2J5LC 3OKKA 3RVUD 3C8KB 1WIPA 4WUKH 1DANT 3KYMA 1HXMA 2BNRD 3FCTB 1T22B 2ICES 1KXQE 5LAXB 3GO1H 4N0CC 3U7YL 1TQCC 3OTTA 4IEFB 1U8JA 2IMNA 4XCNA 1YEEL 3CPLB 3UTTA 3HE7A 4I2XB 1IM9D 5I74C 1NCNA 4KK5D 2W91A 3MR9B 3FOMA 1IGFL 1CFTA 3LKQA 1C5DB 1NDGB 2E3VA 4NN7C 3U4BL 4Q9QL 4OF7A 4LEOB 3SKUD 3FTGA 3UTTD 4DFIA 5F6HI 1NLBH 3GMRA 4P3DB 4D9QE 2DQJL 3MZGB 4CU6A 4M43L 4G6JH 3GBNH 2B0SH 5D71L 4NKDA 35C8H 1VGKB 1N0LA 3OR6B 3VA6A 4JDTL 5D7IF 5DRZB 3MRQA 2FYYB 5D1XD 4G6KH 3CSYB 3VXPA 5E24E 2A77H 1NMAH 4WV1A 1AY1H 1JJUA 1UC6A 4WTZA 5DMIL 5T3ZL 2XXMB 4CU8A 1VACA 4FZEH 2C3XA 2K9UA 4LQFL 4NBZB 5ESQA 3LEXA 3ZE2E 5IB2A 4TPRL 1AQKH 3DVNB 2ITDA 5ADOH 4P5KB 4EEEA 5IBUB 4K3JH 3TBYB 1OWRM 2RCSH 3GSRA 2VDRL 4OD1H 4JFQB 3QQNA 3BPCB 1FCCA 5FYKD 3HMXA 2XA3A 4ZFOB 3SPVA 3LQAL 5IMMB 5EZLB 5IB5B 4Z7WE 1KENH 4LVEA 5CS7A 1X4ZA 5JQHC 1P69B 2JJVA 1UJTA 3ARBC 4OZGF 4FRWA 2Y72A 3O3DB 3U0WL 3LQAC 4B41A 3MODH 2EH7L 3PF2A 1ZLWH 1A02N 4HWZA 5MENB 4YXHL 1OHQA 5J8OA 3QIWC 4LVNB 4X7FC 3QUZB 3OXSB 4MNHB 1EMTH 3ABZA 4TSCH 2CDEA 5BJTA 3PWVA 4H26A 4NWUL 2EZ0D 5IVOA 2I27N 1XCQA 5F93C 5L2KA 1U91A 2Z8VC 4KY1H 4U1IB 3EJJX 4UDUB 4JO4L 1G7LA 3GKZA 1A7QH 1JE6A 4PJCF 3H7LA 4LSDA 2YK1H 4FQXB 2DQIL 1Y0LB 5C0CA 5IHLB 5I0DA 2CMRL 2VR5A 1MJ7H 2EEDA 4NO3B 1HHJA 2I9LB 1YPZF 2F19L 5T3ZE 4Y4HB 4WJ5A 3BVNA 4LHUG 4PJ9A 1F6LL 1RQ5A 4UUJA 5CP3A 3IDXL 5I1HH 2ZNWA 2VLRB 4H26B 2P8MB 2P44B 2ATKB 2B1HH 5GRZA 3L3DB 3MRQB 2H1PH 1OTSD 4F8TA 5CILL 1R3JB 1CU4L 2F54A 4M1GL 1CZ8H 4U0RB 4HZLA 5CINH 4KPHL 2AK1L 5FYKE 1MI5D 4N8VG 3QB7C 3BEWB 2NLJA 2BOBB 5SWSD 1KEML 3TVMA 1F6AA 4LCWD 5I8EA 4BKLB 1XEDA 2PKDA 4WTXA 1G7IA 5DYOB 4JKLA 1KPRA 1WWWX 3UBXI 4NUJA 3LKQB 4RISL 4JFEA 3S4SG 2ZSWB 4XBPB 3QDJD 3MBXH 4JDVA 5JW4N 1UENA 5DJ6B 2UZYB 5JIPA 2QEJA 3OF6D 4YIQB 5ESAA 2R0LH 3LKSA 4RBPK 5KANG 4HS8H 4XPFL 5KSBF 3VH8G 1DUYB 3VGAB 1E28A 3RDTD 3IVKB 1CLYH 1T5WB 4ZAKB 4UI2A 4M5YH 5JTWA 2F53D 1CWVA 3PXHA 1GCFA 1WITA 3FT4A 4K8RD 1IVLA 4PD4J 4NQCE 4OZ4A 3S96A 4O4YH 4XI5D 4LVNC 3WD5L 4OF3A 2ZG1A 1ZWIB 4HIIB 5HGDB 4MDJB 2FX7H 4LLMA 1MCPH 1GZQA 2D0FA 1U0QA 4MS8D 1A6TB 1NSNH 1JFQH 1JGLL 2LTQB 1R3HA 5FO7B 1YMMB 1I9RH 1N0XH 3OZ9L 4NO5B 5C0NC 1U3ZA 1G7PA 3S96B 1HYRC 4DVBB 2DQTH 2Y25A 5D5MF 3KLAA 4Y2DC 1XF4B 3NIFE 4HUXA 4LKXB 4TVPL 1D5XA 4HX1A 5D2NA 2BNQE 1B2WL 3QIWD 4C56A 1A8JH 3FAWA 5E2WL 5CZVL 2A0LC 4HHAB 2NY5L 1OP3H 4JO2L 4YHLL 4FQPA 4NT6A 5EUOB 2ZUTA 1UACH 2ED8A 4GKNB 1HCFX 5IJVB 3B5TA 5GGQL 4Z76A 1FH5H 4YE4L 4OZGA 2MKLC 3P11L 3SGDI 2VQ1B 3BSZH 2F19H 3N9GL 4YBLB 1OGTB 5B8CB 3AC0A 3EO1B 1NFDF 4GMTH 2JLLA 1KEGH 3CVHA 5T1MB 4AYFA 5DD1H 2NXYD 4IMLA 4XBGA 1H3UA 4LLDA 2WWMD 3MXVL 5EOTB 3K80A 5GRVL 1LO3L 4XNQA 5ANMB 1YJDL 3DX7A 2PYED 3MUHL 1T6VN 3IDGA 3MCLL 5EC1A 5IB4B 2R0WL 2VL5A 1BVLB 4UTAH 2ATKA 2AXJA 4IRZH 5B3NA 5DJDA 2B2XL 4HBQA 2IALB 5I2IA 1NGYA 5MEOA 1I85A 1UYWH 1QBLH 3MNWB 1C1EL 3D85D 4NRYB 3BKML 4CVZA 3BKYL 3DJ9A 5FFLA 4YPGA 4RMVA 3IFNL 4R2GB 1G9NC 3EYVA 3QYCA 3QCTL 3F65A 4L9LB 3QDMD 3QDHA 5I19H 1KTDA 5E00A 3GSWB 1NCAL 1K8DA 4ERSL 2H8PA 1N5YH 4JFHE 1M05A 3QEQE 1WICA 1NKRA 1CYGA 2QSQA 2DJ4A 3GSNB 1UA6H 4KAQH 1TJHL 2O26U 3AREB 5D7IB 5EU6E 3HI5H 4F7CB 4CVZB 1OP9A 2A6DA 3F6IA 1QR1A 2Q1EA 3L5JA 2D03L 2VR4A 1BREA 2E5EA 5T3ZH 4HKJB 2AV1A 3BX7C 4JN2B 1H0DB 1EVTC 1HHGB 3O3EA 5MI0B 1AXSA 3RVUC 5A16A 2ESVD 5TFSH 4JAMB 3KPPA 1A3RL 1BVKA 1YNLH 4L8DB 1DQJA 4EXKA 2NY0C 3EGSB 1T21B 5HHXL 3SQOH 1ZHKA 5KVFH 2XTJE 2D7TH 3SCMB 2EO9A 2EDTA 3WN5A 4A6YB 3QUYB 1CQYA 4JZJB 1H9VA 3X3FH 4PJ5B 3H42H 4PYGA 2ICCA 1TIUA 1A3LL 1SEQH 4TUJB 4ZPVB 1I7ZB 2FWOB 4KDTC 5DGQA 3OX8B 2GSIA 3KPLB 1A64A 1BEYH 5CIPH 3PHOA 3H9SE 3VXSA 3H9ZA 1G7MB 2GSGA 3L7FB 1I3GL 5BZWA 5I1AA 2E7LC 1VGKA 3FT2A 3O3UN 3Q48A 3D5OF 5BV7L 4P4RA 4AM0B 1RK0A 2YD1A 4MCYA 3EFDH 5F1KC 1BAFH 1HINH 4G8FA 3AY4C 1XF4A 4HUXB 4U3CA 1RZKC 5C0CE 3H9SA 5TQ2L 3V5DB 3QDGA 4GKZA 3T77B 2AXGB 4XPBH 1XGRA 2YN3A 3MUGB 1MRFH 2OJEA 3HRZA 3NAAL 4GAGL 4U2ZA 5FYJH 4Z7UE 1P4LA 1GHFH 5HI5D 1F3RB 1PBYA 2MNUA 1JF1B 3UTQA 4RGNB 3CLEL 4CUCA 4HAFA 1JNLL 4TSAH 4WHTB 5CJ8A 1PG7L 5SWZA 1FN4A 4MXVF 5I1DA 1XIWA 1HXMB 5EBLA 3WJLA 2Y5TB 4P4KD 4CADA 1MCJA 1F8TH 1UZ8A 4JZNA 1BFOA 1LEKA 1RZ7H 2JCCB 4TUOB 9CGTA 1CICC 2F53B 4AH2A 3EYQD 4ZAKD 1XGYH 1B0GA 1JZ2A 4G43B 3WIFA 3Q5YA 1OM3H 4S0TD 1K8IB 4R26L 1BLNA 3L3OA 2X4UA 4LSSH 4OGYH 2X4OB 1SEQL 5J13B 1JNNH 3WE6A 1R6VA 1U2HA 4EDXA 4LDLB 1SYVA 2GJZA 3TESA 4KDTA 1K2DB 4OQTH 3PQYA 1NAMH 4OSUL 1U93B 4JREC 2V7NB 2VLRD 1TJHH 4MXQC 1E6JH 2VLKA 1GXEA 5D2LB 4HUMB 5HHXH 1FJ1B 3CSPA 4FQ1L 4U1JA 1NGPL 3FQNB 5L9DL 4PRHA 3WN5C 4G9FE 1FO0L 3WS3A 4WW2F 4Y5YC 1EHNA 1IAIM 5SWSB 3H9YA 2CUHA 3BDYL 1DLFH 1YUHA 2EO1A 4AEEA 1CLOL 3O8XB 2ENYA 1QHPA 3SOBL 1E4KC 4I9WD 3L5HA 1NPUA 3BESR 4MMZC 4QHUB 5D7LB 3WFDH 3NFSH 5TF1H 1FHGA 1A1MA 3WS3B 2Y23A 1FG2B 3LB6D 3RQ3A 1Z0MA 5I71B 4NQTA 4NCC1 3EOAA 4YUEH 3RGVA 2C3GA 1NFKA 2ARWA 2VLKB 2EE6A 1H3PL 1KFAL 3UXFA 3MNVB 3FO0H 2V17L 4XPTH 1HDMB 2HH0L 3V0WH 2RB8A 3V5HB 2NX5D 1Q9OA 3QQ9D 4F9LA 3PUCA 1RMFL 3BKYH 1AD0A 2EDFA 1T21A 2WV3A 4NN5C 2AQ1A 3BSZL 1K8IA 2NR6D 4JM4H 3ECBB 3CCHA 1BPVA 1O7SA 1AKJD 2NXYB 1RZ8B 3Q6GL 4IOSD 3S34H 1I75A 4FG6C 1MI5E 4M9OA 3L95B 3NACH 2NY2C 1IC7L 3CZFA 3TLRA 2Y07L 4MA7H 4J3VA 3U36B 3NVQA 1I4FB 3SY0B 2FJFA 3CUPB 3Q0HA 1IGTB 1RZJC 3BKJL 5I66A 3SE4C 3UDWC 2COQA 3U83A 4V2CB 5IROA 3RWJA 1DLHB 2WBJB 4PJIE 4LDEB 5IK3B 5JOPD 3TO4B 4PYHA 5EZOL 4NJ9L 3BPNC 1U8PA 5D2LE 4YHZH 1K8DB 4ZUSB 2DJUA 3WFBL 2BK8A 2FRGP 4PJIA 1CBVL 3IFNH 1N64L 1A5FL 1EUTA 5E8EB 1QVOA 3PWLB 4ENEC 1UB6A 4DKEL 4DGVL 3SKMB 3EHBC 2NY2B 3TP4A 1QBBA 1NMCB 1YUHB 4Q6YA 4Q9RL 1D5XB 4ZUUA 5KVGH 5C0AA 1MAML 1WBXA 4V1DD 3B5GA 1QZ1A 1YJDH 5D2NC 5TJWK 2N7AA 3T1FB 3KPSE 4HUVA 5KG9A 5IVZA 3QZWA 2DD8H 3PP3H 2IFFL 3J7HA 1NMBH 1YMMA 2VDLH 5T1MA 3ES6B 1JGLH 5HI3C 3DUUA 3LOWA 4LEOA 2KQMA 4FQXC 1SYVB 5F1NB 3PWJA 4MA8L 1B88A 5D70L 4L5FL 4OZGB 1TZHB 4HGMA 5I1KH 3IXTB 4KDWA 1T3FA 4BZYA 3L3OB 3CPLA 3KYKL 3FT4B 1N3NB 1JPGA 2V5YA 1ZS8B 5FM5M 3P73A 4OZFA 4KJPD 4F7EB 2DQFB 1UXSB 5GIRA 2Y5TA 1R3KB 5CEZH 1SVZA 5DZLA 4PGDA 4LKXA 2YWZA 3OHXB 5GJSH 3FONA 4K3EH 4N1CA 1QNZH 4JFZH 3D39A 2BDNH 2RIKA 5M94B 3E3QE 4AG4L 1D6EB 2X44D 4FXLA 4M1DL 2FGZA 2UWEB 3G6DH 3EOBB 1FC1A 1G7PB 4CMHB 3IS0X 4D94A 2DKMA 1MHEB 2QQLL 3MLRH 4KV5F 1T1WB 5A2LH 4PP1D 1T03L 4YNYB 4MQXC 1NC2D 4PTTA 5JW5A 1T1ZB 3HC0B 1JGUH 2PO6C 4NGHH 5C0EA 2IFFH 4MD5A 3K8MA 4OGZA 2H2PC 4RDQF 1RK0B 5FYKU 5CIPA 2V2WB 3P40A 2Q7YB 4L29A 2R0ZH 5E6ID 4IRSD 3ZDXE 3NA4A 3NCMA 2VRAA 4D3CL 3F7VA 3BMVA 3KJ4B 3H3KA 1EXUA 4WENB 5C0RL 4DQOH 4P46B 5JOEA 1EEUA 4JFOA 2NXYC 3GRWA 4K2UH 4NSKB 4HGWA 2NCMA 1KBGH 2EIZA 4PJ9B 1JI2A 4WW2B 5EOCL 4QKXB 4WDIA 1JWSA 4UTBH 4Z7VB 2NYYD 4K7PL 5IG7B 2R56H 1XF5A 4DTGH 5IR1A 3O11B 4DKDC 3QRGH 3WMSA 1I1FB 3QDGE 4P2QD 2VLLA 5K33A 1QBML 5CJ5A 2R1WA 3QHZH 1V8HA 2XACC 1G7IB 4NFBA 3MJ9H 2NXZD 4P23D 1VB9A 3U30B 2JCCE 4MDIA 1XR8A 3F62A 5IW1B 1UM6L 4WW1B 3TM6A 3M45A 2ICEA 2DMKA 3QXWA 1MCFA 2VQUA 3BRGC 1PX3A 2HFFB 5ADOL 3IJYA 1M6OA 4YHIA 5GS0L 1NGZB 1DZBA 4P23A 3WDJA 2R2BB 1FORH 1NDMB 5F1OB 2H1PL 5E7FA 4QXWA 3TN0D 3K4AA 3V2AR 4JHWL 4PBVC 5DUPL 4U7SA 3L3IB 4FQXD 1D5ZB 4ZFOA 2HWZH 5SV4A 3I6LD 4MQ7B 4UUJB 1I1AD 2DDQL 5D2LF 3SE3A 3MV8B 5CUSL 4EZMA 4QY8B 4YGVA 1KTDB 4K3DH 3PJSA 3WFEH 3MRNB 5JZ7D 5L8LB 5EZOH 1RZKL 2BSED 4BUGA 2V17H 2EICA 3S4SB 4DN3H 1JF5A 2P5WE 2A83B 2QL1A 3DRTB 3M17A 4F57H 4Y4KC 1IGFH 4LDOB 1CXHA 2H9GA 4UV7H 2V5MA 5HHPA 3V6FB 5IUSA 1FNLA 2DM4A 1QA9B 2YN5A 3IDGB 5EC1B 3Q6GH 4I13B 1BZ7B 1AGFB 3B2UD 4NKDB 2Q87A 1TITA 2JK5A 5SV3A 3QA3B 3M1BA 1F3JA 3DIFA 5EU7C 3FB7A 4O9HL 4KKLD 3EO1A 4R4BA 4XPTL 1RUKL 5EPMB 5DYOA 5FGCB 1AXIB 4XVJL 1N4XL 4QYOB 5EU6A 2ED9A 3BEVB 3NFNB 5HHVH 2BY1A 1Z9SA 3MJ7B 1JPSH 3O2DA 5E5RB 1OAXH 2W9DH 1ZLWK 4Z7WF 1OP3K 3DXAD 1NAML 2A2QT 3BHBB 4G6AD 4OCLC 1IBGL 4YX2H 3MNZB 4LQFH 3HE7C 3RKDC 4KKBC 3ROLA 4LSSL 2ARJQ 2UZIH 4OGYL 4CVWA 1LE5B 4C56D 2LU3A 4LLWA 1KJVB 1XGYL 2MMXA 3SN6N 4KGJA 5DRZA 2ZUWA 5CJQL 4U6TA 4GSDH 3DBXB 2BNRB 4U1KA 1FNSL 5D1ZA 4ZS7H 1YEGL 4PJGE 2OTWA 1ZA6A 2YPVL 2FEEL 1E6JL 1ZT1B 6FABL 3IU4L 1IM9B 1QQDA 5IT2H 1F4YH 3KPRB 4G9DA 4HS6A 4GRLD 3F7RA 1U58A 3UTZB 5I1LA 4N90D 3TYGL 1BQLL 1ZK9A 4PJ9D 1SJEB 3NCCB 2A9MH 2X09A 1K4CA 5EIVA 2CXKA 3KWWA 1CFQA 3RPKA 5E5UB 1GGBH 4XVTH 1U6AH 2G5RA 2Z31C 5IMKB 4UTBL 3P0VH 1VFBA 3QEHA 4WFFE 4UQ3A 4YHOL 4UDTB 1HH9B 1MF2H 1TCRA 2WP3T 4AMKL 2JJTC 4P5TC 1V3KA 1I8LC 2J88H 5K9KA 5FHAL 4XNYL 5FA3A 2P48B 2VXSL 43C9A 1HCVA 1F5WA 5GS1B 5EO9B 1KB9K 3HE6D 2D7QA 2GTZB 1MRFL 5FYJL 4C57C 2CLZA 1UKTA 4YDJA 2O5ZH 1YMME 2C1PB 1JGUL 3GIVA 3QZWG 2BOBA 5CWSA 3CGTA 5IFJA 5DZOA 4Z7QF 4O2CB 3STLB 5JOFA 1EUUA 4YAQB 4O58L 2OLDA 3KJ6L 3PQYE 4HQQH 2FIKA 1UCTA 5EO9A 2E7MA 1B4JL 1CDYA 3MGAA 4M93B 4DGYL 5I8KH 5FYJD 3RWIA 1DVFA 1T5XB 5EIIB 4WI2A 5ADPH 2EIBA 3W0WE 2OZ4A 4EJ1C 3JV5A 2NY4B 4QF1B 2W0LA 4LRIA 4D0CA 1Q1JH 3TFKC 1ZLSL 2IH1B 4FQHA 4NO3A 4I18C 1KCVH 3MRIB 1MCWM 4QRPE 3UJTH 4R0LA 1UXWA 4G6FB 4GXUM 3LKPB 3AFLA 1I8IB 4NCDA 1K85A 4HIXL 1T03H 5DWUH 4AEFA 1G7LB 3HPLA 4KGLA 3DV6B 5CD3A 4TNVK 1I7TA 3MMEA 3E3QC 4JZJC 4NQCA 3LEYH 2DB8A 4PRDA 2XKSA 2FB4L 4MNHA 2B20A 5IOPB 3DGGA 1TLKA 3MX0A 4K55A 4LLYA 4Q2ZA 3ARZA 1P5VA 4F9PC 1X6NA 2ESVE 2W1NA 1W0YT 2XT1B 3THML 2AI0H 3CSBA 4FS0A 1YEIL 4H88L 4OCXL 3FZUC 4OB5H 1X7QB 1EERB 7FABH 1YPZA 3H3BC 2VDOH 4DAGL 1VEMA 1OF2A 3A6BH 1QSVA 2AJ3A 1GGIH 4ODTL 4UV4L 3JWDH 1UA6L 1EFXA 1J10A 2ZUYA 5F89A 3PDOB 1B0RA 5F88A 3KS0H 4CN4A 3BUYB 2F54E 3CFBA 4GJTB 4OD3L 5HDBE 2YD6A 1HHIA 4RFOH 3G5VB 2YUVA 1UG9A 1AGDB 2GIYA 4LFHG 4FMFA 4NDMA 4FFVD 3T0EE 4OLXH 4NQXA 4X6DF 4FABL 3DVNA 5DI8B 1MCNA 1RURL 3GMLA 1KT2B 2NW3B 3BEVA 3NFNA 1JCKA 3LZFH 3DWTA 5IF0A 5HGAB 3NCBB 1NBQA 1YEFH 3ZTNH 2NY5H 1HHKA 1XGTA 3TF7C 1J5OL 1IKFH 1LO3H 3JUYA 3NTCL 4PGEA 2JK5B 1QO3A 2PTTB 2E7HA 3CLFH 1Q94A 4Y19A 2VUOA 4UBDC 3I6LE 4X80H 1HH9A 4LSQL 4LHJB 4KTDL 3EBAA 2V5RA 4Z5RB 3BW9B 2UY6A 4WO4A 1M7DB 3LN9A 4YQXH 1U8MA 2XN9E 5BRZE 4HLZH 3TPUA 1AR1C 4YE4H 1NCWH 3CC5B 2A73B 4YGAB 4AT6B 1VADB 2XPGA 1I7RA 4HPOH 4JDZA 3WFBH 5CD3B 4QRTB 5DFWH 4UT6H 5KZCB 3SGJA 1E6OL 1G7QA 1T1XA 4WFHE 1FBIH 2ZCLL 4S0SD 5CZVH 1AXTL 5DJ2A 4LKCB 2KPNA 4NHCL 4P4KA 4KMTL 2FO4B 5HYFA 1Q38A 3QWRA 3OKKB 3Q3GB 4R4NC 1RFDL 2DM7A 1HHIB 2HAZA 4U0QB 3GMMB 5GRWA 5KTEL 5HHQB 2ADFL 3D1MC 5D1ZB 3RWIB 2AJ3B 5C09B 1FO0B 4QHKJ 3G5XB 5TF1L 4BQ8A 3TEUA 3GNMH 1JWMB 2ADGA 4YAQA 3EO0B 3T0EB 2X4SA 5B3JF 3R0MA 1HH6B 4M4PA 2MQ0A 5TDOA 3EYFB 1ZMYA 2EEAA 2GQHA 1FSKB 1JGVL 3C08H 2O5ZL 1EO7A 5AEAA 1BQSA 5DHXB 2F15A 1P4IH 4O2EA 4FQ1H 3AGVA 4PP1C 4G42B 1EEZB 1ZEAL 4OUOA 3ARFD 3O11A 4NN5B 4XCCH 5IGXL 3G08A 4I48A 2VXSH 4CMMB 3HLAB 5D6DA 1ED3B 3LN5A 1GOGA 4LASL 4OLYH 1N2RB 1REIA 3ARSA 1DVFC 2DRUA 2YZ1A 1LDPH 1KSRA 2DWDB 2J8UF 5C9JB 1YEDA 4QRQA 3P0VL 3QG6A 4NKQB 3T65A 1U6AL 5CBAB 1V7MH 3KPRE 1CGSH 4JRXE 4PRBB 1BZ7A 4P5TB 3UTSB 5HJ3B 4LMQI 1BOGA 1ZT4B 1EEZA 4O51A 4FQLH 2HTLC 3L7EA 1NGPH 4ZNCD 5JOFB 4N0RA 3KLSA 4KV5E 3GSOA 3TIEB 3HG1E 3ARTA 3QUZC 2IAMA 4Y4KD 1T1ZA 3HC0A 5HYJE 1XF2B 5IHBA 1OQOA 4TSAL 2E9JA 3TBTB 4J7RA 3MRDB 3ULVD 1MHPL 2EE9A 3SO5A 5SWQB 5E0QA 4ZXBD 1FL5A 1F4HA 2GTWA 4LL9A 3G5XA 5FO8B 4WI9A 3TCLB 1TJGH 3BO8A 2JJTA 4Y5VB 3ARWA 3DBXA 2J88L 2OR8A 4XPBL 5E2JA 4GSDL 5I8KL 5HHOE 5FCUL 3W0WA 3RZCB 3NZ8A 3U48A 3D39B 1DQMH 3QQ3B 4DGIL 2HJLB 1RZ7L 3ROOB 1A7OH 4DKAA 1F58L 1TQCB 3BP7A 3TV3H 1QFUL 1BJMA 3QEHB 1Y18A 2UZIL 3ROLB 4XPAL 1INDH 3VDAA 5B4MD 3C5ZD 3LQAH 4XMPH 2ZUSA 3FN0L 5C08D 3KYOB 3EHBD 4CKVX 2Z35B 5C07A 5CEZE 3MLZH 1OAXL 1JZ4A 1CXIA 4APQA 3IXTA 2BSSA 1U58B 4NQSA 1C12A 4XRCA 3ZTJH 2ERJB 4MNQA 5FHAH 4AY0A 5IT2L 5D1QD 5MEND 3WIIH 5D1ZC 1OAUL 1URLA 4HIJA 1JN6A 1SY6A 1MLCA 3RTQC 5KSUA 5I1IL 1UT9A 1ZHBA 1BQHA 3I9GH 4RFEA 1FRGL 3GM0A 4Y16A 2JJSC 4NNYB 2EIZB 4RNRB 3R06A 1C5BH 5K9QI 4JRXA 1CD0A 3SGKA 1S7UA 2PCPB 1T2JA 2Q86A 2WUCL 1P6AB 4F58L 5IV2A 4ZXBC 3TYFB 1A9EB 2MQCA 4O00A 4TUKL 1U3JA 4PGJA 1MI5A 2DLFL 2A83A 3WNOA 4OKDA 3BPLC 2NY5C 1DBJH 4LOUC 3BKCL 3GI8L 2XWBA 1UB6B 4P59L 5CEYB 2Q8BH 2GEEA 1CF8L 4X8JA 3DVGA 1MFAL 2H2PD 3HR5A 5FA4B 3VD5A 1HN1A 4LNRB 2EDLA 2NY7H 1DN0A 5T1LD 1YEGH 3QI9D 1NMAL 3FFCA 4U6VL 1OAZH 1UKSA 3AVEA 4U6HA 1B0RB 5F88B 4HIEA 3VFGL 3MA9H 4RMSA 1EFXB 5AUMB 1H5BC 1MAJA 4NKOB 4ZQKA 1D6EA 3GBNL 4KI5C 4XB8A 5BZDB 4G8GB 2GK2A 5CEXA 1JRHL 5EOQL 3RVVD 4PGDB 4OCWH 3ROOA 1ROWA 4FXGB 5GS0H 3EJYC 4BFGA 4AQ1B 5HYEA 5LGJA 1GRWA 5DEGB 1YN7B 1P7QB 1GVIA 3D3VD 3IGAA 3MRGA 1NC4B 4H20L 1G9EA 4MX7B 3MLZL 4ZODA 4MLSA 2OXGA 2CR6A 4S2SB 2PXYD 3X3GH 5LXGL 1RULL 4ISVA 3LKNA 3SE3C 2AK4D 4G9FD 1SEBB 2HVJA 4E41E 3VRJB 3LVEA 3N9GH 3BE1L 4WDIB 4L3EB 3BRFA 4Y19E 4BH7A 2JB5L 1B9ZA 4GQPH 2DBLH 1P7HL 1FZJB 1BD2E 5FF6A 3DO7B 2V2TA 5I73C 4M6OH 3SDXE 4U6XB 4LQ1A 1A4JB 4GUPA 1RZIA 5IESL 4J6RH 2FIKB 2D7PA 4UOW0 5FYKH 4X4ZA 4YHIB 5F3BA 2G75B 5DEZA 2W0FB 2AABH 3UEZA 1YECH 2HVJB 5L7XH 1VSCA 4I0PD 2YSSA 2VC2H 5IW1A 4Z7UA 5C9KA 2JF1A 4M8QB 1FGVL 3FO9A 3BYTA 4XVUD 4P2OD 1T66C 2VXTL 4ONFH 3RRQA 4LCCB 4RGNC 4WI7A 3QR2A 1OL0A 1QSFA 4RMQA 1X5XA 5JR1L 4HEPG 4S1DC 2YPLD 4EVNA 4PG9A 4L4TD 5MERB 5AYQA 4BH8A 4MZ2A 1NGXA 2PYEE 4B53A 3S37L 3CDCA 4QNPE 2EXYC 3O0RH 5F8RC 5CEXB 1MCQA 1CXEA 1UXSA 4OM1H 4P2QB 5DC4B 4MNGB 4TNWK 1HXYB 5KBNC 4PJXF 4NKOA 1FC2D 3ZT5A 3AREC 4QRSB 5EDXA 4H0IA 4F80A 5DMKA 1U8LA 3MLUH 3SDDA 1BIIB 1CG9B 4Z8FL 2CGRH 2EDNA 4M5YL 5GZOD 4N90E 2GCYB 1VKXB 5KVEH 2NZ9D 3O4LD 3O81A 5HXMA 5I1LB 4QXGL 4NGHL 1N0XL 3MRPA 3B2VL 2QV2A 3ARDD 3GSXB 1MLBA 2R0LL 3H0TA 4K7PH 2YA0A 5JW4M 1T1WA 2RFXB 5GSRA 1QQDB 1U3YA 2I24N 4OUUA 3VWJD 1YYLL 4M8VA 2X05A 4QRTA 2HYMA 1KV3A 1W8NA 1J1PL 4L8SC 4U2YA 3U0PA 1MI5B 1INQB 3CC5A 1XGUA 1HDMA 2IQAB 3V5HA 4XVSL 4HWUA 1R5IA 5K9JL 4P2CG 3GSNH 1RUPH 2XTJC 3MLUL 3U9UA 5TDPB 1QNZL 2DMCA 4YXLL 5DF0A 1ZGLM 2BSRA 3GUTA 2Y5EA 3X17A 5KTEH 2M8XA 2EDOA 2Z93B 2M26A 1UB5A 1R3KA 1NFDA 4JRWA 4G8GA 5H2BA 3PABB 3TT3L 2IQ9L 3FRUA 5AUMA 1NUGA 3HMXH 3LH2H 1ZSDB 3ARXA 4U7MA 5C2BH 3QIUB 2X41A 5HVHC 1JTPA 4GRLB 1AR2A 4MD0A 2R2HA 2ICWJ 3T0EC 3PL6C 1I7ZA 1ZV5A 4E0RA 4HPYL 4UT9L 4XC3H 4M1DH 3QEQA 4AG4H 4X5WB 3D18A 1KELH 1A7RL 2XWBB 4GG6E 4OLZL 1M7XA 1FFOB 4PTUB 3QG7H 3QCVL 3DIFB 5F1SA 5IEKB 1P53A 1YN6B 1AO7B 1ACZA 3MO1A 2DL9A 3L3GB 1AGBB 4OJFL 1FGNL 1YEHL 2YEZA 3CFBB 4U1MA 3RBSA 1N6UA 1JZ8A 2I26N 4JAMA 3KR3H 4QRPD 2CO6B 4OZIE 2E8YA 4WWKC 4HBCL 4ZUUB 5JXED 4LSPH 3DXAB 3FB8A 4J3TA 3LIZH 4ZAKC 2GT9A 4G7YL 2FEDD 2ICWA 1U8QB 3VD7A 2GY7B 2HVKB 3D0VA 4OF6A 1AHWA 5A2JH 2GITB 4OZGE 1XIWB 4LBEA 2CLVA 4LAJH 3TIEA 1RVFH 2IC2A 2YKLL 3EYSH 5C07B 1FNEA 4YHZL 3BYYA 4JKMA 4TTDD 3MV01 1UWGH 5IROC 3S88H 5C2UB 1SJXA 3ALPA 2BHUA 3ELAT 3AAZB 3NPSC 1L7TL 4YPGB 3VFRB 1TZGL 5HY9A 3B9KD 4PUBL 3G04A 4J8RB 1YY8A 5I1CL 4TPRH 5BCAA 4JZOA 3Q1SL 2YBRB 3P4OA 3VJ6A 2FL5A 1I9JH 1CLOH 3NZ8B 4PJGB 5FK9A 1QSEE 4HC1H 3E6HA 1OAQH 3VFGH 3RJQB 1T2QH 1ITBB 5I75C 35C8L 3S9DB 4IRJA 3EDKA 3VWKD 5A3IC 4B7LA 4F9LC 4X7CC 1WAAE 4XNMB 2VWEC 4U49A 4IDLA 2Y6SC 3LRHA 1I1AB 2P5EA 1N59B 4OCNC 4QRRE 5B22A 5D1QB 3BN9D 3OAUL 4Y5XB 5DVMA 4PJFE 4AIOA 2VQ1A 4LVHC 1S5HA 1A14H 5F7HA 4OLWL 2A1WH 5IKCA 4TUKH 4Y1AB 4JFOB 4NSKA 5GGVH 5ADPL 1FFPB 4NT6B 1E4KA 2BY3A 1A6PA 3QUKA 2DWDA 2HMID 3QIWB 4Y4HC 4X5LA 5DD3H 3HE7D 2XN9D 4JM4L 3TT1L 1INDL 4L4VD 5ECJE 3RZCC 4Y5YA 4G6JL 4U3XA 4MAYA 4CADB 2SEBB 4L8CA 1QSFE 1OLLA 5DJYB 4O5LH 4QEGA 2CIIA 1T1XB 3I2CH 1IZJA 5LGKA 2WNGA 4KKCD 4UINH 1BIHA 3ARGB 5ACMA 1OAKH 4TVPE 4J3XA 3WLWD 1NGWA 3QUML 3DHMA 4OLVH 5HVHB 4KKLC 4JCMA 3VFOA 1U8MB 3BPNB 5E8NA 4PB9H 4OZFH 5D4QA 3PQYB 2V7HB 5I6XC 1PQZB 4XNUL 5D93C 4GRMB 5JDSB 3PV6A 2P7TB 3HFMH 1Z5LA 2VAAA 4I3SL 3JVGA 1CICA 4IRJD 3NH7L 4R26H 4IHOB 4QTIH 1JPGB 1GGYA 4GG8A 2HTKC 5D72H 1XFPA 3LCYA 5DJDB 1WIOA 1CL7I 3WJLC 4ZO6A 4ZNEA 3MREA 4ODVL 2A9ML 3G6JB 4W4OC 5EU4A 1ZLUH 3INUH 5LGHH 1MH5A 4F7MB 3ZL4L 2Q8AL 3OBAA 2NNAB 1KB5L 4POUB 4XNQB 3I6KA 5L0QB 1KJ2B 5H94A 3O45A 1I9IH 1JNLH 1C08A 2I5YL 2J6EA 3QEUB 3TJEH 3ULVL 3FB5B 3V7AE 5GGUB 1T04B 3ES6A 4HCRH 1JNNL 1E4WH 1K5NB 2UUDH 5KVFL 3D87B 4X7EC 2XKUA 4GAGH 4I3RH 2ID5A 3C2AL 3L5WB 5C0GA 1M7DA 2RGSA 1LEIB 4EDWH 3REWA 1LP9E 1MUJB 2OL3B 3RAJL 1CGSL 4G8FB 4GKNA 1A9BA 4MZ3A 2O93L 1S9WB 1LD9B 3GMQB 2H32H 1DDHB 1RK1B 4IBLT 1AGFA 4XAKE 1I3GH 2VZUA 2AAVA 2WM0A 2F54B 3HZKA 4N0UB 5FGCE 1EZVY 1P7KA 2OR9L 1SYSA 4YXKL 3HG1D 1CE1L 4O02H 4PJAB 5DVNA 3PWNA 5ALBH 3VDBA 2H32B 1UGNA 1KT2A 2NW3A 4LCIH 5HYSG 3SCMD 5CFHA 1S7WA 4GRLC 3DV6A 2P5WD 2J2ZA 4XNXL 3OSKA 5E8DL 4ELKA 5IQ7H 5GQBA 1MVFA 5HDOA 3NFPA 2E9BA 3MRNA 3MRIA 1I8MA 4PP2A 5T33L 4PB0L 3N0PB 4HXAH 1BGXH 5E99H 3T2PA 4JQIH 4UAOB 3S8WA 1NCWL 3GNML 1X5LA 3BZ4A 5JHDA 3PWPB 3RY6A 3QXTA 4HC1L 4HSQA 2X4RB 1CG9A 4YC2C 1J11A 3O3EB 3ZDZF 4JJHA 2VZVA 3LQMA 4HK3J 4EN3B 3GIZH 2PR4L 5H35A 3AU1A 5TE4L 1PLGL 3FN3A 1T20A 3LKOB 5HYQB 5J9PB 3CCHB 2ZUQC 1RFDH 4MNGA 4P3CH 1TZGH 3CLFL 4O2CA 3STLA 1XGPA 2AERT 5I16B 2X7LB 3HR6A 4JFED 3NTCH 3EDDA 4NM4L 2AJVH 3QNZA 3TBVB 3NMEA 5IMMA 2ZCLH 4TQEL 5C70A 1YEFL 3IDYB 4MWFB 1LO0L 3DUSB 3BN3B 5E00B 2HRPH 3HI1B 4OF5A 3TVMD 4NUJB 1FYTA 3ZKMC 1I8IA 2DS4A 3UJJH 4QRPA 4LLAA 4OBSA 5ACLA 5EUOA 8CGTA 3FO9B 1KXVC 1I9JL 5IHUL 4YDIH 4RRPG 2UY7A 4RAUB 5D5MA 1G6VK 4LSQH 3Q1SH 4QHUA 2LU4A 4WW2A 5I1CH 5EU5A 3VG0H 2MCPL 5K59F 2F8OA 4U1SA 3VXUA 2MKWA 5F3BB 4ODXB 4HX1B 3O8XD 2D31A 5C1MB 2A6KB 4P5MB 4PJBB 3JWDL 4FP8H 2ZUVA 5J3HD 3SKNA 4LLDB 4X99A 5CHNB 2J12B 4CW1B 4XX1G 4XX1E 5D8JL 3VXOA 1PAMA 4QWWC 3FQUA 5E2VH 5D2LA 2AQ2A 4OB5L 5C0EB 2AJXH 4WJ5B 1HZHH 4HS6B 1F13A 4JFDD 5CSZB 4ZUWB 2R4SH 4LLMB 1ZT1A 1YNTB 5GGTH 3C5SA 5DS8A 1EGJH 1WEJH 5KN5A 1CFTB 4JREB 4O4YL 4ZDHA 3WFCL 1F4WL 4XGZB 2JELH 1S7XA 3WUWG 1U91B 2IPKA 2Z92B 5GGSY 1NGQL 3WLWC 2W0PA 4NNXA 4TQEH 3C6LA 1LEKB 5L6YH 4FQQA 4OTXH 5MI0C 3DVFA 5LGJB 2FHFA 3HB3D 1T5WA 2DMBA 3RWCA 3Q5TA 5FDWA 1FZMA 3VXNB 3WHXB 3O2WL 3GI9L 4XP6H 1MJUL 4S1QL 3KYAA 5HGGS 3OKNB 3BHBA 3DURB 4AJ0A 1KELL 2IH3A 4XMKL 4QRRB 1MY5A 2FBJH 2G60H 1F90L 3QFDB 5DT1H 5K9JH 4OFYA 3T0XA 2IEPA 4PJFB 2R8SL 2CQVA 3W39B 4RISH 3T3PE 4AEHL 3EYOA 3C5SB 2I60L 5I1JH 2OTUB 5HDLA 3BPCA 5C0IB 4F33A 2RQ8A 3WV0A 3ZYIA 1IGCH 1YY9C 4FFWC 3GSRB 2QSVA 4FNLL 5DHVH 1EJOH 5DFTA 5ICZB 4X8JB 1L0YA 1HILA 1DBAH 3BEWA 1P5UA 3RWDB 2HFTA 1JWUB 4WUUB 5IB2B 3FHQA 2ADIA 3HI6H 1LK2A 3G6JA 4PV9A 1KJVA 3ESVF 2PCPA 2Q86B 2A9NL 5ALCH 4TTGA 5J11B 3Q6FA 3HAEG 4MA8H 1IFHL 2YMXH 4HV8A 2VZTA 4NWTL 1JFQL 3S4SA 5GJTL 3VXSD 1ITCA 3D2UA 2FX7L 4Z0XA 1WWCA 1L7IL 2ORBL 1X4YA 3VXME 4L4TE 1I9EA 4YBLC 3PJSB 4PRHE 5F97E 4I3RL 3EYUH 1MCLA 5LKNA 4JFXB 4LCWB 1MCEA 1MHHA 3SDDD 3TA3B 5F7WC 3CFKB 1CCZA 1MRCL 4N9GA 3EZJB 1AH1A 4U6YB 1ZOXA 3SY0A 2A6DB 2EDYA 3WHXA 4JO1H 3QHTC 2MOVA 4XTRC 3QJHA 5LGHL 4HJ0D 5I18L 2EYSB 4NNPL 4PJ9C 4M48L 4FQQB 1T0MA 3V6FA 3VGEA 4MDIB 5DJAB 4ZOCA 5TDNB 4JFXA 1CLZL 2GJ6A 5DMGD 1EK3A 2HTKD 5HGBA 3JWDC 2B1AH 4P2OB 3OAYK 4KI1A 3RZWA 3EDFA 3RL1A 1IAII 1AC0A 4HFUH 3KYNA 2NY0B 4RRPA 4EQ3A 1LP9B 2X1OA 1KEMH 2W60A 4K23H 3QDJA 1MVUB 5IBTL 5IHZB 3O6FA 4UDUA 2WAHA 1KCSL 4L8BB 2X89D 1W72H 3VI3E 1I1AA 1FG9C 4M1GH 2X1QA 1DANU 4MQ7A 4BELD 1AFVH 1QSZA 5IESH 4CW1A 4LCUA 1JL8A 4NOFA 2ZUQB 3OKDB 3RWFB 3VXSE 4OF8A 3TZVD 2FYYA 1QPXA 3REVA 4UIKH 2BHZA 5TE6H 1CQKA 1UWEH 3CVHH 5GSVB 4KDVA 5DHVA 1J8HD 4ENED 4WI6A 1B0WA 4G7VL 3KLHD 1S9WA 2PW2A 4XBGB 1AI1H 3BJLA 1F3DJ 2VDKH 4PRPB 4KHXL 1MHHB 3CVHB 4XP1L 5HDQL 5AZ2H 4YNYA 2X9XA 4F2MB 4GS7B 4HLJA 3RPIA 1OAZL 4NFDA 2R1WB 5ILTH 1B4RA 4RWYL 4PRHB 1FYTB 4JRYE 3W39A 1YEJL 2CUIA 5HHVL 1NC4D 4KKAC 2V9TA 3UTPE 3HUJB 3PWPE 4O2EB 5E08L 4HUUA 4JKPL 2G5BA 3QDGD 2CK0L 3FMGL 3IXAA 4JANB 4PS4H 1J1OL 3STZA 2GKIA 3OKOB 2D2OA 1TTUA 1D6VL 2XG4A 4XVUC 1KPVA 1PEWA 1F02I 3PDGA 3DMMD 5DMIH 1TVHA 3RVXC 1YQVH 1GZPA 4PJ8D 1JTOA 2WUCH 2ICWB 1KCKA 3VXPB 5ABDE 2ZOLA 4Z7WA 2ADIB 4DW2L 5GHWL 5H35B 4P49A 2H45A 1TETL 4P9ML 2JCCA 4K3HA 2EECA 5D7SL 5CKGA 5DEFB 2EDJA 4UV7L 4OD1L 2LAGB 4GS7C 3T04D 2BRRL 5F6HJ 4H1LG 5DS8B 1PZUB 3HRPA 3MJ8B 4S1RH 1CS6A 3X13B 3B9KC 1I1AC 2J8OA 1EHAA 1LQSR 4HIIA 2DJSA 5HGDA 4O2FB 2DLFH 3P0GB 4WIQA 1J8HE 3CDYA 3D39E 3QHZL 3VXUD 3NCEB 4ODUA 1S7WB 2IANE 4E0RB 2IH3B 2K7QA 3O8XC 3V4UH 1NMCC 4KJQD 4IMKC 5FUOH 3FQTB 4HUKB 4PJBE 5I18H 1FZMB 3VE0A 3VXNA 4M43H 2BVQB 4MAYB 2HFGL 1QG3A 2AKRB 1QFWI 4D0BA 4WTWA 4PV8B 2IPUG 2MTPA 2WQ8A 3V5KA 1Q94B 3IKCB 4LLVB 4OFIA 1TTFA 5FCUH 4UB0L 2LV4A 1S7VB 2XRAL 3KPLA 1J05B 4XXCC 2VKXA 3HI1A 2X89A 1V3LA 4PJGF 4JPIB 5IW6B 3OJDB 4OFKA 1CGYA 1FGNH 4BQ6A 3QH3B 4HZAA 3DI3B 2C3WA 2QADC 5CSZA 3DSNA 3FN0H 5F9WB 2EKSB 2HT2D 4Z18A 3GO1L 2APWA 4OLZH 1AP2B 3QXDB 4LPCA 4PG2A 3C09B 5EZJA 4HZLB 2L7JA 4LPVA 3SO3C 4HG4J 2PXYC 2DI8A 1YC8A 1IKNC 1OSPH 3G5VA 5DT1L 3MREB 4K94L 3AS3A 3BP5B 3F58L 3SDDB 3TIDB 4Q6IC 5T3ZD 5F7EH 1TJGL 2C4FT 2VLRA 2VDQL 5JHDB 1A3LH 4HKBB 5JLZA 1BOYA 2EDHA 3KAAA 1DEEB 1A6UH 4HWNA 3QHFL 5BRZD 5D5MB 3V6OC 4NO0B 3T2NH 5B21A 1YPZB 5DD0L 5IB3B 1ADQA 5AZEH 3S35H 1I1RA 3MRJB 1QRND 1EJOL 2P5ED 1BHGA 3U1SL 5TE7L 1MCKA 3T8XA 4DJMA 1NGQH 3N1PC 3MNVA 3PGCA 1FNEB 2E8ZA 1AGEB 3OXRA 1DBML 3WJJC 4BQ9A 4F7PB 4ZUSA 5L2KB 2H3NB 5J1AB 5D1QC 4J2XA 2IANB 4J3WA 4QGTA 3QNZB 1ZHLB 1F90H 3O3BA 3U6RA 2DTML 3S5LG 3F6LA 4DVRL 4JM2D 1MY7A 4F7TB 3MLVH 3SE9H 1LD9A 5KVEL 5B38A 2HT3D 4R96B 2CGRL 4TN9A 2X10A 5EZLA 5IB5A 4X6CF 32C2A 1T1YB 2P1YA 3T0VA 1U36A 3UYPA 1C5CH 5INDA 4TNWF 3C6LC 3FB6B 1KLFA 1M7IA 1JGVH 4IRSA 3VG0L 1EGJL 4CU7A 4E41B 3QPXH 1PJ9A 4K71C 4PTUA 4L3EA 1U93A 3RTQD 2WMPA 1MHCB 4FQIL 4FQJL 3C87A 3PIQA 3QH3A 3CNKA 3ARFB 5I8CA 3HCVB 4LU5H 3I6KB 5JR1H 1BD2B 2WWKT 4TRPH 3KXFA 1Y6MR 3E2HC 1YC7A 2X9WA 4M02A 3FQRB 5F1IB 5INCA 4FP8L 4PRAB 1SYSB 4X9BA 2UWEF 3OR6A 5JHLL 2VQTA 1BFOB 3LS4H 3OAZH 3KXFD 1A6ZB 4LSVH 3V52L 2FL5B 4POZD 3GZKA 4FXGA 4P2YA 4GRMA 4DKEH 1PQZA 5F70A 3NIDF 4LSRH 2XWTB 4ODWB 5E8NB 1LE9B 2V2XB 3RWGA 5J89A 1UKQA 5C0BE 4YFLF 3L3HA 1IC1A 1F4WH 5HYJD 2WK2A 3MBEA 1RURH 5JUEL 1LGVA 5F96H 1K5NA 3MR9A 2HRPL 3MLTB 1W2KT 2FD6H 5DQ9A 4M7LL 5T1KA 3SDAA 1Q9LA 1U8JB 3K4DA 1FNHA 1EBAA 4NQDE 1KJ3H 1KJ2A 2KH2B 5D1XB 4FQ2L 5H94B 4WO4D 1R0AL 4I4WA 4MCYB 4KJWC 3FO0L 4LSVL 3RU8H 3SKOA 1H3PH 1KFAH 3BWAA 1JYVA 2FSEA 4JM2F 1JYNA 3VW3L 4C55A 3U2SB 2DM2A 4JY5H 3MZTA 2W9EL 2Z4QA 4I5BA 3KPNA 5EBWB 4DOHE 3H3PL 1NAKH 1ZVHA 1CE1H 1NAMB 1UZ8B 4UILL 3EOTL 3SE9L 5FGSA 5D7LD 5C0DA 3V7MA 1SHMA 3RY6C 2FNBA 3MO1B 1C16A 1T7WA 3X12B 1GIGH 3C6SA 5DMGC 3OGCA 5BRZA 2HH0H 3MUY1 4M7JL 3V0WL 5D6CB 4X5WA 5E8DH 3CH1B 1NANI 3KPOA 1FV1A 2A6IA 3QEGL 4ZUVB 1A2YB 1AJ7H 2XWTA 5EG6C 3CMOH 2APTA 4HCRL 5J12C 4GRLA 4LARL 3U4EB 3VD3A 3QIUA 1I8KA 2C5DC 4XMLH 1FYHB 4PGBA 4P4RB 4AM0A 3DX6B 3T2OA 1F2QA 3M1BB 4X6DE 2KKQA 4QXTB 2FX8H 1F42A 3LPWA 3F58H 1V3MA 5DFVD 2Z93A 4BQCA 2JIXD 2WLZA 1X5KA 5J56B 4LCUB 1MCWW 4MA1C 2YA1A 1U8HA 1ONQA 1S9VB 2J4WL 4MJIB 4GMSL 2C26A 2UZXB 4KFZC 3H7BB 5D7JB 1NQBA 1R24A 2IQAA 3JTSB 4K7FB 3GB7B 2P5EB 1OAUH 4QO1A 1PG7H 4OUUB 2RFXA 4LCCC 3RNKB 5F72S 3KVQA 5DD6B 4GT7A 3QAZB 5SWZD 2OMBA 2AEPH 1YMMD 2HKFH 1PX4A 5F6IB 2CXGA 3FFCD 2VMFA 3LSOB 4OKVB 1OD7A 4XWGH 4RAHA 2W59A 4K8RH 1U41A 1YN7A 1CXFA 5DEGA 4D9LL 3OB0K 2EDEA 3IDXH 5LQBL 3G5YA 5L88L 1JMZA 5C6TH 3WXVL 4MAUL 3F12A 4IOIA 4R6UA 1A1NB 5DD3L 1DQML 2YK1L 1NGXB 2J8HA 2QADB 1A7QL 1MPAL 2ICEB 4F7PA 4U6HB 2Z0BA 4HK3N 3HLAA 2GAZA 3T0ED 4NRXA 1P4BH 2O5YH 2HKFL 3MLSH 4HS3B 1CK0L 1SJVA 1X5GA 2ADJB 3ARGD 4OD2B 4XPHL 2Y1VA 1F00I 5HYJA 1I7UB 2UV3A 4HHAA 1UZ6E 2JJUA 4IJ3C 1RUQH 3EYFA 1RPQA 1KB5H 2M2DA 1J7VR 3L6FB 4Y4HD 1EHXA 2W0FA 4KRLB 1YNKH 4RGNE 4APQD 3ETBF 3OB0H 1BVLA 5DD5H 2FH6A 2VN4A 5D72L 3E1F1 2NY1D 3V4UL 5TFSL 3STBA 3MGOB 3DX8A 4NNYA 4MXWH 4GKSA 1JHKH 2OQJA 3KGRA 4JFYA 4JB9L 3RWDA 4OCSL 3A6OA 2FX8L 1BQLH 1PD6A 3GMMA 3LD8C 3MBED 4L29B 4ZYKA 4QRUB 4XCEB 1U3HD 1N5AA 3GSXA 2YPKB 1OLZA 2DQDH 4MB3A 3HZMB 4U1HB 2R2HB 3NBNA 3SQOL 1J05A 1X44A 5CJXC 4HJ0C 3U4AA 1MIEH 4XP4H 1NCAH 4R3SA 1FSKC 3IDIB 1YNLL 4P3WA 3ARED 3QNXB 3OKNA 4K3GA 4YBQC 4JG1L 2QKIA 3KPMB 1DQDL 3NIGF 4GAJL 4LEXH 3VH8B 1G1YA 4C56B 3VXTA 3MV7B 1LE9A 1Y18B 3RWCB 5BOZG 2EXYD 1T7ZA 1PZ5A 2EC9T 2FJGB 5JORA 1JTTA 4QTHA 3I6GA 3ULUL 4JLRA 4YIQA 5ESAB 4PUBH 4UILH 1V3JA 3T4YB 4OZFB 4F7EA 1NAKL 3P73B 4KK6C 5FHBH 4D8PB 1OB1B 1KN2H 5BVJB 1CGXA 3N06B 1KYOJ 4F57L 3GMNA 1NL0H 2EYRB 2ZJSH 3LQZB 3VW3H 1BFVL 3C2SA 3CDGA 1U95A 2P8LA 4RWYH 4PJBF 1U2CA 4M7JH 4R4ND 4AL8L 3EZ8A 3SDCD 5E8PB 4I0PC 1KB9J 1KLGA 4X9GA 5T3XH 5I8CB 3WNLA 4HFUL 5HGHB 2NLJB 2BVPA 3QI9B 3BPOC 3WFEL 5CEYA 2D4DA 1PY4A 4EIGB 2BCKA 5DMKB 1AO7D 3MJ6A 5JUEH 3EOTH 3UO1H 3VI4E 5DJZB 3L3DA 5DK0B 5I1GL 5E7BA 3NABH 4Z78A 4IIQA 2IJ0C 2CKBL 2P8MA 5GRJH 5CBAA 5IMLA 4ZAKA 5FYLL 5C0BB 4LSRL 5SWZE 4JO1L 1XT5A 2CKNA 5C92A 3BZEB 4WWKA 1IEAB 4GQ9L 4XCFL 2LVCA 2AGJL 4N8CH 5A40E 1BD2D 1LO2H 5DFVC 4CNIA 1NCDH 1VGEH 1WCBA 4UBDD 5DUML 1T0NA 3WFZA 4NHUB 4CMMA 5JHLH 2VYRE 2ZSWA 4XBPA 5ACZB 2AJSL 3TZVB 1V7NL 4JQVC 1G9MH 1MQKH 3EYUL 2XZCH 1RUPL 4YHKH 1JPTL 2F8VA 3HNTH 5DR5L 3HNSL 4JM2B 1MFEH 5ICXB 5MEQA 4KWUA 4JHWH 1IZKA 1RY7B 1J9CT 1DBBL 5GISH 4L1HA 2JIXA 4ONHA 5GJTH 3F7QA 2H26A 5I16A 5GS2H 4RGMB 1MSPA 2XZAL 3T0EA 1UWXH 2BSTB 3AM8A 5TH2B 2E6PA 4PJ7A 4LOUD 5CAYB 15C8L 4JGMA 3IJHB 1A7BA 4RX4D 4EN3A 4CN6A 4FMKA 5DJ8B 3VWJB 2XTJD 2E7CA 3C5ZB 1DEEA 5C08B 3HI6L 3CFEA 2VLME 4HIEB 3QISA 2BFVL 1DVFB 1T5XA 4JFEE 4L8BA 5E2TL 1DN0B 1YDPA 5K9OA 3LMJL 3VRJA 4NJAL 2ZUXA 3KDMB 4OF0A 3QG7L 1YEIH 2RHEA 12E8H 3S37H 1YYLH 1P84K 4JGUA 5F9WC 4GW5B 5JPNA 4HH9A 5BJTB 2ZCKH 1MCHA 4G6MH 1CGUA 2FBJL 2G60L 3MJGX 3K7UA 4O51B 1WGOA 1QLRA 1G0XA 3ARDB 4PRIB 5F7NC 3MOBL 1MELA 1OT1A 4NZUH 4JKKA 5DD0H 3V95A 4PY7A 2NMSA 1QO3B 2FLRT 4M7ZB 2N1KA 4NM8H 5DA0B 5L6YL 2OL3A 1MREH 3HS0B 3SPVB 4NQEB 2BVQA 2NY6D 1MCRA 2DQHH 1TDQA 1LO4H 3I85A 5LJYH 4WU5B 5F9OH 5DHYB 3C09C 3G5ZA 1T04A 4OQTA 1H3GA 3ZE2F 2P47B 3UAJC 4K07A 5D6CA 2XQYG 3LN4B 2UWEE 1MJUH 3BP4A 2YRZA 3ZKNC 5KVDL 3HN3A 2B5IC 3SGDH 2VZ3A 3X13A 4F7MA 1S3KH 3F7PC 2EIEA 1WBZA 3CX2A 5J57B 3BUYA 4HUNB 5IBLC 1CU4H 4V1DB 4H20H 4J6RL 5KOMC 1JNJA 4RNRA 1FAIH 3PGDA 4OI9A 3ZYJA 2CH8A 2J6EL 1CFNB 4G43A 3WIFB 4UB0H 1OSPL 2VIRB 2GFBA 5IFAH 3O4OC 5CP7A 1KCUH 1S7RB 2VXUL 1FLTX 4HIJB 5EOQH 5GGTL 1KNOB 1ZTXL 2R2EB 4Y16D 3SJVA 1ES0B 5IW3A 3TBTA 4DZ8A 3BQUD 2CMRH 1DBBH 4JRYB 3QUZD 3S36L 3VFOB 4N0FA 1K9TA 4LHUA 1JVKA 3SEPA 4J23A 3UTTE 4D9RD 2VXTH 1MCIA 4JDZB 1NFIB 4H1LA 3TJHD 3FFDB 4XCNB 1NCCL 3VWKB 2NZIA 2VXVL 1NJ9B 3IDUA 2F74B 4LLQB 2PUQT 5DJXA 1KN2L 3LKPA 1EFXD 1MJJB 3P2TA 5BVPH 4JRYA 2BNQA 5DUMH 3QDGB 4QOKE 3T77A 3ZMRA 5F9JB 2SEBA 2AXHA 5T5NF 4W6XB 2MCPH 3NOIA 4Q9CA 3BGMB 3UZVB 2IWGA 1U3HA 4YDLC 1IM3A 2CKBH 2VITA 4TTDC 5GISL 3OJ2C 5KS9F 1EEYA 4P9MH 1A6AA 1A7NL 4YR6A 3HNSH 4FA8A 3TCLA 4GAYB 1SJHB 3PHOB 4U6VH 5EN2B 5HGAA 3TBSA 2AW2A 1CLCA 3JV0A 3GMLB 1V7NH 2AV7B 2XA8H 1J8HB 1Y6KR 5T3XL 1XF2A 4ZOBA 4R97B 1J1OH 4WGVB 2VUYA 1BZ9B 5IB1A 2YOCA 3ISWA 5J7CC 1GGCL 4X99B 5CHNA 5KS9E 3MV7E 1F6FB 3G5ZB 5DTFB 4YUEL 1CD9B 4U3HA 4ZO9A 4HWEL 4CGTA 1YEJH 4YR6B 4UOJA 3G6AA 4CVXB 5GRJL 2NY4C 1B3JA 2J5LB 4KKNA 5D7SH 5CKAA 3HPJA 1U3HB 2NY6C 5GHWH 1AXSB 2EYSA 3G04B 3PHQB 5T1KD 2AV1B 3B6SB 1SBSH 1PVHA 3GHEH 3O9WB 2LAAA 3IFPA 1TVDA 2FATL 3ET9F 3B2UC 5DO2C 3O3BB 2ZPKH 3QDMA 4LRNL 4NQDD 4TULH 1XCTA 3G6JF 1EH9A 5JPMB 4L9LC 2YD7A 3T3ME 2GK0B 2VTFA 2P5WA 3UBXB 3ILQD 5DLMH 3TBVA 1I7TB 4F3FA 4LBEB 2EE2A 3FQXB 2P4AB 2Q8BL 4MD4A 3BW9A 4ZUTB 4OSUH 3TJEL 2UVEA 4BK5A 1XF5B 3WFDL 4TVPD 4HGKC 3O9WA 4LIQH 5J9PA 5IG7A 3QPQD 1YMHB 5JZ7C 1QFUH 1H5BB 4ODVH 5JHDE 1DQDH 5CGYD 4X6EA 3JV4B 2BY0A 3AS1A 3GK8L 1Q0XH 4PJHE 3S5LA 2W07A 1AGBA 2FO4A 1D9KA 1BWMA 2X4QB 1FORL 1LO5B 3GSUA 1HSAB 2AEQL 1KCSH 4OLYL 4XNUH 1QTYT 3VWKC 5IBTH 4E5XB 5L2KE 3D2UD 4NOBA 2AJZA 1PY9A 1JK8A 3MJ9A 3VGHA 2FEEI 4OLVL 4WGWB 3R4DA 1C8PA 1PEZA 4QXUL 3V4PL 1R5WB 3FN9A 4WUUD 4UINL 3WIHA 5ISZA 3B5HA 3TN0A 2NXZC 3CDGB 2IAMC 1X5YA 3LQZA 5C0JA 3MRRB 4PJHA 1YYML 3MRCB 1W0VB 4LHUD 4NQEA 1QACA 3UTSD 2I9TB 3NZHH 4WHYH 4R7NA 3ZE0F 3IAQA 1LDSA 2NYYC 3X11B 3IJSA 1JGEB 1MRCH 5DK3A 3REWB 3MPCA 3QXAB 4HT1H 4K2UL 5ANME 1QA9A 3VH8A 3MXWH 4Z78B 4ONGH 2F74A 4LLQA 5DJXB 2BXZA 3RX7A 1A1OB 3EDJA 3FFDA 4R3SB 1FL6A 5MEPA 5D6DC 1CD1B 3OAUH 1NUNB 4XGZA 1MHPH 5DGRA 3OB8A 4MQSB 1S9KC 1PSKH 4Y8DC 3QULB 2P46B 1IGCL 2QQLH 3MLRL 5J12B 1JZ6A 3QUXB 4OFYD 5GZNC 2IG2H 2QHRL 3MQIA 4FQLL 5F89B 3VXRD 3VI3F 3EKCA 5BS0D 2DQCL 3SDYL 2IGFL 4NIKB 2R9HD 3CXDH 1FNAA 2R2BA 4Q9BA 1LNUA 3GI9H 3QJFB 1G84A 3EYQC 1S7SB 3HI5L 1PKQA 2BVYA 2DF3A 2FJHA 1KCRH 3HNVL 5IEHA 3SKMA 1FDLL 3LHPL 4YHNB 4XCCL 2C1PA 4P4KC 2G5BB 5EC2B 1NGWB 5JNYB 4LF3B 3DYOA 3TO4D 1EDQA 4M7LH 4CMHC 2I60H 4LAQH 4JJ5B 3QDMB 3VGDA 3SGJC 3T3PF 1OAQL 5B8CC 3TC9A 4G3YL 2NW2B 3WBDA 1BMGA 5DJYA 3DUSA 4UIMB 2BJMH 5HPMA 1WCBB 4UU9B 3U30C 1GC1H 3VGAC 5EFIA 1X4XA 1SQ2N 2X4TB 4G7YH 5E4EB 2X6MA 1S9YA 4PRNB 2H6PA 3VD4A 5E2VL 1WCQA 4PJ5E 2B2XH 5CLWA 3IS1X 4F15B 1RZIB 1JI1A 5BVPL 3LS4L 1FLRH 4P46A 4UTAL 4KQ4H 3ARDA 2ESVB 4KROB 2W9EH 3N50A 4PJCA 3AUVA 1K4CB 2NY1C 1UJ3C 4OZHE 2YRLA 3I3DA 5CSGA 1A3QA 3MXVH 4YH6A 1ULVA 2V2WA 1CDGA 5I8OL 3QCTH 3QXUA 1SEBA 4JE4B 3SDAC 1AIFA 3VXQB 1CXLA 1KEGL 1KLGB 3RKDD 1DE4A 2DYPB 1N6QL 1K4DA 4ZFGL 3DMMC 4RMTA 4FQIH 3W5MA 3MUJA 3N1QC 3MBEC 1MHEA 5C0CB 5CGTA 3P9MB 1QBLL 2G9HA 3KHOA 3LEYL 2VLJD 4WEMB 2WIIB 5GS1A 1YY9D 2HJFB 1J18A 1IM3B 2CRZA 2NY3C 2XZQH 1XCQB 5I15L 1KULA 1G9NL 3T4YA 1ONQB 3EOAB 5TDNA 5KSAC 2Q7NA 1RIHH 4CJ1A 2HKHH 3HE6A 1T0MB 4UDTA 1LE5A 2VDOL 4C83B 4DAGH 1HYSD 1ZLSH 2DQFA 4QXTA 3CSGA 3OKLA 4JQXA 3O6LL 1UJ3B 4XH2B 1ZVSB 1BBJA 2Z9TA 3UAJD 3IJYB 1KCLA 4YDIL 4HMDA 4A6YL 5DRNB 2Y9RT 1NFIA 3GSNL 3QFJD 4LVOB 1JUFB 4M61B 5DO2D 1HHHA 2QHRH 1QPPA 2GI7A 4DN4L 3ORJA 1QR4A 3A67H 5CD5D 4PB0H 4WI5A 5CBEB 3SJVB 1WC7A 4XCEA 1TPXC 3B2VH 2GT9B 2IQ9H 4J4PD 1KACB 1P1ZA 3H9SD 4OM0L 1C16B 4Z7VA 5EWIH 3DROB 5T1DH 1RV6X 2OI9B 4R0LC 1PLGH 5ETUA 2UYLA 3GBLA 1F4AA 4U1MB 3WL9B 5E4EC 4A2MA 4Y16B 2LVEA 4XNYH 3LPFA 3IAPA 3KPNB 4DGYH 5KSUB 1QKZH 1T4KA 4JVUA 1MLCB 4EBQH 4WUUA 3HZYB 4OCXH 4QNPF 1WC7B 3LN4A 4U7KA 4PGBB 4XTRD 1QVOB 5FKAA 1QEWA 4NQED 5I75B 2P7TA 3AMKA 4XRCB 2FB4H 3OAZK 1GGBL 3WJJA 1CVRA 4LSTL 4CDHA 3FTGB 4AENA 1SM3H 4EUPH 1Z0NA 4M1CD 2EYRA 3KYOA 5GGRY 1MFDH 2X1XR 4ONGL 3HRZB 1F3JB 1RJCA 5HD8D 4I2XA 1DLHA 5D2NE 5I76A 2V2XA 3RWGB 4PY7B 4OQTL 1D9KD 3F12B 1H3WM 4IOIB 4XP5H 1U8KB 3HE6B 2AXFB 4YHOH 2BRQA 3OKMB 4PJFF 4K7PY 3T4AB 2N4IA 1D5MB 5F7LB 2F8XC 4M6OL 4PJDB 4Z7NE 3NZHL 1OM3L 5FUOL 4L4VE 1KJMA 1Q0YL 4G5ZH 2OM5A 5CJQH 2AP2A 3DRQB 3QNXA 5MP6H 1FL5B 2X5PA 4TVSa 2C1OA 2PTUA 2CKBB 3MSPA 3BGAA 4TUJA 4GLRI 4I4WB 2VO5A 1UCBH 2XTJB 5E9DB 5I71C 3PIQB 2OK0L 2DOCA 3GSOB 2QLVB 3BIAX 1Q9LB 3EUUA 2DLHA 2AJUH 5DC9B 3FQUB 4L4VA 1U8HB 2FCBA 2DM3A 1IGML 1CE6B 2KDGA 1FNSH 3EDEA 4ZS7L 4HWBH 3L3KA 3T1FA 3DX8B 4PR5B 3VWJA 5I1GH 4RMUA 3S37X 3KPPB 1RAMA 4KVCH 4BSWB 3EFFA 4AMKH 4NUGH 1K3IA 4PFEA 1N2RA 2HFFA 3TH2T 2CLRA 3O8XA 5E95B 3V6BR 4OV5B 3BGFB 5HHOB 2J7LA 4UIMA 2R15A 3OQ3B 4Z95H 3VFTB 3LRSA 4WNQB 1JP5A 4MHHG 1FFNB 5CMAB 4H0HB 1A2YA 5F7DB 1ZANL 2IBGA 2IPUK 1GL4B 1ORSA 1U92B 2XYCA 5CLTA 1NEZB 3SDXF 3RUGB 5J1TC 5IR1B 4Z7UB 1N4XH 3OXRB 3C6SB 3QT2A 4Y5XC 4BA8A 3ARYA 3GDBA 4WU7B 2V7NA 4PGCA 1F4YL 2X4SB 4HIHA 3OHXA 5I30H 4X4XB 3SBWA 2VDKL 4QT5B 2X4UB 4NO0A 2VE6A 4RDQG 3PHSA 3CVHL 4QWWD 3CZFB 4GBXA 3U2SA 4JFDA 3B3IA 2VL5B 4PBXA 3SKOB 3UYRL 5GGVL 5HHNA 3MA7B 5C07D 4ODBD 3EJZC 4OLWH 1D6VH 4ISVB 5C0BD 1T0PB 4M7KH 5EOTA 5E8PA 5I74B 2DQUH 1WLHA 4PTTB 4WHTA 3RIFK 4JKPH 2VZ1A 3UTQB 2MQ3A 1AQKL 3NFPB 2WSKA 4PRPD 3UTOA 3EOBA 3N1MC 1A1OA 1BJ1H 2OJZL 4K3DL 3NCYS 4NZJA 3MUGA 2DICA 4ZTOL 4GLRH 4UT7L 1OPGL 1ZANH 3RGVB 2CDGB 1T2QL 5FB8A 1KJ2L 5BOPA 3M8OL 4ODWA 5EIQA 3FONB 4G80A 4OFDA 4YHYB 4Z76B 1JGEA 2R56L 1Q72L 2CIKA 3V5KB 2DQJH 1FNGA 5C3TA 4XNZB 1J0HA 4ZQKB 1RZFL 2JB6B 2I9TA 3PWLA 3PABA 1Z6JT 1T7YA 8FABB 5D7LE 4P23C 5JXAH 1UB5B 5C0RH 1UM6H 2R0WH 1OWWA 2QHLA 1LEIA 4NZRL 2FLBT 1VESA 3HR5B 5FA4A 3VFUA 1H15A 1OW0C 3FQNA 3CH1A 3KPOB 3NA9L 1FE8H 4NO5A 2V9RA 4HJGB 5HDQH 5FO7A 4KUCD 3V9FA 4JRYD 2HLFC 3QZWB 2K1MA 4UQ2A 1AGDA 2DKUA 5I9QB 1VEPA 2KZ1B 1I4FA 1NLDH 4MYWB 4NO2A 5F7UA 5SX4H 3G6DL 1XH3A 5DUPH 5GGQH 2FGWL 4JY4A 4P46D 4DQOL 5JW3L 3QWOA 3PGFL 3KPQB 4JFZL 5E6ZA 2XNAA 5F7KC 5BO1L 1TQBB 1TJIH 4X7DC 2A0LD 2PO6D 4ZXBB 4XP5L 2DAVA 1TVBA 4JZNB 2VAAB 5B38G 5KJRH 1UCBL 5IGXH 4PRDB 3GSNA 1KOAA 4HUUB 1P84J 4JGJA 3RHWK 2GAZB 2PO6A 1VEOA 4EI5A 2Q6WA 1QBMH 4ODUB 5J6GA 2PF6A 3GSWA 1XCTB 3BDBA 4RGOL 5CJBA 3BXNB 4MJ6B 1ORSB 1U92A 3HC4L 3ARRA 4Z7VF 4CDGC 1XGRB 1HI6B 5E9DD 5F9DC 5GGSB 5IM7B 4IS6B 4KC3B 5AD0B 3MGTA 1FIGL 1IGTA 4KHTH 3P3YA 4UMGA 4V1DE 1HSBB 2YMXL 2MFNA 3WXWH 3TT3H 3G5YB 1FVEB 4ODSH 3U36A 3LMJH 1QKZL 3MRFA 4XMLL 1NEZG 3ZE1E 4LARH 4H5SB 3RX8A 5GSVA 4U31A 3QUKB 2OXHA 1RZ8A 3MCG1 6CGTA 4M3JA 1MAMH 5TF0A 4KTYA 4YHMH 4E9LA 1S7TB 1DUZA 2O61B 4G6ML 1IQWH 4GRWE 1GZPB 2FZ3A 2X4NA 4U05A 2L0DA 3K1DA 2IAMB 4MNQD 2FX9L 4X5XB 4I2XE 3JTSA 4Z7NF 1T89A 3QUYA 2W60B 5E5MA 2VXQH 2WINB 12E8L 3OJDA 4FQXA 2Y7QB 1LEGA 5DR5H 3BRDA 3FB6A 4WFFD 5HGBB 5FA3B 1J86A 1DUZB 2DLIA 4OGAD 1S7TA 3IB4A 4MX7A 1K3ZA 4LLVA 4DUXA 1YEDB 3X14B 1FAKT 4PJHF 1DFBL 3PL6D 3VFTA 2F53E 4J3SA 3RHWF 2AEIT 1YECL 3HAEH 4Y2DB 1WF5A 2F5AL 4KMTH 5CEZD 5IIEB 3GJFH 4WFGD 3IYLW 2VJXA 4MB5A 1KJ3L 4IM8A 3ZHKA 2AK4A 1CFQB 5IM7A 1BM3L 3IDMA 5E9DE 4U4BA 2XZQL 1PFCA 1NANH 3OKDA 3RWFA 1ZHLA 1C7SA 2XQYK 2FD6L 1CE6A 3ZDZE 1CN4A 4HJJH 3T0AA 1FFQA 1P4LB 2BNRE 2ENSA 2WW8A 1KXTB 4QLRA 2Q6WB 4QGYA 3X12A 5BXFB 3TNNB 4ALAL 3TBWB 4PY8I 3FFCE 5HYSA 4G9FB 2AJSH 4JO3L 2ADGB 5BS0E 2VC2L 1JWMA 4XP6L 3O6LH 3JSSA 5ITBL 2OL3H 5C09A 1BLNB 4NRYA 5FUCE 4U0RC 3UJIH 2BNRA 4PJ8B 3HC3L 5JLZB 2C4XA 4MJ4A 1VACB 3SE4A 5C0FB 5HHQA 2EZ0C 4Z7WB 3TYFA 1A0QL 5A3ID 1EMTL 4TSCL 1DL7H 5IQ9B 1FLRL 2Z91B 4WW2C 1UEYA 3D85B 4HXBH 1G0DA 3NABL 4DK6A 4JG0H 3IVKA 3S34L 3DX7B 3D9AL 3UC0H 2XY2A 4XZUB 3BP4B 1H3TA 4MVBC 3WO4C 3ARGC 4EKXA 3IDNA 3IXAB 4JANA 2ATPA 3WLBB 2B8OT 3VMPA 4IMLB 1HZHL 3ARBD 4FTVB 1FFRA 1P1ZB 4QHMB 1R5VB 4AZ8A 3BAEH 4GXVL 5JW4R 1MFCL 1U8IA 5EUKA 1OGTA 1ZHKB 4X7SL 4YWGH 1S7QB 5DSCB 2XY1A 5EORH 3VFUB 1MIML 4L8DA 5DWUL 2JJWA 1F2XK 2AJYH 2NY7L 4NJ9H 4DUVA 5C6WH 5F9AC 2DTSA 5DDHB 4KK8C 2VSDA 3IETA 4I77H 4QHMA 1HHGA 1CF8H 1H0DA 4WEUD 1BQUA 1WFTA 5AYUH 3DNKA 1BECA 3BKCH 3GI8H 3CH8A 2XXCB 4X4YA 1ZVSA 5DHVB 4PRIA 2R23A 1FPTL 2ZOKB 1UVQA 3WNPA 4DCQA 3AS2A 4G8EA 4X7TA 5JIHA 3C60B 3GBML 4H0GA 3RWEB 3WSQL 1ND0B 1EA9C 1Q9WA 3UP1A 5IBUG 1M05B 2QQKH 4POYA 3M17B 5FECA 5MHSE 1QFPA 5EA0L 3W0WB 4PJ8A 4AEIL 3BH8B 4PJ5A 5E99L 1HHJB 4KI5F 5EB9A 1XGUB 1HILB 1RUQL 3V79C 5SWQA 3WIIL 2A38A 4JFHD 2R4RL 5BS0B 1GZQB 3ULSB 3TBWA 2GW5A 2FHCA 4NN7B 1ZGLA 3RNQA 4C4KO 1RZJH 3O2VH 1ZLUK 3U82B 4Q6IB 5TE4H 1S5IH 1VKXA 4OCSH 4OZ4B 3MROA 3NAAH 2B4CC 4R9HA 3OXSA 4P5MA 1VCAA 2F5BL 3GSVB 4M6AA 4GKOA 4F7TA 3D48R 4QRSA 5CCKH 1D5IH 4PJCE 4PRBA 3ZKXB 1S8DA 3SOBH 1EV2E 3O4LA 4ZSOB 3RI5K 2FH8A 3ZKXC 1OTTC 5GRVK 1IILE 1X9QA 3T2QA 5LQBH 2BNUA<