4ZPVB

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTIICRASQDINNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGSDYSLTISNLEQEDIATYFCQQANTLPPTFGAGTKLELRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
total genus 45
structure length 212
sequence length 212
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zpvB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zpvB01
3K1KC 4I8DA 4P5TB 5IHBA 4KUZH 2JK5B 1GGIH 2VLJA 4MHHI 1KT2A 4PJHE 4PJ5E 2B39A 4JREC 4BA8A 1NEZG 2YBRB 5E6IB 3MRCB 3CFDA 1YEHL 4J4PC 1FAKT 2Y5TB 4BQ9A 5IFAH 3HNTL 2YD3A 2D31A 4JLRA 3DNKA 4RGNB 1A8JH 3OQ3B 2WWKO 3BEWB 4Y4KA 5D93C 1AFVH 3QG7L 4DGYL 4R4BB 1G9NL 4RFEB 3LQZA 2FJGA 3ULUC 1UWGL 4G9FA 1DUYA 2Q7YB 1L7TL 3WEXA 1LEKB 1RFDH 3U0WL 5C0NC 1G7LB 3QH3A 1JYVA 2X1PA 1G9NH 1RVFL 2YXMA 3O4LD 4OZGA 4TYUA 1KXQE 3O4OB 3KJ6L 1L7TH 2DYPA 5BJTB 3QDGB 1RVFH 2OR9H 2AQ1A 4Z7NE 3BGAA 4NQCE 1KNOB 3ZT6A 4DWHA 2HG5A 2KL6A 2GEEA 4QT5B 3VFVB 4D0BB 4HWEH 1TVHA 3RWGA 1WV7T 5GZOC 3CX5J 2BCKA 5DJ0A 3QFDA 2FJFB 1DVFD 3V52L 3RNKB 1TENA 1J8HA 1I8MB 1HQRA 3RVTC 3CK0L 4ZYKB 3V52H 4JZNB 1IEBB 3PABB 3SDCD 4J6RL 4UU9A 4WNQB 3TBTA 3FCTA 1XIWA 5FV2A 3KPRA 3QUMB 3DBXA 2P5EA 4EOWH 4HK0A 2D9CA 1FNFA 2A77L 2AEIT 4KRLB 4XGZB 1EFQA 3PWJA 4WU7A 1AR2A 5JQ6L 1A9BB 3GM0A 4M4PA 4YH6A 1YNLH 3ZL4L 4OFYD 1XGPA 2A77H 3PWLA 1FO0A 3PGFH 3MLTA 3OKKA 5DRWA 3VRIA 4HULB 1R3IL 2XICA 2O5ZL 4LMQI 4XT1C 1G6RH 2E3VA 1YMHB 1CR9L 5B8CC 4HCRH 3V6FB 1R3IH 3O2DL 2C3HA 2YKLL 5EZJB 1YY9D 2P42B 2H9GB 1SYVA 4TPRL 5FUCC 2R23A 3C60B 2W92A 1MCWW 1OP3K 2NY1C 4X6DA 5IMKB 1ITCA 4FQ2H 3CFCL 1I9EA 1NGWA 1T0NA 4PLOB 4QCIA 4YHIB 1ZA6A 4PJ7B 2PYEB 3BIKB 3DVFA 1KTLA 3NCYS 3ILPA 1MY5A 4ODXB 1U93A 3CSYA 3IFNL 3HZKB 3D69A 4ETYA 5FYLD 3SE8L 1DJSA 2IANB 4HJGA 4KY1H 1UG9A 5GSVB 3LN4A 4X5WA 2R2HA 4OF5A 4R96B 4X4XB 1P4LB 5F7DB 2VN7A 4XPBL 1U8JB 3SE8H 1TVBB 2V7HA 4BH7B 4Y19E 7FABL 3KPPA 5JPNA 4PJIA 5GISL 1YY8A 4ZS7H 1G6VK 1IEAB 2VLLA 3JBG7 3K74B 3EOYG 3ES6B 2DTMH 3LN5B 2VDRH 5DR5L 3N1GC 1JVKA 3VJ6A 5J6HA 1C12A 3ZHDA 3ZSTA 3QIUD 1NGYB 1KV3A 5I1EH 2J88H 3UP1A 5DR5H 3UTZA 5EFIB 3FRPG 1RUAH 5IVZA 3RWIA 3P9WB 2Z4QB 3N50A 4LCCC 1Z6JT 3TEUA 1FNGB 1XGUB 2XKNA 4ODBD 4NKMA 1OP5K 1C5CH 2P8MB 3H3KA 1NUDA 5JR1L 1FE8L 4XXCA 2V17L 1I4FB 3MRQA 3RUGF 1ZGLM 1KTKE 4XMPL 5JR1H 4MWFA 5KSUB 3WKML 3H2WA 4WGVB 3MV8A 1RK0B 4U31A 1M7DA 4FFYL 3WKMH 4U0RC 1GAFL 5A2LH 5DMKA 1MUJA 3T1FB 4A6YA 4MNHB 1I8LA 3QEQA 4QLRA 4N1HB 3ARDA 3K8MA 4WJ5B 4X6CF 4CVWA 1BD2D 1GAFH 5C0AA 3V5KA 1HWHB 4BFGA 3MJGX 1B0RA 4PJXB 3BD3A 3D39D 4J1UA 4NQDB 2CMRL 5C0BD 2R4RL 2ZUQC 4KTDH 4UIMA 2ZUUA 4OI9A 2EKSB 1DVFC 4RMUA 5IB4B 1DSFL 4EDWH 2R4RH 4OIIL 2X6MA 4ZSOE 3P73B 3VRLF 1FYTD 4DN3L 3IXAA 2DQUH 5MHSD 3OKEA 4V2BA 5INCA 2IPUK 4PRHA 3SDCC 3AUVA 4K7PX 5HGDB 4JPVH 4OUOA 2IC2A 5C0CB 1N5YL 4QHMA 3PQYA 1T3FA 1XGYL 5SX4I 4F2MB 5EBWA 3RY6A 3UJIH 5C9JA 3MBEA 1Q8MA 2BVQA 1XGYH 1R5WA 2HAZA 3OGCB 3P0GB 5H94A 3MA7B 5ADPH 3V4VL 4HS6B 2Q3AA 4Q9RL 4ONFL 4JRWA 3IDYB 5E6ZA 1CLOL 4EI5B 3VH8A 1VFAB 1YY9C 3H3BC 4Q9RH 4Y16A 1QO3A 1KLUB 4QHUA 2HJKB 1CLOH 4NN6C 4QF1B 1ZGLA 1UCTA 3T8XB 1FV1B 2DLFL 3OAYH 1BX2A 1N59A 4G9DA 1PY9A 3KYNB 1H3WM 2DLFH 3QO1A 2CJUL 1MCNA 3MLZL 2G2RB 5CSZB 3MFFA 1RUQH 5H37H 2YWZA 1QBBA 5LXGL 2EIZB 1AXSB 4KVNL 4PJ8D 1G7PA 1AIFA 2DBLL 5T1KB 3UDWA 4NQVA 3KGRA 5LXGH 4G6ML 4KVNH 4L4JA 5DMIL 5GRVL 25C8H 2DBLH 1A1NB 2W91A 4B7IA 3WLBA 5HHOE 4JVUA 3OB0H 5MERA 5I19L 3TJEH 1Q0XL 2ZWLT 5DUMH 3MACL 4W6XB 5T1LD 1UC6A 1HHGB 3QIUC 2Q8AL 1ZA3B 5E2UL 5KSBE 4WVRA 1F3JB 1Q0XH 2ADGB 2R29H 4N90D 2GJZA 4JN2B 5K59F 5EO9B 4YE4H 1HYSD 2Y06H 3OZ9H 4FRWA 1FH5L 1MF2L 2FWOA 1IZKA 3KXFA 2JJSA 3A67H 5EN2B 4N8VB 3AAZB 2AJ3A 1MF2H 3MZGB 4M1DH 3MLYL 1S9YA 1OT2A 3VGAB 1AGDB 1BQSA 4PJ7F 1NBZB 3V95A 4QHLB 1UQSA 3LS4H 4S2SA 2X4SB 5SWZB 4OUUB 3TA3B 4DW2L 4GKOA 1ZLWK 1TZHB 1U36A 2KDGA 3BZFA 5TJWK 3NAAL 5DZLA 1TLKA 2BZDA 3WD5L 3R06A 1S5IL 3THMH 1P69B 3SGEI 1T2XA 3C6LA 1UJ3A 3ULVH 3BZ4B 4NFDA 3G08B 2FIKA 3WD5H 3N85H 4N1EA 4WWKD 5DQ9A 3BYYA 3RI5K 5DK2A 2RIKA 4NZTL 2ZPKH 4ZQKB 3VCLA 2BK8A 5E56A 4XPTL 4MVBD 1CGTA 1SQ2N 5ICZB 1JL8A 2CK2A 4GUPA 1BEYL 3M8OL 1I3GL 3VXNB 2OL3A 3MRRB 2EYSB 2Z8WC 1XGRA 3O2VL 1I3GH 4D2NA 4KK8D 4HPYL 5IMLB 1ZS8A 4YO0B 4U3XA 4MYWB 3EGSB 4QRSB 2QSCL 4QXTB 4HPYH 4EEEA 2D7NA 2QSCH 2UWEA 2DM2A 2V9TA 4I9WD 4EI6A 4O00A 2ATKA 3DUHA 1NBYA 1N8ZB 3V4PH 3BXNB 1N0LA 5D7LB 2GK0B 3TVMB 4TQEH 4KDTC 4G6FB 5F93C 5SWSE 4P3WA 3UTSB 5L88H 3ZKND 2V5MA 2CK0H 2W0KA 4JFDA 1I85A 1NFDE 4PJXF 1PQZA 4YC2C 1RIVL 3VDBA 4CVZB 2F19L 4OD3L 5K9JH 2APVA 5D5ME 3CFKB 2OLDA 2A83B 2F19H 2WP3T 4ODSH 1B9ZA 5DJ6B 4I4WB 1Q9LB 4PJ8C 3RX5A 1FBIL 4XNMB 1KYOJ 1HZHH 2OJEB 3E6FA 2OK0L 4H1LH 3STBA 3EOBA 1BLNB 3DGGA 3R1GH 4FQ1H 4Z0BL 3QEGL 3FO2A 1A1OB 2YD4A 2PTUA 2VLJD 3RIAK 5JZ7D 4YQXH 3D0VA 2GITB 3DETC 1ZHLB 4GRMB 3RY5A 3QUXA 1D5ZB 4YXHL 3K46A 1AGFA 2AW2A 1BF8A 2ZP0T 1J5OH 5BV7B 2AXFA 3F12B 3QQ9C 3GUTB 1AJ7L 2EDJA 1TQCC 5IFHL 4YBLC 4Z7OE 1KPVB 4GXUN 2GY5A 3T3ME 3V6OA 1AJ7H 2GIYA 3GMQB 3VG9C 4G9FD 1BQLH 4I2XB 5MENE 3NN8A 1MCIA 1JP5A 3RP1A 4YHPA 2WNGA 4Y5XA 1CFTA 2DYPD 5HYIA 4Y5VB 3O9WC 3C09B 1PKOA 1VENA 5A2JH 2DL2A 3BZDA 3IDGB 2VXVL 5C09A 1JF6A 3VFOB 5F7EH 2VXVH 3UPCA 3PDDA 1HKLL 3MZTA 5FA4B 4HIHA 2IALA 1IVLA 1R5IA 4LPUA 3L6FB 3FQUB 4MA3B 2W0LA 4JAMB 1EEYA 1D5BA 4ISVA 3S5LB 3QXAB 1WWCA 4WWKC 4ZTPL 2NY5H 2WLZA 3D2UA 3X11A 3BQUA 4MVBC 3O8XC 5ESVA 3RVUD 1Y6NR 2F58H 4RMQA 4N0UE 2H32B 3GMPA 4ZTPH 3HPLA 1OAYH 4D3CH 4FZEL 4YAQB 4OZFG 2QSTA 4M7ZC 1T1WA 5F7WC 5I1JL 4CUCA 5F6HJ 1CQKA 3H42L 1MH5A 4JN1L 4J3OC 1FDLL 1EJOL 1N5AB 3HAEB 3WFBL 3H9SA 5H35A 3H42H 3QJFB 4ELMA 3N1QC 3I9GH 1JMZA 4MCYA 1TETL 2CUHA 2LABA 4WI4A 2E7MA 3DX8A 5IESH 1KCKA 5JUEL 3NFPA 5IHZA 4PGCB 4K3JH 5D7IA 2XIDA 3W0WB 2PXYA 2EDQA 1FCCA 2R9HD 4HT1L 5HHME 5MEQA 4KK6C 3L3IB 4LIQE 5HPMA 2V5SA 1NANH 2I9LB 2J6EH 3OXSA 3RWJA 3ZYIA 1U2CA 1GOGA 1I9RH 3AB0C 5IOPB 5F3BB 3QR2A 3MLXL 4B7LA 1V5JA 3B43A 1U8PA 1IKNC 3LB6D 2A2QT 3ARTA 3DROA 3F58L 4PLKC 4HIXL 3MLXH 4K2UH 4ZXBC 3IS0X 5BZWA 1QFOA 1A7BA 2WINB 5LAXB 1MCHA 1LEIA 5CBEA 2J4WL 3F58H 1DCLA 3GBNL 2P45B 3LS5L 4OM1H 1CBVL 2D7MA 4PG9B 5GGRB 2YK1H 3ORJA 2J4WH 1LO5B 2JLLA 4PR5A 4Y1AE 3P4MB 3LS5H 5SWQB 3RDTA 4OZIA 4YX2L 2B5IC 3TV3H 1RUPL 4PJHB 4YX2H 1N0XL 1IGTB 1P4IH 4KXZH 1OOAA 4XMLL 3ZE0F 4QTHB 3O2DA 3DI3B 2VR5A 1K4CB 1TJHH 4XP4L 2R0LL 2XNAA 2JB5L 5I2IB 3DV4B 4HH9A 5IKCB 3MV8D 2V2WB 1KPUB 2VZVA 2YUWA 2BC4A 4KTEL 3RL1A 3KPSA 4BQCA 1H8NA 4EUPA 1NGZA 4KTEH 5C0AD 1FC2D 3LKPA 1WEJL 2R1XB 3H0TA 32C2B 4AM0B 4XBPB 3UTTE 2XWBA 2DIJA 2CKBB 1QSFB 4OLZH 1WEJH 2YWYA 4TUKH 1EIBA 2ED9A 4GLRH 4M1GH 3RY4A 4N5ED 3U36B 5DEGA 3ARYA 1MNUL 2HKFL 4HF5H 4DGIL 5D9SA 5C0EA 1RZGA 1MNUH 2D0FA 5ANMB 2A74A 1A14L 1UH4A 1DP0A 5JIHA 3SKJL 1F5WA 5CKAA 2FO4A 5GIRB 3RVUC 3AREB 2B20A 5EC1A 3D5OF 2DBJA 2UY6A 4NRXA 3B9KB 5F1OB 4U6XA 3FB7B 5FB8B 2VKWA 2VZ3A 5EU3A 3VXOA 3ARBB 1B0GB 4KHXH 1E6JL 4L8DB 2CRMA 1N7ML 3VRJA 1LEGA 3CFJA 3NACL 2BNRE 4XPAL 1TNMA 5E5UB 1DQQA 2DICA 2GJ6E 1Z9OA 2PO6B 1N7MH 2CO7B 4R97B 2Z31B 1R24A 3TBVB 1O0VA 3IJSB 3GSVB 3EOAA 2R9HC 4X4ZA 3HC0A 2NYYD 2QR0B 4ZO7A 2AXHA 3OF6D 2X89A 1BWWA 4NBZB 5C0BE 1CDIA 1UYWL 1WTGT 4JFXB 2H1PL 1CK0L 4HSQA 2IQ9L 3V0WL 2P49B 2QQLH 5T3XL 3IJHB 3W9EA 2AKRA 5I1LB 1IGFH 5KVFH 4M61A 3LB6C 3GGWA 5HDBF 3HR6A 4ACPA 4ZFFB 4X6EA 3BOVA 3T4YA 4PJAB 3Q6FB 5T3XH 3O6LL 3U9UA 2ESVD 1KN2L 4KPHL 1JNJA 2E27L 3PNWB 3FO1B 3O6LH 2ICWB 4OLWH 3D3VE 3SY0A 4LPVA 4GRLB 4RA3A 1TCRB 5F88B 3BPNC 1OAXL 4RGMC 5AZ2L 3DI2B 4M48H 1OQXA 4QRQB 5DJXA 4O2FA 4JEGB 1JPTH 5LQBH 3OV6A 1DLFH 2FD6H 3KXFD 1OAXH 4UOW1 2CDGA 2BNQD 2BSSB 5ALCL 5JHLL 2H2SC 5CLTA 3MV7A 4ZUTB 5EIIA 4P4KB 4EJ1C 4JGUA 1MLCA 4NKDA 5A40E 5ALCH 4LVOC 2YMXH 1MIMH 1YEGL 1Y0LB 2J8HA 4YIQB 1CGUA 4FG6D 3EZJB 2HFFB 5F9OL 1J0HA 3T4AB 1DQML 1HHHB 4QRRD 2IJ0C 1RQ5A 1FFPB 3GHBH 5ALBL 1DQMH 2QKIA 4PJ9D 1GL4B 3G6AB 5CZXD 4MDIA 2EEDA 3QUML 3DUSA 4PRNB 5HVWA 3PL6A 3QUYB 5CMAA 4DUVA 3ARFC 3QUMH 4C83B 3ZE2E 5I75B 1E4JA 1F8TL 1L9MA 4P5KA 2P7TA 3I85A 4YXLH 3UAJD 1OM3L 4ZSOB 1D9KB 3L5XL 1HH9B 1F8TH 5D1QB 4AH2B 4XMKL 4LLMA 1OM3H 4NO5A 4PJBE 1R5VB 4PJHF 3QUKB 2O61B 4XMKH 3KJ4B 4UV4L 3E6HB 4EIGB 4YHNB 1RURL 5EU6B 1LO3L 1HH6B 4GG6A 2EDTA 5F89B 2BDNL 4QHKI 3RAJL 4CL7A 4LF3A 4LVNB 3H7BB 1F4XL 2DQHL 3X13A 2BVYA 1LO3H 2ED7A 2B0SH 2R0WL 5EOTA 3TYFB 5E08L 4X6BB 2BDNH 2NMSA 4PP2B 3RAJH 4OZ4B 1F4XH 4JM4H 1LNUA 1TJIL 1J9CT 3WLWD 4XC1L 2R0WH 3BDYL 5E4EC 5E08H 3SJVD 1T5XA 3B2UC 1E28A 1AD9B 4AEFA 4NC1C 2M1KA 3BDYH 15C8L 3CPLA 4JFDD 4YHMH 5D70L 4ZUUA 3PUCA 5IW6A 1JGLL 5D70H 4MJIE 2NLJB 2GSIB 4ZAKB 3JWOC 3W82A 2WWMD 4XBGB 1QG3A 2HN7B 4HWZA 4HJJL 2NYYC 3IU3B 3SEPA 1CU4H 2IPTH 3F6LA 2XN9A 1MELA 4HJJH 1Y6KR 1PG7W 4G8IA 2PTTA 1X5FA 4D9LL 2ID5A 4P48A 1PG7H 1NCBL 5IG7B 4FTVA 4L3CB 3VGGA 4R8WL 5LBSL 4D9LH 1QLEL 2MOVA 3HC4H 1SEQL 4DKAA 1A7OH 5HVGB 1QLEH 2FHCA 2Y1VA 1NKRA 3F62A 2FYYB 3CU7A 5L2KD 3VFUB 3MUJA 5KSBB 3AS3A 2UV3A 3H9YA 4OTXL 4PGEB 4FQXB 1FZKA 1DBAL 2P5WA 2CLRB 5IROA 5INDA 3IT8D 1U92B 2R69L 1P7QD 2IG2L 2X1XR 2O5XL 1JN6A 2X1WL 3S98A 3QNXA 3V5HB 4XNZC 2MHAB 4MGXA 4G43B 1BGXL 2O5XH 2AV1A 3D1MC 1LVEA 4M93B 4R3SB 3V0AC 5C07B 3VFSA 4O2CA 1S9KC 2YA0A 5BOZG 4J3UA 4FG6C 1MRFL 1TJGL 1A0QH 2R2EB 1CD0A 1H5BA 1JHLH 3ARGB 4L3ED 3IDMB 4G8GD 1KJMB 2NY6D 3HE6D 1TJGH 1FL6B 2IPUG 3OB8A 1S7TA 4HZLA 4LLYB 4PJ9C 5CZXC 4OT1L 3ZHLA 1YC7A 4KKBD 1YMMA 1CE1H 3MO1B 4MNQE 2J2ZA 1SBSL 4PJAF 5SX5H 3QQ3B 5BXFB 3D2UD 2ENYA 4CDGC 4OT1H 1ZWIB 4V1DE 5IQ7H 1II4E 4HMCA 4L9LC 4ETQB 5FCUH 4HHAB 2VLJE 4Q2ZB 2DD8H 1JRHH 1MJJA 3REVA 1K4DB 1I8KB 3SDAD 4NPYB 5DK0B 4JREB 3VXMA 3DGCR 5F6IC 5D1XA 4YDJB 3H9SD 4GQ9H 1YPZA 4DQOL 3CXDL 3H9ZA 1S9VA 2VSCA 2DKSA 3QEHA 5D93B 1I9IH 3QHFH 5F9DC 4DQOH 4G9FE 1FAIL 3QB7C 1KIRB 5A16B 4LU5H 4LARL 1HCFX 4OZGE 2A6KB 1VSCA 1UENA 3HG1D 3QWQB 5D72H 1BZ7A 2FDBP 2PXYD 4NCDA 4X4ME 4YNYB 3BESR 4EXPX 1NBVH 5E2WH 3DVGB 4MAYA 4HUVA 5SWSB 4UUJB 2NY4B 4U05A 3FO0H 3SN6N 3TO2A 5H8DA 4D94A 1PFCA 1FRGL 3IETB 5TH2A 1HHJA 4EQ3A 3AS1A 2OXGA 3VWKD 5JXEA 2DM4A 2Q8BL 4YDVB 3UROR 2WWMC 1J8HE 3S97C 2HT3D 3QG6B 1LP9E 1HIMH 4HS8H 4Y2DD 3GJEA 5B21A 4P2RB 4YGAB 5D5MB 3WN5C 2YRLA 3QPXL 5FYKD 1KJ3L 3IF1B 4BSWA 3LKRB 3VMOA 5K9QG 3KPRE 2Y6SD 3AS0A 4Y7MA 2P5EE 4OF6A 1KJ3H 4DVRH 2X4QB 1NL0H 4PD4J 4UTAH 2P1YA 1YNTA 1MCOL 1T20B 5DUBA 1YQVL 1PDKA 3N1PC 4DAGH 2YRZA 3AMKA 1MCOH 2MKLC 1HNFA 2XA8L 4MHHG 3SE4A 2OI9B 4NFBA 5ESQA 5CLWA 1T7VA 43CAB 5FYJE 1EHNA 1KB5B 5IF0B 1Q9OB 2AK1L 1OTUC 3QZWA 4MQXC 3IU4H 3C8DA 3LKNB 4P3DA 1X6NA 4WUKH 4X6DE 4O02L 1GGTA 1Q9KA 1NKOA 4H5SB 5L0QC 3KPNA 2IAMA 3G6JB 2VB5A 3DARA 2I60L 3V9FA 4U6HB 3MRGA 4Q6YA 1C5BL 1RZFH 4IIQA 2JIXD 1U8IB 3FKUS 4PRAA 2I60H 4NO3A 5HJ3A 5AYUL 2VTFA 5A43C 2K7PA 2W0FA 1AD0A 1LD9B 4IRSB 4P4RA 3NIFE 5ERWB 3TIDB 5DXWA 5BQ7B 1S5HA 1TXKA 2NY6C 3MRPB 1FNLA 4PRDB 3FB5B 1JYNA 4JM2A 4P59L 1UVQB 2IWGA 4LL9A 4NM4L 4PP1D 3ZTNH 4CVXB 1FVCB 1UB5A 1MWAH 5ENWA 2H3NB 4NNPL 3JWDC 3UBXB 2HLAA 3ROOB 4KKBC 1RHFA 1AH1A 1PW3A 3X3GL 4HK3J 5ACZA 2YPLB 2E7LA 4JY6A 4UDUB 2XFXA 4W6WB 5ELIA 3MNWB 3OR7A 1H0DA 2ZCLL 3S4SB 5D2NC 3X3GH 4A2LA 5ICXB 4Y5YC 3RPKA 4LHUB 3TT1H 4N0UB 5LG1A 5KSBF 3BW9A 2NXZD 3SDAC 2VUOA 1ND0B 3VXTA 4LCCB 1CD8A 3G04B 3C6SB 4PGJA 1OGAD 3R8BB 5DEFA 1DUZB 4X0KA 1DQJA 3EO9H 2KQNA 3K2MC 3L5IA 1EHLL 4XB8A 5JOFA 3M17A 3F5WA 2R56L 4RCAA 1LQSR 4TOYH 5H2BA 3SDXB 3WHXA 1KCRL 1AQDB 3O4LB 1C5DB 1KB9J 3QEQE 5KJRH 1VFBB 2D4FA 1OLLA 1GIGL 1KCRH 2GSGA 4KAQL 4P3CL 4RAUA 5C0AE 3S96A 2X89D 2ZSVA 4F7MB 3QDJA 5F1NB 5KTEL 3VFNA 4ZNEA 1OARL 1M6OA 1U8NB 2Z8SA 3VWKC 3P77A 2GT9A 3QUZA 4HGKC 3P40A 5DFWH 3ETBF 1DVFB 4NCC2 5HHNA 2CUIA 3MRHB 4Y2DC 1JTOA 1NH6A 4UQ2A 4P46A 3MGOA 4PRHE 3TNNB 4DGVH 3GNMH 5B3NA 4KK5D 4HXAL 5BV7L 1LO0L 2X70A 3OGOE 2R0ZL 2Y6SC 2GAZA 4URTB 2AXGA 3PQYE 3G5XB 4NHCL 4OBRA 2WANA 5D8JH 5BV7H 5BVPH 4OGXL 1LO0H 1ZHBA 3DUUB 2R0ZH 2NTSP 5FOBB 3D85B 4O58H 4GXVL 4Y1AB 4U1SB 1EX0A 3BEVA 1BQHB 2XRAL 4OGXH 3QWOA 4AK1A 5I71C 3F65A 3GMOA 3GI9H 4AMKH 4H0GA 1P5UA 3HCVB 1J1XL 1QRKA 3MV7D 1J05B 4JQIL 4YDLC 5T5FH 5FGSA 4TVPL 4XP6H 4ZO6A 3BD5A 3AROA 3GKWH 4XPGL 3GIZH 4IOFD 4TVPH 4OFDA 1YJDL 4X6CA 4NN6B 3KLSA 4L8SB 1I7RB 4H20H 3SE9L 2CXGA 1YJDH 2P8PB 1JFQH 4PYGA 1EXUA 5KANI 3KR3L 1SEBB 3DSFH 4U1NA 3UZEA 5FO8B 3NH7H 3OKLB 4JO4L 2P43B 3RQ3A 2I9TA 4BFIA 5B38A 4EN3A 1U0QA 3TO4C 1HSAB 1XCTA 5D5MF 4JO4H 1NANI 5ISZA 2DJ4A 5DD5L 4NKOB 1UCBH 2YS4A 1I1YB 1I1AA 3BRDA 1FVEB 1JV5B 1W72H 2YBRA 4HIEB 5E6IA 3MRCA 4PP1C 3TLRA 4OD1L 2H32H 4XBEL 3SKUD 3D0LA 5IEHB 2W65B 4JFFE 4OF7A 1K5NB 3BEWA 1KTDA 4HEME 4P5MA 4AL8L 2X2YA 4R4BA 3UYRL 3HAEH 4WCYL 5BS0A 1JPST 1F4WH 2Q7YA 3L9RA 4Z8FH 1LEKA 5F7NC 2FRGP 1BBDL 1JZ6A 4WCYH 2YZ8A 5J11B 4EVNA 4Z7OF 5EUOB 1EDQA 2ATPA 5E00A 2LTQC 2X4RB 3T3MF 5BJTA 3QDGA 4MCZB 1MCFA 3H9HB 2NY2D 4KXZI 3RA7L 3FOMA 3PWVB 4LPCA 4QT5A 4CW1B 4OM0H 5GRVK 3UJTH 2F5BH 1H3XA 3G6JF 3DMMA 1JWUA 1CCZA 2BNRB 3QXWA 4IMLB 1I8MA 3IDXL 1QQDA 1OT1A 4JR9L 2ZJSH 1I7TB 1O7VA 5FHBH 3QT2A 3PABA 3JV4B 3U9PH 4M03A 4U7MA 2OMNA 5C0DA 2OZ4A 1IEHA 4FOMA 2QSVA 5IIEB 4XGZA 1JGUL 1E4XH 5FECA 1FG9C 1MCCA 3D39B 3LD8B 5C0BB 1IQDB 2E7CA 5D4QA 4WI2A 2V6HA 4RMRA 4GLRI 5C2UB 5JDSB 4FTVD 2BVTA 5CUSH 2DI8A 4X7EC 1YMHA 5LVEA 1NC2A 4KK5C 5HTSA 3Q6GL 5EZJA 3S3PA 4KWUA 3C5ZA 2H9GA 5E24E 3VXQB 4RZCB 3D3VB 1T1ZB 3MNZB 1MCPL 2VDLL 3WS6C 2IBZX 4B53A 2NX5A 2YPVL 1MCPH 2UWEE 4RAVB 2EH7H 2PYEA 3BIKA 5JDJA 4ODXA 2H26A 1KFAL 2FNBA 2YUZA 1HHKA 3HZKA 2I07A 1BVKB 3C8KB 4Z78B 4LPYA 1PZUB 2IANA 4NQED 4XVJL 2OQJA 1KFAH 1MQKL 5F7DA 2PW1A 2CKBL 1REIA 4IOFC 4JFDE 1VACA 1TVBA 3QWRA 4XVJH 5KVMC 1HE7A 1MQKH 1XR8B 3P4LA 2CKBH 3B5GA 1IEAA 4NZJA 1UM5L 1WBXA 4JPKH 4KRPC 5J1AB 4U33A 3ARPA 3ES6A 4JHAH 1IAIL 3LN5A 5DSCA 3IB4A 1UM5H 5CWSB 1FYHB 4J12A 3FMGH 2ZSWB 1CICD 4MA8L 2Z4QA 4JO1L 5GHWL 1T03H 3NTCL 1RY7B 5FO7B 4Q6IB 4MA8H 1GGBH 1RU9L 1CDJA 2DQEL 1FNGA 4OGAD 5MI0C 3ZDYF 1L7IH 4GG8A 4WW2B 5DWUL 3KWWA 2P8MA 5JTWA 5C0RL 5D1XD 1I4FA 4PJBB 1U8QB 5EPMB 4BZYA 2ZOKA 1KENL 4XRCB 1CLCA 4NWTL 5C0RH 1TQCB 4YBLB 3V6OE 2D9QB 1QKZL 1EZVX 4NWTH 4GW4B 3VG9B 1LK2A 5DMJB 1RJYB 1RZIA 3T1FA 5IMOA 4MNHA 3QYCA 4OCXL 2NY2C 3U79A 2C3WA 2WWKT 2BOCB 4WIQA 4PRPA 4GXUM 3QRFM 2DQCL 3MXWH 4FQIL 4QRTA 2BMKA 3HC3H 2EKSA 1N26A 4NKIL 5FGBC 4GAJL 2DQCH 2EH8L 5C09E 1UWEL 1I7UA 3R0NA 3G5ZB 4FABL 3P73A 4M8QA 1ZVHA 4GAJH 4I5BB 4NKIH 5J7CC 4OB5H 3U2SB 3SDYL 3FHAA 2QLVB 1P53A 3QCUH 3S6CA 5JW3H 1NCDH 4FNLH 5CFHA 1WT5A 3T0VA 5C0CA 3E2HC 4FQPA 1G7QB 3VFRB 1I3VA 4DEPC 1BBJB 4AEHH 5C2BL 1U6AH 4POZD 1NJ9A 2YUVA 2WQ8A 1OCWL 4JY4B 2YR3A 5L8LB 2ADIA 5AWNH 5C2BH 1NMBL 1INEL 1IQWH 1R3KA 4IDJL 1JNLL 4XH2A 4LSPL 1OCWH 4I0PB 5LGHL 1MCBA 3RJDA 2ARJB 5EU7E 2I26N 4M7ZB 4KROC 3LQMA 3I6GB 2KKQA 3T09A 3RIFF 1KEML 2EYRA 4IDJH 1JNLH 5EUOF 4EI5A 1VFAA 1WCBA 1QPPA 1OF2A 4LVEA 2AV7B 1KEMH 1KLUA 3H9SE 5HBBA 4OGYH 2HJKA 4N0RA 4L8CB 3EFDH 1FV1A 5HDLA 4OFPA 1JYWA 4ELME 4NQSA 3BUYA 2HT4D 4XVTH 4PLJD 5E9DA 3KS0H 5J8OA 4QHNB 2XTJD 2A1WL 3RL2A 1ZLSL 4KQ4H 3P0VL 4PY7A 4DVBA 5CSZA 3RGVB 4K71B 1HINL 3ZDZF 2A1WH 2EDHA 1LO4H 5KS9B 3S37L 2W60B 5FKPA 1NLBH 5B22A 2HVKA 2Z9TA 4RFOL 5HY9B 3S37H 1F6AA 5EOQL 1WAAA 1U3HD 3AB0B 1T21A 3W9DB 4RFOH 3C08H 1H9VA 4I3SH 3W39B 4OV5B 3VGBA 2XOTA 2Z35B 3QCTL 3B9AA 3T0EA 1D3CA 4WFHE 4LFHD 2FR4A 2DQGL 1CICC 2ADGA 1AXIB 2P4AB 2PCPB 4YFLF 1AP2B 3QRGL 4BKLB 1F4AA 4ZFZB 2EDRA 5C0JB 3RWFB 4OZIE 1PYWA 3S36L 3VG0L 2R1YA 1NC4A 2B5IB 2VLJB 3AAZA 1G1YA 2MPAH 1A6UL 3S36H 4QTIL 3CFDB 3P4NB 1S7XA 5EBLA 1A6UH 2D31B 4JLRB 4QTIH 3MV9D 2LQRA 5E2VL 1J87A 2X1OA 3CX2A 4KUCD 5IUSA 5T1DL 5A2IH 2IMMA 3GSXA 4M43L 4U2ZA 5IJVA 5E2VH 5DJCB 2FJGB 2EDLA 2X09A 4G9FB 1X5AA 3BGMA 1NBQA 3WEXB 3QH3B 4R26H 1NLDH 3RNQA 3KPSE 4CVUA 3BZ4A 4ZNCD 3RTQC 3G08A 3S35L 4XXDA 2DYPB 1DFBH 1PJ9A 2IFGA 3SO3B 5B39A 5I1IL 5IBTH 3S35H 4ZQKA 1EHXA 4N8CL 1E6OL 2HG5B 5BRZD 3LMJL 3EO1B 1QRND 3RWGB 1D5IH 4OZFH 5EBGA 5IVNA 5ICZA 2BCKB 1JGVL 5DJ0B 1VGEL 3LMJH 3QFDB 3CSGA 3HNVL 2FEEI 3VXNA 4LBEA 1G9MC 2J8UA 1J8HB 1VGEH 2CRYA 4NO0A 3PV7A 4P46D 1HQRB 5I17A 2VRAA 4YJZL 5IMLA 5GS1B 3HE7A 3P9MA 1DANU 4XX1E 4LSDA 4WW2F 3TBTB 2P8LB 3KPRB 1W2KT 4POZC 3DBXB 2OS7A 5BW7C 1JF5A 5IHUH 4PJBF 4W4NA 1OW0A 3S3JA 1XFPA 3WHE0 4JKKA 4WTZG 3WFEL 1R3JA 5D7LA 1XGPB 4JG1L 1JRHI 5DRWB 3MLTB 3OKKB 3VRIB 1DN2A 5TE7L 2Q1EA 1F90L 1S7VB 1ONQB 4HKZA 3WFEH 2W9EL 5IVXB 4WTWA 5DGQA 2DMCA 2CH8A 2MSPA 3VI4E 1YZZA 3DO3A 5KVEH 3BN3B 4JGMA 3RZCD 3C2SA 3LV3A 2HT4C 1YEEH 4PLJC 2X4OA 4CVZA 5IB3B 1B0WA 3QIBC 2I25N 4E41D 4GBXD 1DANT 1NGWB 3MREA 1ZA6B 2Y07H 3UXFA 5FUZH 4I4WA 1Q9LA 1KTLB 3ILPB 4XNMA 43C9A 4PJGB 1XR9B 3WXWL 4EN3D 5E99L 3D69B 4ODVL 1E4KC 1BLNA 4XHJD 5EOCH 5I15L 4UTBH 1AHWC 4CN4A 4HJGB 4JKPL 3LN4B 5TQ0L 4X5WB 5E99H 5HI5D 3VD7A 2VE6B 2HWZL 1U3HC 5ADOL 5I15H 3OG6B 3MJ6A 4JKPH 3WJLA 5AYQA 5T3ZL 5JPNB 3KPPB 3TIEA 4PJIB 1FORL 2R4SL 1FLTX 2VLLB 1ORSB 3F12A 3LH2L 3Q1SH 5T3ZH 3GUTA 1CLZH 4PY8I 5ETUB 1FORH 3S88H 5EC2B 3VJ6B 5J6HB 3TBYA 5BS0D 1V7NL 4I2XA 1WTLA 1XF3B 3UTZB 3QDMA 2G60L 3CVIH 1QP1A 5D7KE 4X4YA 1CGXA 3LQAL 4JFEE 2G60H 4IS6A 2E9IA 4M6OL 1PZ5B 3LQAH 3P9LB 3PDOB 5F7HA 4NKMB 3CDCA 2Z92B 4JHZA 2NCMA 1D5XA 4M6OH 1AQKL 3DMMD 1GHFH 4DKFL 1CG9A 4LVOB 2EXWD 2XI9A 3D48R 3GM8A 5FA4A 4MWFB 1AQKH 5D7JD 4KV5E 1RUML 3L6FA 3MV8B 5D71H 1M7IB 4MA3A 3Q3GA 1QR1B 1M7DB 1INDH 2VWEC 4JAMA 2G75A 3ZT5A 2VLKD 2G5RA 4XWGL 1BZQK 5DMKB 4HK3N 4FFWD 3QXAA 4WO4D 3BAEL 3HFML 3QEQB 3EYSH 1FG2A 4K94H 3ARDB 2ARJQ 5C0AB 1NCUA 2HH0H 3V5KB 4LK4A 3HFMH 1B0RB 1QR4A 4J1UB 3QXDA 3OKNA 4YAQA 4NWUH 3V8CA 1SMAA 4FP8H 2ZCHL 4IJ3C 5A3ID 3IXAB 3OKEB 1N5AA 3U7WL 4LLVB 5INCB 4PRHB 1J1OH 2ZCHH 1XH3A 2DQDL 5CJ5A 2W1NA 4YK4C 1CD1A 1BFOA 2XKUA 3KDMB 3U7WH 4MAUH 3BMWA 4MSWA 4P2QA 4QHMB 1KB5H 2DQDH 4GG6E 4ELKA 5EBWB 1MVUA 5C9JB 2BVQB 1CQYA 4PGCA 1FPTH 2X7LA 1R5WB 1QLFA 4AG4L 2CR6A 5EB9A 2OXHA 4CN1A 3FQWA 3U30C 2I9LA 1M05B 4MB3A 1HXMA 4JY5L 1JK8A 3VH8B 3RZCC 3VGDA 1RZKH 4QHUB 1RPQA 1ZGLB 3O6KL 2AEQL 1IAIM 5IFJB 1BX2B 4G9DB 4GBXC 5GRWA 4JFZL 3O6KH 3QO1B 1BJ8A 4F33B 2PYFB 1FFNA 4PG9A 4OCSL 5GGRA 1X9QA 5BVJA 4XHJC 2XN9E 2Y36L 2VR9A 3CJJA 1G7PB 4OCSH 4I18A 1C1EH 4MMZC 5HI5C 4NQVB 3WCYA 4EUPG 4S1SL 1J0IA 1MCRA 3QI9A 4FTVE 4D8PB 3TWCH 4G80B 4J3WA 4QTHA 3IRPX 4UB0L 2VL4A 3TH4T 3NFSH 4GW5A 4S1SH 4WV1A 2YC1A 1K4CA 2QEJA 5MERB 3Q2CA 5DJDA 1GC1H 4KVCH 4Y4HC 3BPLB 5CD5C 1EBAA 5E7FA 3VXUD 5F70A 3EJJX 1KPUA 3PF2A 2GJZB 5HI3D 2YA2A 3CFEA 2P5WE 3MLUH 1A4JB 2NXYD 4XX1G 3OAUH 4XXCC 5E6YA 4N8PA 2DLTA 4JB9L 3ZHKA 4YDKH 4G7VL 1EFXD 1RIHH 3KXFB 2AJSL 4JRYE 5T33H 5C86A 2QV2A 3CLEL 4PRPD 2D2OA 32C2A 3U83A 2AJ3B 2BNQB 4AM0A 2F9BT 2BERA 1S9YB 2AJSH 5I1KL 3CLEH 2LU4A 3TN0A 4H88H 2EXWC 4MZ2A 4PJGF 1UQSB 5I1KH 5DVKA 5I9QC 4YUEL 5D7JC 5AG8A 4LIQH 4PB9L 4YHZL 1P84K 12E8L 2X9XA 1CYGA 3UPRA 5ESAB 5HYQA 4YUEH 3BZFB 4PB9H 4FFWC 4DOHE 4OF8A 4WO4C 5JHDD 3BO8A 2KZWA 2Z93A 3R06B 3MCKB 1UJ3B 4ZS6D 2FB4L 2EIBA 1YMME 4PJIF 4BYHA 1OP3H 1X6LA 2FIKB 3MUHL 2NY0D 3MRJA 5C08D 4F80A 4RX4D 2FB4H 1L6XA 5DK2B 4OQTH 3B9KA 3VCLB 3BMVA 3FB7A 2VXSH 3ZSSA 2DQTH 5A3IC 4J7RA 3ARBA 1B0GA 1J0KA 3A6CH 3QDHA 1VGKA 2GYSA 3VXME 1Y18A 2EICA 2OL3B 1DR9A 5CD3B 1XGRB 4IOIA 1YPZE 5DYOB 2E6JA 5F6IB 3TT3L 2Q6WA 5SX5K 3S9DB 4I48A 5TE6H 2CGRH 5I0ZA 4EI6B 3GSVA 1ZKAA 4LCWE 2ATKB 4UV7H 4XB7A 4YEFA 1A7QL 1T66D 1NBYB 4PJEA 5GSRB 3SJVB 1ZT1B 4OGZA 5DDHA 2C3XA 4BQ8A 5FYLL 3E3QE 5L9DH 1IM3B 2EKJA 1MRDH 3IJHA 5I1LA 4JFDB 4M8VA 2F54E 1ETZB 4ZFFA 3WNMA 4U1MB 1PQZB 1OP5H 5FHAL 3REWB 3Q6FA 3MJ8B 2J3SA 1QHOA 2F53E 2DQJL 5TDNA 4Z6AT 1I9JH 2ADJB 3FN0L 5I6XC 2I24N 2VDNL 5FM8A 2AJYL 3INUL 4QNPE 4FS0A 1ZGLP 3FN0H 5H37G 2VDNH 4OJFL 4RMVA 1E4XI 4ZPTA 3E6FB 5FV1L 4K8RD 2V2XB 4QRQA 4OCWL 4G6JL 5FYJU 3QQ4A 5FM5M 5F3HA 1NC4D 2D7QA 3NFNA 2IGFH 3CMOL 3D0VB 2K9UA 4NP4L 1ADQL 4JQVA 4ZUTA 5HVFB 1AO7A 3QUXB 1G7HA 1CLYL 1AGFB 3CMOH 5HYJD 1ADQH 3CC5B 1F2XK 2AXFB 3IAQA 2ERJB 1NQBA 1Q72L 3F8UB 5I18H 1MJ8L 5HI3C 4BH8A 4TTDD 4WU5A 3VWJD 4OLXL 1MJ8H 2XTJE 3C8HA 4C56A 1ZV5A 1OAKH 1Q0YL 4YHPB 3G6AA 1VESA 4Y5XB 1CFTB 4QXWA 4XZUA 3LIZH 1CT8A 4Z0XA 1MRCL 4PRNA 2QHRH 2AQ3A 1J0YA 3MODL 3CUPA 1MRCH 4C83A 3JUZA 3WJJC 3QFJD 4LCYA 3GK8L 2EXYC 2YD9A 1BJMA 2DF3A 4LRIA 3MODH 4MA1B 4Y89A 3MRMB 3VW3H 1D9KA 1OLZA 1HH9A 4G8GB 3HE6B 2W9DL 3VFGL 4HX1A 1T22A 1R5IB 5JXAL 2ZG1A 2CLZB 3QUKA 1WFUA 4NGHL 4ISVB 4P0DA 2W38A 3BP7A 5F89A 3K0WA 2NY0C 3VFPB 3D2UB 4QXUH 4TULL 3X11B 3BQUB 1JNNH 4LEOA 1OAZL 5D2NB 3GMPB 3HPLB 4TSAH 4X6FA 5DZNA 2R2CA 4TULH 1ZEAH 2DLGA 1PEWA 2F5AH 3CDYA 3SDAB 3NA9H 1MH5B 2XQBL 4F9LA 5HGBA 1LO2L 5GRJL 1ERNA 3GO1L 3H9SB 5H35B 2XQBH 5FGCE 1LO2H 1BVLA 3MUY1 4ELMB 1OPGH 2GSIA 4MCYB 5GZND 3CU1A 4WY7L 4XP5H 4FFZL 5HHXL 3NFPB 3PP3H 4TSBL 1T66C 5IHZB 4FXKA 3IU3A 4WY7H 3QSKB 4POUB 4P23C 1NDGA 4BSJA 5D7IB 1S3KH 1P2CB 2ZOLA 4IBLT 3NGBC 3F6IA 1CFNA 1MHPL 1QHPA 2PXYB 3KYKH 3PV6A 2XZCH 2AEPL 1KJ2B 2XV6B 5GRYA 2C1PA 2HA1A 5HPMB 1SJVA 3WSQH 3QDJE 2AEPH 2FBJH 4L3CA 3RWJB 4ZNEE 4OZHA 3VWKB 5EA0L 1MHEA 4CMMB 1U8PB 2HYMA 2AVGA 4Y2DB 1KG0B 3FB8A 5F1SA 5BZWB 3SBWC 1MLBB 3HRZA 4NOBA 1ZLWH 3MTRA 2BY1A 4PGEA 4FQXA 1JHTA 5AD0A 2ICWI 4PR5B 3QDMD 1E0OB 1BPVA 4OZIB 1NAMA 3L3OA 1QBLH 2KH2B 3V5HA 5E8PA 3WL9B 3LRSB 4G43A 4ODHH 3UYPA 5C07A 3I3EA 5EZLB 4XHQA 2AQ2A 1B4JL 4S0TD 3KPMA 4YDLB 1VEPA 1OSZB 2WIIA 3L3HB 3EYVB 5TE4H 1WSST 1CGSL 2XNAB 2YHGA 3L3KA 3DRQA 4TTDC 1SJEB 1DBKL 4HH9B 3VWJC 4X6CE 2Y7QB 5IT2L 1CGSH 4TUJA 4IRZL 4LLYA 2BC4B 1BJ1H 5J3HD 4NT6A 3K81A 3QHZL 5AUMA 4L29B 5IT2H 3RL1B 3K4ZA 3FQRA 3MO1A 5AAMA 1EGJL 1DBJH 2ZUYA 3QQ3A 3NZHH 1LE9A 1PG7X 2JIXB 1U8KB 2D4DA 5ISZE 1SY6L 1NCAH 4MB5A 5GJSL 4HHAA 2AABL 4F57L 5LGKA 1UH2A 2RGSA 4NPYA 4YZFF 4WUUA 5DEGB 3VFMA 3T2NL 2OBGA 4F57H 3TP4A 4J4PA 4YDJA 4HJ0D 2MWCA 4RGNE 3RU8H 5D9SB 1DQLH 5IBUB 3TZVD 3MC0A 4CU8A 2A74B 2VDKL 5EU7C 5HD8D 4P2QD 3GSNH 4GRWB 2FX7L 5BS0E 4KKLD 5FOJA 4KJYA 5KSVA 1WZMA 2EYTB 3QIWC 1KIRA 5E2JA 5A16A 1ZT7A 1KN4L 3CX5K 4R2GD 4NRXB 1G9NC 2FX8H 3QDGE 5J1SC 4OCRH 4XP1H 1SBBA 2NXZB 4YHOL 4YNYA 5EU3B 1QUNA 3DVGA 2AK4D 1XF2B 5KN5B 3IETA 1OGAB 2D0HA 3QAZC 3VRJB 2YRPA 1LEGB 3CFJB 1XF4A 4EBQL 5DRNB 5TPWL 1DQQB 5GZNC 4YDVA 1AKJA 1CDYA 1NEUA 3FFDB 1KC5H 3IFLL 2BFVH 3X12A 4WI3A 4AIXA 2VR4A 3ZZ1A 3LKRA 2MQ3A 1XGTA 4LVHB 4K07A 2X4QA 5KAQF 5A1AA 1DQDL 1RIUL 4LRNH 1B88A 4JCMA 1CL7L 4UT9H 4NDMA 5LCVL 5CGTA 1A3LH 4LQ1A 1U8LA 1DQDH 3QI9D 2LFGA 4M61B 5E94A 1YEJL 3GGWB 4L4VA 3T4YB 43CAA 1RZJH 4CADA 1N64H 1VPOL 3MOAL 5B8CA 1Q9OA 3EDJA 2VLRA 3VXRD 1FNHA 1UJTA 4HUXB 3GFUA 3SOBH 3ALPA 2FSEB 3STLA 1U95B 2NX5E 4BFBD 4UQ3A 1IKFL 1EERB 3EJYD 4F8TA 5KVGL 3G6JA 1MCQA 5DJXB 1HDMB 4PJ7E 2PYEE 1G1CA 2FJHA 1M1SA 4U6HA 4ELMF 4MXWL 2A73B 1IKFH 2FEDC 1HHIB 3SGJC 1U8IA 4HKXB 4JO2L 4XCFH 3MV7B 2IANE 5E95B 1LD9A 2QQKL 4IRSA 5D7IF 2AJVH 1UA6L 4JO2H 3K1DA 5BQ7A 3MRPA 3WDJA 1UVQA 1UA6H 2FIRT 3HNSH 3JV5A 5J3HC 3UBXA 2CUMA 1KGCD 4AEEA 5DD1H 3LPFA 1MCEA 3DXAA 1ZT4B 3MNWA 4NZRH 4MDIB 4ZG1A 4LNRA 3EYUL 4OSUH 4LHUA 3OBAA 5CMAB 1AE6L 1DBBL 1P6FA 2UZXB 2EE6A 1FLRH 4LLQB 4P5KB 2P7TB 3NPSC 5I8KH 4LCCA 3G04A 1PBYA 3BP5A 3F7QA 2B4CH 4HJ0C 3RVWD 3C6SA 4UDTB 4OZIF 4LLMB 3OHXB 1PEZA 1FO0H 4OD2A 3TZVC 5LWYH 2Q76A 3BHBA 3C5JB 4G5ZH 4NO5B 1FVDA 4MXVF 5HD8C 3D6GA 1D6VH 3LAFA 3FAXA 4KKLC 5FYJH 3T0WA 5HHVH 4KDWA 4GG6B 4NNYA 3SDXA 4LF3B 1A3RH 1AQDA 2Q20A 5EOTB 4ERSL 3TH3T 4KH2A 3UTQA 4HUMB 4Q0XL 1FL5B 5FFLA 4BUHA 2NY2B 4DFIA 3L5HA 4PRPE 4ERSH 5F9JA 3ULVD 5L6YL 2G5BA 4MNGA 1E28B 4Q0XH 4M7JL 4XCNB 5DD0L 3A0OA 2XTLA 4YBQD 3R8QA 1U8NA 1IGML 5L6YH 3LEXB 4M7JH 1DVFA 2C4XA 3BT2L 5CP3A 4ZUUB 3SKMA 1T89C 4PV9B 5DD0H 3MRHA 1WFNA 5CP7A 2RFXB 2WQRA 3IDNB 3SDCA 1Q1JL 1F58L 4HC1L 5IJKC 5C0CE 3HN3A 1EHAA 3V4UH 5CZVL 3G5XA 3I3DA 5L7XH 2VITB 1F58H 1QSED 3E2HB 3V5DB 5FOBA 5FDWB 4DEPB 3AU1A 5HYEA 4G8IB 1BQHA 1IM9D 2PTTB 2H6PA 2ORBL 5KVDH 1X5KA 4GRWF 4FTVB 5I1HH 1JGDA 2AXJA 5B38G 1FN4B 4LSQL 1J05A 4RAHA 4ZD3L 3OR6A 1XF5B 3MRBB 4QOKA 1U3YA 3BKCL 5DQDL 3SO5A 2ZNXA 2XPGA 3SKNA 5E9DE 5HGGS 3TJHD 3EJYC 1FZKB 3LDBC 1S7RA 5INDB 1SEBA 4HEPG 5HPOA 4R6UA 1JN6B 5C71A 1FNEB 3QNXB 2D03H 4ZTOL 2XY2A 1D7FA 2ZZUT 3DX9B 4A6YH 1MJUH 4QRPD 1SJXA 1SM3H 2AV1B 4IRJD 4NQEB 3MJ9L 1YN7B 3VFSB 4Z7QF 4O2CB 1I1YA 4UNVA 2NW3B 2NY3D 1HYRC 1JV5A 5E70A 1H5BB 1WAAE 3MLWL 2OTWB 2VUYA 1HILA 3GSOB 1K5NA 1S7TB 1KELL 4R7NA 5J12C 2JCCB 3T0EE 5GS0D 1YYMH 4ZOCA 3QIUA 1AI1L 1CICB 4P2YA 5EUOA 1AI1H 4N5UA 5F7FA 2N4IA 1IMHC 4MCZA 4BM7A 4J8RA 3FFCD 1TZGL 4NN7C 5E8NA 3RVWC 4BZ1H 4CW1A 2R0KL 3EDKA 3VXMB 1TZGH 3CCHA 1BREA 1W0YT 2WUBL 1RSFA 4FHBD 4OIAA 5D1XB 2R0KH 4M6NL 3VU2A 4HUUA 1YPZB 4HFWA 4OFKA 1S9VB 1EBPA 3PHSA 4M6NH 4XNXH 4DZBA 2JELH 4GKNA 3BVNA 5EZOL 2NR6C 1X5XA 2B2XH 4WW1A 2CIKA 1IGYA 1BD2A 2BVOA 1QBML 2ITCB 3ULVC 4W4OC 5IIEA 1MY7A 1WIOA 5CILL 3D39A 1IQDA 4YBQC 5I8EB 3NCJL 1QBMH 3TM6A 4MAYB 4HUVB 5IGXL 5CJQH 1ROWA 3TO2B 4EDXA 4C58B 5TH2B 5B3JE 3NCJH 1HHJB 5D1ZD 3B9VA 2BHYA 3IFPA 1N6VA 5ABDE 1FYTA 3U7YH 1Z9SA 4PGZA 1IGIL 2J8UE 4ZPVA 3MRKB 1K3ZA 3RVXD 2FZ3A 3ZKQD 5DK3A 1G0XA 3GJEB 3VXQA 2EE3A 5C6WH 4XPFH 4C55A 4ONGL 3GBLA 5CINL 5CIPA 1V3LA 5F8QC 3ULSB 2F15A 2RCSH 3MCLH 4OLUL 3PJSA 5FKAB 2FGZA 3KPTA 1YNTB 4RDQF 1A64A 5DUBB 5CGMA 5D7LE 4GG6F 3ZKSD 1F00I 3C8KA 1BVKA 5K9KB 4P9MH 4KDTA 5ESQB 1M4KA 4U0QB 1F4HA 4QY8A 5FCSH 2ZUWA 2GUOA 5KBNC 5CCKH 2E6PA 2LE9A 5HI4D 4FZ8L 3QZWB 5JO5A 1CIUA 4EXKA 1RZ7H 4APQD 4P3DB 4FQJL 4FZ8H 3HR5A 1UZ8B 1FL3A 2XTJB 5DI8A 5IB1B 3KPNB 3IXTA 3E8UL 3DO7A 2IAMB 2ZSWA 4PYHA 5CJOH 4Y0GA 3MRGB 4KI5D 4IIQB 4IRJC 4HDIB 4PJ8A 2Z8VC 3I75A 4MMXC 1SJHA 1CZ8H 3OG4B 4PRAB 5FO7A 2DWEB 1P1ZA 2NY3C 2RR3A 2XWTA 1WZKA 1AD0B 3BRGC 1AHWB 2OSLB 1CFVL 4DKEL 1S5HB 3QJHB 2O26U 4LNVA 2X4UB 1U3HB 4WUUD 3HS0A 5I30L 1UB5B 5A2KH 2OL3L 4PRID 2HLAB 4HUWB 1X5LA 5T1LA 2BJML 1QACA 1CXLA 4JY6B 2OL3H 3U4BH 3OR7B 1MAMH 4I2XE 2KZ1B 3ULUD 1FGVL 1RJYA 3WFDH 1WZ1L 1NFIA 3QQNA 3AY4C 1JWSB 3UC0L 4AQ1B 3VXTB 1PKQB 1DN0A 3O9WA 4TVPE 1ZHNA 3O2WL 1C08A 3DYOA 5DEFB 1X4ZA 3F7YA 2PR4H 3O11B 4X0KB 3O2WH 2V7NB 4ZOAA 1JPSL 3M17B 4PS4L 3F5WB 3PWPA 4XNUH 2EDXA 4F58L 3WHXB 4P9HH 1FSKB 3P11H 1EGJA 2RAMA 1BBJA 1YEIL 2GSGB 3OJMB 4WWKA 4RAUB 1MFBL 5HDBE 1SY6A 4KMTH 4JY4A 2APBA 2ZSVB 35C8L 2UZYB 4FQCL 3QA3A 2GTWA 2ADFH 3O8XA 2IFFL 3C5SA 1MFBH 1QRNB 3QDJB 1CDUA 3VFNB 4WFFD 4HS3A 1T7YA 1M6OB 3P77B 2GT9B 2ARJA 2L7JA 3I6GA 5HHNB 3RVXC 3EOTL 4YDIH 4OKVA 1FCGA 4IJ3B 4P46B 3MGOB 1X5GA 2AV7A 3SQOL 1ZHKA 4IEFB 3GHEH 2Y72A 2VLME 2X70B 4U6VH 2GAZB 3SQOH 2AXGB 4YK4B 4LGRB 1WICA 4M5ZL 4M7KL 2HT2D 4QHNA 4KRMB 2NY1D 1YPZF 4UINL 4M7KH 3PGCA 4U1LA 3QWOB 2H2PD 1PLGH 5KS9A 3GMOB 1CI5A 1CF8H 2VDML 5ICYA 1A7NL 5GGTL 2W60A 5TF1H 4CU6A 3GMNA 3U30B 4N8VG 5DRXA 1A7NH 1I1FA 1MI5A 2L4OA 4DCQA 4APQC 3I50L 4OLVL 4JRXD 2JTDA 4DZ8A 1IKNA 3W39A 1T0MA 3NABL 5LGJB 5DHYB 1ZLUK 4E41B 4ZXBA 2SEBB 1EXUB 3DXAD 5K9QI 2OP4L 3JWDL 5I1CL 5DLML 4BKLA 4OBSA 4K3GA 3SGDH 1PX3A 4DUWA 4BFIB 3IGAB 4EN3B 2OP4H 3CXHJ 1UACH 1BM3L 3PG2A 1XCTB 3FONA 4KU1A 3RWFA 5C0JA 5ISZB 4QNPF 1A21A 1ULVA 1BM3H 1I1AB 1A7PL 3SDDD 5F9WC 1KSRA 3P4NA 4R4ND 3DVNB 3D0LB 1YEHH 1G84A 1KTDB 4KJPD 4P5MB 3HNTH 4I3RL 4KZEL 3TH2T 5J06A 5DJCA 3TBWA 5BS0B 3L9RB 4KZEH 3QG7H 4DGYH 4X9IA 1Z9LA 4JG0L 4WFGD 1UWGH 1FZMA 4EVNB 2ATPB 2GFBB 3U0WH 4XPHL 5E00B 1CDBA 3EYOB 1RV6X 3LZFL 4JG0H 3RWHA 2BX5A 1P5VA 1ZE3C 4XAKE 3FOMB 3FAWA 3KJ6H 3I84A 2VDPL 4Y88A 1EK3A 4WI5A 3JV6A 3LRHA 4G7YL 1KJ2L 3S37X 4F7PA 3EO1A 1QSFE 3O6FC 1MCDA 3FRPA 1V3JA 3DMMB 4ZFGL 2Z91A 1JWUB 4PJFB 2XT1B 1QQDB 5D7JB 5I9QB 4M7LL 4QRUA 4QHKJ 3IS1X 5GS1A 1KACB 3ZTJH 1GRWA 4KGLA 4GS7B 2XXMB 4LCUA 3CH8A 2G9HB 3QUZC 5ANME 5EDXA 3BPOB 8CGTA 4WO4B 5FYKL 5JOPE 2P8LA 1XF1A 3CK0H 5C0DB 4JM2F 4KMQA 1KCUL 4J6RH 4HAFA 3HI5L 5FECB 3OTTA 3U4EB 3MLSL 1GGCL 5ITBL 3S36X 3HI5H 4OCYL 3P0YL 2YSSA 5JQ6H 1CGVA 1ONQA 1S7VA 3ZL4H 5IVXA 1BFVL 2BVPA 1NC2B 4KRNA 2WMPA 2O5ZH 4I3GA 1BFVH 4HQQL 1R3HB 3C5ZB 1CR9H 4QOKD 2X4TA 2FECI 3O2DH 3GSQA 3HI6L 2YKLH 3MGTA 2HT2C 5IB3A 2V5TA 3IRZA 2NX5B 4TPRH 4BZ2L 2H2PC 1H8SA 4PTTA 3S35X 4PPTA 5D96B 3CFCH 4PJGA 2H26B 5K93A 1XR9A 1HHKB 3CLFL 4U1GB 2I07B 2UUDH 3QDAA 3QXUA 3TC9A 1PSKL 5F72S 4M3JA 4JCLA 3V79C 2OQJB 3IFNH 4EUPH 2PW1B 3FT4B 2VE6A 3LEYL 4E42A 2E9JA 3MGAA 3DSNA 3L7EB 1VACB 2JF1A 1RHHA 4PJAE 2F8OA 3LEYH 1CIDA 2O5YL 4XPBH 3L3DA 4P5TC 1ORSA 4HC1A 1NDMB 1BP3B 1WBXB 7FABH 5ETUA 5GISH 2O5YH 5DSCB 4U7KA 3WDHA 5EC2A 5I6XB 4G42A 4PJ5A 2GCYB 3QISA 1XF3A 3EDEA 1QFUL 3S5LG 3BH9B 2D3VA 2VMFA 4GRWH 3OWEA 2APXA 4L4TD 3SDDC 3C9NA 4R4NC 1PZ5A 4K3EL 4NRZA 3P9LA 3PDOA 1J7VR 4GG8B 3KWWB 2Z92A 1AO7E 3O4OC 3D9AL 4KJPC 1EVTC 2BVUA 1MJ7L 2ZOKB 5F1IB 3WFCL 2OMBA 1FE8H 3ARVA 2AGJL 3VXUB 2EDYA 1CDHA 2V17H 3HAEG 4F7TA 1M7IA 1MJ7H 4NQDD 1QR1A 4XMPH 2NXYB 1LK2B 4C56E 1RZIB 5IMOB 1IAMA 1YUHA 4LSVL 2DL9A 4FFYH 5EORL 2A0LD 3BIBX 3RIFK 4PRPB 3MJ9A 2VL5B 4MJ4A 4QRTB 1F6LL 5DF0A 1FQ9C 2BMKB 4Q9QL 3OX8A 5L8JB 2YN5A 3ARFA 1I7UB 2CMRH 3PXJA 2UZIL 3ALXA 2WUCL 4M8QB 5E1HB 2L0DA 1DSFH 4LKXB 4LLVA 2HFEB 4OIIH 5FDYA 3ILQC 3OJ2C 1FFRA 4DN3H 5JHDB 1UGNA 4UIKL 5GXBB 3KDMA 5MEPB 4F37K 1F11B 1K6QL 5HVHB 5EU6E 2GJJA 1C8PA 4UIKH 1FZJB 3AMLA 4ZUVA 1N5YH 2X05A 1KPRB 3MLVL 4KMLB 2NY0B 1NJ9B 5E8OA 1N2RA 5DJ2A 2ADIB 4ZODA 3C60C 3WIHA 5BZDB 1R3KB 4XH2B 4D9RD 1IGJA 5IB5A 1X7QA 1MHHA 2EYRB 1M05A 1W0WA 3V6ZA 5DMGC 3V4VH 1WCBB 1OF2B 4ONFH 4ZUWA 5GGQL 3HTLX 3LKSB 4RFNB 2AJUL 2X9YA 1RAMA 1RZ8A 4NQSB 5IFJA 3BUYB 2AJUH 5E9DB 5T1KD 3RL2B 4F33A 2PYFA 4PY7B 4DVBB 3UTPD 4AEIL 3K4DA 2CJUH 4JKMA 3MLZH 3OF6A 1DTUA 3NGBB 2HJFA 4JO3L 4YWGL 1YNKL 5FKPB 1HSBA 1FIGL 4DJMA 2HVKB 1MHCA 3T77A 3WO4C 4D8PA 4OZHE 4G80A 1F6AB 1YNKH 4G6MH 4D9QD 3DETD 4NC0B 5DMIH 1T21B 4R0LC 2GK2A 2ESVA 4WEBL 5C0FA 4U1JA 4K23L 3BJ91 3PP3K 2EC8A 3IYLW 4WEBH 3QQ9D 3T0EB 5I19H 1I7ZA 2FR4B 2KUTA 3ARZA 3ZKXC 1S8DA 5IQ9A 3MACH 1A4JA 5FGRA 2Q8AH 3ZMRA 5E2UH 1P7KB 1F3DH 3B5HA 1YQ2A 3DPBA 3HRPA 1NGQL 4M6ML 5GGVL 5C8JB 2CLVB 1PYWB 2X41A 5ITFB 2R1YB 1NC4B 5SWZD 3FHQA 4MDJB 5DS8A 1KIQA 2BNQA 3RWCA 1FH5H 3O9WD 4G8EB 5C07E 2OTUA 3GMLA 1S7XB 5EBLB 5E5RB 5HYJB 3SCMD 3GJFA 3MLYH 1IC1A 4WI9A 4EZMA 4MXQD 3GSXB 5ESAA 5IJVB 1F6FB 3PWPD 2B8OT 4DW2H 3BGMB 4ONHA 4QRRA 1R0AL 3MCKA 3RNQB 3FQNA 2A0LC 4PJ9A 4X8JB 3NAAH 4Y8AA 4XXDB 3HB3C 1QNZL 4KI5E 5DD6A 1S5IH 5B39B 1WWAX 1K8IA 4KJWD 1AY1L 3O8XD 1N6QL 5DFVD 2XWJA 4NZTH 2FL5A 4F8QA 4L9LA 4XPTH 5T3ZE 4PG2C 5IB2B 4LBEB 5AAWA 1NSNL 2J8UB 4HWBL 1Q94B 5CD3A 4NO0B 1BEYH 3M8OH 5I17B 1NSNH 5DYOA 1V7ML 3HE7B 3P9MB 4YHKL 3WNPA 3O2VH 4XP9L 1T4KA 2XY1A 2QJDA 3IDYC 4MJ6B 2RQ8A 3TVMD 5CAYB 5EH1A 4XP9H 3UTSD 5GRUL 2K3TA 1CE6A 5I0DA 1LDPL 5F7YC 1OTSC 3HMXA 4P2OD 3BRFA 1H3GA 5C0GA 1R3JB 5F71A 1LDPH 5GSRA 4JHWL 4LASL 1NGPL 1ZT1A 3SJVA 4HKZB 3FJTA 4KK6D 1IM3A 4JHWH 5DJYB 1NGPH 3HUJB 4KGJA 5DC4B 5DJAB 1MI5D 2XACC 1ETZA 1GZQB 5EIQA 1INQA 3LV3B 1E4WL 4U1MA 3REWA 3MCG1 3S34L 3MJ8A 4M9OA 5FUOL 2X4OB 2ADJA 4PLKD 5EIVA 4CN6A 4U49A 4P2RE 5FUOH 4ZXBD 1RIVH 3WN5A 4OD3H 3MREB 3L3GA 2ZG2A 43C9B 4H26A 2V2XA 5EG6C 4U1KA 3I6LE 3MLRL 1FBIH 5BO1L 3QNYA 2LV4A 1P6AB 2OK0H 1QD0A 3MLRH 5BO1H 4Z0BH 3QEGH 2LU3A 1X5HA 4G6AD 4L4VE 4S10A 3WMSA 3PE9A 3TIEB 2DKUA 5BCAA 3CC5A 2A6DA 5TDOA 1G6RB 2VLRE 5L2KA 4NJ9L 4YXHH 4U3HA 2H41A 3L1OL 5FUCE 3BKJL 3TBYB 5IFHH 1BF2A 4X80L 1EEQA 3VD5A 5FF6A 3KLHC 3FN9A 3QDMB 2VJXA 3VXSD 1FNAA 3PP4L 2DRUA 3BKJH 4WI6A 2HTLD 1P7QA 3G6JE 3KHOA 3TA3C 4X4YB 1KEGL 4PREA 5HYSB 5GGTA 5HHPA 4IS6B 4OFVA 3BDBA 4XNYL 2HMID 3TGXA 1UM4L 3SCMC 5FEBA 2DJSA 2V5RA 1D5XB 1QLRA 4MXQC 4JJ5B 4XNYH 3MRMA 4L3EA 4LOUD 1CG9B 3T2OA 4G8GA 3HE6A 2VDQL 1G0DA 2CLZA 3Q3GB 5ID1A 1HKLH 3C2AL 2VDQH 2G75B 2R1WB 5FA3B 2YPLE 4M3KB 3J8F7 2BY3A 5EWIL 1WAAF 1FG2B 4C4KO 3VFPA 1B6DA 5EWIH 4FQQA 4KJWC 4JPWL 5D2NA 5DFVC 3QXDB 3OKNB 4PGDA 4Y5YA 3WNLA 2KBGA 3WUWB 1KUMA 1RJCA 4FZEH 3SDAA 4CMHB 3NPSB 1BOGB 5I1JH 5FM4A 4QXGL 1XH3B 4JN1H 1FDLH 4WHDA 1CD1B 1EJOH 1YC8A 1A6AB 1BFOB 2BRRL 4JANA 3TVMC 4IHOB 1KXVC 4MSWB 4P2QB 3WFBH 4TSCL 4S1QL 4ELKB 3SDXE 1JHKL 4K9EL 1MVUB 3IKKA 4P2OC 1TETH 3O4LE 4M62L 2X7LB 1IGCL 4KK9C 2VXQL 1QLFB 4R2GB 1JHKH 4Z77B 4K9EH 1P2CA 3HG1A 5JUEH 4M1CD 5DJZA 1CDGA 1KJ2A 4FFVD 3GDBA 3O45A 3FQWB 4MNGE 4WFED 4OI7A 1HXMB 4RIRB 4HT1H 1JK8B 4NZUL 4HMEA 3VWKA 1RK1B 1UKQA 3KPOA 4CMMA 1G7MA 2KQMA 1IAKA 5KZCD 4Y2DA 1KG0A 1T6WA 4NHUA 3HZVA 5B3JF 4HIXH 1MLBA 1FFNB 4PJ5D 1U41A 2J8UF 4UAOC 4XI5C 3ZDYE 1KLFA 5BVJB 1U2HA 3GBNH 5BV7C 5L2JA 4HXBL 1CBVH 4I18B 1G9EA 3QI9B 3WL9A 3LRSA 4G6AC 1CXIA 4OAWA 2CIIB 1D6EA 4GW5B 4WV1B 1RUPH 2YC1B 5EZLA 2X10A 2H2SD 1N0XH 1B2WL 3G5YA 1IT9L 3JWNC 1OSZA 4XMLH 3L3HA 3EYVA 5DJDB 2EIEA 2R2BA 4KKAD 4Y5VC 1SJEA 3C09C 2V5YA 4XP4H 2R0LH 2Y7QA 5KOVC 2JB5H 1MFDL 4NQCD 3HUJF 3CFEB 2HTLC 4L29A 3N1MC 1BIIA 4JDVA 3BD4A 1MFDH 1YJDC 4PIRF 1E27A 1Y6MR 3DX6A 1WBZA 5AZEL 2JIXA 2HMIC 1U8KA 2BHZA 5FYLE 3TO4A 1T1YB 5GJTL 4NUJB 4LOUC 3TN0B 3ARFD 1CVRA 3FT2B 3FT3A 3NVQA 3UMTA 5GS2H 2XZAL 5IEKA 2E9BA 1W0VB 2BHUA 1CXFA 3UPRB 2GHWB 3ARED 1FNSL 5HYQB 2XZAH 3STZA 1Z5LA 1A4KB 3BO8B 2X9WA 2HKFH 4GMSL 5JNYB 2Z93B 5J12B 4DGIH 4NQTA 3T0DA 3SGDI 3MRNA 2EYTA 4GMSH 1A14H 2DI7A 3RFZC 3MRJB 3SKJH 1OB1A 1MIEL 5EUOE 1H3UA 2YD6A 1P9MC 4K3HA 2ICEA 2DDQL 2CO6B 2LAAA 1TQBB 3HI1B 4F15B 4CAGA 2N1KA 2EDDA 2Z31D 3MROA 4NN7B 3GB7A 1A1MA 1VGKB 1XF2A 3B2UD 4ODUA 3MRIA 1OGAA 1Y18B 5KN5A 5DMYA 3PHQA 4OQ1A 4CNIA 8FABA 1E6JH 1F97A 3JTTA 2FH6A 1MFEL 4IOIB 5DRNA 4YHYB 3H8NA 5DA4A 3MRFA 3LY6A 1EJ6A 1QBAA 3ZDZE 2Q6WB 3NACH 3FFDA 1MFEH 4XPAH 3SKOB 2WBJD 4I48B 1Q9WA 4Z18A 4M1CC 1F4YL 1BFSA 1J0ZA 1UKSA 1BD2E 4FFVC 4PJEB 1AGBA 3BGFC 4Y19D 2MMXA 4X9GA 3D39E 3KYMA 4X9FA 5DDHB 1QYGL 4F3FA 4S1RL 1UYWH 2H1PH 1CK0H 2IQ9H 2VQ1A 1FYTE 3SPVB 3V0WH 5MHSE 1N6UA 5TDNB 4LSTL 2NY7L 2VZSA 1JJUA 1XMWA 1OD9A 4HUXA 1KN2H 4KPHH 2FSEA 1QSEB 2NY7H 2E27H 1U95A 3UBXG 3WS6A 1KULA 3O41B 4P4KD 4ZPTB 2N7BA 4XVSL 1ITBB 1CTNA 1X44A 5C1MB 1K2DB 4KZDL 3G6DL 1HDMA 5T1MA 4O2EB 3QQ4B 4P99A 4XVSH 2A73A 3NMEA 5F3HB 1HHIA 5AZ2H 3S4SG 4HKXA 3NFNB 4KZDH 3G6DH 4LHUG 5C6TL 3ZYZA 5IBLD 1AO7B 1G7HB 4KFZC 4KKAC 4NN5C 5C6TH 5JHLH 4JJHA 3RBSA 4JKWA 1YEGH 4BH8B 4WU5B 1FZOA 3DHMA 3MBXL 3UTTA 1U58B 2VSDA 4B50A 3QUYD 5F9OH 4LPXA 4C56B 4LDLB 3UO1L 1ZT4A 4LLAA 3WKNA 4BSVA 5F7UA 2AAVA 3CIQA 4E5XA 2OZ4L 4XZUB 4GAYA 1CT8B 1ZTXL 2DI9A 4Z0XB 1QSVA 4X98B 5ALBH 3CAFA 4IMKC 2UYLA 4IRJB 2OZ4H 4HLJA 3CUPB 1H3PL 1ZTXH 3WIIL 1DEEA 4LCYB 2P47B 4LLQA 2NY3B 4H1LB 3WIIH 1QFWM 4G3YL 3AREC 5KOMC 3KNBA 4UDTA 2VN4A 4JVWA 2IADA 3OHXA 4HX1B 1T22B 3C5JA 1ZLVK 2VZOA 3L5XH 1JPFB 2A38A 1JZ5A 2FHBA 4LHJB 4N90E 5E1AA 3BP7B 4JPIB 4UV4H 5HSFA 2AEWA 1RURH 2C26A 1J11A 3FQTB 3BP6A 3QPQD 4F9PC 4XC3L 3U46A 4LEOB 1VHPA 5FO9B 2PO6C 4X6FB 2DQHH 1FL5A 2QADD 3FFCB 4MA7L 2Z31C 5D2LA 3OPZL 1BQHG 1TJIH 1D5MA 4ZAKD 4XCNA 4XC1H 3MR9A 2AJZA 3MX0A 5HGBB 1GGUA 4QGYA 3OPZH 5FGBA 3LEXA 4PV9A 15C8H 2WBJC 1BVLB 2RFXA 1EEZB 3PWPE 3IDNA 1JGLH 4L1HA 3MXVL 5JIIA 3NCMA 4FXKB 2VITA 1NDGB 1HOCA 3MXVH 4HAGA 1A6WL 2ZOLB 3V5DA 5HHOD 5FDWA 1CFNB 3JXAA 3PV6B 3UTOA 4AT6A 1TMCB 4WEUD 3KLDA 1A6WH 1JPGB 2C1PB 1RD6A 2ZNWA 4I1NB 4JZJC 4OZHB 5HXMA 4GRLC 3X3FL 5D1ZB 1FN4A 1NCBH 4HWBA 5EU4B 2F8XC 1MHEB 4R8WH 3Q5TA 5LBSH 4RGOL 4MQSB 4JFQA 4YPGA 3TESA 3GI8L 1XF5A 3FB8B 3MRBA 1SEQH 4RWHA 2DIBA 1S7SB 3B8SA 1EO8L 3GRWL 3GI8H 3HRZB 1OTUD 4P4KC 4MD5B 4A2MA 4MQXD 2VKXA 3RJQB 1JHTB 2BY2A 1EO8H 3B4NA 5AD0B 3WS3A 4I9WE 3ARWA 4OTXH 5C3TA 1ZVSB 3EYFB 1DBAH 1NAMB 4XAWL 3L3OB 1LHZA 5EU5A 1FNEA 1KLGB 3ARGD 4PUBL 5EBMA 5IBLC 5KS9E 4N0YL 5E8PB 3DX9A 2R69H 2IG2H 4NQEA 1YN7A 5T5NF 2IH1A 2VXTL 4JDZA 4N0YH 2NW3A 1BGXH 3KPMB 2WIIB 4PJEF 4PY8J 3RPIB 3L3KB 3DRQB 3LRGA 2OTWA 1MRFH 2WIMA 3GSOA 4Y4FD 2OJZL 4O51A 3WBDA 5CBAA 3QUYC 3HMWL 5J9PA 3P3YA 4TUJB 5CSBA 3HPJA 2JCCA 4NT6B 5AUMB 3VGFA 3HMWH 4UILL 1A6ZB 3FQRB 4DK6A 3WHE1 5D1QC 5DRZB 1CICA 3SGKC 1LE9B 1KCVL 4CRPA 1KCSL 4HFUL 4J3TA 1SBSH 3LKOB 3KJ4C 4XNQB 5CHNB 4O9HL 1M7XA 3T2QA 1KCSH 4HFUH 2C5DC 4UNUA 1I75A 3OJDB 4LVNC 1BAFL 1U8HA 2QQNL 3LEVL 4WUUB 5F9WB 3VFMB 5DJ8B 2F8VA 1ACYL 3NA4A 3T3PE 1BAFH 4PRIB 3HZMA 1HEZA 5KW9L 5MP6L 1LILA 5DVMA 2GTZA 3CXDH 4KJYB 3QPQC 5KSVB 5SWSD 2NY4D 2NPLX 5GGRY 3MLPA 1ZT7B 5KG9A 5JW4Q 2QADC 4E0RA 5IK3B 1FAIH 3FZUD 3JVGC 2ITCA 5I66B 4LARH 4ZAKC 3ME0A 4MJIA 5I8EA 2YXFA 4Y2OA 1A6PA 4MLIA 4PB0L 2MCG1 4JDTL 3CFIC 1XF4B 4ZDHA 5I74C 4O4YL 2Q86B 1FRGH 3UJJL 1AKJB 3MRKA 1P7HL 1PY4A 4U1IA 5JPMA 2Q8BH 3MNVB 1RJZA 3X12B 5IP4A 1Q38A 2YD5A 3K3QA 1JNHA 1XGTB 3QPXH 1O7SA 3ULSA 4K3DL 5BW7A 5FKAA 1X5JA 4S11A 4NDMB 4K8RL 2XZQL 2YD1A 4UZGA 2X4PB 4K3DH 1U8LB 1S7UA 2I5YL 5GGSA 4Q97A 5K9KA 3CH1A 4JFYA 4K8RH 1YQVH 5E94B 5IVXE 4L4VB 5MEND 2I5YH 4CADB 2XA8H 3O0RL 4CKVX 5B8CB 2VLRB 4K7FB 3IKCA 1DDHA 2AK1H 4OLYL 4M93C 4Y8DC 3STLB 3AM8C 1UZ8A 1TDQA 2C3VB 4H0IA 4M4RA 3K2UL 2NY1B 5IB1A 5I1DA 4UQ3B 4JFHD 3ARGC 3QIBA 4O02H 1J10A 1H15B 1PAMA 2FJHB 4WTXA 3K2UH 1YECL 1IC7L 2A9ML 1V3KA 4PJGE 4HDIA 1EMTL 2PW2A 1M71B 2DWEA 1YYLL 1IBGL 1C5BH 5CJXC 3TO4D 1E4KA 4ZOBA 1AHWA 2OSLA 4R4FL 5AYUH 3WXVL 4NJAL 1IBGH 3QJHA 4Y4FC 1KOAA 2X4UA 1U3HA 2EE9A 5K9OA 3TNMB 4PJIE 1IL1A 4NJAH 1GGIL 4JRXB 3PWUA 4V1DA 4HUWA 2PKDA 4P59H 3UEZA 4OZHF 3G5VA 2VZTA 2ICCA 3CVHA 4NM4H 5I16A 4L9DA 1OVZA 2JJUA 3DXAB 4NNPH 4MX7A 5IFAL 1FJ1B 3MYZA 4MD0A 3V7MA 2AI0L 3DX7A 5CEYA 2UUDK 4LNRB 1AFVL 3NZ8B 1URLA 1MOEA 4WENB 2AI0H 3N1FC 1Z0NA 2ZCLH 2AERT 1JWSA 1RFDL 3SDDB 2BOBB 5HGHA 1PKQA 1S7WA 1X5IA 3BP5B 1RI8A 3RX7A 5JW5A 5DHVA 3LQAC 4NO2B 4POYA 4OD2B 2OR9L 3MV9A 2Q76B 3BHBB 3O11A 1FVDB 1JE6A 2V7NA 3LCYA 1G7IA 4HWEL 4Z5RA 4X4MA 2APWA 3MV8E 2NY4C 4NNYB 5HHMD 1EHLH 1CGWA 4P2CG 2C7UA 3FZUC 2R56H 5F7KC 1N4XL 4U0RB 2VQUA 2FHFA 3UTQB 3U0TA 1SMOA 4K94C 4NOFA 1N4XH 5F9JB 4RRPG 1LP9A 2G5BB 3P2TA 1JWMB 4MNGB 5BRZA 1GIGH 4KAQH 4P3CH 2A6IB 1QRNA 4GMTL 4HGWA 5GPRA 2ZUQB 4EOWL 4KI5F 1I8IA 3SKMB 2YZ1A 5KTEH 4GMTH 3VMPA 3GEWB 1OARH 4GAGL 1YNLL 4ZUSA 3D85D 4Y1AD 5CP7B 2E8YA 3PGFL 4MLSA 1T1XB 4GAGH 3SDCB 1G6RL 4FQHA 2ARWA 4XWOD 2OI9C 4HCRL 4HXAH 4H8WL 3EZ8A 1F13A 4OCLC 4NHCH 4HV8B 2PUQT 3AU1B 2IBGA 2H6PB 4H8WH 1JGEA 4RQQB 3WIFA 4WI8A 4GXVH 4J3XA 4LP5A 1JGDB 2XRAH 4YPJA 4AENB 2DMBA 4FQ2L 3ULUF 4UOJA 4NM8L 1UWXH 2NQCA 3IDIA 4ZOEA 2CRIA 3OR6B 5EUKA 3DYPA 3L7FB 1BOYA 4NC1E 4NM8H 1J1XH 4JQIH 1PD6A 3VFTB 3RZCA 4QOKB 5FIEA 4LPWA 4KY1L 1RZKC 3L5WA 4XPGH 3MRDA 2XPGB 3SKNB 3UTTD 5E5MB 3OKOA 4IRSC 5LGJA 5DHYA 4F7EA 4KRPD 1S7RB 4E41A 4GBXA 2SEBA 2J5LC 1OY3B 3SE9H 4ZS7L 2N56A 3EIFA 4EKXA 3KR3H 3IGAA 2DTML 2VDRL 1TTGA 5I1EL 2J88L 3CGTA 1RUAL 5DD5H 3WO4B 5TFSL 3DVNA 4KKCD 3R4DA 1HILB 2E7HA 2ESVE 1A6TA 4OD1H 1MEXL 2NNAA 5TFSH 4R0LB 3ZDXE 4N0CD 1PX4A 3AFLA 4R7NB 4XBEH 1GC1C 1C5CL 1HWGB 1S9XA 1MEXH 3OSKA 4RWYL 4Y4HA 5IWLC 5ECJE 3QIUB 1MCLA 4PLNC 4AL8H 3ZKXB 3UYRH 2OR8A 4RWYH 3IJYA 3VFWA 2GFBA 2Z0BA 3MOBL 3EYOA 1IZJA 2BNRD 3KXFE 4L4TB 1BBDH 5CSGA 4J8RB 2GJ6D 1GYAA 4WHYH 5E8NB 4NSKA 2BNQE 1I3UA 3MOBH 2X1QA 3RA7H 3CCHB 3P30L 2EDNA 4HG4K 4UT6L 4HUUB 4PJFA 3CDGA 3P30H 4HFWB 4KTDL 5D7JA 4UT6H 4DZBB 3DECA 4W81A 4EDWL 4GKNB 3BVNB 2VLKA 2G9HA 3IDXH 4QRRE 4JR9H 3I2CL 4WO4A 1EVUA 1U9KA 2DQUL 5DQJB 3TFKD 1JZ2A 4WW1B 2CIKB 1IGYB 1BD2B 1T7XA 5JMRA 4EQ2A 2BVOB 3I2CH 4JPVL 2GKIA 3CSPA 3L95A 3U4EA 2VNCA 3IAPA 2C1OA 2C4FU 2MQCA 1JGUH 3QP3A 2HRPL 4EDXB 3UJIL 3D3VD 3T2PA 3IVKB 3ROLA 3MA9L 3IFPB 1LE5B 1FYTB 5ACLA 2HRPH 4KROD 4TNWF 4ZPVB 5ADPL 2K1MA 3MA9H 2FZ3B 1R3HA 4XWOC 1U8OA 5CEZD 3Q6GH 1YEDB 5FAAA 5CIPB 4R90L 2UVFA 5K33A 2VDLH 3B6SA 3PJSB 1GSMA 1S9WB 4R90H 2YPVH 1V05A 3IFOA 1OGTB 4L8SC 3SDXF 2ED8A 3SJVE 4W70A 4GKSA 3O3AB 2YD7A 5JIKA 3V0VA 1UXSA 3AS2A 5FXCH 1RUQL 4WDIB 2C4FT 4QY8B 3FT4A 2GUOB 3L7EA 5I8CB 1GZPB 3O6ML 2PETA 1VDGA 4TNVF 1LDSA 5JO5B 5JLZB 1NDMA 3IDJA 3OKDB 1CXEA 25C8L 3O6MH 2NZIA 3UZQA 3HR5B 4YC2B 2ICWJ 1FL3B 5DI8B 2JJTC 3IXTB 3DO7B 4I0KA 2GCYA 3SE3A 2CDFA 3PIQB 1IAIH 2B7DT 3TJEL 4Q58C 1BVZA 2EDFA 3ALWA 5DUML 1KIPB 5SV3A 4PJ8B 3I75B 4YZFE 1SJHB 3BH9A 4JFFA 1AC6A 1P1ZB 3V7AE 2R29L 2XWTB 4JO1H 5GHWH 3NTCH 4HKJA 4YE4L 3LPGA 4KKCC 4ORGB 2Y06L 3OZ9L 1RU9H 5J11C 2DQEH 3HS0B 3KS0J 4N0CC 3A67L 5DWUH 1DZBA 4DUXA 1T2JA 3GRWA 5L2KE 3CZFB 4M1DL 5T1LB 5F1IA 1DL7L 3M1BA 3VXUA 2AS5M 1KENH 1DL7H 3VGEA 3LS4L 3ZT7A 1QKZH 2DLHA 1EFXA 4FMKA 1NFIB 3RTQD 4B5EA 4OCXH 2VL5A 3THML 4MJID 1DN0B 3O9WB 3ULVL 1ZHNB 1GOFA 4FQIH 2VZUA 1C08B 3N85L 3SCMB 3WJJA 4LAQL 3F7YB 3GMMA 1AC0A 4L3EE 2EH8H 2ZPKL 4G8GE 4JQXC 1UWEH 3LD8C 5KSAD 5I73C 4LKXA 1HXYA 2HFEA 1FGNL 4LAQH 3VH8G 1H3TA 3PWPB 4FABH 3NCEB 1NEZB 4V2CB 2OX5A 4LP4A 5JHDA 3WFHA 5DA0B 3TFKC 5MEPA 1QZ1A 1F11A 1FGNH 1U8MA 3DV6A 1IAOA 3SDYH 4XVUD 4I0PD 1T83C 1MWAB 4Z76B 1FZJA 4WWKB 1KPRA 1MCKA 5C08A 1FP5A 4RX4A 2VABB 4YR6B 5D2NE 3I6KA 3QA3B 2GTWB 3O8XB 5BZDA 3C5SB 2FLBT 4HS3B 3EO0B 1NMBH 1INEH 2E8ZA 5JA9A 4LSPH 5LGHH 2HFGL 4OKVB 3V4PL 2WSKA 1EUTA 3LKSA 1ZHKB 2BSTA 3RGVD 4TQEL 2HFGH 4LSSL 4PTUB 5L88L 4W68A 2CK0L 3QULB 4LSSH 3T0BA 1RULL