4ZPVR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
molecule keywords D12 Fab Heavy chain
total genus 45
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zpvR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zpvR01
2AJFE 4L3NA 5DO2A 3D0GE 4QZVB 4ZPTR 2DD8S 3SCLE 3D0HE 2GHVC 4ZS6A 2GHWA 4KR0B 3SCKE 4XAKA 4ZPWR 3D0IE 3SCJE 4L72B 3BGFA 4KQZA 4ZPVR 3SCIE
chains in the Genus database with same CATH superfamily
3TZXA 2CJYB 2DGQA 3GIKA 5HJXA 3CF5Q 1IBMJ 2C2ZB 4DR5F 4V19J 3Q8SB 3HCXA 1ITPA 4PWDB 2RHQB 3VHQA 3AT1B 3DRYA 3BEGB 4IQ2A 3LH2S 3LW5C 3N28A 4M5LA 1FKRA 2UUAF 5DM6Q 4Z2LA 2J9EA 4HEA9 4TU8A 5KFWA 3NLCA 3GYNA 5DDRC 5LMNJ 2UUTA 1S12A 1NBEB 3R9LA 1Q8KA 1XR7A 1LWEA 4WK3A 2IAJB 1N6QA 2LJ4A 3KLEA 1WNOA 2SXLA 4RW7B 5C2CA 2WCXA 3BV8A 4LSLB 1Y9OA 5A8RA 1LWCA 2PC6A 2VASA 1Z4UA 4CO5A 3KK3A 4PXBA 1RI7A 1KFSA 2GQQA 4LR8A 3V2UC 1VFJA 3C8YA 4KGMA 2O9OA 4DV5J 4URIA 2HFOA 4PG5A 2HLTA 4C6AA 2UP1A 5GAGI 5FDLB 3M8PB 3R3TA 2VQFJ 4GKJF 1BKFA 1OMSA 3K5OA 3BKUA 1VC5A 5HLFB 1BQMA 5KT7A 2F23A 1S6QB 4CNYA 2CPXA 2P2CB 5KOXA 2OPSA 2BJ1A 4NRUA 3M8QB 2ZC3A 3Q8RB 4WE1A 1HKMA 1NPRA 1WTFA 3HSDA 2F3JA 4WE1B 1HBMB 2EEYA 1YGYA 3BR8A 3K89A 3MOZA 1PAEX 4H4OA 4EO6A 5J2NA 2O67A 3G9CA 4XK8C 5GAGU 3IWXA 4WFXA 3W63A 2IDEA 1RHMB 2CZVC 2NZCA 3BN7A 2QTWA 2DGOA 3MHYA 3CCTA 2C3OA 2POKA 3CMQA 4K4YA 2W4PA 1DURA 1JNSA 2QL9B 2V4RA 1YJWS 3CJQA 2HWTA 1KT0A 2MZSA 3G6MA 5EGYA 1N36J 3TVKA 1F3FA 4KTQA 2QC3A 1QSYA 1CJKA 1T11A 4NEZA 2JLEA 2YNIB 3P8BB 4OI3A 4Y3CA 1PBUA 3KHRA 2B9EA 3BQ0A 3BO2A 3GP9A 4NCGB 4RW7A 4M5DB 3ZO7A 2ALZA 1WEXA 3FVYA 3O5FA 4LT6A 4X64F 2F65A 1HKJA 3PO4A 1FCAA 4B3SF 3AAWB 3T1YJ 4CLWA 2FLNA 3ENAA 2V2ZA 4TVAB 1V3ZA 3ARTA 2RU9A 3K58A 3D66A 4NXMJ 4B3MJ 5EX0A 4DRKA 2MNTA 1JNRB 3DC2A 3TRGA 4DI6A 3KK2A 3JYTB 4FYDA 1KC8T 2XPAA 2G41A 4LAWA 4TY9A 4M94A 4KO0B 1U2CA 2CDRB 3ZZUA 1FJCA 4CQ1A 1D7IA 3W4RA 4QBUA 2MKCA 3EGZA 6AT1B 5EWGA 4ERDA 4EEYA 1RT3A 3MXHP 2F21A 3BGUA 1S9EB 2V2KA 3MM9A 4MTPA 4ZVUB 2YWGA 3MI7X 3KOAA 3TA1A 1Q6HA 3BGFA 3I0SB 2MLYA 2DSWA 3WQWA 3MCSA 2CPJA 5A6PA 2N3OA 1VQLS 2V67A 2DGVA 4DR6J 2LQBA 4WP8A 2AGPA 2D74B 2KKHA 4DFKA 3ZZYA 5KG3A 4KV8B 4NYOA 2PIIA 4AD6A 2GJ2A 2WK2A 2KFNA 4B9SA 3GYGA 3NS6A 3PYEA 5C42B 2DO4A 4Z2HA 1SKUB 1TQLA 1T03B 4X4SA 4N56A 1ELOA 1OSDA 4GO7X 1AA1B 1YIJS 1VQ9S 3ARXA 2WSFC 3SXLA 1RBLA 4QT2A 5K20B 2F8HA 4UUWA 1FWPA 5E41A 1QUPA 5I3QA 2G1DA 1TU0B 1VQ8S 1CULB 3C66A 2HQDA 4E98A 2XB2D 1KLMB 2FB0A 1HNVB 2OSRA 2RVJA 3A3OB 2NXCA 4WFYA 3EDQB 2QZ8A 2WW4A 2A3CA 1HBUA 2N3LA 4OZ5A 2H5EA 3I0RA 1AFIA 3U1NA 4EZ6A 4WK9A 1F6TA 2LA6A 4OV1A 3TW0A 2ERRA 5E0OA 2BKNA 5CA5A 3PR4A 2AJFE 2BACA 1Q5YA 2Z8QA 3I0SA 1KSPA 4F02A 4C8KA 1RB0A 1Z2LA 1WD6A 4K7QA 2KGJA 3JS9A 2L48A 3Q22A 2V4JA 3P4UB 2XY5A 3I4HX 5LXRA 5DIUA 3O5MA 1JLQB 4WTOB 5F8JA 1WWHA 4IR9A 1HHQA 4F4KA 2ASDA 3ET6B 3MEDB 3ZTQA 4KJIA 2FGOA 1WDDA 1OJ4A 3QT6A 1Y4ZB 1QAXA 4NLWA 2RDDA 3F44A 4YEAA 4JI6F 4ECXA 4Q2MA 2CJKA 2FVQA 2VC1A 4ZVPB 1Q8LA 5ETNA 4AE5A 3OXFA 1S72S 3VAKA 1TUGB 4J9NA 1N88A 1DQ9A 4ID5B 1F5AA 2Z2ZA 3N6LA 1G3OA 1K9TA 4PXCA 4RU2A 1HD0A 4DUZF 2R2RA 4OZ0A 1N48A 3HSGA 3HHLD 1KTQA 4JFJA 2YBVA 4D3GA 5CD4H 5EN1A 4TU7A 4MMOA 3ZTPA 3A8EA 4ZP8A 4B3RJ 4WKHA 1U1LA 1TV6B 4JUZA 4AFFA 3WC2A 5BYSA 2HNYA 1EIYB 5T7LA 4CCHA 1OY9A 1UR8A 3QMQA 4KKOB 3KCEA 4DV0F 1X9SA 5GQBA 1G1XA 1H7WA 4N8OA 3G82B 4IRDA 3H59A 4LRDA 1WF1A 3N6MA 4HR2A 4FS2A 2PI5A 1N5VA 4OL8A 2HHVA 3BSNA 3CHCA 2G13A 5K9FA 3NCQA 2XZTB 3BN4A 2KR7A 3SCJE 4MJKA 2CNNB 1RLCL 1RUSA 2JH3A 3KAHA 1QSSA 4AXJA 1CG2A 2AKWB 1QAJA 1JK9B 1FO1A 5HLFA 3MCMA 2PMHA 4OYAA 2V63A 1FKOB 1NJZA 3CT9A 4ID5A 1YDLA 5EWEA 5EDWA 1M5SA 2MJNA 1N33F 2MKIA 3W5ZA 5L9XA 3ITHA 3RR8A 3N6NA 1BXNA 1TL3B 4DRMA 3UF8A 3GJQB 4FYYB 4O0NA 2Q43A 3OTOF 1OWXA 3S1TA 2R7TA 1U6ZA 4QWDA 3GV5B 5KG4A 4K4WA 4F7VA 3MM7B 1AFJA 2DJWA 4DRNA 1AUDA 1WSRA 1JLFA 1NCLA 1LWEB 2IJRA 2YVSA 4KSEB 4D3HA 2FQQB 4OMFG 4RNOA 3R1HA 4LF8J 2EFOA 2XP8A 5JVGQ 1XBWA 3M6XA 4LFAJ 3AB4B 4RUCA 2M8DB 1F9EB 1FKTA 2PA8D 4RBUA 2XMTA 1HIYA 3G8SA 3GWCA 3ETOA 2ZH6A 1FKKA 4DV0J 3C15B 2HG4A 2OPPA 3PZPA 2HFVA 3DLEB 1IBKF 1VQNS 2MZQA 3LPEA 4FYWB 1S4FA 3GCWP 4MIAA 3ARWA 3FY1A 4L3NA 2B9XA 4WP3A 2EC2A 3ARZA 3J81Y 4LR9A 4DF4A 5CYQB 3QBCA 1M1HA 3SDEB 4DUZJ 2UXBF 2IRXA 1IX5A 4AQYJ 1V3RA 1ICEB 2E5LJ 1VDHA 4DR1J 2BE2A 4JYAJ 5HANA 2YPYA 1VF8A 2PV3A 1TVRA 2K7JA 3ULHA 3KLGA 2OELA 3K2YA 4OYXA 2ZKTA 4NA1A 5J2MB 2CG4A 1HQUB 2MPUA 2NYIA 1IXKA 2RRAA 3PW2A 2JZVA 2KFYA 3T5KA 4OI6A 4XIUA 2CZ4A 1HI8A 2BABA 2N4CA 4ZIWA 1FDNA 4H4MB 5LMUJ 1P9QC 3UI4A 4DSJA 2AEJA 2O01C 1VS3A 2YX7A 4X4PA 5CQGA 3FQLA 1RWMB 4B17A 3CJRA 3V4IB 3IXQA 3Q83A 3KUEA 3RW7A 2VFTA 3TQ1A 3SV3A 4OI0A 4QW9A 1M5YA 2CQGA 2Y78A 2QLFB 5KT3A 3VAIA 4DX6A 1U45A 1Y11A 3WKZA 1KNZA 1RTZA 2VH7A 2CADA 1IKYA 2LDYA 1Q4RA 2MDAA 1HARA 1SC4B 2QO3A 3CDEA 3GFYA 4MYUA 4YDXA 2W25A 2CPIA 2D9PA 3PW7A 2IYGA 3BH6B 1Y5NB 2XMJA 1KQFB 1VCTA 3BSCA 4DDFA 5D4NA 3NGDA 1AT1B 2B43A 3WL1A 3MPDA 3GCXP 1MROA 5D4OA 3ZFVA 2IBOA 3MM8A 2NUUG 1F8AB 4CTAA 4DL7A 1ZBCA 4ZPWR 1HMVB 1GMUA 2A3AA 3CHDA 1Q81T 4CT8A 4UQGA 3OSPA 1HD1A 1S9FA 3AS0A 4Z2GA 1RHQB 1V3SA 4G2PA 1HQEB 2CQ3A 2MTLA 2OKQA 4ANDA 1CJTB 3BO3A 2D3UA 1VBZA 4UY8T 3J80Y 2Y8YA 4JI8F 2VBZA 4TNOA 1NNDA 2XMWA 4K4VA 4QR2A 1FRIA 4KKOA 3IM8A 1N34F 3VWSA 3MM9B 2XP6A 2W7OA 1LW0A 2UUAJ 3FCVA 4A8OA 1EKRA 2YBTA 1ZOTA 2O66A 5F8LA 3UE2A 4F4WA 2XMAA 1JLBA 4JI7J 1TELA 4N8NA 2CNLB 3EZOA 3GJRB 1VI7A 3T1HF 5B08A 2XP4A 3C16B 1FWKA 3PRAA 4W9OA 4QWBA 4NZCA 2RIJA 1RAJA 1N56A 1RHRB 1H2TZ 1GOIA 2KL8A 2ZKUA 2P6TA 2LEBA 2J0WA 3CC4S 3QJPA 4F50A 1FTRA 3FZ2A 3JQKA 2UVRA 5A0YB 3KMSA 5F8HA 4USJC 1UJ6A 3M8QA 5IQQA 4KHPF 2V2QA 1HBOA 2HNDB 4RO0A 3IR7B 4ES2A 1FKPA 5LSOA 1XNQJ 4P2XA 4P8UA 2VB6A 3DKDA 5D77A 4F4XA 2XY7A 3ENWA 2HPUA 3J81U 1YLXA 1HQEA 4CLLA 2B51A 3R7NB 2BE7D 3WH0A 4B08A 5DO2A 4IDKA 4G50A 2R3VA 1N4LA 2XG8A 2OI2A 2VFSA 2Y0SD 4TXSA 4TN2A 1RT4B 5G0RA 1N8RT 5E3CA 3R2CJ 5DIVA 2MQOA 2VA2A 5KFQA 5HW8A 4LSLA 3T5HA 4DSFA 3HT3A 3LA0A 2V9WA 2EFGA 1E15A 5CABA 2E7XA 3D6TB 2G4BA 1QPFA 3MD3A 1HKAA 2Q79A 3C6TB 3TX0A 2NPFA 1TKZB 1G7CB 4Q5VA 5J2PA 1WB0A 4PQUA 4DG1A 2HHTA 2P5VA 1TL7A 1LQ9A 1S4EA 3E51A 4Y2KA 3JAMY 3J7Z5 4C8OA 4O3RA 4ED0A 1S6QA 1GMWA 4TW7A 1DQ8A 1Y0OA 2QT7A 3KLIB 1FVQA 4TYOA 3TA0A 5HT1A 1WACA 2R8IA 4NA3A 2VODA 1FX2A 3G6ES 2QV6A 2XYPB 2M08A 4DX5A 3N5BA 3O5DA 3R97A 1B4SA 2ILZA 1FKJA 3OJSA 1RTHB 2WVCA 3TUJC 1H0GA 3BGOP 3SSRA 3NL0A 1R9HA 4IG0A 4HLBA 4KYZA 1NDPA 1P1LA 1R6YA 3KJFB 3SBMA 4ILRA 5IFMA 2AGQA 1FKHA 3PYFA 3RG6A 4A8SA 4ODPA 4K0KF 2P9EA 2VPXB 3MTKA 3O6QA 3QGGA 4OI2A 2XMUA 5ETVA 5DDQC 5B0CA 3PKYA 3D1OA 3JTPA 4F3QA 2HSEB 4MGVA 4Y2CA 3FDSA 3OV7A 2JL9A 2Z2MA 1OQ3A 4QIVA 3NBPB 4ICLB 3PVXA 3W1YC 1YHQS 2V8PA 4IO9Q 5IV4A 2KZMA 1S59A 5C24B 4V19X 3CGIA 1F0XA 3FUYA 1H6KX 4S3KA 2XSJB 2DITA 1NK0A 1S1TA 2NSCA 5LXYA 3WC0A 1S1VA 4B3RF 4M63A 3CCRS 2FC9A 3X3UA 2B7CB 2FLLA 1QPLA 2XM3A 3SFUA 4DV3J 2B8QA 2HQIA 2NXEA 1D2KA 4YB6A 3MZIA 1RCOB 3Q8PB 3K0JA 3N79A 2E1MC 1K44A 4JV5F 1FKIA 3KACA 5LM7E 4ZVGA 1RT1A 3GR1A 1PGZA 2RE1A 5HO4A 4QWCA 1VBKA 1C9HA 4TX0A 2R2UA 1RTHA 2RF2A 4FKYA 4Y00A 1X0FA 5B0AA 2RF2B 2AYBA 1U1KA 4HKQA 1W1YA 1FRHA 1Y3KA 3DOKB 3WBZA 1T9TA 4DV3F 5IOLA 4LFCF 4NRTA 2HS4A 1RAOA 2FJBB 2O5DA 2G0CA 2RHSB 3G2XA 2R7RA 1SBRA 4CI0B 3OXLA 1YITS 2UUCF 2IC3B 1SUQA 4IOBA 4KGZB 4O4GB 3Q86A 2J7WA 3DDIA 3HZGA 3JSBA 4DU7A 3NWGA 5EHHA 4DLEA 5G0RB 4TLQA 3KJVB 2UUBJ 4WF9Q 1FHTA 2C3YA 1JMTA 1F9FA 2J76E 2DR6A 2R7OA 3DRRB 2RU3A 3DRRA 1PIEA 4BBYA 4DZ6A 1TKZA 5J2PB 4CM0A 4ZPTR 1Q16B 1S6PA 1M5KC 2XI2A 4E2FB 2DH7A 1BQMB 3DDNA 1I1GA 4USHA 2MB0B 3UQBA 2EFNA 1FJDA 3VAWA 1WOSA 3V6DA 5KFSA 4A8MP 2DNOA 2PEHA 3BQ1A 1C0UA 2XP5A 4AUKA 4E8UA 4ZLLA 3PX0A 4X62J 4OYIA 1APSA 5HTGA 4DFPA 3CGNA 2X51A 3OBIA 1FESA 3PHTA 3HPOA 2ASLA 5IV3A 1EJ7L 4K4SA 1EETA 1R8CA 1KVJA 4DS4A 3RBEA 2RQKA 3HI9A 4QIEA 2IAJA 1RAFB 2AWZA 3NCPA 3N5FA 4BC9A 3DGPA 4R5PA 2B3TB 4YDDB 3RRHA 4ODRA 2QLBB 4C11B 3F73A 3PRBA 3G86A 1TMMA 4KGXB 5MAOA 3W9JA 1YVFA 3RZAA 3M30A 2ZH3A 3QPIA 3T1HJ 1Z1ZA 3BSOA 2DNLA 4B9LA 3HFKA 4ED4A 2HK2A 2GZOA 3NEKA 2GS8A 4J9MA 2HHXA 2R8KA 2QA1A 5C24A 3TDBA 4PEOA 2Y1IA 2WONA 3MM5B 4Q7AA 1NKBA 4BDPA 4MIWA 2CZ9A 2G0JA 4X66F 4M5IA 1JXLA 1WOPA 4DWSA 3CHFA 2IJFA 3HSJA 2V6AA 4QPXA 2CKWA 3LP0B 4DCPB 2QEXS 1ZM9A 1J6YA 2AW0A 1X4FA 3X1LB 3HVTA 2RQCA 4W90B 1T05A 1RHJB 4JI4F 3RM9A 2GIRA 2B7BB 4M1KA 4F25A 5B0DA 3EGNA 1W1PA 1CJTA 1VJWA 3CDAA 1SQEA 4H4KC 4IKAA 4YY3J 3KLVA 5SZTA 3QAUA 2V8GA 4KHRA 2CQCA 4NLRA 2Q5AA 4J7CA 4F0MA 3QWPA 2HIQA 3MR6A 2CFXA 1ZL1A 1KS2A 1FE4A 2CPYA 2VF3A 2EK1A 3DRPA 3G87A 4G1QA 3FBEA 3CJ0A 2GHPA 1RWOB 4L73A 2KH9A 1C1BB 1LWXA 4WYLA 3W5YA 3EYZA 2HHQA 1NSQA 2W01A 4K2JA 4JI6J 5KG6A 3LUYA 3NNCA 2M2AA 5IWAJ 2MF9A 2J7UA 2I8EA 4CO4A 3NRKA 3SQOP 2AHOB 4YS2A 2JEFA 2PE8A 2BRLA 4DR5J 4E0DA 4WZQA 4CYUA 1QSLA 5GPGA 3QYYA 4LREA 4N7TA 4ZVTB 2YXLA 1GK8A 4DV2F 3ARYA 3AD7C 3GQCA 1CBKA 1KHWA 2KB2A 3OL8A 4ILLA 1N0UA 2QYGA 3VAGA 1NDLA 2DG3A 5D0GA 3PKMA 4UT4A 2ACYA 1B6CA 5KOWA 8RUCA 1HJVA 2VZ9A 4DL3A 4MKYA 4IDKB 1VHIA 1Q82T 1VIOA 3TAQA 2DXFA 5KT6A 4V1Ak 4ZMMA 1U1RA 3T6BA 2CQHA 3IK8A 2OIHA 3K17A 1XK8A 1IR1A 5CHCB 3OUYA 2F8MA 5KFVA 4CLPA 3GIIA 1YI2S 3DLGB 4EBDA 5I42A 5HQLA 1U0SA 2MQLA 5B0EA 3M30B 1FKGA 1T3NA 1H38A 1DBDA 3M8YA 3NXZA 4P74A 4DSIA 3OTEA 4CLKA 2DKOB 3D0IE 3D67A 3DM2B 3M2UB 5F0WA 1P9YA 1RISA 5U47A 3B9DA 5KFPA 4EUVA 1GXLA 1UWBA 2A0FB 3I96A 3JTOA 4OHZA 5HI7A 3PRDA 2XWYA 1ZZFA 3Q2SC 5KG5A 5I3UB 2VQEF 1GAOA 2RURA 1T94A 4LIWA 1QUVA 3UNYA 3VZIA 3IO1A 4LFAF 2XHWA 3CCWA 4C7QA 3M8WA 1VBYA 1JLGB 5KFXA 2GVDA 1J5OA 1F1BB 1HJWA 4CM2A 1TFWA 5HKGA 1RWXB 3BS9A 4B3OA 2HIYA 1C0UB 2L08A 3U02A 1FRJA 1UA0A 4DR4J 2R7SA 2VC0A 1IBLF 4OLOA 4FF3A 4JOUA 4MKAA 4MK7A 4OX9J 1U1NA 1C1CB 4NSBA 3WX4A 2CWXA 3JYMA 4NLUA 4RBTA 2J6SA 1H2UX 4QIWD 2OFGX 2XGQA 1W9PA 1ZU8A 3O5QA 1SIWB 3W9IA 4ZLPA 3T5LA 1NJIT 1GRJA 1B0PA 4GIVA 1BUXA 1X60A 3MUTP 1QE1A 2CVIA 2GMHA 5DG8A 4RW8B 3KG1A 2FJEB 3NG8A 4YB7A 4O0IA 1VYAA 2BM1A 2EULA 2L9WA 4I2PB 5HVFA 4XO0A 2VA3A 4IH5A 4OZLA 3DLBA 3OA5A 2RRBA 1PAUB 5ETMA 4QW8A 3OQ2A 1UWBB 1LOUA 2JSXA 3LGNA 2P9CA 1ZBKA 3HHLA 5LSRA 5DLFA 3ALGA 1LWFA 1PYOB 1S1UA 3PHEA 4DN0A 3SDEA 3GZ7A 5E33A 4AT1B 2UUCJ 3OLAA 1LL4A 4DPUA 4DV4J 1LG1A 4UW2A 4DR3J 2NQPA 2JFKA 3QFWA 4LF7J 3T19A 2GHVC 5G4DA 2W8KA 5D3GB 4I69A 2UZ5A 1DLOB 1MNEA 5AXKA 4TQRA 4IOCQ 1JX4A 3PX6A 4J4NA 2ZEJA 2DHSA 4OJGA 5DM7Q 2MMYA 1UR9A 3HVTB 2RKIB 4I68A 4AL6A 2V0NA 1KDNA 1WSVA 3HX9A 2LEAA 2XZDB 1RT2A 1X0PA 2JOQA 2I6WA 1SC1B 2J9CA 5HMWA 2GMJA 1TV6A 2MZRA 2ZM6J 1MN9A 2LQJA 2W9BA 1IM6A 3CXCR 4OYZA 4ZPAA 3DNCA 2DXEA 2LEPA 1IBLJ 1SV5A 4W9PA 1JLFB 2GMLA 2HEKA 4DV7F 2JFDA 2DRBA 3NNHA 1HWKA 2L3MA 3EIPA 1MN7A 1V5IB 4ZVSB 4OI1A 2KHCA 4ATNA 4EGLA 5C25A 1L3SA 1FWLA 1B64A 2BEFA 4Z7YA 3H8YA 2RUGA 1N33J 4L74A 1UVLA 1S0OA 1JLEA 1H74A 1HWJA 3SMZA 1S79A 1JLEB 4B9MA 4JV2A 1D7JA 2LXUA 3EGVA 1LWFB 3ODKA 1RT7A 3NGRA 4NASA 2GFFA 3HHLB 2DPJA 4NYZA 2BUNA 2YNFB 3TUZC 1YBTA 5E3PA 4K50A 3FBFA 3MM6A 5HQ8A 3FFIA 2V8HA 3CCES 2H9ZA 1PKUA 4GGQA 1FDBA 2A10A 2PPNA 3GG1A 2LU1A 4S0MA 2ZNZA 4U6PA 3H4DA 1FD2A 3LGMA 2QL5B 3WZ0A 3KLHA 1VQKS 1S9GB 1T9UA 2J7KA 4O3OA 1SR0A 1ZCNA 3O5LA 1KP6A 3FBBA 3UO0A 3KUHA 3VGVA 3I6PA 5ETOA 2EI5A 5BYRA 2VONA 2HGLA 1R0AB 3V6DB 4C9DA 4TW6A 4RZRA 3IFEA 1XRVA 1X4BA 5D78A 3AS3A 5A8KB 3MFIA 3IR5B 2AEMA 2VCDA 2N7YA 2CWKA 4ML4A 7FDRA 5FD1A 1IWAA 2IMWP 2A3EA 2MKSA 3ILOA 4K4UA 3UD4P 1SI9A 5JH8A 2HQGA 2R8HA 4HACA 5A6WA 2J0XA 4ECQA 3BXWA 5E3AA 3H5SA 4DZDA 1HA1A 4R0XA 1N5TA 1NH8A 1W1VA 2VV5A 3HLUA 4MYTA 2KHDA 4N77A 4F04B 4EFAC 4C02B 1HW9A 2IC3A 3RJMB 4OJHA 2YNHB 4Q0BA 3HFZB 4I2PA 4ZJQA 2FHJD 1U1OA 4JI1F 2KJWA 3KUGA 2XTJP 4NLTA 1K9MT 2HMIA 5LJ5Y 2B4VA 3DI6B 2HLUA 3IBFB 1NK8A 3PW4A 1WG5A 4MPKA 4QQBA 2V5HG 5CD4A 4XPCA 1VRUA 2F5GA 3AOBA 2VFVA 4EBCA 3PFEA 1WKKA 4LVOP 5KTQA 5GMKa 4DR2J 1FJEB 2WK4A 4X4TA 5IXUA 1XTZA 1WORA 1B99A 2F9JA 2YTCA 4RW6A 2RT3A 1EETB 4KC5A 3AJDA 4WPAA 4J9QA 5HP1B 2W9BB 3QRRA 5T7LB 2KXNB 3SYZA 3CJ3A 2DH8A 1RAAB 1RWNB 2LYVA 2A1BA 1YX2A 4QZVB 1VK8A 1RT2B 2XBPA 4LRAA 1HR0J 2FVPA 2NZ4A 4NNRA 3EJMA 1ULRA 2AX0A 4Y28C 3TJ9A 2J9DA 2XSFA 3OTBA 4JI4J 1U1PA 3T9NA 2GNKA 4A8QA 5A8WB 1H7XA 4EBEA 1YZ6A 3BBFA 4KT0C 5HROA 4P8XA 4OIXA 3NS7B 4HL9A 2DTJA 2ALYB 5KFGA 3V6JA 1RHUB 5E7OB 3I6CA 1XQIA 2B31A 3MEKA 4QYZK 4OJ3A 3RB0A 2DXDA 4CT9A 4M95A 4J9RA 4ODOA 4L6V3 4X2BA 3Q24A 4KQZA 3O1LA 5L9NA 1CULA 3TAPA 5J2QB 1NJWA 3K8WA 4U67Q 2Y0BB 1ZAXA 2CJXB 4C0OC 1N36F 3LO3A 1TKXB 3ZZ0A 2I38A 5T41A 3VF0B 4DL6A 4OX6A 4LAVA 2YKOA 4ZPBA 3BBBA 4KFBB 1W25A 3CE8A 4I56A 4OV6A 2RJZA 3UPFA 3HK2A 4GVBB 1E44A 4ES1A 1TFYA 2ZJQQ 2E29A 3IC1A 4FXWA 1HNZF 2G2OA 1LL7A 4IH7A 4EZ9A 3UVJA 5HMYA 2XPBA 3CJTA 2VG6A 4N19A 3TEHB 2FHJA 3O2IA 5AE2A 3IG1B 4FNHA 4CO1A 5KFZA 2HS0A 2AP6A 3IM9A 1CJVB 2VKRA 3QZ7A 1HW8A 4UY85 3H90A 4Q2LA 3MGJA 4AYBD 3CO0P 3OR2B 5K8OA 2ZFHA 3BQ2A 4ETZA 3CDBA 2P4VA 3FC9A 3M6WA 1H3DA 3FXYA 2HBZB 5L8RC 1YK9A 1DFDA 2ZE2B 2GVZB 3AB2B 1RKJA 1SQGA 3O5EA 4QIBA 2KI3A 2B9YA 2KT3A 5KG2A 1KT1A 1X6NA 2MEWA 2F63A 4TQSA 2EBEA 2M52A 3MCOA 2KM8C 3IR6B 1H0HB 2WB4A 5EWFA 1D0EA 6FDRA 2OH2A 2HWHA 1UTAA 1ZM2A 3GB0A 4R25A 3P49B 3L7UA 2BQRA 2MHEA 3UNGC 1SJQA 3QRPA 1S7IA 4ILMA 5BXIA 4FBUA 1NSPA 2MQNA 1WEYA 1N5QA 2OPQB 4LR7A 3PR5B 5LMUF 3FZBA 1KWMA 3VAMA 4O44A 2ZDPA 3JQMA 3CD7A 4L76A 4NZ7A 4LAYA 1TVRB 1WC5A 3DHWC 2E44A 1QM9A 2PMZD 8ATCB 2BMBA 2QSWA 1ZPVA 3PXGa 3TAMB 4UOGA 1W7WA 2F1FA 1L3UA 1IWGA 3P6YC 1FEHA 1FJ7A 3SSSA 4JV5J 3H25A 3CZ8A 1Q1CA 2ZJPQ 3AY0A 4ELUA 2E5IA 4KBIA 2H4YB 2ZC4A 4KGKA 1RTDA 3NNAA 2WW8A 1I94F 2CYYA 3JQJA 1WC6A 2V68A 2CPDA 4AY1A 3BYRA 3M8SA 4JI8J 1U2FA 4M5NA 5AE3A 1CVJA 3EWGA 3M32B 3IBCB 2KO7A 4GC6A 2RD5C 2PI6A 1R7IA 3NBPA 4ICLA 1UETA 2CRLA 4USUA 1NHKL 4OHXA 4F3MA 1YJTA 3HDSA 3Q0AA 4Y6IA 1FRLA 2OP5A 2YQ3A 4O3PA 3UN3A 2NREA 3BDPA 3JSMA 1IQZA 1KQGB 4RPFA 3CCJS 3A8JA 5IM0A 3FEXB 2YKMA 3WIUA 3UCGA 3EZ5A 1R8HA 3OR1A 2FVRA 4OQJA 4WBFA 1S0VA 2C3PA 4OX7A 2MQPA 5KFJA 1XN9A 4WFNQ 3DLJA 2OLHA 4GVBA 4NLPA 4DV6J 3G6LA 1XNQF 4RUBA 3IWLA 4JI0F 1U6BA 1JJ4A 2CPZA 2GGPA 1LL6A 1WC1A 1LJYA 3MM8B 4G65A 4CTAB 2XC9A 2XMMA 3CTRA 4CLUA 2YNGB 1G2EA 3GIRA 4ZPVR 1NZAA 1TKDA 5D4PA 2WBRA 1E6YA 3MECB 1VLYA 2F8EX 3GSIA 3MMCB 3QIDA 4ED8A 1U09A 2OD4A 2XLKA 3IWNC 4R0EA 2DIUA 5ETKA 1KEKA 2AYEA 1ZTWA 4K4TA 1ZH5A 5J1EA 1ZPWX 2X3GA 1LV5A 4DQSA 1P6TA 1FNMA 1MWYA 4C8YA 1N32F 5BXJA 1QD1A 5DRKA 3C6TA 2NR0A 4QCLA 1EQ3A 2IBKA 4ITZA 1JJHA 1SUQB 1VJQA 2Y3YA 1X9MA 4U95A 4FF4A 4MNKA 2HBQB 3MPVA 2FKEA 1XMBA 3CHEA 1IR0A 3HVAA 4ANEA 3FEZA 1I3OB 2DT1A 2A3BA 4WXWA 2ITKA 2F40A 4RBVA 2W7PA 2ZNYA 5AXLA 1AXQA 2ASYA 1S9GA 2ROPA 4I7FB 4ZVRB 5B0GA 3T9ZA 1UJ5A 2KDOA 3FRZA 3ZZZA 4AQYF 1J5EJ 1IQTA 3G6VA 4LF9F 4IQMA 3KWMA 4K5SA 4RW6B 2AJ2A 3PJWA 3OR1B 3B4MA 5HMZA 3I5BA 1RLDA 3IMQJ 2OPQA 2DSUA 3PG9A 3V5RA 3K5NA 4DIPA 4ECVA 4FNIA 3C46A 3TC5A 2R2SA 4DQPA 3OFGA 4GC7A 4P10A 2GJFA 2KT5A 2ZH9A 3BKTA 1OO0B 3AD8C 4LGXA 2ADCA 1U6FA 1OY6A 1RU1A 4ENOA 3GV7B 4PYDA 2OFHX 2V9KA 3DLLQ 3AOCA 1FKSA 3OD2A 3GU0A 4PG6A 3P3DA 2XLJA 3CC7S 4WP9A 1WI6A 4HBEA 5GAHI 2KVIA 4G3IA 3JYJA 2DY9A 2K8IA 4XAKA 3M2VB 1VBXA 1HKIA 3HF5A 4URGA 1S1XB 1HL6A 1XC9A 2ROEA 4FPIA 5KFUA 4R8UA 3THPA 4I0WA 1SJRA 2WVBA 1R89A 4F8RA 1DLOA 4FKXA 1KN6A 1R0AA 5GAEI 1IM4A 2CXEA 4WFBQ 1ZBTA 3WIVA 4CZCA 4KFBA 2C28A 1N52B 1HMVA 2R8JA 2KN4A 2YWHA 3AA9A 3B78A 3ITHB 4DX8H 2UU9J 1RAGB 4UOCA 4ZKAA 1RYSA 4FAPA 2KT2A 1RT1B 3K7RA 1DHMA 1V5VA 2HK3A 2KYXA 2MLXA 3T3FA 1HQUA 1Y3JA 3D3BJ 3EXYA 4YUDA 2YX1A 1NWRA 2APOA 2MJUA 1TL5A 1X5PA 4CLZA 1S6OA 1PBKA 3K5MA 1SJ3P 4KIAA 1JKHB 2HAFA 1X7VA 3DXBA 1WOOA 3RBZA 2MGZA 1VQMS 4LMZA 3AFGA 4EI2A 1PYSB 1RZMA 2NXJA 3M2VA 4FYVB 4TYBA 2DHAA 3M32A 3OFHA 4UTGA 3RYLA 3O5JA 2CJAA 4DWSC 5LL6d 2DGWA 4RUHA 2XSJA 3MAQA 3ISZA 1BL4A 2DO0A 1FRXA 1FXRA 2B4PA 2K1RB 1F9HA 4ZHRA 4ZN3A 2GQ2A 1TUWA 5KFBA 3I55S 2VFUA 2FHMA 4Z37A 1TKTA 4YMEA 3MEEA 3L3CA 1L5UA 3PO5A 2G8ZA 4HH1A 4H4KA 3MUMP 2ETNA 3QGHA 2HQ3A 1A6LA 4FVCA 2UXDF 3MURP 2M1IA 2B6AB 2F2DA 2QRRA 1XNRF 1JNEA 2RKIA 4PPZA 2Q6CA 5DLGA 3RRKA 1FVSA 3UDCA 3BBCA 1ZYQA 4O44B 4PG4A 4ECRA 4ZS6A 4ZVFA 1KVKA 2C22A 2FTRA 2DR8A 1RK8A 4RL1A 4LUBA 3QLHB 3QJJA 2IYIA 3ARUA 2V8DA 4MNJA 2VL1A 4IG0B 3UWTA 5L1KA 1TFVA 4HARA 1X4GA 3DDKA 4DFJA 3TEGA 1VRQC 1VISA 2FIUA 3BPSP 3KHLA 2XS2A 4I6WA 4L3KA 5L39A 1MU2B 1VQPS 4L75A 2VG7A 3V81B 4F4AA 4DL4A 3R1LA 2C2MB 3AA8A 3F41A 3ET6A 3MEDA 4M5DA 3Q8VA 3B4DA 3DLEA 9ATCB 3QT8A 2WLZA 2HFNA 3C15A 1FTCA 2FDNA 3CJSA 3OR2A 2IM0A 1GXUA 1NSKL 2IJNA 3M1VA 2EXUA 4DG1B 4FXVA 3QZ8A 2BOPA 1N5YA 1LG2A 2HAIA 4A4JA 4CDIA 4RNMA 4F2SA 3KNAA 2ZQTA 5AJ3F 4KAIA 3WD2A 2JEIA 4ZA1A 4OZ1A 1UZHA 1T02A 1FFWB 2X7IA 3GR0A 1RTJA 1RHKB 4BWJA 4DR7F 1Q95G 4ECUA 3JSRA 3TZWA 3RGCA 3KHGA 5K8MA 1E6PA 2XWXA 4B3OB 1ZA1B 1R8AA 2GGPB 3ARVA 3I0RB 5SUHA 1FRMA 3PJXA 2E5HA 5F41A 5CYMA 5BR8F 2DT9A 5L1LA 4B9TA 3GE9A 3V6HA 1RGVA 1PINA 2O3DA 4FZVA 2V34A 4KRWA 1FAPA 2JRSA 3A8KA 4PRFA 3AS1A 1FXDA 4DRIA 4MFBA 2PN6A 1DTTA 2DEIA 3E2EA 1WUUA 4LF6F 3ZZPA 2Y1LB 2DR5A 1NH6A 1AROP 2ATCB 2D9FA 2NXNA 3US5A 1XIQA 1S97A 2E9RX 3D0HE 4DPTA 5CCLA 1ZAVA 1UFWA 1Q0NA 2JLGA 2XS5A 4DV5F 2D3O1 1UEVA 1KFWA 3HT0A 4NLYA 3C16A 3SI8A 2IF4A 5A76A 3GFHA 1VQ7S 2FJXA 1NWSA 2QX0A 4XTTA 2IFXA 3LP0A 2YWFA 4X4OA 2PV2A 5ETTA 3VGTA 3R5DA 4Z7CA 2UUWA 3FMWA 4L72B 1GT8A 1U26A 3TAMA 2KYZA 5LSLA 5AJ3J 4WU2A 3AS2A 3IAS9 5HP1A 1RAEB 3D4JA 4ZDNA 3DFEA 3K5PA 4O2TA 3PFOA 3R5AA 5AE1A 1UW4A 1CJUA 2AQ4A 3AJ1A 2BZ2A 4O23A 2ZBRA 4WIIA 4XDDA 5D0EA 3MUVP 1MSWD 1X9WA 4DRHA 3FRYA 2EKYA 1RDRA 1BGXT 4ZVEA 4C97A 1T9VA 3VCDA 1ZM3A 1HJXA 1VR6A 3B54A 3CJ8A 1JKHA 1DTTB 1W2IA 4NLSA 3EVMA 4PAAA 4A48A 2E1RA 3CCQS 4ECWA 1RACB 4NXNF 1K1SA 2G2YA 2BJ9A 2DNRA 2Q66A 3QJLA 4G1PA 2RMLA 2OO4A 4LIRA 2V4QA 2DNKA 2V69A 5M2UA 2AU0A 1RWKB 1NSAA 2DB1A 2LQ5A 1YBAA 4J90A 4WWSA 1IKYB 2ZVIA 2YH1A 4OLPA 2ZVSA 1YG0A 1CC7A 4P71A 1NJYA 1FKAF 3VAFA 4I64A 4ALZA 1SJ1A 1WELA 2FC8A 2UV8G 2OEMA 2XO6A 2RRNA 1F2HA 3G8TA 2CQ4A 2C2EA 2WSCC 1U49A 2E9ZA 4NLXA 2HZVA 1HNWF 3OFEA 1RSCA 2F4FA 2UZAA 5M2PA 4ZCIA 1KTVA 3D7SB 3KK1B 2J6UA 4H54A 4ECYA 2CPEA 3GJSB 1S9EA 2DISA 4GO5X 4EWTA 1RWUA 2LVWA 1FXLA 4UOFA 2MZJA 3D1HA 2QA4G 4URQU 4TLRA 4I1TA 1X31C 2BJ3A 2CJQA 3C14A 1GNKA 3NAHA 5B7WA 4X65J 3KYLA 2J9DE 3GILA 3JB9k 3SQGB 1A9NB 2W9AA 2BW2A 3ZZRA 1CS4B 4HYKA 1GQEA 3DU5A 4U96A 2XP3A 2HHPA 4DR3F 2JC0A 2VG7B 3O5KA 2UUBF 2XLIA 5KT4A 2NUHA 2QN6B 1V6HA 3R6GB 4B3TF 2ZZTA 2HQCA 3OVBA 4HDGA 3C3LA 2O92A 4IYQA 5J1NA 1B0VA 1PC4A 2VICA 1EP4B 2WZ1A 3M9OB 5LMNF 3HJFA 3QT5A 3J7YI 2W2OP 3LGHA 3FSIA 1Q7YT 2ASJA 5HWBA 4I2QB 4ZITA 2KXFA 3B6BA 4LF4J 1X5OA 4P52A 1REVB 1TL4A 2B4OA 3DLKA 1VIXA 2YKAA 2X1FA 4OZJA 4GKKF 3I9ZA 1KBRA 4DV2J 3QFHA 2GX8A 3GMGA 3MAHA 2BA9A 1O6XA 2J8SA 2MZTA 5MLCV 2RB7A 4ZP7A 5DQHA 4Q22A 2DGTA 2JHEA 2ZH5A 1K1QA 4U8VA 4U86A 2XP7A 3D5MA 3E8OA 1WHVA 2W24A 3ONQA 3M6VA 3UFCX 1SIZA 2EKNA 2NYHA 3MM7A 4WJBA 3MDFA 1XMQJ 4X4UA 3DOMA 3EICA 3UDEA 2RDJA 2H1YA 4LF7F 3OXGA 3CSKA 4GKKJ 1L1PA 1QZ2A 5FIIA 1PG5B 2EBGA 3OTCA 1H2VZ 1TMJA 2RQ4A 3MMJA 2MGZB 5J1EB 2QA4S 2AYGA 3QOKA 5K14A 4C11A 4PUOA 1UA1A 3DLGA 4MT1A 4C3MA 4F3OA 4NLOA 4IQCA 3BPDA 2YNHA 3BYPA 2QA2A 4Q0BB 3UI6A 1X4EA 2ZH7A 2VN1A 3H20A 3RBDA 5FDLA 3VZHA 4ECZA 4HHJA 1NRKA 2YKNA 3EVWA 4F4YA 2CDQA 1Q6IA 1RWPB 2VDHA 2ZUGA 3EGWB 4Q8FA 1D9FA 1WKJA 4WU3A 3J7A1 2M2BA 4NYPA 3W61A 2PV1A 2DHHA 2Y9HA 1QAIA 3HKWA 3KK1A 2PPPA 1JXVA 3OOBA 2ESCA 1OPZA 1R8PA 5AT1B 1EHNA 4P9SA 2ZD1A 1VQ4S 1MWZA 1T0TV 3PYGA 3CIMA 4U8YA 2DBBA 1VQ6S 3JTNA 4CO2A 2VBXA 3KJQB 4DCOB 2HNYB 1BQXA 2KM8B 1GX6A 1RT3B 5E5NA 1OGGA 2ZR6A 4A8XA 5KFMA 3I87A 3EX7B 1WNEA 3I4PA 2UXCJ 3BDEA 2Q6BA 3U1LA 2L9DA 2ATLA 1YW5A 3AODA 3TWZA 2O1PA 2XCPA 2E1PA 4JFLA 2JVRA 5DQIA 1UAWA 4LF1A 3UI3A 2B5UB 2MLZA 3FBCA 3WQVA 4M8LA 4LF6J 2VJUA 1RYRA 3ENQA 5FJ4A 1NXIA 4UQTA 5DS7A 2D3ZA 3P5BP 2D9OA 4DH0A 3KTQA 2V8VA 1CQNA 2CG8A 2W2MP 3NGKA 4PQAA 3SSQA 4OHYA 3QATA 1GPFA 5D0RA 3S7RA 3DHXA 2IVYA 4B3TJ 3BB5A 1QVGR 3G8QA 2OMOA 2ZWOA 1IUJA 4DXLA 2M8HA 3RRGA 1RBOB 3UQIA 3QSYB 1NHUA 2HFZA 1YRUA 3S6EA 3N4WA 2B6AA 3BSAA 3G4SS 4IUFA 3DRXA 4OX8A 4WCEQ 2OTLS 4LF4F 1SC6A 3T5JA 4LRCA 4JI2J 3BREA 4UZBA 3RM4A 1BLUA 2NCKL 2ZBPA 3OTDA 1S6UA 4FPRA 3T41A 4DV4F 1WAWA 1J4IA 1JLAA 2LXFA 2Z2YB 2R8GA 5HBMA 1OGBA 1R43A 4YR0A 4HI1A 4JI5J 2A2DA 3C19A 3D68A 2K7KA 2JJ4D 1CJVA 3TVZA 2ZQSA 2N4DA 1S5ZA 5D75A 3M8ZA 4R0JA 4DR4F 2WRMA 4IRKA 3DRSB 4OI4A 1PBAA 3CW2C 2JWNA 2DGXA 2QG9B 3LTOA 3V6KA 3AXKA 3KNGA 5H9EJ 4O4GA 3KABA 2PGCA 5IT0A 1U8SA 3POTB 3UD3P 3IAM9 5BJRA 3AXMA 3IGNA 5RUBA 3EPGA 4LSNA 3O8WA 1TCOC 3AOAA 3M8PA 5GAEU 4QU6A 3OL6A 4MKBA 1RT6B 2HNZB 3QWUA 5IWAF 1SC3B 1HPZA 1U0HA 4YFUA 3RAXA 2ZQUA 1HPZB 1S48A 2IA0A 4YHHJ 4C0BA 4ZK7M 4RW9A 1R31A 2H51B 3DMJA 3ENVA 4S3JA 3N01A 5AXNA 2FJDB 2GIFA 3TOQA 5KFOA 4F2RA 3HMJG 3AROA 1RTJB 2MYFA 2AV5A 5AXMA 3K8VA 4QIFA 4BLGA 4NA2A 3MMBA 5K14B 3UN5A 5ADZA 1NU4A 3GFZA 4G1IA 1T05B 4G6VB 1ZB5A 1HKKA 2RUQA 4UDMA 3GYXB 4C2MA 1KVIA 4ANCA 4X65F 4DV1F 2HHHJ 1SKWA 4C3LA 3JSYA 5F8GA 1K8AT 3OL9A 2VQFF 4DS5A 2YX4A 2B8PA 1ROTA 3HHKA 3H5UA 1FT8A 3D3CJ 3UVJB 2UVUA 3L7OA 3ETMA 4PG7A 4EK2A 4OYBA 3V81A 3AHPA 1M5OC 2P9GA 2EG1A 2ZUAA 5HK4A 2RH3A 1RWWB 1R0CB 2CA9A 3PCOB 4PR6A 1SJFA 4JI3F 2ILYA 3DM2A 4JFIA 2PN0A 3M2UA 5HSPA 3FJ2A 3OL7A 4YP3A 1ROUA 3CJKA 2AOSA 1YJUA 1NK7A 3VGUA 1PYTA 2BBEA 1YKWA 2ABYA 3JXOA 4ZN1A 2ZHBA 3UCZP 2MKJA 1VMBA 2X1BA 1B70B 3GG0A 4NX9A 4RKUC 3PV8A 1IJFB 3R2DJ 4FXDA 5F0UA 2AGOA 4DFMA 3NCRA 2LU2A 2J0SD 1RKIA 3WL0A 3CULA 3KAGA 3JAMU 1YJ7A 3OJUA 3Q89A 5KFFA 1TK5A 2GV1A 1S0NA 4NLGA 4TW8A 4PXEA 1O51A 4DEZA 4DN9A 2KG0A 2UVWA 5HBMB 3VAHA 2BANB 3HHLC 1WJ9A 4A8KA 1YATA 3CIZA 3SQGA 1UVJA 3RTVA 3OFFA 3FMBA 1SVDA 2VJVA 5J1PA 4HTJA 2OFNA 1J2VA 3KHHA 5DG7A 4MKVA 1QJHA 4DRJA 1FERA 3SCKE 3M9NB 4LF5F 1WG4A 2IVMA 2BRKA 3NY0A 4DPOA 1WI8A 1H98A 1EKSA 2B4UA 3NGUA 3IHZA 1IKXA 1VHFA 2D1CA 3PYDA 1MW7A 1S1WB 2NSBA 1RAIB 2Z57B 4YOEA 2LECA 2CIMA 3D1QA 2H5JB 4W5UA 1FEEA 2ZBCA 1NZ8A 2RAQA 3QAEA 4ZJOA 3I56S 3RMEA 3DMJB 3FQKA 4ITSA 4YR2A 2Z58B 3AQUA 3CDUA 5B0FA 2EC0A 2RNEA 1NK6A 4J9SA 4KE5A 4Z2IA 1DARA 2XEXA 3IKGA 1TKXA 2MSSA 2XI3A 3DCAA 3H2UB 3WX8A 2XGPA 4A8YA 3TARA 4F36A 2H5IB 3QSIA 2BYCA 2LKZA 1MMLA 1WHXA 4ZCKA 2N87A 1FKPB 4I6YA 4P72A 1NSGA 2PD1A 3TNVA 4NI2A 3CC2S 2QJ3A 1M1GA 3O3LA 2ACMA 2WB1D 3H0PA 3W2WA 2FHKA 3D2WA 2Y1RI 4DR1F 3D6MB 2W2QP 1GX5A 1FKLA 4QPTA 2UXDJ 1Q8IA 4WK1A 2NLWA 1IJEB 3TJ8A 2AZ1A 1N32J 3HZEA 4A8WA 2OPPB 1R3NA 2I5JB 2MXYA 4IRCA 4URSA 1SL1A 1Q8BA 4NEYA 4WFZA 1IBCB 2VG5A 5HUAA 1JQGA 3HULA 3LALA 3WIJA 1L3KA 2LLZA 3ISND 5DQGA 3CJ4A 3CCLS 1YJ9S 3G6XA 1VC6A 1LK7A 1B7YB 2RQSA 1HWLA 1WEZA 1GMVA 2M0GB 2XYGB 3KFWX 5D4LA 2DRAA 3FFIB 2RSEA 3K5LA 1ZBVA 2ZD1B 1JJ2R 5HQMA 2JVOA 3KLGB 4U7UD 2IM3A 2VU5A 1RXOB 1ZM4A 1HBOB 2HNDA 3BJYA 3KAIA 1TTHB 1HHTP 1C4CA 4IFYA 4FF2A 2IPOB 4I7FA 2ZZNA 1HYSA 2EK6A 2DHXA 2F4VJ 1NPPA 3IRXA 3J7YU 3PJ9A 5KFKA 1SYTA 3IBWA 2Z0GA 3HXMA 1VQYA 2HGNA 3M7VA 2EFVA 1RADB 1TK8A 4BS2A 4Z2KA 2PPOA 3P45B 4CIOA 4KHPJ 1UJ4A 4HH0A 4F0HA 4LBIA 5BYQA 2H54B 4ID8A 3ZTSA 4PUOB 1UVMA 2VKZG 1C0TA 4OYOA 2YWKA 1S0MA 2BJ7A 3I82A 3N9UC 2W9CA 2AT1B 1X4HA 3EVOA 4RLEA 2W2NP 4RNNA 2XY6A 1VC0A 1IKVA 1UKUA 4BC7A 2VBYA 1W9VA 1C2PA 4RW4B 4I2QA 3W2VB 4DHVA 4QWAA 2DNGA 4YN3B 4C4WA 4TYAA 1RAHB 3CDWA 2VPWB 2GAGC 1LW2B 4RWWA 3UW1A 3DI6A 4P6QA 4X84A 4ZOSA 1J5OB 3ZZTA 4CH7A 1PJ6A 3HHNB 1KLMA 3H7HB 2QMWA 1HNIB 2F7VA 4KPYA 2UXCF 1AUSL 4ETXA 3NTPA 2A18A 2A6MA 2YKQA 5DG9A 3QIPA 3TANA 3B8HA 1SKRA 1F2GA 4HI2A 4IT6A 5DETA 3OLBA 1UL3A 3OHBA 2A6OA 1F40A 3THTA 3CCUS 4PABA 1Q79A 5CYJA 4ODMA 2C2OB 2DEJA 4HVZA 3OUYB 3TUPA 2G2ZA 5DEZA 4DV1J 1SL0A 3R7BB 5HMXA 5F3TA 2LMIA 1DRZA 1HI1A 2E5JA 2HHHF 1DY3A 2RUSA 4ZVHA 3QGPA 5LOQA 4ELVA 4K0KJ 2YKPA 1BMQB 5KAKA 1D8ZA 5DITA 1PCAA 1BQNB 2MSTA 3V4MA 1REVA 3DLKB 3M05A 2FLPA 1XEZA 4MH8A 3W65A 1EYMA 4ZHRB 5HJYA 2EFQA 1VOMA 2FY1A 2E5GA 3M6UA 4WJXA 2WHOA 2W2PP 2HWIA 3D28A 4NE9C 4DX7A 4X4VA 5C2GA 4IPXA 2HHWA 1TL3A 2FLOA 4ODLA 1A0OB 1Q6UA 3ARQA 1HBUB 3M9MB 1T95A 2I9SA 2XNRA 4KY3A 1M5VC 4NI2B 2J6TA 3R5CA 4B3MF 4DUTA 2PA3A 3WDOA 2H3EB 4B3SJ 3ILLA 3LAMA 1HWUA 5I98A 2XHCA 1KQKA 3TZYA 3GFXA 2ZWPA 4CLFA 2OTJS 2CQ0A 3IA0A 4MAVA 1WHYA 3KG0A 4KB7A 4ECTA 2UV8A 3NWRA 1U48A 1T9WA 2AMCB 2PMWA 4MK9A 1S76D 4U9RA 1E6RA 1BD6A 2KRBA 2IDLA 1LXJA 5FLXY 4IR1A 3SIPB 3NMAA 2FDMA 4PYAA 4J91A 4BHQA 3OSNA 3CH9A 2FJWA 5D3GA 4U85A 1QLNA 3ZTRA 4LAXA 3CJ5A 4OZ2A 1S77D 1YRTA 2DNHA 3IP0A 1BWVA 4W9QA 2MPHA 3EY6A 1GMWD 4OX9F 1UW9A 4KH1B 4QJVA 1CQMA 4ZLJA 3KLHB 3KJVA 2GVDB 3PW5A 5JMNA 1T3OA 3LWLA 1Q7LB 4O3QA 2FD2A 3HM9A 5J2MA 4ODQA 4OYPA 3MEGA 3W64A 5IT9Y 2OEJA 5HL7Q 3IRXB 1IKWB 4C8LA 1MU2A 1AZSB 5DZ6A 3DXSX 2WVFA 3W8PA 2KRRA 3UR0A 4QYZJ 4ZPCA 1NB2A 2WM0A 2XULA 4ED6A 4MFBB 2CJ9A 4QOTA 4JI2F 5HROB 2C2RA 1UEKA 2IRYA 3H9RB 4WIWA 2MQMA 5D0HA 3RGIA 4WXOA 3ZXWA 3BGLA 3G82A 4WTYA 4CH1A 4DV6F 3L7PA 2DGSA 2YWEA 4ZPDA 3T1YF 2HVDA 1WHWA 5KFLA 4O3SA 1FFSB 1Q78A 2DGUA 1E9LA 2GQCA 5CXTA 3DOLB 4LQ3A 4JI5F 3CD6S 2B5JB 3KADA 4B02A 2B5JA 5K8NA 1LFPA 3MR7A 1KRPA 3DGVA 4JYSA 4ED2A 4M5GA 2CAJA 1TZ0A 2GAHC 4HBOA 1RA6A 1TKTB 4CH0S 1JXEA 2CNOB 2QLWA 2BQUA 2R4FA 2FZCB 1YJNS 1CSJA 1K47A 2FYXA 3BH7B 4Y34A 3WHIA 1LXNA 2BVZA 3KK2B 2GHWA 4KR0B 1YWXA 2F9DA 4JP8A 3PEHA 3JYTA 4J9PA 4ODNA 1HBMA 2I0XA 2FVSA 1F5CA 4Q8EA 1HHSA 3HJVA 4LBPA 2R7QA 1I51B 3IS9A 5H9EK 1AZSA 1PO6A 1IKWA 2FHOB 2ROGA 3ARRA 5JUMA 1JNTA 1EQMA 3QLHA 4DR2F 4J9UE 3L09A 4UF4A 1EX8A 3KKFA 3W9HA 3JXVA 4DMZA 1CS4A 5F8MA 3MECA 1SJ4P 1L3VA 3A8IA 4LF5J 2AIRB 3EDRB 4KHMA 3P96A 2U2FA 4HDHA 5D6GA 2R9LA 4NL5A 3KMQA 3ILIA 2VIHA 5LT5A 3MMAB 4W92B 4MNLA 4HACB 2IHR1 4K2XA 1T8EA 2OUGA 2ZH2A 5B8IC 1BE4A 1HNXF 2MHNA 4DU8A 2UXBJ 1VRTA 4KV8A 4P75A 4QT3A 1FDDA 4O4RA 4A8FA 1TAUA 3ALFA 1JNDA 1JLCB 1MMNA 2IM1A 2YWWA 3W2VA 4ER8A 3RAQA 3TP2A 4QYRA 3LAKA 3RBXA 3QQCD 1R8BA 3SFGA 1LQ0A 1U1MA 3PA7A 2G1HA 3TUIC 3MR3A 1BQNA 1A7GE 2XMKA 4WYWA 4CYUB 3Q8QB 1TAQA 2Y8WA 2VUGA 3NAIA 2JEJA 1O0PA 4DR7J 2D69A 1FK9B 1NK5A 1REGX 4W4MA 2FY8A 2MZ1A 4NXMF 5JJBA 1JLGA 2W4CA 4K59A 3MD1A 4TY8B 4PWDA 5D8HB 3BF4A 3MAAA 4JFMA 1N54B 4UOHA 3MR2A 2IA6A 4KO0A 3IGVA 2DCLA 4NLVA 5KFAA 1M90T 2BX6A 2X1GA 4X64J 4DOZA 4GVLA 4X4NA 1JNZB 3IRWP 3LANA 3DRPB 1O6IA 3LOUA 3CD0A 5B0BA 4TU9A 3KDOA 2Z2LA 5FLXU 3UCUP 2U1AA 2PEBA 3ILJA 3QT7A 3R27A 5KFCA 3KK3B 5GPRA 1F3VA 2JX2A 1G6BA 2C1EB 5CCMA 5IZHA 5I42B 4XPEA 3PTWA 4WZMA 1NMVA 3KLEB 1J5EF 1HLWA 3LP1B 4NCGA 4OYWA 1I6JA 2ZH4A 4N76A 4DWSD 1SL2A 3LPYA 4C48A 5F8IA 3NMRA 3ELHA 3CJKB 4A47A 1JWWA 4MNMA 2E1AA 2QIFA 3O5RA 1XWLA 1LW2A 4YR3A 2J0QD 1E6NA 1GTEA 1N5SA 4FN5A 4AXIA 3H98A 1WDTA 4DZ3A 2IRUA 1ZZNA 1U47A 1MLAA 4DV7J 1Y5LB 2DNMA 2CQPA 2C3UA 3KLIA 2M88A 4X62F 1KKHA 2XP9A 1AYEA 4KGVB 1HQ2A 1LNQA 3GTYX 2HFUA 5HWCA 2C2KB 2M3DA 4Y2MA 3GIMA 3FAPA 3HVRA 1FK9A 2IUZA 2JNJA 4K8RA 4DQQA 4LF8F 2RDIA 4Z2XA 2BV3A 2BE9B 1HR0F 1NPKA 2V94A 2LXIA 4Z2JA 3DGPB 2I1RA 2QFIA 4RNFA 4R5PB 3RW6A 1Q1KA 4JI0J 4EMDA 3HFVA 1I5OB 3HHDA 4DUYF 2GA7A 3R6LB 4I67A 1ACMB 2C42A 2YNIA 4RW8A 5L1JA 1QE1B 1OIAA 1RA7A 2FGCA 4WKFA 2DIVA 3F56A 3QO9B 5C42A 3QO9A 1E6VB 4USMA 3MMAA 1RQ0A 1RT6A 2HNZA 1TR0A 2CQ2A 1SQFA 2HRTA 2P8IA 3GLJA 4Q43A 3Q23A 2DCUB 4LSNB 3QRQA 3SEOA 1Z2ZA 4RW4A 3VQSA 3L9ZA 2YKMB 4CLTA 2AD9A 8AT1B 5J2QA 3J7ZT 1C4AA 2ZITA 3ZNJ1 4DQIA 4J5OA 1U8WA 4U7CA 2PI4A 3TO8A 3UI5A 3FSXA 3NS5A 3GIJA 4H4OB 1X5TA 1TL1A 5A0YA 3DU6A 1I94J 1HBNA 1YTYA 2ZM6F 2VPYB 2K2PA 2W8LA 4FP9A 2HBYB 4P2MA 2XS7A 3MR5A 2DSVA 1IR2A 2PSZA 3OW2R 4YB1P 1OSCA 1FE0A 3OVAA 4YB5A 2L9NA 1RABB 2WVEA 1HNXJ 1NUEA 2Z56B 4DJBA 1DQAA 3M2RA 2ZBIA 4C8NA 4ECSA 2CPHA 2AWGA 3BMBA 1H73A 2AF6A 1FKBA 1RT4A 3W2WB 9RUBA 4FS1A 4MSPA 4USKA 3L4BC 4DR6F 1D09B 1LW0B 1NEEA 5A2QY 2HW3A 4FVMA 5GADI 4FYXB 5HVHA 1FKFA 2AJ1A 5A8RB 1FNOA 1UZDA 3U27A 4ED1A 4Y2IA 4XDCA 1KHVA 4Y2AA 3AJ2A 4ZVQB 4NCAA 2N7CA 4DUYJ 5BR8J 3RFWA 4P73A 3JSMB 3L95X 4JI3J 2EPIA 3A3NB 1EP4A 2RQMA 3B82A 1NDKA 1E6VA 2BOAA 2DY1A 1BC6A 1SB6A 1S1VB 1D7HA 2HVZA 2KJVA 2XO7A 4LF9J 4MTVA 3D6HB 1RTIA 1PILA 1XJWB 5KT2A 3UQAA 1QTMA 1A7XA 1QDUB 2HZCA 1ZTTA 3FCHA 2OEKA 2NS1B 3OPKA 1W2BR 1OPIA 4DRQA 2YY3A 1EARA 3DYAB 3E01B 3FK4A 1M5HA 3MAAB 2VHGA 4TY8A 1L3TA 5E3QA 1NLKL 1EHWA 4ZP6A 1YBUA 2C2DA 4PTMA 3H42A 2B0GA 3A12A 3W7BA 5B09A 5IC4B 1U2RA 3CWJA 5C7PA 3MMCA 6FD1A 1OYDA 1PSDA 4JI7F 4J9LA 1JLAB 1QY7A 3U1MA 1RTDB 3IN5A 2GO9A 2EG2A 2HGMA 3W60A 1C1BA 2QMXA 2AZ3A 1U7LA 1F5BA 4K4XA 2ZZMA 3BGRB 3DOKA 3VQTA 2ZDOA 1FD8A 3ISNC 2OSQA 1S57A 1T03A 3PIOQ 3AH6A 2LCWA 2AYMA 2CVEA 1PJ7A 4DPYA 4WKAA 4DL2A 2DT0A 2GO8A 2R7WA 3FGVA 2MY7A 3LWMA 1H72C 5IC6B 3SV4A 2ADBA 5F8NA 3T6JA 2OGUA 2QF8A 2L41A 1XERA 2JDJA 2Z4PA 1S1XA 3VALA 2DVIA 4DWIA 4OJ1A 3W66A 3C6UA 2XQCA 2ZH1A 1JIHA 1WC4A 1GXTA 2G0IA 3HSZA 2VOOA 3IKDA 1OY8A 1NK4A 5HN0A 4GKJJ 4QR0A 3M2RB 3RUBL 2WTFA 1S49A 2YH0A 3FEYB 2VG6B 1VQ5S 1GUVA 1M5PC 3W62A 3J81j 1N6QB 3H40A 4USTA 3DLHA 4ED5A 2DT3A 1JB0C 1Q5VA 3E3XA 1BHNA 2HHUA 4MIBA 2H65B 1FFRA 1VGYA 2CQDA 4TKTA 3WD3A 2AEFA 2YQ1A 2ZBQA 1R0BG 3I5CA 3TVYA 4CO3A 5L46A 4OZ3A 3A13A 3KLFA 1IBMF 3IG1A 4QU7A 1SCJB 2PO4A 4ED3A 3QNWB 2EVZA 1WG1A 4J9VA 4OYMA 2D3OR 3LP1A 4NWBA 2G9OA 5DZ7A 1XNRJ 2H48B 3RB3A 2CQBA 2KG1A 1NMEB 1NH7A 4K5RA 5CH7B 4USVA 3DN9A 4I4BA 2DHGA 4RW9B 5HATA 2VQEJ 4AL7A 2HQFA 1FD9A 2KVQE 4FN2A 3H4BA 1S1UB 2HFSA 2ZOFA 1W9UA 4UZCA 1D8YA 1SH0A 2PFDA 2HZAA 3R5GA 5IT4A 5JVHQ 4EYHB 2BQ3A 4JYAF 4GRSA 3BM7A 3TI0A 3LF0A 4LFBF 2HBRB 2ZHAA 4M5MA 1SKSA 3B9AA 3G71S 4HHHA 2DR7A 3D9BA 5IS2A 3C14B 4N41A 4ODKA 4U7UK 5LJ3Y 5A2QU 1NO8A 5D15A 3H5YA 1QVFR 5H9FK 5KFEA 5ETQA 1D9AA 3FCWA 4O3NA 3G96A 3MOJB 2KTQA 1KFDA 3SCLE 3I5AA 3OVSA 3GJTB 4EU0A 1K0VA 4P2SA 1JVWA 3VAJA 3WD0A 2OHDA 2QLJB 5JXSA 5DJBA 4X66J 3K57A 1ZETA 5KFHA 3NKYA 5ETLA 5A8WA 2AJ0A 1NB7A 2RS2A 2OMLA 5KG0A 3KAFA 2WOMA 2BR0A 4IO1A 4CO0A 1CTNA 5KG1A 3TX8A 4DPWA 1U0HB 1KLNA 3M1VB 4X4QA 2K8GA 2LQ9A 4RWXA 4DQRA 2HMIB 3CMES 3PY8A 2HVHA 1FKOA 1X4AA 1KONA 4LRFA 1EIBA 2C3MA 1UFKA 4UUXA 5KFYA 3SCIE 3PX4A 4LFCJ 3RAMA 5IQ6A 2UU9F 3AQPA 1E6ZA 1BY9A 1W1TA 2ZOMA 2UVVA 1FJGJ 1URNA 1KOOA 2F4EA 3D0GE 3GONA 4HT5A 2HURA 1CPZA 2JLFA 3VVTA 2ZH8A 1HYSB 4IFYB 3J80U 2ZJRQ 1HFEL 2XYHB 2E5LF 4DT4A 5HAOA 1GTHA 1FFQA 3O5GA 1MMDA 2KO1A 3A4TA 5DDPC 1UPPA 1KOHA 2DPEA 4R5EA 1ZAWA 2H4WB 2K3KA 3KJNB 3PACA 4YY3F 3HKZD 2YBUA 1YQHA 3KXDA 3WQPA 1Q53A 4M5JA 5EUHA 2W7AA 4P8VA 1UFLA 3B8SA 4H4MA 1J4HA 4PPDA 3BR9A 3Q8YA 1V9OA 4FF1A 3NGSA 1R6VA 3R5JB 1BWEA 4N5SA 2X1AA 3LP2A 4NPOA 4DL5A 3H5XA 3BO4A 3N0VA 2K1RA 1JLCA 1UPMB 2YNFA 4OFZA 4C8MA 1IVZA 1FKDA 2KZZA 1JJCB 1LKZA 3ICLA 4PXDA 1UMJA 1QTNB 4JB8B 4ZP9A 2R7VA 3NOCA 2CQ1A 3FKBA 3T1AA 3W8GA 2L2SA 2IIHA 4PWUA 4DF8A 4ZCLA 4K4ZA 2EWHA 1HNIA 1LK5A 4C3KA 5ETRA 1XMOF 3SZ2A 1SH2A 2BM0A 4LBHA 1X4DA 3RR7A 2CNKB 2DNQA 3MDYB 2W1BA 5CYMB 4BF8A 3UR3C 2LP4A 2K3IA 5ITHA 1KD1T 4NLDA 2AX1A 1EB0A 4MAKA 3C2PA 2F4VF 2RUDA 1GH8A 5C25B 4NZ6A 4ZJLA 1ROFA 1ZK6A 1UP1A 2IMOA 3VGSA 1LEOA 2PFFB 3R8YA 2Q3PA 2DRDA 3R5BA 3V4IA 4DPXA 3PR9A 3CCMS 1YJRA 1VRTB 2ZR5A 2CJBA 2HRUA 1PC5A 1UWAA 2DNPA 3J7AN 4WIQA 3O5PA 4P7VA 1N34J 4IG3A 3LUOA 1C0TB 4C0HA 4YQWA 2JEGA 2OAUA 1UVNA 2JZ5A 1EQ0A 4DROA 1WTBA 2AJ4A 3B7XA 2YKNB 2HYIB 4NXNJ 1P1TA 5E2QA 3Q8UA 1S10A 3TQEA 1O5JA 1NK9A 4NLQA 3GPKA 3A3PB 5GAHU 2BE2B 1YSJA 3MWBA 2FPHX 3THVA 4QWEA 5F9NA 2BJ8A 2E66A 1VQOS 1NMWA 2B56A 3AQOA 2OD6A 5GMDA 3PIPQ 4DSKA 4GMKA 2IY5B 5DF0A 2CQIA 3CGMA 2QE5A 2DNYA 4LVNP 3ARSA 2GW8A 3DOMB 4PKDB 1CJUB 1URRA 1C1CA 3M8RA 4CWBA 1NKCA 1SXLA 1NDCA 1SV5B 2M9KA 2NXUA 3W5XA 4B9NA 2XNQA 4M5HA 3PRVA 4PWWA 1CJKB 1Y00A 1JLBB 3TJAA 3W3SA 1FJGF 1UVIA 2GJIA 3I32A 4HTIA 2V4JB 1RT5A 4QIGA 5KFRA 3ARPA 2LA4A 3DOLA 2LPVA 4KPCA 1Y10A 2WOMB 7FD1A 2I5JA 5DGBA 2OLWA 3EMTA 2WAQD 2Y1JA 2BKPA 1T9XA 2COLA 1ZBWA 2YQ0A 4J9OA 1HNZJ 2QMUB 3EXCX 3VR1A 1M0SA 5I3UA 2GCFA 4USIA 1U1QA 5DDOC 1T9YA 2KXHA 1PJ5A 2MQ8A 3D54A 1FF2A 1UEUA 3VV2B 1VRUB 4Y0FA 2E1CA 2HVIA 1RWVB 3BKFA 3O5TB 3UD5A 4B9UA 4EYIB 3HO1A 3OT9A 2QLXA 5GADU 1MROB 3K59A 1NWTA 4HHUA 1O8BA 1RCXB 4RR5A 1DTQA 2X3DA 4W98A 4N47A 3VVUA 3NI6A 1DTQB 3CCSS 4NOHA 2MKKA 1UVKA 4PCQA 4I6AA 1GEHA 1U25A 2J5AA 3GSDA 3IS9B 4CRJA 1FX4A 4G1QB 3EUNA 3PM9A 4LRBA 1R27B 4IQXA 2LKNA 1NWUA 2C2NA 1IN0A 3U7JA 2LFVA 4ZIVA 1N1AA 1RJJA 1DZ5A 1TP7A 5KG7A 2DR9A 1NM2A 5KFIA 2BW7A 3ZTOA 1RE1B 4P7TA 5CZVA 2R2TA 2GIQA 3Q2TC 2OPRB 1UCNA 2E7VA 2VBWA 1D6OA 2FVCA 2VPZB 2KI2A 2WBMA 3PNIA 1XHGA 4CNZA 2B9WA 5K8PA 2N82B 3KLFB 2W9CB 1IKXB 5K5MA 2HS3A 1RT5B 3NP5A 1VLOA 2VG5B 4P2FA 3RB6A 3RM8A 1FFGB 4ED7A 1HWIA 2XMVA 2D41A 2NPIA 4DSLA 2IVFB 1S1TB 4WFAQ 2BKOA 3MEEB 4EO8A 1OQ6A 1G4CA 1QAYA 1X4CA 2MKYA 5L38A 2E9TA 2EFPA 3MM6B 3RU0A 4WKYA 2JC1A 4LF2A 1Q86T 1RTIB 1CC8A 2A2CA 2R42A 2DYAA 3GPAA 4Q44A 3H2VE 3I31A 2M5YA 2PDAA 1Y0HA 4LJMA 2HVEA 4U84A 4WKRA 3MPWA 1D1UA 1CLFA 2MQQA 4BCAA 1B7FA 5GVQA 1HI0P 4JBCA 4Q7NA 3MEGB 3ZZOA 4IT4A 2VFRA 5I4MA 1F60B 3TR5A 1TUVA 2VD3A 4OHWA 4ZLNA 5T14A 1JLQA 1KR4A 5ETSA 2E7WA 3EM1A 2XCAA 3M4XA 2DSZA 3CVKA 4X4RA 3BGRA 3TA2A 2M4MA 1IBKJ 2OPRA 1P27B 2ZE2A 1K0TA 1U24A 1XR6A 2VOPA 4C98A 2MKHA 5C5JA 3TCZA 1EZZB 2FZKB 4JI1J 1YZ7A 1D9DA 4RJVA 1TL7B 3G6YA 1X6LA 3ZC4A 2MY8A 1TL1B 2M7SA 4Y65A 2PT0A 4LSZB 3C6UB 5GMEA 4ES3A 5KFDA 2DD8S 3RB4A 1CEZA 1VK3A 2BJDA 2DG9A 1HNVA 1WF0A 2V2VA 3MMBB 2LQ8A 3DYAA 2CUYA 1U79A 3E01A 2WVDA 3D6FB 4LQ9A 2FAPA 4BWMA 5F3ZA 1ZA2B 3CEDA 4CLYA 4RUAA 1OWQA 2BXJA 2YNGA 2FJVA 1WKLA 4DRPA 2DK2A 1LFWA 1OYEA 2KE0A 3FSYA 3KDNA 2QFJA 4F4ZA 1FA0A 1HXVA 3S01A 4F0KA 2FUG9 2D7SA 4F26A 3O44A 5DGAA 4P8WA 4TNSA 3CNQP 3I9V9 4DBQA 3HVWA 4PZVA 2KU7A 2DPIA 5L1IA 1OS5A 2QYCA 3POTA 2QSFA 3HD2A 2V50A 4IH6A 5HBFA 4DLGA 1K73T 4J37A 1S99A 5M2RA 4CLSA 3DRSA 3TYTA 2DNZA 2DH9A 2RSQA 3EE3A 4KH0B 5HW6A 1NKEA 1AW0A 3O5OA 1N5YB 2RUCA 4CP5A 1H0IA 2LGOA 1X8DA 4USWA 2KFWA 2XZWA 1XR5A 1P8GA 3GV8B 1NAQA 3CPWR 3PDNA 1DJ0A 3CD5A 3LQVA 3PEJA 1RU2A 4RX6A 3HHEA 1SH3A 4OZNA 4FDFA 1JCHB 2HKEA 3CB4A 3QGIA 4NMXA 4DL0C 5EX3A 4PG8A 1FNXH 3UN2A 3MFHA 1J27A 3AD9C 2QL7B 5I3PA 4A46A 3CCVS 1HBNB 2GC8A 2Q1LA 2OJ3A 2R7XA 5KFNA 3EPIA 3QIPB 3UQSA 2W4DA 1B3TA 2K06A 5H1SV 5HVGA 3CUNA 1J4RA 2RILA 4FBTA 1RBAA 1ITXA 1D3WA 1MG7A 3ADAC 2HHSA 4DCJB 3HP6A 4JV1A 3A1YG 4LFBJ 1AB8A 2ZQVA 4OHVA 3TZZA 1XMOJ 1NJXA 3CO9A 2DNNA 3PW0A 3EZUA 5CAAA 1Y7PA 1RP5A 4RNHA 4IFVA 1X5SA 5H9FJ 1MWQA 3MCNA 7AT1B 4IG3B 3KZ7A 4F67A 1P5QA 1N0VC 3WD1A 3UDLA 2ZHOA 5F9LA 5HW7A 2A3JA 1SPBP 2IM2A 3BZQA 4ZVOB 3MPYA 2CPFA 2HRYA 3P5TL 5THWA 4Q45A 1TK0A 2GVZA 4NMLA 3CMAS 5ETPA 1WC0A 1IKVB 2RS8A 3CCZA 5IM0B 1U4BA 2FZGB 4R8UB 4RU9A 4J9KA 5CZXA 1KQSR 2BDPA 1S6PB 1YJVA 2KFZA 2QGFB 5J2NB 4HT7A 1Y5IB 3FNNA 2ZOGA 1FDAA 4ZCMA 4QR1A 2OPSB 3KG4A 1RD6A 2ZR4A 4JV0A 1T7PA 2EW9A 4JFKA 3NRBA 2I2YA 1B0TA 1E6YB 1S7HA 2BANA 2YPZA 3F0NA 3HD1A 5E3RA 5A8KA 2R7UA 1WC3A 3WD4A 3ZNUA 1M1KT 1U02A 2FJAB 1FRKA 1WF2A 1DAXA 1YRXA 3CJ2A 4MK8A 4NCBA 4C8ZA 3MTJA 1XMQF 5IT9U 2WLYA 3H2LA 2M70A 1HNWJ 3R7SB 3OTOJ 4AL5A 4IFVB 4DSEA 1W26A 2VDIA 5KFTA 1LWCB 3UDVA 2J8AA 3S8SA 4IOAQ 3NOGA 1NHVA 2PBCA 2LDIA 4M5KA 3O5IA 2AJQA 1FI4A 3LP2B 4YHHF 3B9EA 3MF5A 4J4OA 2BJEA 1S1WA 5KT5A 1RT7B 1VQSA 3OHAA 3MPUB 4PQUB 2WSEC 5CYQA 4DWSB 1EAYC 4B9VA 4NZ0A 2P6SA 2DG4A 4DZ2A 5J6EA 2WONB 3MM5A 2Z30B 3VTIA 1EDQA 1ZS6A 2DT2A 3NGTA 4ELTA 1GFWB
chains in the Genus database with same CATH topology
3CF5Q 2DGQA 3GIKA 4V19J 4DR5F 3Q8SB 4PWDB 3DRYA 3LH2S 3BEGB 4IQ2A 3N28A 3LW5C 1FKRA 5DM6Q 4Z2LA 2J9EA 4HEA9 4TU8A 5KFWA 3NLCA 3GYNA 5DDRC 2UUTA 1XR7A 1LWEA 4WK3A 2IAJB 2LJ4A 3KLEA 1WNOA 2SXLA 4RW7B 2WCXA 4LSLB 1Y9OA 5A8RA 1LWCA 2PC6A 2VASA 1Z4UA 4CO5A 3KK3A 4PXBA 1RI7A 1KFSA 2GQQA 3V2UC 1VFJA 3C8YA 4KGMA 2O9OA 4URIA 2HFOA 4PG5A 2HLTA 2UP1A 5GAGI 5FDLB 3M8PB 3R3TA 4GKJF 1BKFA 3K5OA 1VC5A 5HLFB 1BQMA 5KT7A 1S6QB 4CNYA 2CPXA 5KOXA 2OPSA 4NRUA 3M8QB 2ZC3A 3Q8RB 4WE1A 1HKMA 1WTFA 4WE1B 2F3JA 1HBMB 4EO6A 1YGYA 3BR8A 3MOZA 4H4OA 5J2NA 2O67A 3G9CA 4XK8C 5GAGU 3IWXA 4WFXA 3BN7A 2CZVC 3MHYA 4K4YA 2DGOA 3CCTA 2C3OA 2POKA 2W4PA 1DURA 1JNSA 2V4RA 1YJWS 2HWTA 1KT0A 2MZSA 3G6MA 5EGYA 3TVKA 4KTQA 1QSYA 1T11A 4Y3CA 2JLEA 2YNIB 4OI3A 3KHRA 3BO2A 3BQ0A 4NCGB 4RW7A 4M5DB 2ALZA 1WEXA 3FVYA 3O5FA 4LT6A 4X64F 3PO4A 1HKJA 4B3SF 1FCAA 3AAWB 2FLNA 1V3ZA 3ARTA 2RU9A 3K58A 5EX0A 4DRKA 2MNTA 1JNRB 3DC2A 3TRGA 3KK2A 3JYTB 4FYDA 2XPAA 2G41A 4LAWA 4TY9A 4M94A 4KO0B 1FJCA 4CQ1A 1D7IA 3W4RA 4QBUA 2MKCA 3EGZA 5EWGA 4ERDA 4EEYA 1RT3A 3MXHP 2F21A 3BGUA 1S9EB 2V2KA 3MM9A 4MTPA 2YWGA 3MI7X 3KOAA 3TA1A 1Q6HA 3BGFA 3I0SB 2MLYA 2DSWA 3WQWA 3MCSA 2CPJA 5A6PA 2N3OA 1VQLS 2DGVA 2LQBA 2AGPA 2D74B 2KKHA 4DFKA 3ZZYA 5KG3A 4KV8B 4NYOA 2PIIA 2KFNA 2GJ2A 2WK2A 4B9SA 3NS6A 5C42B 2DO4A 4Z2HA 1TQLA 1T03B 4X4SA 4N56A 1ELOA 1OSDA 4GO7X 1YIJS 1VQ9S 3ARXA 2WSFC 3SXLA 5E41A 4QT2A 2F8HA 4UUWA 1QUPA 5I3QA 2G1DA 1VQ8S 2XB2D 3C66A 4E98A 2UXCF 1KLMB 2FB0A 1HNVB 2OSRA 2RVJA 4WFYA 2QZ8A 2A3CA 1HBUA 2N3LA 4OZ5A 2H5EA 3I0RA 1AFIA 3U1NA 4EZ6A 4WK9A 2LA6A 4OV1A 3TW0A 2ERRA 5E0OA 5CA5A 2AJFE 2BACA 2Z8QA 1KSPA 3I0SA 4F02A 4C8KA 1Z2LA 1WD6A 2KGJA 3Q22A 2L48A 2V4JA 2XY5A 3I4HX 5LXRA 5DIUA 3O5MA 1JLQB 5F8JA 1WWHA 4IR9A 4F4KA 2ASDA 3MEDB 4KJIA 2FGOA 3BQ2A 1Y4ZB 1QAXA 4NLWA 4YEAA 3F44A 4JI6F 4ECXA 4Q2MA 2CJKA 2VC1A 1Q8LA 4AE5A 3OXFA 1S72S 3VAKA 4J9NA 1N88A 1DQ9A 4ID5B 1F5AA 4PXCA 3N6LA 1G3OA 1K9TA 4RU2A 1HD0A 4DUZF 2R2RA 4OZ0A 1N48A 3HHLD 1KTQA 4JFJA 4D3GA 5CD4H 5EN1A 4TU7A 4MMOA 3A8EA 4ZP8A 4WKHA 1U1LA 1TV6B 4JUZA 4AFFA 3WC2A 5BYSA 2HNYA 5T7LA 4CCHA 1X9SA 1UR8A 3QMQA 4KKOB 3KCEA 4DV0F 5GQBA 1G1XA 1H7WA 4N8OA 4IRDA 3H59A 1WF1A 3N6MA 4FS2A 4OL8A 2PI5A 1N5VA 2HHVA 3BSNA 3CHCA 2G13A 5K9FA 3NCQA 3BN4A 2KR7A 3SCJE 4MJKA 2JH3A 3KAHA 1QSSA 4AXJA 1CG2A 1QAJA 1JK9B 1FO1A 5HLFA 2PMHA 1FKOB 1NJZA 3CT9A 4ID5A 5EDWA 5EWEA 1N33F 1M5SA 2MJNA 2MKIA 5L9XA 3ITHA 3RR8A 3N6NA 1TL3B 4DRMA 3UF8A 2Q43A 3OTOF 1OWXA 3S1TA 2R7TA 1U6ZA 4QWDA 3GV5B 5KG4A 4K4WA 1AFJA 3MM7B 2DJWA 4DRNA 1AUDA 1JLFA 2YVSA 1LWEB 4D3HA 4RNOA 4KSEB 3R1HA 4OMFG 2EFOA 2XP8A 5JVGQ 1XBWA 3M6XA 3AB4B 4RUCA 2M8DB 2PA8D 1FKTA 4RBUA 3G8SA 2XMTA 3GWCA 3ETOA 2ZH6A 1FKKA 3PZPA 1VC6A 2HG4A 2OPPA 1IBKF 1VQNS 3DLEB 2MZQA 1S4FA 4MIAA 3ARWA 3FY1A 4L3NA 2B9XA 3ARZA 3J81Y 4DF4A 5CYQB 3SDEB 2UXBF 2IRXA 1IX5A 1V3RA 2BE2A 1VF8A 2PV3A 1TVRA 2K7JA 3ULHA 3KLGA 3K2YA 2ZKTA 4NA1A 5J2MB 2CG4A 1HQUB 2MPUA 2NYIA 1IXKA 2RRAA 3PW2A 2JZVA 2KFYA 3T5KA 4OI6A 4XIUA 2CZ4A 1HI8A 2BABA 2N4CA 1FDNA 4H4MB 1P9QC 3UI4A 4DSJA 2O01C 1VS3A 2YX7A 4X4PA 5CQGA 3FQLA 4B17A 3V4IB 3IXQA 3TQ1A 3RW7A 2VFTA 3SV3A 4OI0A 4QW9A 1M5YA 2CQGA 2Y78A 5KT3A 3VAIA 1U45A 3WKZA 1KNZA 2VH7A 1IKYA 2LDYA 1Q4RA 2MDAA 1HARA 2QO3A 3CDEA 4YDXA 3GFYA 4MYUA 2W25A 2CPIA 2D9PA 3PW7A 2IYGA 1KQFB 1Y5NB 2XMJA 3BSCA 4DDFA 5D4NA 2B43A 3WL1A 1MROA 5D4OA 3ZFVA 2IBOA 3MM8A 2NUUG 1F8AB 4CTAA 4DL7A 1ZBCA 4ZPWR 1HMVB 2A3AA 3CHDA 1Q81T 4CT8A 4UQGA 1HD1A 1S9FA 2CQ3A 3AS0A 4Z2GA 1V3SA 4G2PA 1HQEB 2OKQA 3BO3A 1VBZA 4UY8T 2D3UA 3J80Y 4JI8F 2VBZA 4TNOA 1NNDA 2XMWA 4QR2A 1FRIA 4KKOA 1N34F 3VWSA 3MM9B 2XP6A 2W7OA 1LW0A 4A8OA 4F4WA 2YBTA 1ZOTA 2O66A 5F8LA 3UE2A 1JLBA 4N8NA 1VI7A 3T1HF 5B08A 2XP4A 3PRAA 4W9OA 4QWBA 4NZCA 2RIJA 1RAJA 1N56A 2ZKUA 1H2TZ 1GOIA 2LEBA 3CC4S 2P6TA 3QJPA 2J0WA 4F50A 1FTRA 3FZ2A 2UVRA 5A0YB 3KMSA 5F8HA 4USJC 1UJ6A 3M8QA 5IQQA 4KHPF 1HBOA 2HNDB 4ES2A 3IR7B 1FKPA 5LSOA 2XY7A 4P8UA 2VB6A 5D77A 4F4XA 3ENWA 2HPUA 1HQEA 2B51A 3WH0A 4B08A 5DO2A 4IDKA 4G50A 1N4LA 2XG8A 2VFSA 2Y0SD 4TXSA 4TN2A 1RT4B 5G0RA 1N8RT 5E3CA 5DIVA 2MQOA 2VA2A 5KFQA 5HW8A 4LSLA 3T5HA 4DSFA 3HT3A 2V9WA 2EFGA 1E15A 2E7XA 2G4BA 1QPFA 3MD3A 2Q79A 3C6TB 4Q5VA 2NPFA 1TKZB 1G7CB 5J2PA 1WB0A 4PQUA 4DG1A 2HHTA 2P5VA 4O3RA 1LQ9A 3E51A 4Y2KA 3JAMY 3J7Z5 4C8OA 4ED0A 1S6QA 4TW7A 1DQ8A 1Y0OA 2QT7A 3KLIB 1FVQA 4TYOA 3TA0A 5HT1A 1WACA 2R8IA 4NA3A 2VODA 3G6ES 2QV6A 4IQXA 2M08A 3N5BA 3O5DA 3OJSA 2ILZA 2C22A 1FKJA 1RTHB 3TUJC 3NL0A 1H0GA 3SSRA 1R9HA 4IG0A 4HLBA 1P1LA 1R6YA 4ILRA 5IFMA 2AGQA 1FKHA 4A8SA 4ODPA 4K0KF 2P9EA 2VPXB 3MTKA 3O6QA 3QGGA 4OI2A 2XMUA 5DDQC 5B0CA 3PKYA 3D1OA 3JTPA 4F3QA 4MGVA 4Y2CA 3FDSA 3OV7A 2JL9A 2Z2MA 1OQ3A 4QIVA 3NBPB 4ICLB 3PVXA 1YHQS 4IO9Q 2KZMA 5C24B 4V19X 3CGIA 1F0XA 1H6KX 4S3KA 2XSJB 2DITA 1NK0A 1S1TA 2NSCA 5LXYA 3WC0A 1S1VA 4B3RF 4M63A 3CCRS 2FC9A 3X3UA 2B7CB 2FLLA 1QPLA 3SFUA 2HQIA 1D2KA 4YB6A 3MZIA 3Q8PB 3K0JA 3N79A 2E1MC 4JV5F 1FKIA 3KACA 1PGZA 4ZVGA 1RT1A 3GR1A 2RE1A 5HO4A 4QWCA 2R2UA 1C9HA 4TX0A 1RTHA 2RF2A 4Y00A 1X0FA 2AYBA 5B0AA 2RF2B 4HKQA 1U1KA 1W1YA 1FRHA 1Y3KA 3DOKB 3WBZA 4DV3F 4LFCF 4NRTA 2HS4A 2FJBB 2O5DA 2G0CA 1YITS 1SBRA 4CI0B 3OXLA 2UUCF 2IC3B 1SUQA 4IOBA 4O4GB 2RS2A 4DLEA 2J7WA 3HZGA 3JSBA 3HO1A 3NWGA 5EHHA 5G0RB 4TLQA 3KJVB 4WF9Q 1FHTA 2C3YA 1JMTA 1F9FA 2J76E 2R7OA 3DRRB 2RU3A 3DRRA 4BBYA 1TKZA 5J2PB 4ZPTR 1Q16B 1S6PA 1M5KC