4ZPVR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
molecule keywords D12 Fab Heavy chain
total genus 45
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zpvR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zpvR01
4XAKA 5DO2A 4KQZA 3SCIE 2GHVC 4ZPTR 3SCKE 2GHWA 4L3NA 3D0GE 3D0HE 3BGFA 2DD8S 2AJFE 4ZS6A 3D0IE 4QZVB 3SCLE 4KR0B 3SCJE 4L72B 4ZPWR 4ZPVR
chains in the Genus database with same CATH superfamily
5E3QA 2W4CA 3MECA 3V4IA 3VAGA 1O51A 1UVNA 2MMYA 2VFUA 4B9NA 1XHGA 2X3DA 3GYXB 2GQQA 2PD1A 3TP2A 4Z37A 3BJYA 3H2LA 1FERA 2RUDA 4U8VA 3Q24A 4OZ2A 3W2VB 1KN6A 4PWUA 1SR0A 2QO3A 2CQ0A 5HAOA 1D6OA 1N6QA 3LF0A 2YNGB 4FZVA 1CJVA 4LBIA 1S6PA 1FXLA 1WACA 1RT7B 3GB0A 3M9MB 3A8IA 2UU9F 2M88A 4WIWA 1EHWA 4QW9A 4JI5F 1OY8A 1ZH5A 2CZVC 3ILIA 3BKUA 5KFKA 3B4MA 2ZC3A 4MAKA 1FKTA 2Q6CA 4USWA 1C0TA 2CUYA 4QU7A 1CLFA 2G13A 4YEAA 4DZ2A 4M5GA 3QOKA 3RYLA 2XYGB 1SPBP 2DVIA 1X4BA 5D0RA 5KG6A 2ZNYA 2JX2A 2GV1A 3SDEB 1RHKB 5DO2A 3DXSX 4RW4A 4N8OA 3ITHA 5L46A 2PMHA 3AD8C 1GRJA 2FZGB 3CJ3A 1JLFB 1RADB 1DTTB 2DIVA 2V2QA 2Y3YA 3C16B 3K89A 3R5BA 8ATCB 4JFJA 1SC6A 2A3CA 3TRGA 5K8MA 1T05B 3LP0B 4WZMA 1WTBA 1CPZA 2HQIA 4BC7A 1NUEA 1O6IA 2X1FA 1UJ4A 4DV5J 3C15B 3GFYA 4QBUA 1H0IA 1C2PA 2DHAA 2RT3A 4R0EA 1HI0P 2HW3A 3VZHA 5HROA 1BQMA 2OTJS 5IZHA 2RILA 1GH8A 3WC2A 1X4DA 5DITA 3EDRB 2Z2LA 1VBXA 2U1AA 4LF4J 2BKPA 2MQ8A 4ODLA 2MKSA 3R3TA 1XNQJ 1HFEL 2H5JB 2RQ4A 2ZH2A 4USKA 5BJRA 1S72S 2ZR4A 4ELTA 5CH7B 4MNJA 3MM7B 4GVLA 4F4ZA 3J80U 4S0MA 1C1BB 2IA6A 4TN2A 2HBZB 2R7UA 5D78A 3PDNA 2RS8A 3KDOA 3ZFVA 3BV8A 4U67Q 1NKBA 3MUTP 1FFWB 1LG2A 1N48A 3D6HB 3BXWA 3KLGA 1FKRA 1ZM3A 3QZ7A 4HL9A 3W1YC 5A0YB 3R9LA 4ZPTR 1F1BB 4NCGB 1OGGA 1RT6B 2DXFA 1ICEB 1ZS6A 2Z30B 3BKFA 2DHSA 3C14B 3D28A 2I38A 4NX9A 4FYWB 5HVHA 3D0HE 3G9CA 2D9PA 1ZAWA 4DHVA 1OWQA 1F3VA 3EZOA 1X4AA 1HNIB 1MWZA 1KFSA 2DRAA 5CYQA 3UQBA 3OFHA 1F8AB 5HI7A 4OV6A 2V0NA 1KBRA 2V8HA 4KHMA 4FAPA 2RE1A 3TAPA 2JZVA 3GV8B 1VYAA 3DLEB 3HD1A 1FX2A 2C28A 4N41A 1HBMB 3FRZA 3W64A 3MFHA 4QYZJ 4BWJA 3ARUA 1IBCB 4DSEA 1XTZA 4J4NA 1VGYA 3JQJA 1S0OA 3SV3A 2XP7A 2IM2A 4P52A 2KO1A 1NWUA 4Z2HA 2Q1LA 4J91A 1FFGB 5FLXU 2B6AB 4NLWA 1L1PA 4LF1A 4F04B 1VBZA 2A0FB 4O3NA 3PKMA 4G65A 2OFNA 1N34J 5K9FA 1HA1A 2KE0A 5HWCA 1NHUA 4PKDB 3OJUA 4KJIA 3R6LB 4P6QA 3L7OA 3ALFA 2HRYA 2E1CA 4PPZA 4RW8A 2Z2ZA 3CDUA 1RHJB 1RJJA 5B0FA 4D3GA 1NJWA 2DITA 4B9LA 1Q79A 2ZWPA 4YR2A 5LMUJ 5E3RA 1K0TA 4OI3A 4PYAA 2UVWA 2ZQSA 1U24A 3E01B 4CLYA 3CPWR 4ERDA 1RAJA 1MU2B 1FWPA 4EU0A 4IR1A 1ROUA 5H1SV 2PMZD 4O44A 3VGUA 4C8KA 2CDQA 1XC9A 4B3SJ 3N6MA 1KONA 1KC8T 4M95A 4WZQA 4GO7X 1NNDA 2IDLA 3C19A 3VAWA 1V5IB 2GJFA 1VQ6S 1D7HA 3R7BB 3VF0B 4UUXA 3L7UA 1IKVA 2IVFB 1S1WA 1Y3JA 2HNZA 3SCKE 1S10A 3I6CA 5E0OA 3W5XA 1S57A 3LP0A 3F56A 5D3GA 2JFKA 2PI6A 1XBWA 2QE5A 1GT8A 4CO0A 3Q0AA 2RMLA 1RKIA 5F0UA 4EBEA 2DY9A 4QR0A 3JYMA 3CB4A 1JJHA 1IJEB 2AJ4A 1LXNA 5HROB 1F60B 3MUMP 1UVLA 3MR3A 2NLWA 1VRUB 2V94A 4KH1B 4WXOA 4X62J 4X4OA 2AHOB 1DLOB 4B3TF 3GIIA 1J4HA 2QN6B 3CT9A 3FCVA 5GAEI 4WYLA 1X4FA 2XP6A 3QO9B 3TVZA 2VQEJ 4ZPBA 3R5CA 4J9OA 2MZQA 4CP5A 2C2ZB 1RWKB 2HK2A 3TJAA 2CFXA 3K5OA 4U6PA 2C2RA 1Q4RA 5L9NA 3KAHA 2B43A 2WONA 3CJ4A 3OTDA 3FAPA 1EARA 2E7VA 2WSFC 4IDKB 4QPXA 2IRXA 3OFFA 1W9VA 2ATLA 3SV4A 1H73A 2CG4A 4HEA9 2ZQVA 3FY1A 1QAXA 1T3OA 3VR1A 4DR4F 1NM2A 1F2GA 3IG1B 2HGLA 4ICLB 3DDKA 4PG6A 5C2CA 1L3UA 4A4JA 2IM3A 2YKOA 3AJDA 4ETXA 4U85A 3V81B 1ZTWA 4FYVB 1C4CA 1ZBCA 3PEJA 1R3NA 1QTNB 2UUWA 2BJ9A 5CYQB 4JB8B 3O6QA 1RABB 3FUYA 3ICLA 1AYEA 2WB4A 1W9PA 3W8GA 2QT7A 1RKJA 3K2YA 3MMCB 3OPKA 2DISA 1FAPA 4LT6A 1BC6A 1T9YA 3KJNB 3LANA 1LL7A 2PI5A 2VG6A 4DCPB 4ODQA 1WHVA 3M7VA 4EO8A 2CADA 1UTAA 4DU7A 2W1BA 4ZN1A 5AE1A 3NXZA 2ZJPQ 1Q82T 2HMIA 4O3RA 4X4UA 5CYMB 4A8SA 3MM6A 2XBPA 4HDGA 4YDXA 4ODOA 5FDLB 2XC9A 2QLXA 2QA4G 3D4JA 3QATA 4F36A 3R1LA 2B8QA 4A48A 2YBVA 2HHTA 1REVA 1IBKF 1NZ8A 1RTJB 3GG1A 3IR5B 1EX8A 2O67A 1FA0A 3NBPA 3TA2A 1FJGF 4J4OA 9ATCB 3GJQB 4OYMA 3BGFA 4W5UA 1R7IA 3MMAA 3G8TA 2PSZA 4LF8F 3MPVA 4URQU 3KMSA 1NWTA 4WWSA 4FF3A 2EXUA 2V67A 2HFSA 1R31A 2A6MA 2EWHA 2RKIB 5I3PA 4R25A 4LFAJ 3WHIA 4J9KA 1JNRB 4JV0A 2AU0A 3J7A1 3RR8A 2RF2B 4P75A 1FRLA 4F4XA 1YWXA 3WX4A 2UP1A 1SQEA 3EGWB 3ILJA 1Z4UA 2J7UA 4HT7A 4DWSA 5DJBA 3PXGa 3V2UC 1NDLA 1ZA2B 3KUGA 4CLSA 1ZYQA 1UEVA 2IUZA 1Y00A 2J9DE 1TKTA 3ILOA 4I67A 4PWDA 4M5KA 4NLXA 3AY0A 5C24B 4OV1A 5K20B 1QLNA 4MT1A 1N4LA 4JI0J 1FXRA 1G7CB 4ITSA 3R2DJ 3ETMA 3M8ZA 2ASDA 3CTRA 1K44A 1C1CB 4N7TA 3G82B 2GVZB 2J76E 3MOZA 3AQPA 1Q95G 3AQOA 1IKYB 2V2VA 2EC0A 4WE1A 3S6EA 1NJZA 1SC3B 2JDJA 4GKJJ 3T5KA 3LAMA 2ACMA 3BPDA 4KYZA 3SSSA 3M8RA 4LAWA 1S1XA 2C3OA 3DRSB 3O2IA 1Y11A 2VJUA 1FFQA 1RACB 4ED6A 4DR3J 4DR7F 1FEEA 1NMVA 3HVTB 2HAIA 4P71A 2XEXA 1Q16B 1SKWA 4LF5F 4QU6A 2ASJA 2FLPA 2X1GA 1M1GA 1R6YA 1FKDA 2HFUA 5E3AA 3QMQA 5KFPA 4QW8A 5G0RB 3SDEA 3TZWA 2GO9A 2ZBPA 1B6CA 2B9EA 4WIIA 4DZ6A 2W9CA 2HIYA 3LTOA 5LMNJ 3I5AA 4C8OA 1KP6A 3CZ8A 1XR6A 3I9ZA 3V6HA 1TV6B 4WP3A 2W4PA 4HBEA 1M5HA 4TY8A 3W5ZA 3CCLS 1LQ0A 1X6NA 3MDYB 3GFXA 3EVWA 3UE2A 3RM8A 4C02B 1Q86T 1RAHB 2ZVIA 1S49A 2VBWA 3GR1A 1F9HA 1HPZB 2HIQA 3T9ZA 3ZZRA 4Z2XA 2XCAA 3JSMA 3CMQA 3KMQA 5EUHA 3I0RB 2NQPA 3HSDA 4ZPDA 1PILA 1M1HA 1NSKL 2K1RB 3DMJA 4UUWA 1Y3KA 3WIVA 4E98A 1U45A 4WF9Q 1N5QA 1J4IA 1JLAA 5J2NB 2XZTB 4TXSA 4F0KA 2PC6A 2YKQA 3PW0A 5JH8A 1L3KA 3BH7B 3EXCX 4I7FA 4IFVA 3TQEA 7AT1B 2R2SA 3FSXA 4KKOB 1VBYA 2OIHA 2KT5A 3ARZA 1AROP 4FPRA 1XMQF 2GFFA 2XP4A 3PW4A 5LSLA 3IBCB 3KLGB 5CYJA 1W7WA 1TL7B 1UKUA 5A8RB 2CQ3A 2EC2A 2KKHA 5IS2A 5GAEU 4DV0F 4RWXA 4CT8A 3FDSA 1T7PA 4XDDA 2CQHA 2VPZB 1TKDA 1MU2A 4G1IA 3BDEA 2WVEA 3MPUB 5I3UA 2F9DA 2UU9J 3PIOQ 5EN1A 4QT3A 3B9DA 1KS2A 4OJ1A 4DV2J 1WC4A 1S6PB 1D8ZA 2LMIA 3N6LA 1JNEA 2AJFE 2EBGA 2GMHA 3OV7A 3OVAA 2KU7A 3Q83A 1RLCL 2GX8A 3RR7A 2OPQB 2VDHA 3CVKA 5EX0A 2V5HG 2ZHOA 1KT0A 3MMBA 3W60A 4ZJQA 5GMKa 5ETRA 3EX7B 2IBKA 4RL1A 4DWSC 2ZBRA 4WP9A 1KEKA 4DRJA 4DRMA 2BJ7A 4I2PA 4QPTA 4C11B 2FVQA 4PUOA 1FD2A 4KAIA 2YWHA 2KRBA 2LLZA 4AYBD 4FN5A 4QIEA 1FDBA 5HK4A 4ECUA 5KFEA 1FVQA 1SQGA 2GAGC 3DGVA 3KJFB 1XNRJ 2RSQA 1RHMB 5F9NA 4A8WA 5EHHA 4OJGA 4DR6F 1TFVA 5JJBA 1JXEA 1OJ4A 2ROPA 3Q8QB 2KXHA 1HNWF 1KHVA 2CPXA 2QSFA 1HIYA 4OZ5A 5SZTA 2KN4A 2BJEA 4U7UK 2M8DB 4NXMF 2DEJA 1LK5A 3CD0A 4J7CA 2DSWA 1TFWA 2J6SA 1YHQS 2KG0A 1RU2A 1N33J 4DSIA 4HI1A 4OX7A 5FIIA 4NXNJ 4UQTA 5HW6A 3BN4A 2YXLA 3WDOA 2V8PA 5HKGA 1U6BA 4FKXA 1H74A 2XNQA 4ANDA 4OX9F 1JNTA 4ANCA 2J8AA 1BD6A 1OO0B 5L39A 2MGZA 3KKFA 1V3SA 2R7QA 4O0IA 3VAKA 1RT2A 2M7SA 3DYAB 4ZVOB 4DR2J 2IYIA 3CJ5A 4MFBB 1NU4A 2M2AA 3BYRA 3H25A 4YOEA 4K5SA 5DEZA 2F4FA 3G2XA 4YMEA 1T94A 4KSEB 1BKFA 3VVTA 2VH7A 5C5JA 2W9BB 1JJ4A 1RTDB 3HJFA 3KCEA 1Q8BA 2Q79A 1RWNB 4HH1A 2DO0A 1AT1B 2IM0A 3TW0A 2YBUA 4PABA 1D7IA 1WHYA 3JYTB 2MQMA 3HZGA 4I4BA 1ZETA 1VQLS 4C7QA 2HZVA 3DHWC 2DSZA 1FF2A 3N28A 2AOSA 3G86A 4ED3A 1RAEB 4F2SA 3UQAA 3I0RA 2XMUA 3QIPB 3M30B 4USHA 2PIIA 3UVJB 3IM8A 1PINA 3M6UA 2XQCA 2QC3A 2UV8A 1ZZFA 5CQGA 1QD1A 5FDLA 5CXTA 2B4UA 3KZ7A 4M5HA 1U1KA 3P5BP 3RB4A 2F3JA 1WKKA 2OD4A 2ZOMA 4C8LA 1UPPA 2DGUA 1YKWA 1HMVB 3D67A 5KFCA 3NTPA 2OPSB 1HJWA 1DRZA 1P6TA 1NZAA 1N5VA 1CS4B 3FC9A 4IFYB 4RU2A 2NREA 3H5SA 5KOXA 3RJMB 1BE4A 1UZHA 1YIJS 2XY5A 2E5LF 1H0GA 1FKPA 1S1XB 3UCGA 4BHQA 5JVHQ 2ERRA 1LWEB 1JIHA 1T0TV 1SVDA 4ZIVA 3ARYA 2YH0A 2COLA 2C3YA 3MCSA 3IG1A 3BN7A 4ZJLA 3UDVA 3UWTA 4CO5A 4DL0C 3OUYB 2XO7A 1NK8A 4OX8A 4JP8A 4A8OA 3HX9A 1M5YA 4RBTA 3VALA 2XO6A 1VC0A 3V4IB 2ZD1B 3TWZA 2OTLS 2ZKTA 4O4RA 4ZVSB 1T11A 3H8YA 4DX8H 4XPCA 1VJQA 4HI2A 4LRBA 3OL8A 3UD3P 4MAVA 1SI9A 1SUQB 1E6PA 1HI8A 1S0NA 2XWYA 4OJ3A 1UWBA 4MIWA 1J6YA 3HT3A 4EBDA 1S9EB 2EFPA 3DHXA 2NXUA 4RNMA 5T14A 2M08A 2R9LA 4I64A 4FXVA 4JYAJ 2U2FA 4K50A 1B64A 2JLFA 3LAKA 1SYTA 2J0XA 2W8KA 1VQ8S 2FVRA 2V8VA 1K47A 1U6ZA 2AJ1A 4WK1A 3VGTA 3NMRA 4Y28C 2ZQUA 3PTWA 4J37A 5KG4A 2YKPA 3OA5A 1MN9A 2NXNA 2WAQD 4QYRA 5SUHA 1OPZA 2K2PA 3BB5A 1C1BA 3WBZA 2YWFA 4WKHA 3KLIB 1H2VZ 4CH0S 5DQIA 4DR4J 2XS7A 1TTHB 1QAIA 2OLWA 4KO0B 4Y0FA 3M9NB 3KADA 4RUHA 3QRRA 1ROFA 4JYSA 1U09A 3Q2SC 4USIA 4E2FB 1F5AA 4MIAA 4DS5A 3F73A 5IM0A 2HZCA 2R7TA 4P8VA 1LWXA 1RE1B 5L1KA 2OP5A 3QQCD 4ZKAA 2HWHA 5LSRA 3KNGA 4DMZA 4RWWA 4MSPA 2HS0A 1JLBB 3CJTA 4OI0A 3EVOA 3DNCA 2DCLA 3ENAA 3VAHA 1S1UB 3O5TB 4IQCA 2DNRA 4OYWA 5LJ5Y 3BQ0A 3RAXA 3CJ2A 4RPFA 3FQLA 2D9FA 4K8RA 3UI5A 1JLAB 3PY8A 3J80Y 1U8WA 3CD5A 2DGQA 3J7ZT 3ONQA 2FVCA 3CH9A 4WBFA 4PQUA 1WDDA 5EGYA 3WD2A 4K4WA 1D9FA 4CQ1A 5J1PA 4DL2A 2QGFB 5KFGA 2ZJQQ 1HNXJ 3OL9A 3V81A 3EDQB 3MWBA 3R5GA 4KFBA 1NK6A 1FRIA 3V6DB 2FJXA 2VODA 3A3PB 4QIFA 2AWGA 3RMEA 1HR0J 2MPHA 1Q1CA 4TW6A 1XRVA 2CQDA 1I5OB 4Z2LA 2FC8A 2VFTA 4WFXA 1NDPA 2LKNA 4FBUA 4GKJF 2L2SA 2VCDA 2KDOA 3NCRA 1NSGA 4DWSD 2DB1A 1B7YB 2C2DA 3SCJE 2VZ9A 2HHPA 2ESCA 4PPDA 3TNVA 1Z2LA 2HHQA 3RU0A 2ZH5A 1FFRA 1DJ0A 2K06A 1Y4ZB 5E7OB 2J0WA 3FNNA 3ZXWA 4CLKA 5HMYA 1A7XA 3CO9A 5K8PA 1U2CA 2I5JA 4URIA 4ZVFA 1TV6A 1TP7A 3I82A 2E66A 2CG8A 5HLFA 4NLSA 2IM1A 5KG0A 3RBXA 2F5GA 3CHCA 4DIPA 4Y34A 4G1PA 4HDHA 5EWFA 3VAMA 1G1XA 3AJ1A 4MKAA 1FWLA 1HJVA 4LRCA 3R8YA 3LUOA 4LVOP 2R8GA 4HTIA 4C8ZA 4ZCLA 3H7HB 1KTQA 3I6PA 2M2BA 3OHAA 1GK8A 2FHKA 1BWVA 3U1LA 3JSRA 4L3KA 4NLPA 1TUVA 4DPXA 1URRA 1WJ9A 2DG3A 2WONB 1S99A 3D66A 3GLJA 4OI2A 4UT4A 3OL7A 3PG9A 2ZH1A 2PFFB 3HMJG 4U7CA 1VQ7S 2M3DA 4QR2A 4YS2A 4RW6A 3DXBA 3W9HA 1X6LA 2DGVA 3B8HA 2ASYA 1IBKJ 1N36F 1D09B 4C2MA 1UR9A 3PW7A 2CIMA 2Y0BB 1VRUA 3W66A 5K8NA 4DV6F 2HBQB 3KK2A 3LP2A 3RAQA 1OPIA 4ECRA 2HBRB 3AA9A 1B0VA 1C0UB 3AJ2A 1UETA 3UQIA 1AXQA 1HL6A 2GHWA 3N5FA 4NA2A 2V9KA 2E29A 1WG1A 2ACYA 2QMUB 3HKZD 3GZ7A 4WYWA 2R8JA 1VQYA 2CA9A 1GEHA 3JXOA 4RW8B 1E6YB 1SJ1A 1YVFA 2DH8A 1BUXA 3ALGA 4ZP6A 4KO0A 5C25B 2DO4A 4CZCA 1LL4A 4DPTA 2LA6A 5A2QY 3D6TB 4Q5VA 4HACB 2MB0B 1AW0A 5KFLA 4F3QA 1U1RA 4QZVB 3DRRA 1RAGB 1VQMS 3VZIA 3MM8A 2XSJA 4DRKA 2DGXA 3RM4A 2BOAA 4QR1A 4JI2F 4ER8A 1N5YA 2QA2A 4QOTA 1KFDA 1RUSA 3W61A 4O44B 1RTJA 3NAHA 3R5AA 4EEYA 3KLEB 1Q7LB 2CQBA 1W1TA 1NB2A 4DZ3A 3OTBA 5ITHA 4J9LA 1SJ3P 4LBPA 3SBMA 3LH2S 2LQ8A 3C8YA 1B0TA 3WC0A 1JNZB 4LUBA 4N47A 5DG7A 1UR8A 2RIJA 4FYYB 1WHXA 1VR6A 2PPPA 1PSDA 2AX1A 2Z4PA 1R89A 1U2RA 3LA0A 4DXLA 3KJVA 1UWBB 2XMWA 4H4KC 4MKBA 3H40A 3MMCA 1XIQA 1AA1B 2F8EX 2VF3A 3KK3A 2ADCA 1HNZJ 3NOGA 1DY3A 2MZJA 4Y3CA 2IJRA 4BDPA 2BANA 2I6WA 2JHEA 5I42A 3RGCA 3CGMA 1UPMB 1P8GA 3BH6B 3DLKA 4PTMA 2PN6A 4O2TA 2D9OA 3MGJA 5F3ZA 4V19J 3RW6A 4PR6A 2E5HA 3MEDA 4WU2A 3RM9A 4B9UA 1TL1A 5IT4A 5H9FK 2YKNA 1S6OA 2FY1A 3ZC4A 2Z0GA 1W2IA 2UXCJ 1HKKA 1WF0A 4TX0A 3M2UA 4L74A 4MTPA 4RR5A 2IPOB 2WHOA 2A18A 1KDNA 2ALYB 1OQ6A 1G6BA 1KKHA 2GIFA 2HGNA 4A8XA 1EIYB 2ZD1A 2HYIB 4Q44A 2YH1A 3CGIA 3VVUA 4C3MA 4F50A 3HDSA 2MSSA 4IDKA 4C3LA 5HJXA 2GGPA 7FD1A 5HJYA 2QLWA 3L4BC 4WCEQ 5A8RA 4DR1F 1JX4A 2DR9A 3RZAA 3OBIA 2R42A 3NCQA 1BHNA 1XNRF 3THTA 1NK9A 4NOHA 3MTKA 1VRTA 5I98A 1WC6A 2YQ0A 4NRTA 3CD6S 1LL6A 4Z2GA 2EG1A 2WB1D 4A8MP 1OSDA 5DG9A 2X7IA 2BX6A 1N54B 1X4HA 3T5LA 4W9QA 3H2UB 3ENWA 1LW2A 2JRSA 4RNFA 1M5KC 2VUGA 2DNNA 4WFYA 5D77A 4ZP9A 4EGLA 3PKYA 1DZ5A 5CABA 1S6UA 2R8KA 4JI4J 1W26A 2YKAA 3ARXA 1CQNA 2M1IA 2MPUA 2M70A 5IOLA 3T5HA 4OZ0A 4DV4F 1RBLA 2JH3A 2W7AA 1TKZB 4Y2KA 3R7SB 3W5YA 4F4WA 4HBOA 2MZSA 4X66J 5AJ3J 1PAUB 2R8IA 1WC1A 4OYPA 2RQCA 4DV1J 3MEEA 4JI6F 3D1OA 1EQ3A 2VBXA 3N4WA 3TAQA 1MLAA 1N0VC 3ZZ0A 1PCAA 4FXDA 4X4VA 1IR1A 4I56A 3LWLA 2HLTA 4CWBA 3QJLA 1NLKL 2BJ3A 3TA1A 1SB6A 3EPGA 3VGSA 3WD3A 5H9EK 3AODA 5G0RA 1TMJA 5ETTA 3OXFA 1CJVB 1LOUA 1TL4A 2HFVA 2L9DA 2Z57B 3UO0A 2RHSB 1NH6A 3NGTA 1HWJA 2WK4A 4C98A 1YX2A 5GADI 3RUBL 4F4AA 3PRAA 2DCUB 2OKQA 5GVQA 1NWSA 1GAOA 3BO4A 3AOCA 4F67A 1S48A 1ZOTA 2B9WA 2JLEA 1T8EA 2Y8YA 1UFLA 3P49B 2LQ5A 4FNIA 3KLFA 2LA4A 1HHQA 4ZPVR 3EJMA 1WOSA 1NPPA 3P3DA 1HWUA 1WF2A 2RB7A 4KBIA 1Q6HA 4DL6A 1K8AT 4JI7F 4F0MA 4K4VA 3JAMU 5DRKA 4KT0C 2BXJA 2FHJD 2V8DA 5B0BA 1HYSB 4P74A 3KDNA 4ZLLA 2QL7B 3PYEA 3KHHA 2BOPA 1E6ZA 4IH6A 3G96A 3VAFA 2GQ2A 4ZJOA 2BE9B 2LXIA 4ANEA 3QJPA 4FYDA 4A8FA 4U7UD 1LJYA 1I3OB 1O0PA 1WWHA 2AEMA 2BABA 5HANA 4N56A 3CC7S 5JXSA 2AT1B 3US5A 2FPHX 5B08A 2WLYA 1M90T 1HBNA 2OD6A 1VMBA 2CDRB 4HLBA 1HNZF 1QE1A 1RT3A 3M05A 2NPFA 2QZ8A 2KT3A 2XMVA 8AT1B 1GTHA 1YJ9S 1VQNS 4E8UA 2K3IA 1NK0A 5F3TA 4PZVA 2IJNA 1JJCB 1VBKA 2I0XA 2OFGX 2QL5B 5MLCV 3DLHA 3D68A 2HNDA 4L73A 3RB3A 4QCLA 4C9DA 2E7XA 4JOUA 1WEZA 3DRYA 4BBYA 1F6TA 4OYIA 3OSNA 3OTCA 1VC6A 5A8WB 1UL3A 4O0NA 5J1NA 1AUDA 3JTOA 1UW9A 2PV2A 4G2PA 2VC0A 3UFCX 1CS4A 2IBOA 1DAXA 2X51A 3H2VE 2OO4A 3I5CA 5J1EB 2Y0SD 5F8HA 4ODNA 1CULB 2ZKUA 3DRPB 3ARVA 2DRDA 1HBOA 1O6XA 3PM9A 4FYXB 5BYSA 1QUVA 1MMLA 4NLTA 5IV4A 1WAWA 4NCAA 4IPXA 3Q2TC 1RT5A 2C2NA 5AXLA 4IRCA 1QUPA 2UUAJ 2G1HA 4KRWA 3J7AN 2Q43A 4M63A 1I51B 3LALA 1PBAA 4ZVHA 1IN0A 1VLOA 4I2QA 5U47A 4WFAQ 1ZCNA 1TL3B 2MTLA 3DOKA 5HBMB 4DCOB 5HQLA 4Q0BA 1DTTA 1S7HA 2NXJA 2MQPA 2XLJA 4CH7A 5CCMA 4ECQA 3JYTA 5B8IC 1SJ4P 1X0FA 2XPBA 4RBVA 1TZ0A 2KVIA 4HVZA 4KKOA 2CNOB 4N8NA 4NZ6A 4CM2A 4JI3F 1UVJA 2CRLA 2ZNZA 3IBWA 3CC2S 3GJTB 2H54B 2M52A 1TK0A 1XEZA 1R43A 4X84A 1KOOA 1KD1T 3M6VA 3NOCA 5HMXA 4NPOA 2XP9A 1ZU8A 2JOQA 1LWCB 1PYOB 2MGZB 3F0NA 2RAQA 4KIAA 1YRTA 4Y65A 3DLGA 2MEWA 3MR6A 1F5BA 1V3RA 2XP3A 2B4VA 2QYGA 3NP5A 4FNHA 4OI4A 4R5EA 1R8BA 1X5OA 2DGTA 2CJQA 3IS9B 3HFVA 1FRMA 2N7CA 1YRXA 4WTYA 2FB0A 4F3MA 1QSYA 5B0DA 4GVBB 4DFMA 2DNKA 3I32A 2YWEA 2QLFB 4G6VB 2AIRB 2IC3A 2ETNA 3TEHB 2QLJB 2IA0A 3HHLA 1W1PA 4RNOA 5J2MA 3NNAA 4B3OA 3G6VA 2R7XA 3ZZPA 1S1VA 2VKRA 1NJXA 3MOJB 4B3RJ 3W9IA 3AXKA 2Y9HA 2RVJA 2Y1LB 1TKXB 2OFHX 3ZTQA 4DV1F 3KLFB 1T03B 2UV8G 5KG5A 3HXMA 2VFRA 4K0KJ 2VFVA 1HNIA 5FD1A 2EFGA 2HAFA 4RNHA 4C0BA 4C0OC 3AS3A 4ED8A 3T5JA 5ETVA 1N52B 2EFQA 2YKMB 4H4MB 1C0UA 2LYVA 2MQQA 4F25A 1RAIB 4USJC 3AROA 5D15A 4CLTA 3Q8YA 2X1AA 5D3GB 4C3KA 3D3BJ 4MK7A 4MH8A 1DARA 1QDUB 2ZZTA 3FSYA 3PV8A 3ARSA 3RRKA 2OMOA 5AE3A 4RZRA 3FQKA 2KFZA 1NSAA 3NS6A 2Z2YB 1PG5B 2NSBA 4I69A 2OMLA 3M4XA 1UVMA 2ZH8A 2F7VA 3BGRB 5GQBA 2W01A 4OMFG 3BSAA 4RW7A 3KLVA 1EJ7L 3GYNA 4DFJA 2DRBA 4YQWA 1FKSA 3CGNA 1T95A 1UMJA 2RQMA 3LPYA 5LSOA 2ZM6F 4QWCA 2GVDB 1HNXF 1H72C 3CCES 4JI5J 5HMZA 2MZ1A 1RK8A 1SJFA 3KHRA 4IT4A 3CCJS 1WI6A 3C16A 4TVAB 2ALZA 3BMBA 4KV8B 2ASLA 4F02A 2LPVA 4UOCA 3T19A 2W7OA 1T05A 3A8KA 1S9EA 3NAIA 1CJKA 4U96A 4ED4A 2FKEA 3MM9A 4X65F 2QF8A 2FIUA 5KFMA 2GS8A 2P9EA 2LP4A 2AZ3A 3BYPA 5D4NA 1HKIA 4N5SA 3G4SS 4JI8J 4JI1F 3MD1A 2QSWA 1I6JA 3KG0A 5E2QA 4ZS6A 2DNYA 2GNKA 4M5IA 3ZZYA 2V2KA 3S7RA 1X9WA 3MPDA 1D2KA 1WHWA 2MXYA 3A3NB 2HHXA 2MF9A 2KI3A 1SV5A 3O5RA 1TAUA 2F63A 2PO4A 2GJ2A 3OSPA 1OIAA 2YNFB 4ZOSA 3QJJA 1YJWS 2YNIA 5BXIA 1YTYA 1S9FA 3NRBA 4NYOA 2J7KA 2WK2A 1H7XA 1VK3A 4CO4A 3R97A 3UI4A 3VCDA 4RO0A 1GQEA 2ZH9A 1SH0A 3BZQA 4IFYA 5K8OA 1P1TA 2LGOA 2QA1A 3N9UC 5KT5A 5HP1A 1M5VC 2I1RA 4B3RF 3AS1A 1GFWB 1X7VA 3FBFA 4TYBA 4YHHF 2AV5A 2CJ9A 3PCOB 2UUBF 1Y0OA 2MY8A 1TL5A 4ECZA 4JV2A 2W7PA 2UUBJ 4AL5A 1PBKA 5HVGA 4NASA 2VOPA 1YJTA 2HPUA 2KM8C 1HHTP 2NXEA 3HD2A 2H4YB 5JUMA 1H7WA 2UUCJ 3DRRB 2LECA 3DRPA 4HHHA 1P9YA 2DHHA 4K4ZA 5KFOA 3I0SB 1PJ7A 1FNMA 3WQPA 2P4VA 4OYAA 3UW1A 4LFAF 1EDQA 3F44A 3NY0A 3KLEA 4HARA 1JNDA 2RQSA 2D7SA 1RQ0A 3U27A 3SYZA 3PX4A 5HTGA 1X31C 4LRAA 3K17A 2GC8A 5F0WA 3LGMA 1E44A 4IOBA 4Q0BB 3EMTA 4Q7NA 5IWAJ 2N82B 2ZDOA 1UEKA 3KUHA 4TQSA 2XLIA 4ED5A 1ROTA 1U1MA 1IM4A 4Q22A 3W3SA 4DU8A 4NCBA 3K5NA 3IWNC 3K57A 3OXLA 5DDQC 2C42A 1EHNA 2H9ZA 2OELA 3D2WA 1BWEA 1HXVA 4JYAF 3R1HA 3MXHP 5IM0B 3LP2B 2H1YA 4DQIA 1A6LA 1T9WA 1GXLA 2B8PA 2XYHB 3KG4A 4U8YA 5IV3A 2IMWP 4B3MJ 4C0HA 1VQ4S 4HHUA 1REVB 2HLUA 1Y5NB 3CDWA 6FDRA 1BL4A 1PYTA 1S1TA 2H48B 3KAGA 3NGDA 1U4BA 2YNGA 2DR7A 1FRJA 4JI2J 1KRPA 4UZCA 1JLGB 3FJ2A 1XMBA 5L9XA 5LL6d 3I87A 2FJWA 1KNZA 2MKYA 1SH2A 5FJ4A 2ZJRQ 2W8LA 5J2QA 5HBFA 2DHXA 5JVGQ 1DFDA 3IRXA 1CJTB 4UOGA 2DNPA 1RWVB 4B9VA 2RRAA 4UOHA 3BSCA 4B9TA 2HFNA 3UQSA 4ITZA 4ODPA 2PFDA 3MZIA 1FKOA 2F9JA 4QIVA 4R0JA 5G4DA 1T03A 3GV5B 3RRHA 1OY9A 3IFEA 1QPFA 3M2VA 2B51A 4DX7A 4DWIA 2DG9A 2DT0A 2ZOGA 4QIGA 4ZVUB 3WQVA 1QSSA 2H4WB 2XGPA 4ZCIA 1B4SA 2VHGA 2NR0A 1EAYC 4O4GA 3IR6B 2BZ2A 2K8IA 1NDCA 1PBUA 2FJVA 5AJ3F 5K5MA 2DNZA 3QO9A 1C1CA 4EUVA 4AQYJ 2J7WA 4M1KA 1W1VA 4W9OA 1HNVB 3A13A 3CIZA 1Q6IA 3ET6B 1UAWA 1TKZA 3M9OB 3K59A 3BSOA 4IT6A 2BQRA 3TI0A 2NYHA 3BEGB 4ZHRA 5CCLA 1FE0A 4P10A 4DV7F 4HACA 2BE7D 4S3JA 1TL7A 2VG7A 1F3FA 2IYGA 2QRRA 4JI1J 4Q43A 4CT9A 1PIEA 3PEHA 4DWSB 4KGVB 5KTQA 2E1RA 5JMNA 3BO2A 4FBTA 4M94A 1S4EA 1BY9A 2K8GA 3S01A 3SZ2A 2J8SA 2ZUGA 4B02A 3UR3C 1VQ9S 3WD4A 4LFCJ 3HLUA 1FWKA 1VDHA 2OPQA 4OYZA 5HBMA 5KT7A 2AD9A 3KJVB 2FVPA 2H65B 3RBZA 4AY1A 1L3TA 4AUKA 2AQ4A 1S0MA 2CPFA 1KLMA 2MQNA 1NMWA 4DFKA 4K2XA 2KT2A 4OQJA 4X2BA 3Q8PB 3VQSA 1P1LA 2YPZA 2W24A 3JSYA 5A2QU 1HARA 4ECWA 5E3PA 2LQ9A 1EYMA 1F0XA 5CYMA 4DEZA 2FJDB 3UPFA 1N33F 3MPWA 3U1MA 4DUTA 2R2UA 3TC5A 3KJQB 4WTOB 1TL1B 1JLCA 2DSUA 4MNLA 2ABYA 2ZH4A 1WNOA 4LAYA 4LR9A 3ZZTA 5CA5A 1KFWA 2BJ1A 1FTRA 4TY9A 3V6KA 2NUHA 5KFBA 4LIRA 1WKJA 2MQOA 1QAYA 2GIQA 4HHJA 1LWFB 1U47A 1WEXA 5HW7A 2FYXA 2HBYB 2SXLA 5LOQA 4DQQA 1VS3A 2CQCA 4OHWA 1N36J 2XS2A 3DM2B 4DQSA 5M2UA 1QE1B 1RT3B 4EYIB 4LFCF 2OSQA 1WC3A 3ADAC 3DI6B 3HZEA 3POTA 4PEOA 3TVYA 2KM8B 1WC5A 2L3MA 4CLFA 3M2RA 2PI4A 3QZ8A 3V5RA 2B9YA 3THVA 4UW2A 3NWRA 4WP8A 1N34F 1EP4B 3IA0A 4NYPA 1AUSL 4WKFA 3MAAB 4QQBA 3AA8A 3CMES 1TKTB 1TQLA 3PHTA 4EBCA 3ZZUA 2ADBA 4PWDB 1JLGA 4U9RA 4NI2B 5KOWA 4S3KA 3ZZZA 3P45B 4OZ1A 2AZ1A 3J7YI 3QFHA 3UF8A 2DH9A 3TUZC 3A8JA 3H20A 1RTHA 2G0IA 2YNHB 1HBMA 1IR2A 2XI3A 4DV2F 1NJIT 1J5EJ 4LF9J 4IOAQ 1KVJA 3T1YF 3DOLB 1FKOB 1X4GA 2OHDA 4DROA 4V1Ak 5D0HA 3DLKB 3IXQA 1XNQF 3W4RA 5L1IA 3FBBA 3DLLQ 3DRSA 1JKHB 4C97A 1TL3A 1S12A 2LEPA 3BGUA 3DOKB 4OI6A 4AL7A 3Q89A 1QY7A 4KR0B 2QX0A 3H90A 2FLOA 5T7LB 2UUAF 1TCOC 3RW7A 4GKKJ 2WBMA 1WTFA 3M6XA 2VL1A 2W25A 4N77A 4ZP7A 4DPYA 2MKIA 2BDPA 2BQ3A 1Q7YT 1BQXA 3O5KA 1KHWA 2C3PA 3HHKA 2BA9A 3CJKB 3QNWB 3TX8A 5KFDA 5CD4A 2G4BA 2ZZMA 2DNMA 1U79A 2IJFA 4R5PA 2DT9A 1FD8A 3ISNC 4NMLA 3D9BA 1RBOB 3MCMA 1X9MA 2HNDB 5B09A 2GMJA 2OI2A 4PQAA 2UXDJ 4PYDA 5DQHA 1H6KX 3HHLC 1PO6A 3MMAB 4DSLA 1ZTTA 2FGCA 2R8HA 2HFZA 3QAEA 2K1RA 4ES1A 2HQFA 3WKZA 1QZ2A 4G50A 3HCXA 3HHLB 4DI6A 3CCWA 3N01A 1FJDA 2HRTA 4WJBA 2AGPA 3IRXB 3OLBA 1GMVA 3ZO7A 4UY85 2O9OA 4H54A 1QJHA 5KG1A 3H42A 3M8SA 1YITS 4R8UB 1AFJA 3BBFA 1QTMA 3NGUA 5HUAA 4NMXA 4B9MA 1Y10A 3C3LA 3C46A 1HBNB 2N7YA 2ZFHA 3IGNA 2W2OP 4NRUA 2Y1JA 1WI8A 2BRLA 2DNGA 1MROA 5E41A 2B6AA 1YZ6A 1JB0C 2PGCA 2VV5A 3D54A 3M32B 3GONA 4ZLJA 3CCQS 1HR0F 4UTGA 2HFOA 4RUCA 2UXBJ 1G4CA 2Z58B 4BS2A 3R6GB 3DKDA 2KFWA 1RAAB 1S9GB 3DDIA 2ZE2A 1FHTA 4DFPA 3BBCA 1TVRA 3JAMY 1HQUA 2LFVA 2MKKA 1PGZA 2FLNA 3CF5Q 2KYXA 2MJNA 3EICA 4DR1J 1RWMB 3SFGA 4ZVGA 1FFSB 2RQKA 4L6V3 1RWUA 4LF7F 1WG5A 3GIMA 1TELA 2RDJA 4IG0B 3CJ0A 3IGVA 1IQTA 1UCNA 1HI1A 1YLXA 3NRKA 1U1NA 1SC4B 2BJ8A 2BACA 1Q8KA 2AJQA 1VQPS 1YRUA 1FJGJ 4K4SA 3HVRA 2ITKA 5GPGA 4Y2MA 4TQRA 2HGMA 1FRXA 4DG1A 2LXUA 3NS7B 3G6ES 1YATA 3BSNA 3NS5A 1NEEA 2AW0A 3SXLA 4H4OA 3FSIA 2DNOA 1R8AA 3BO3A 3GIKA 4J9SA 5DG8A 2MSTA 1CJKB 4LQ3A 3PO5A 4ZCMA 4IG3A 2CYYA 4JI4F 2XS5A 1U7LA 1ZAXA 1Y9OA 1ZBTA 1SXLA 3AQUA 3AS2A 3I4HX 3PYGA 1RSCA 5AXKA 3GYGA 5DM7Q 5RUBA 2B4OA 4Z2KA 3UN2A 2R7SA 1OWXA 4PCQA 1R0BG 1V9OA 3B8SA 4M8LA 5IFMA 5L38A 4ECSA 3WQWA 3PIPQ 1ZZNA 2KI2A 4X4PA 1QAJA 4J9VA 4P7TA 3OQ2A 4OI1A 4J9RA 1FK9A 4TNSA 1RT4B 2D3ZA 1RISA 4P2FA 4ZPCA 2IFXA 3W62A 3AD9C 3EE3A 2XZDB 4WPAA 2MDAA 3LUYA 5K14A 3CHDA 4DSKA 5GAGI 3QT7A 2N3OA 3X1LB 1PJ6A 5ETQA 1SUQA 2DNQA 5KG3A 3PW5A 3K8VA 4DDFA 2ILZA 4RKUC 2KZMA 1NMEB 1R6VA 2GJIA 3WIUA 1YQHA 5KAKA 4FXWA 4FF4A 5KFZA 2ZH6A 1ZBVA 4OHVA 4JFLA 1XWLA 1UEUA 2A2DA 2WCXA 2ZBCA 3M6WA 2HQ3A 4IH7A 1VCTA 4U86A 4M5LA 4CLWA 2NUUG 1J27A 4NEZA 2ZWOA 1DTQA 3MM5B 2CNKB 4YN3B 1X4CA 4J5OA 4JI6J 4X64F 1IQZA 4MJKA 1Q8IA 2B31A 1UW4A 3DU6A 3OXGA 4JFIA 4FKYA 3JTNA 4LR8A 1NHVA 3R7NB 3W9JA 1RTIB 1S97A 1I94F 4NLGA 3PRBA 5E3CA 2JSXA 4PUOB 1HBUA 1H3DA 3SSQA 1T9UA 1RHRB 5KFRA 4ECYA 3L9ZA 5BXJA 3WX8A 4J9MA 3S1TA 2OUGA 4K4YA 1JXLA 1OYEA 1HHSA 3A12A 3IKDA 3O5MA 3BF4A 4LGXA 2XULA 5M2PA 4Q45A 2EK6A 4YB1P 1J5EF 1H2TZ 1MROB 2V2ZA 3QSYB 4X4SA 3H5YA 4AL6A 3GPKA 3HVTA 2UXDF 1J4RA 3M2RB 2QIFA 4WXWA 2HHHF 4M5JA 2RH3A 4LIWA 1VHIA 3I96A 1UJ6A 3F41A 3OR2A 2CQ2A 2V50A 1NWRA 3M1VB 3QFWA 5KG7A 2YWKA 2DR5A 1S4FA 3FCWA 4ZVTB 4CNYA 4NZCA 2F8HA 2HHVA 3O5GA 1Y0HA 4PWWA 2E44A 2FZCB 3RGIA 3H5XA 5C42B 3KAIA 2DBBA 1NSQA 5IXUA 2NS1B 2A3JA 1E6RA 2FJEB 1KLMB 2B56A 3NGRA 3DGPB 3KACA 4K5RA 3GU0A 2APOA 4WKYA 5M2RA 4F26A 1HWIA 2AYMA 3C2PA 1D9AA 1EB0A 1IWAA 2W9BA 3QLHB 2PPNA 3DMJB 2M9KA 2RU9A 2P6SA 2DJWA 2ROGA 3I4PA 4H4KA 1GTEA 3OLAA 1JLCB 3MDFA 4NA3A 2G8ZA 2FGOA 3N5BA 1U8SA 3RG6A 3H4BA 2JEJA 2FUG9 4GRSA 3MCOA 3I0SA 4OX9J 4TW8A 4ZMMA 2VA3A 4USUA 4BWMA 4ZVEA 3HVAA 1UWAA 3A8EA 5DZ7A 1F9FA 2DD8S 4TNOA 4FN2A 3IWLA 3UVJA 5F8IA 3UN3A 2KG1A 4OL8A 4NA1A 1ULRA 3MHYA 3MEDB 1NCLA 2E9RX 1VJWA 3HT0A 2B5JB 2JVOA 2YKNB 3O5FA 1FT8A 1HNWJ 4LF4F 4GGQA 1K73T 5KFWA 3G6YA 1F40A 1KOHA 3J81U 5LMUF 1RLDA 2LDYA 3O3LA 3R27A 4ZHRB 4WFBQ 3CULA 4TKTA 2CWKA 4RW9A 4J9NA 2W4DA 2XMAA 3PX6A 1A7GE 4OLPA 2DT1A 1Q6UA 2EPIA 1OQ3A 2CJYB 2D1CA 1P27B 2NYIA 1EQMA 2DGOA 3K58A 1N32J 1OS5A 1CEZA 1M5OC 2Z8QA 4USMA 4DPWA 2VKZG 3CD7A 2DR8A 4MYUA 2ZOFA 2UVVA 3MECB 2MNTA 4C8NA 3JYJA 1FEHA 2HWTA 2GO8A 1N5SA 4ODRA 2KYZA 2XG8A 1Y5IB 3A4TA 3CE8A 5J2PB 4ECVA 1OMSA 3MM5A 4PG7A 4DL7A 1NK7A 3SCLE 2IHR1 2CQ4A 3L95X 3KLHB 3GWCA 2IAJB 2XWXA 3LO3A 2DY1A 2D3OR 5DM6Q 2BJDA 2VBYA 2J6TA 1S0VA 4KHPF 4YB6A 5B0AA 4C8YA 3WIJA 5F41A 5LM7E 5C25A 4NLRA 3NL0A 1R0AA 1GMUA 1Z1ZA 2CVIA 2Z56B 5KT6A 2K7JA 2V4JB 1JLEB 2RRNA 2HVDA 3QYYA 2E1AA 3IR7B 4NSBA 4I0WA 1J5OB 4MFBA 3GILA 1VQOS 3ARQA 2VFSA 5DS7A 5ETPA 3TOQA 3OD2A 1B0PA 3FGVA 3M8QB 4NLUA 4OLOA 1NDKA 1PAEX 1TUWA 1NO8A 2BKNA 2H51B 3TQ1A 3HKWA 2BUNA 3GSDA 2E1PA 1EQ0A 2B3TB 3ENVA 1D7JA 2BE2B 2RUQA 4UDMA 4OJHA 4X65J 1WOPA 4FS2A 3OR1B 3GG0A 5AXMA 1VRTB 4IO1A 5DIUA 4IG3B 4YHHJ 4NLQA 4LF6J 4DSJA 1B99A 2KXFA 3C6TA 3IAM9 3D7SB 4AXJA 1DQAA 4RNNA 4C4WA 1QVGR 5B7WA 4DS4A 1EETA 2VOOA 2BW7A 5GMDA 5KFIA 4Z2JA 4CLLA 3QLHA 3PX0A 1U1QA 4N76A 2MKCA 3U1NA 2Z2MA 4B17A 2C1EB 4X66F 2H3EB 4O4GB 2J6UA 3T1HF 1C4AA 3AHPA 3EUNA 1CJUB 3B7XA 2YNHA 3MF5A 1RTIA 3TR5A 2D41A 5F8LA 1WEYA 1HNVA 3KHLA 2ZE2B 1RA6A 4ZA1A 3SMZA 3W8PA 3OHBA 2CJXB 4TW7A 3TCZA 2QMXA 2W9AA 4F4KA 2CKWA 2Q6BA 3EM1A 5D4LA 1RU1A 4LRDA 2FQQB 4DRQA 3D0IE 2CJKA 3E8OA 3QBCA 2HK3A 4RBUA 4IQXA 2KGJA 1VI7A 4X4NA 1A9NB 3TO8A 3ISND 1DURA 4W4MA 3SFUA 1R27B 4CH1A 3AH6A 4YR3A 1IKXB 4L72B 2KFYA 4ZPWR 2AYBA 2LJ4A 2CPIA 1FRHA 2OEJA 3KLIA 3KG1A 2E5IA 2CQPA 4ID8A 3K5LA 3KK1A 3KWMA 3EGVA 3G6MA 2F65A 2G0CA 2HSEB 2V8GA 2WSCC 4J9QA 2F21A 1KVIA 1UP1A 1FDNA 1VQSA 2HNYA 2R4FA 3DI6A 3LPEA 3O1LA 4NYZA 1KQKA 3TAMB 1FKJA 4UY8T 3QRQA 3GTYX 1CQMA 2HVZA 4HR2A 4DF4A 1U0SA 2CPDA 3TUPA 1RHUB 2DHGA 4LBHA 3ODKA 2C2KB 2AGOA 1D1UA 1ITPA 5HO4A 1YI2S 4DN9A 3B82A 1E15A 2BMBA 3I9V9 1NB7A 2AJ2A 4MPKA 2XY6A 2P9CA 3NWGA 3TANA 3QSIA 4GIVA 1FDAA 2IMOA 2W2PP 2BM0A 1ZB5A 1CVJA 2OSRA 1HWLA 3Q8VA 3JXVA 3HSJA 8RUCA 3OR2B 3FEZA 1LW0A 5KFJA 5KFFA 3Q86A 3ILLA 2VQFJ 3GIJA 2XHCA 2HMIB 2UVRA 5HSPA 4CO2A 3MR7A 2KZZA 1IVZA 2JC1A 1N88A 3HM9A 4DUZJ 5EWEA 1JLBA 2UVUA 2VN1A 4MIBA 2F23A 3LQVA 1FO1A 1DQ8A 1RBAA 5KT2A 1IXKA 1HQUB 1PJ5A 2N3LA 3IMQJ 3SEOA 3TX0A 4P2MA 2QLBB 1MG7A 4MKYA 4GVBA 2XPAA 4P2SA 1UZDA 2MLXA 2M0GB 5ETNA 3VAJA 4B3OB 4IYQA 4YR0A 3LGHA 5KFVA 1WF1A 4JFMA 3N0VA 2XHWA 2BM1A 1VQKS 3TYTA 4C48A 4KHRA 2VG5A 4ID5A 4IQMA 1Y7PA 3M8WA 5IT0A 3HP6A 5A8KB 4K4TA 4DR2F 5IT9U 3JTPA 1FJ7A 3PACA 2OPRA 5HN0A 4FS1A 3U7JA 4CRJA 2DPIA 5A6WA 5GPRA 2R7OA 2EEYA 3TZXA 4LSZB 4N19A 3H98A 4JV1A 4H4MA 3E2EA 4YB5A 2HHWA 2ZR6A 1BQNA 2P2CB 1LQ9A 3ARPA 3SQGB 4LF2A 1NH7A 2RUSA 1W9UA 3HHNB 2EVZA 4ZVQB 4CTAB 2WW8A 4WKAA 2DNLA 1Q0NA 1LWFA 2RHQB 4K59A 4BC9A 4DV7J 4WE1B 2HHHJ 4LR7A 3RAMA 1IBLF 3DN9A 2NXCA 5C7PA 1XR5A 1A0OB 1N6QB 4MNKA 4USTA 1M1KT 2BYCA 1HWKA 3LWMA 1V5VA 2CXEA 2F40A 3BGRA 3QIDA 4MNMA 3D1QA 4Z7YA 4EFAC 1RB0A 2LVWA 1J2VA 2AF6A 2IVYA 2JC0A 2RRBA 5LT5A 5MAOA 5DDPC 4DUZF 4EZ6A 4DR6J 4A46A 2FY8A 3C6UA 1HLWA 3DDNA 1SIWB 3EZUA 1NK4A 1EKSA 3IAS9 4Q7AA 2ZHBA 2BW2A 1FI4A 3ELHA 3JS9A 2M4MA 4XO0A 4TU8A 1FKFA 1Q5VA 3MM8B 4GO5X 4DZDA 3OR1A 4PQUB 1N5YB 1RDRA 5DQGA 1OSCA 3AAWB 5D4OA 4R8UA 3QGGA 1L3VA 5DGAA 3CNQP 4B9SA 3B4DA 2JEGA 2PEHA 3BR9A 3V6DA 1NHKL 1IKWA 1JLQB 1WDTA 3NEKA 3LP1A 1PC4A 2M8HA 3ARWA 4KGKA 2FC9A 3HF5A 1VLYA 1LW2B 4AQYF 2L41A 1S77D 4ODKA 4DH0A 2YQ1A 5HVFA 3NBPB 1BLUA 1VHFA 5L8RC 3UDCA 2D69A 3QGPA 1VIOA 4XK8C 2HQCA 2ATCB 2DG4A 2PMWA 3O5QA 2H5EA 1JCHB 2L48A 1WG4A 2J0QD 2ZC4A 4DQRA 1SKSA 1IM6A 1DBDA 1AB8A 2G2OA 5BYRA 4R5PB 4LF8J 4QWEA 1I94J 3P96A 1JVWA 2FHJA 1U1PA 4JI7J 3EPIA 4LSNA 1CTNA 4X64J 1ZAVA 2A10A 5D4PA 3WZ0A 4A8QA 2DK2A 2WVCA 2UXBF 5H9EJ 3PFOA 2QJ3A 4I6WA 2F4VF 3M8YA 2ZDPA 3MURP 3O5IA 2YX4A 1FKKA 1T9VA 3IO1A 1Y5LB 4LFBF 2B7BB 5KFTA 2YQ3A 3TAMA 2DT3A 3B78A 2HVEA 5DDOC 1GOIA 1WKLA 2GVZA 4IH5A 2O5DA 3JQMA 4KPCA 2A2CA 2UUCF 1WNEA 4QWDA 2GQCA 5ETMA 1B7FA 1FTCA 1XR7A 2ZVSA 4M5DB 5ETOA 1R8HA 3T1YJ 2AWZA 4WKRA 1RTZA 4DR3F 4DR7J 2OPRB 4PXEA 2QG9B 3TARA 2B0GA 4LF5J 1LWCA 2XP8A 2VA2A 4FF1A 2FHMA 5CHCB 1GPFA 1RWPB 4IQ2A 1GX5A 4L3NA 2AP6A 3M2UB 4FVCA 3UI3A 2F1FA 1FK9B 1I1GA 2RDIA 4ES2A 2W2NP 4K4UA 2QMWA 3CO0P 3NG8A 2C3MA 2XY7A 3HK2A 3CIMA 1Q81T 1F5CA 1IWGA 2GVDA 3HHEA 3OW2R 1ZK6A 3NLCA 3QWPA 4QWAA 4DR5F 4YY3J 5A0YA 3ZNUA 2Q5AA 2XSJB 5DF0A 4QIWD 4NLOA 1U48A 4J9UE 4OIXA 1WB0A 2VBZA 1TAQA 3AFGA 3KFWX 4O23A 3P5TL 5KFUA 1U2FA 2O1PA 2ZEJA 4WIQA 4ECXA 3OTEA 2HHSA 4QWBA 2BRKA 4OZ3A 5A8WA 3VHQA 4RW4B 2GHPA 2YBTA 2O01C 3TJ9A 2FDMA 2CZ4A 1RTDA 1C9HA 2KO7A 2RUCA 1RAOA 3K7RA 5J1EA 1QPLA 2JJ4D 3SCIE 2D74B 3PR4A 4H4OB 3ZNJ1 2K3KA 1LKZA 2XCPA 3MR2A 2PPOA 3EGZA 1N5TA 3E3XA 4WJXA 3LOUA 3W63A 4DUYJ 1YG0A 1WORA 2VDIA 5IQQA 4P73A 3CCSS 2VB6A 3RBDA 3GPAA 3C15A 3DFEA 1LW0B 4UF4A 4DSFA 2V9WA 2CNNB 4LSLB 2BQUA 3EIPA 2YTCA 3A1YG 1B3TA 3QGIA 2AKWB 3IHZA 2W2MP 3GE9A 3QIPA 2JNJA 2FAPA 4ETZA 1TMMA 2LU1A 4E0DA 1X4EA 5DZ6A 2C2MB 4RJVA 3NNHA 1N32F 3UD5A 4GKKF 4I6AA 4P7VA 2EFNA 3L7PA 2QEXS 5BR8F 3HHLD 5BYQA 5HATA 3IN5A 1AZSA 4ZLNA 2A3BA 4C6AA 4CTAA 3I56S 2W9CB 5DETA 3UNGC 4EO6A 3KK1B 5F8JA 4DT4A 2P9GA 4JI0F 4ENOA 1XMOJ 3B9AA 2AEJA 3FZ2A 4ZDNA 5C42A 3ULHA 2HNYB 2O66A 4DV5F 4KHPJ 1NRKA 2WVFA 2C2OB 2OEKA 2XMTA 1U1OA 4DCJB 1D9DA 1YGYA 1V3ZA 1T9TA 2IDEA 3MPYA 3DLGB 2E5LJ 1VK8A 2HQDA 3THPA 1W25A 4MK9A 2MQLA 4EK2A 3TZYA 2P6TA 3TDBA 2VG5B 3MEKA 1E9LA 3IS9A 2CPEA 4I1TA 4ID5B 3ARRA 1LFWA 4JI3J 2X1BA 2P5VA 2YWWA 4JV5J 2HS4A 2PBCA 3N6NA 4XTTA 1RXOB 4NXMJ 3MTJA 1YBAA 2K7KA 4O3OA 4MKVA 2WTFA 5F8GA 3KAFA 2RS2A 1QVFR 2WVDA 4TLQA 2QA4S 1FVSA 2DEIA 2KB2A 4IFVB 1SC1B 2OAUA 2E5JA 2Q3PA 5KFQA 4G1QB 4O3PA 3C6TB 2DGWA 2DSVA 1H0HB 2G2YA 3DCAA 4KGXB 3ARTA 3LW5C 2WM0A 2WW4A 4PG8A 5J6EA 5F8NA 1FNOA 2B5JA 4USVA 2XP5A 2ZZNA 4ALZA 5I3UB 1TK8A 1Q5YA 2IVMA 1T9XA 2DGSA 3G82A 1HW9A 3HVWA 1S1TB 2HG4A 3CEDA 3ET6A 2AJ0A 4FP9A 1ELOA 2ZBQA 3VQTA 4ED0A 4KTQA 4LMZA 1ZPVA 5KFXA 2I2YA 2MLZA 3HSZA 3FCHA 1X8DA 2MZTA 3N79A 2LCWA 1T02A 2DXEA 4OZNA 3Q22A 1TFYA 3D6MB 3MM6B 1UA1A 1HBOB 4DV3F 4BF8A 4FF2A 1ACMB 6AT1B 1SJRA 2GIRA 2AMCB 2AEFA 3NMAA 4PXCA 2CQGA 4NXNF 2ZHAA 2R7RA 4DL4A 3JB9k 2IRYA 1RWOB 2VC1A 4OYXA 4DV0J 4XAKA 2LQJA 3Q23A 1D3WA 2PT0A 3AB4B 3LP1B 2GA7A 4B08A 3CCRS 3PZPA 2R7VA 3L09A 2IC3B 4QIBA 1IKVB 2VQFF 2QFJA 1BQNB 3GP9A 3SQGA 3ZTPA 2R2RA 2WRMA 3PR5B 3MI7X 3FFIA 3PNIA 5HL7Q 1TK5A 3J81Y 1TKXA 5KFHA 1VOMA 2FJAB 1P5QA 2RJZA 4O3QA 4W98A 3KOAA 3OTOJ 2DNHA 4F4YA 2VPWB 3FBCA 4UQGA 4NI2A 5B0GA 4DX5A 4DLGA 2G2ZA 2GZOA 1BXNA 1S76D 3PJWA 3QPIA 1SV5B 2VU5A 1DLOA 2LXFA 4KH0B 1X60A 4LSNB 3FXYA 1RT1B 3UCUP 3OUYA 3PVXA 2CZ9A 2GW8A 2C2EA 1M5SA 1AZSB 1N56A 3OFEA 4AXIA 1N8RT 4NZ7A 1G2EA 3PR9A 4HTJA 4W90B 5HW8A 2W2QP 3FKBA 4P2XA 3ZTSA 4DPUA 1YBUA 2DKOB 2D3UA 3WD0A 4ZVRB 2CPZA 1E6VA 1JXVA 1TU0B 2GCFA 5B0CA 5HP1B 2HVIA 1S1VB 1FESA 4DRIA 1CJTA 2I9SA 5T41A 1J5OA 1NBEB 3BBBA 3WL1A 4J90A 5AE2A 1O5JA 1XQIA 3RB6A 4F7VA 4IR9A 1KQFB 1YZ7A 1EETB 3W7BA 1IKWB 1JLQA 4ZITA 2MHEA 2HWIA 1IBMF 2YY3A 1R9HA 4FPIA 2HKEA 3M8PB 5DGBA 5BR8J 3PYDA 1FKIA 4ZIWA 3EXYA 3DRXA 1XJWB 2Y1IA 2KTQA 1EKRA 3AXMA 2OPPA 1MWQA 3J81j 3HSGA 3CW2C 4KC5A 4ZPAA 1GNKA 1URNA 2RURA 3CDEA 1SBRA 3IP0A 2A3EA 2CPYA 2ILYA 3VV2B 1Q78A 4K4XA 2LU2A 3W2WB 2POKA 2MJUA 1MNEA 4G1QA 3Q8UA 3FEXB 4P72A 4CNZA 1HQEA 4GC7A 3TVKA 3FMBA 3T3FA 4B3MF 1RA7A 4OZJA 3BGLA 1SJQA 2XNRA 3AT1B 4LJMA 2MHNA 6FD1A 2EW9A 1XN9A 4DL3A 4CYUB 3CCZA 2Q66A 4ZP8A 4PRFA 3BKTA 4ATNA 4IOCQ 4RW7B 1KVKA 3J7YU 3R2CJ 1IKXA 4I7FB 3G8SA 4J9PA 3V6JA 1S9GA 4EZ9A 2B9XA 3GMGA 1TVRB 4P9SA 5LXRA 2DPJA 2R3VA 4KB7A 4F0HA 1QM9A 4DN0A 4URSA 5A76A 3BR8A 3MCNA 3IC1A 2UUTA 4JFKA 1TR0A 1VIXA 1U02A 3PYFA 5HLFB 1RTHB 4ML4A 3OJSA 2OH2A 2Y8WA 2HURA 4X4RA 3CXCR 5KT3A 4LFBJ 1HPZA 1XK8A 2CWXA 3JSMB 5DDRC 2E9ZA 2KHDA 4LRFA 2PV1A 1ZBWA 1RD6A 3NKYA 4ZCKA 1RAFB 2QYCA 4M5DA 3SIPB 1FNXH 2LEAA 3BPSP 2VPYB 4Y00A 3ZTOA 2XSFA 3PW2A 3CCUS 4F8RA 2EG2A 1MMNA 3NGSA 4KPYA 2GMLA 4LAVA 1JLFA 2JEFA 4D3HA 2HZAA 1CBKA 4JI8F 4CM0A 4W9PA 4NNRA 4WK3A 2CPJA 2B7CB 2DTJA 1RHQB 1N0UA 3B9EA 1U0HB 3EVMA 3LGNA 3AB2B 3PFEA 3IK8A 1IKYA 5H9FJ 5I3QA 5F9LA 1ZBKA 2V69A 3CDAA 3OOBA 2J9CA 3CDBA 4LREA 1DQ9A 5CD4H 4EMDA 5EDWA 2J9DA 2OEMA 3GFHA 3T41A 1MMDA 5A8KA 1VFJA 3CC4S 2I5JB 1D0EA 1FCAA 3POTB 3VAIA 3TA0A 2JWNA 4ED7A 1KQGB 1GXUA 1S7IA 3OT9A 4L75A 3K8WA 2ROEA 4Y6IA 3DOMA 3G87A 3MEGB 3SI8A 2EFOA 3CJ8A 3BREA 5IWAF 5B0EA 4V19X 1EP4A 1LEOA 2UZ5A 2PN0A 1FE4A 5CAAA 1FX4A 2PEBA 1S1UA 2A1BA 3PRVA 1VRQC 3C66A 3R5JB 3CCVS 4TU9A 4IRDA 4G3IA 2DPEA 2KRRA 2V68A 4Y2IA 3PRDA 5D75A 1JQGA 1UFKA 4DQPA 1NPRA 4KV8A 1FKPB 3FZBA 2HRUA 3H5UA 4B3SF 3TUIC 2DH7A 4Y2AA 4U95A 2KR7A 4ED2A 3QT8A 4AT1B 1VC5A 3DYAA 2XMKA 3DOLA 2BVZA 5HQ8A 2QV6A 1T3NA 1SKRA 1X0PA 1ITXA 4WFNQ 2NPIA 2XB2D 2RU3A 3K5MA 3CUNA 5L1JA 3CHEA 3AOAA 4OYOA 5A6PA 2RSEA 1JKHA 1NKCA 3QWUA 4TU7A 5IC4B 4MGVA 4NZ0A 4OZLA 2WBRA 3HHDA 5J2NA 2VD3A 3QRPA 2M5YA 4P8WA 3W65A 1CC8A 1VQ5S 4IUFA 2R7WA 2IIHA 2WVBA 3AOBA 2B4PA 4DF8A 3PJXA 4FDFA 1UFWA 1AFIA 1RT7A 1U26A 3CJSA 2VICA 3M2VB 2CQ1A 3I55S 1WUUA 1Z2ZA 1L3SA 2F4VJ 4P8UA 2MYFA 2L08A 3AS0A 2J5AA 3D1HA 4WU3A 3HO1A 3KUEA 2ZH7A 5IT9Y 4Z7CA 1JJ2R 2PDAA 4B3TJ 2GAHC 4Q2LA 5D8HB 4MYTA 5LXYA 2KJVA 1EIBA 1MSWD 2CJBA 2VQEF 2OLHA 5GADU 4KGZB 2F8MA 4CI0B 2IRUA 3DM2A 3MMBB 4WK9A 4CCHA 1LFPA 4ODMA 1LWEA 3VGVA 1F9EB 1DHMA 5ETKA 4C11A 5FLXY 4LF7J 4W92B 3GJRB 4NLYA 2BKOA 4CDIA 3Q8SB 4YUDA 1RWXB 4QT2A 2H5IB 2V63A 4PG5A 1BGXT 2VJVA 3O5PA 5L1LA 3M30A 3MAAA 2E7WA 2RD5C 2N87A 1MWYA 4DV4J 2NCKL 3G8QA 5AT1B 3FVYA 7FDRA 4DUYF 4URGA 1LNQA 3B6BA 4IRKA 1ZPWX 3I5BA 4RU9A 1SL1A 4AD6A 3BDPA 1P9QC 3DLEA 3IWXA 2XZWA 4NLVA 2BR0A 3KXDA 3RFWA 1HMVA 4DRPA 1YDLA 2AYEA 2IY5B 4NE9C 1FKLA 3W2WA 2OPSA 3QAUA 5AXNA 2CNLB 1JMTA 2V4RA 4BLGA 4KFBB 2V4QA 1HW8A 1OGBA 4F3OA 3WL0A 1LG1A 1KTVA 1X5PA 2ZBIA 5D0GA 1RT6A 2O3DA 2WOMA 2HHUA 5CZVA 5ETLA 4Y2CA 1K0VA 3B54A 3C14A 4ELUA 3RTVA 4F2RA 4K0KF 3KNAA 3U02A 2FJBB 1YK9A 3OL6A 4EWTA 5EWGA 4RX6A 2V34A 3C6UB 4LF9F 3BM7A 5ADZA 2HS3A 5KFAA 1D8YA 1TUGB 3ITHB 1EZZB 4LAXA 1NXIA 3CJKA 3ZTRA 4MK8A 4DG1B 2CJAA 2UXCF 2QFIA 1CULA 4NL5A 2R2TA 2EI5A 2G9OA 3D0GE 3QGHA 2EK1A 3DGPA 3JQKA 4R0XA 1FRKA 2MKHA 1LXJA 5E5NA 1JNSA 4ES3A 1SCJB 2UZAA 2CPHA 1K9MT 4UZBA 2G41A 3H9RB 3FEYB 1WELA 4HT5A 3SSRA 1GMWD 4OHXA 4DOZA 4YDDB 1R8PA 1ZM9A 1UVIA 1RI7A 2CQIA 4NEYA 3KLHA 1NAQA 4CLPA 1ZM4A 4TYOA 2G1DA 1SL0A 2E1MC 1IBMJ 1FKBA 2PA3A 4LSLA 2J0SD 4DJBA 1NKEA 2EULA 2A3AA 4P8XA 2KVQE 2GGPB 2X3GA 3T1AA 1YJVA 1SQFA 3UCZP 2B5UB 2MKJA 4Q8FA 3OTOF 3M32A 4O3SA 2EKYA 3CCTA 1OY6A 2LQBA 2NZCA 3E51A 1YJRA 3HI9A 3UDEA 4ECTA 1KLNA 2WLZA 1GMWA 1KT1A 1XERA 1Q8LA 3NGKA 4ILRA 3OFGA 9RUBA 1E6YA 1U25A 4LQ9A 1YSJA 2JFDA 2MLYA 3MAHA 4AFFA 4C8MA 1DTQB 3GCXP 3V4MA 2AX0A 4RW9B 2RKIA 5D6GA 3O5DA 2YPYA 4PG4A 2C3UA 2XMJA 4HH0A 3HPOA 5DLFA 4ELVA 2RF2A 3H0PA 1ZM2A 4ICLA 1MN7A 4CIOA 1X5TA 4Z2IA 2MZRA 4Q8EA 1HQEB 2E5GA 2BV3A 2VPXB 3BS9A 3JSBA 3MEEB 2XYPB 4HYKA 4CO1A 1K1QA 1V6HA 3TEGA 4ED1A 2RNEA 4UOFA 3D6FB 2EFVA 2WSEC 3FBEA 5HMWA 4GMKA 2HEKA 1KR4A 2IAJA 3DOMB 3MEGA 1RP5A 5T7LA 2KFNA 2KJWA 3ENQA 2XM3A 2OJ3A 2JEIA 4PAAA 2DT2A 4KY3A 3T6BA 1W1YA 2NSCA 3KYLA 1FD9A 2VONA 5IC6B 1BQMB 3H59A 1WOOA 5ETSA 4M5MA 1YJUA 1IX5A 4DRHA 1WC0A 3J7Z5 2WOMB 1APSA 4I68A 5EX3A 3HFZB 3KHGA 5GMEA 1R0CB 4FVMA 2CAJA 3DLJA 4KGMA 1WSRA 3UDLA 2XGQA 1RYSA 1RYRA 3T9NA 2JL9A 5J2PA 2DIUA 1QSLA 3CMAS 1JK9B 3O5OA 2YVSA 1HYSA 1IJFB 2PA8D 4K2JA 1S59A 5THWA 3EYZA 3CJQA 4LF6F 2E9TA 2L9WA 3QT6A 3FK4A 1C0TB 2WZ1A 4RW6B 4OFZA 4PXBA 4IO9Q 1SIZA 3MD3A 2VG6B 5GAHI 1HKAA 3ISZA 4OYBA 3T1HJ 1PYSB 5HQMA 2N4CA 1N1AA 1NPKA 4YP3A 2XLKA 5KG2A 2FDNA 3P6YC 3GJSB 3NNCA 1L5UA 1RCXB 1X9SA 1E6NA 1FDDA 1GX6A 3CCMS 2HVHA 4DRNA 2YX7A 2ZUAA 3W2VA 4ZK7M 1U6FA 5DLGA 1KSPA 3R5DA 3KABA 3PA7A 1IUJA 1Q53A 3FFIB 3GCWP 5KT4A 3RBEA 2YNIB 1UA0A 2ZQTA 4K7QA 2PE8A 2HQGA 1HBUB 3VTIA 1HKMA 3D5MA 4TLRA 2ZR5A 1ZL1A 1KWMA 3O5LA 5HWBA 1S6QA 2BANB 2DXDA 3K5PA 3P8BB 4L76A 4ZVPB 5KFYA 5I42B 2NZ4A 2ZITA 2BBEA 2AYGA 5D0EA 4BCAA 1SKUB 4AE5A 3FRYA 2ZM6J 2QL9B 4CYUA 2BE2A 1U49A 4MTVA 1H2UX 1RZMA 3DU5A 1NJYA 4YY3F 1RT5B 1WD6A 1CSJA 4ILLA 3I31A 1FXDA 2LDIA 3OVSA 3EY6A 1RT4A 4NLDA 4X4TA 4DR5J 3O5JA 2VIHA 3M1VA 4X62F 1SH3A 3HULA 3IKGA 2XI2A 2JVRA 1S5ZA 5LJ3Y 3BGOP 2ZH3A 2PV3A 2L9NA 3D3CJ 5C24A 4KE5A 1H38A 1BMQB 2YKMA 3BQ2A 1F2HA 1HJXA 4RUBA 3RB0A 3NI6A 1NK5A 3GR0A 3HJVA 1WSVA 1CJUA 2OGUA 3SQOP 4DX6A 2D3O1 4A47A 2CVEA 2V6AA 5C2GA 4U84A 2F2DA 4Q2MA 2KL8A 4GC6A 2DYAA 1FKGA 1R0AB 5I4MA 4CO3A 2RDDA 1H98A 1UVKA 3KK2B 2FVSA 1YW5A 1JLEA 3AD7C 2EBEA 2FTRA 2JLGA 3MAQA 4XPEA 1REGX 1RT1A 4EI2A 4ZLPA 4NWBA 3MM7A 1ZA1B 2YNFA 3ZZOA 3L3CA 2A6OA 1FJEB 1PKUA 2EKNA 1FKAF 3IRWP 3H4DA 4DV6J 3O5EA 3UD4P 4HKQA 1VF8A 4IKAA 1G3OA 2Y1RI 2VASA 3G6XA 1PC5A 5J2MB 2N4DA 4IG0A 4TY8B 3EGNA 4OX6A 3GFZA 3FMWA 5KFNA 4PXDA 1KQSR 4DPOA 3GQCA 1IR0A 3BQ1A 1JWWA 3MM9B 4X4QA 2IF4A 3UN5A 1FKHA 1R8CA 4DL5A 2I8EA 4XIUA 4RLEA 1HD0A 2P8IA 1YBTA 4OHZA 3GV7B 3MUVP 5CZXA 1S79A 1W2BR 1OYDA 2KH9A 3O8WA 4KQZA 2JZ5A 2FLLA 3PO4A 1X5SA 3MR5A 4DLEA 5HT1A 1UJ5A 2FZKB 4M5NA 3MFIA 2LEBA 5J2QB 4JV5F 1B70B 3X3UA 3EZ5A 1LV5A 2XTJP 3CJRA 4I2PB 2KXNB 3T6JA 3Q8RB 3KK3B 4DV3J 3OVBA 1NH8A 3TJ8A 3UNYA 4EYHB 1YJ7A 5LMNF 2FD2A 1FJCA 3A3OB 4I6YA 3S8SA 1LK7A 1O8BA 3CWJA 2C22A 1XMQJ 1M5PC 3CSKA 3DLBA 2Y78A 3P4UB 4I2QB 3RRGA 4QJVA 4A8KA 3IBFB 1HQ2A 3WD1A 3NCPA 1S1WB 2F4EA 2HNZB 3MMJA 4LVNP 3GSIA 2J9EA 5E33A 1K1SA 3TZZA 2O92A 4ILMA 3CHFA 1HKJA 2MY7A 4OHYA 4WFZA 5KFSA 1RCOB 4QYZK 3UI6A 1S6QB 2XMMA 5K14B 3PJ9A 4CLUA 1YJNS 1K9TA 1E6VB 2YWGA 4MMOA 2V4JA 3TUJC 2VG7B 1M0SA 2GHVC 3DC2A 4NCGA 4DBQA 5GAGU 3E01A 4JBCA 4XDCA 4YFUA 1CG2A 2AGQA 4A8YA 1U1LA 1HD1A 2DR6A 4RUAA 3EWGA 4TYAA 5F8MA 1RT2B 3O44A 1SL2A 1IBLJ 3KTQA 3WH0A 2RUGA 3IM9A 4ZN3A 5IQ6A 1CC7A 3M8QA 3PHEA 4CLZA 4YB7A 3M8PA 1NSPA 3UR0A 3HFKA 3VWSA 3G6LA 1Q1KA 3GIRA 1RWWB 2QTWA 2KHCA 3ETOA 1VISA 2FHOB 2OPPB 1GUVA 3QT5A 5GAHU 3G71S 5DIVA 1U0HA 2YX1A 2G0JA 4JUZA 1RGVA 1MW7A 1GXTA 1XMOF 3K0JA 2BEFA 2LKZA
chains in the Genus database with same CATH topology
5E3QA 2W4CA 3MECA 1UVNA 3VAGA 1O51A 2MMYA 2VFUA 4B9NA 1XHGA 3GYXB 3TP2A 2GQQA 2PD1A 3BJYA 4Z37A 3H2LA 1FERA 2RUDA 3Q24A 1KN6A 3W2VB 4PWUA 1SR0A 2QO3A 2CQ0A 1D6OA 3LF0A 2YNGB 4FZVA 1FXLA 1S6PA 1WACA 1RT7B 3GB0A 3M9MB 2UU9F 2M88A 4WIWA 4QW9A 1ZH5A 2CZVC 5KFKA 3B4MA 2ZC3A 4MAKA 1FKTA 2Q6CA 1C0TA 4QU7A 1CLFA 2G13A 4YEAA 4DZ2A 3QOKA 3RYLA 2DVIA 1X4BA 5KG6A 2ZNYA 2JX2A 2GV1A 3SDEB 5DO2A 3DXSX 4RW4A 4N8OA 3ITHA 2PMHA 3CJ3A 1JLFB 2DIVA 1DTTB 3E2EA 3R5BA 4WZMA 4JFJA 1SC6A 2A3CA 3TRGA 5K8MA 1T05B 3LP0B 1WTBA 1CPZA 2HQIA 4BC7A 1O6IA 1UJ4A 3GFYA 4QBUA 1H0IA 1C2PA 2DHAA 2RT3A 4R0EA 1HI0P 2HW3A 3VZHA 5HROA 1BQMA 2OTJS 5IZHA 2RILA 1GH8A 3WC2A 1X4DA 5DITA 1VBXA 2Z2LA 2U1AA 4ODLA 2MKSA 3R3TA 1HFEL 2RQ4A 2ZH2A 5BJRA 4IR1A 2ZR4A 4ELTA 5CH7B 4MNJA 3MM7B 4F4ZA 2IA6A 1C1BB 4TN2A 2R7UA 5D78A 3PDNA 2RS8A 3ZFVA 4U67Q 1NKBA 3MUTP 1N48A 1LG2A 3KLGA 3BXWA 1FKRA 1ZM3A 3QZ7A 4HL9A 5A0YB 4ZPTR 4NCGB 1OGGA 1RT6B 2DHSA 3D28A 2I38A 4NX9A 3D0HE 3G9CA 2D9PA 1ZAWA 4DHVA 1OWQA 2DRAA 1X4AA 1HNIB 1MWZA 1KFSA 5CYQA 3UQBA 3OFHA 1F8AB 5HI7A 2V0NA 2V8HA 4KHMA 4FAPA 2RE1A 3TAPA 2JZVA 3GV8B 3DLEB 2C28A 4N41A 1HBMB 3FRZA 3MFHA 4QYZJ 4BWJA 3ARUA 4DSEA 1XTZA 4J4NA 1VGYA 1S0OA 3SV3A 2XP7A 2IM2A 2KO1A 1NWUA 4Z2HA 2Q1LA 3BQ1A 5L1KA 2B6AB 4NLWA 1L1PA 1VBZA 4O3NA 3PKMA 2OFNA 5K9FA 1HA1A 2KE0A 5HWCA 1NHUA 4PKDB 3OJUA 4KJIA 4P6QA 2E1CA 3L7OA 3ALFA 2HRYA 4PPZA 4RW8A 3CDUA 1RJJA 4D3GA 5B0FA 1NJWA 2DITA 4B9LA 1Q79A 4YR2A 5E3RA 1K0TA 4OI3A 2UVWA 2ZQSA 1U24A 3E01B 3CPWR 4ERDA 1RAJA 1MU2B 4EU0A 1ROUA 5H1SV 2PMZD 4O44A 4C8KA 2CDQA 1XC9A 3N6MA 1KONA 1KC8T 4M95A 4WZQA 4GO7X 1NNDA 3VAWA 1VQ6S 1D7HA 3VF0B 4UUXA 1IKVA 2IVFB 1S1WA 1Y3JA 2HNZA 3SCKE 1S10A 3I6CA 5E0OA 3LP0A 3F56A 5D3GA 2JFKA 2PI6A 1XBWA 2QE5A 1GT8A 4CO0A 3Q0AA 2RMLA 1RKIA 5F0UA 4EBEA 4QR0A 3JYMA 3CB4A 1JJHA 1IJEB 2AJ4A 1LXNA 5HROB 1F60B 3MUMP 1UVLA 3MR3A 2NLWA 1VRUB 2V94A 4WXOA 4X4OA 1DLOB 4B3TF 3GIIA 1J4HA 3CT9A 5GAEI 4WYLA 1X4FA 2XP6A 3QO9B 3TVZA 3OL9A 4ZPBA 3R5CA 2MZQA 4U6PA 2CFXA 3K5OA 2C2RA 1Q4RA 5L9NA 3KAHA 2B43A 2WONA 3CJ4A 3OTDA 3FAPA 4IDKB 4QPXA 2WSFC 2ATLA 1S72S 2IRXA 3OFFA 1W9VA 3SV4A 2CG4A 4HEA9 2ZQVA 3FY1A 1QAXA 1T3OA 3VR1A 4DR4F 1F2GA 3IG1B 2HGLA 4ICLB 3DDKA 4PG6A 4A4JA 2IM3A 2YKOA 4ETXA 4U85A 3V81B 1ZTWA 1C4CA 1ZBCA 3PEJA 1R3NA 2UUWA 5CYQB 3O6QA 3ICLA 2WB4A 1W9PA 2QT7A 1RKJA 3K2YA 3MMCB 3OPKA 2DISA 1FAPA 4LT6A 1BC6A 3LANA 1LL7A 2PI5A 2VG6A 4ODQA 1WHVA 3OLAA 4EO8A 1Q82T 5AE1A 4X4UA 2HMIA 2ZJPQ 4O3RA 5CYMB 4A8SA 3MM6A 2XBPA 4HDGA 4YDXA 4ODOA 5FDLB 2XC9A 2QLXA 2QA4G 3R1LA 2HHTA 4A48A 1REVA 1IBKF 1RTJB 3NBPA 3GG1A 3IR5B 2O67A 1FA0A 3TA2A 4J4OA 3BGFA 4W5UA 1R7IA 3MMAA 3G8TA 2PSZA 4LF8F 3MPVA 4URQU 3KMSA 1NWTA 4FF3A 5I3PA 1R31A 2EWHA 4J9KA 2RKIB 3J7A1 4R25A 2AU0A 1JNRB 4JV0A 3RR8A 2RF2B 1FRLA 4F4XA 1YWXA 3WX4A 2UP1A 1SQEA 3EGWB 5DJBA 1Z4UA 2J7UA 4HT7A 4DWSA 3PXGa 3V2UC 1ZYQA 1UEVA 2IUZA 1Y00A 2J9DE 1TKTA 4I67A 4PWDA 4NLXA 5C24B 3AY0A 1QLNA 4OV1A 1N4LA 1FXRA 1G7CB 4ITSA 2ASDA 3CTRA 1C1CB 2J76E 3MOZA 3AQPA 3AQOA 1IKYB 2EC0A 4WE1A 1NJZA 2JDJA 3T5KA 3LAMA 3M8RA 3SSSA 1JJ2R 1N6QA 4DFKA 4LAWA 1S1XA 2C3OA 3DRSB 3O2IA 1FFQA 4ED6A 4DR7F 1FEEA 1NMVA 3HVTB 2HAIA 1SKWA 2XEXA 1Q16B 4LF5F 4QU6A 2ASJA 2FLPA 2X1GA 1R6YA 1FKDA 5E3AA 5KFPA 3QMQA 4QW8A 5G0RB 3SDEA 2W9CA 2GO9A 4WIIA 1B6CA 3I5AA 3I9ZA 3CZ8A 1XR6A 3V6HA 1TV6B 2W4PA 4HBEA 1M5HA 4TY8A 3CCLS 1LQ0A 1X6NA 3MDYB 3GFXA 3UE2A 3RM8A 4C02B 1Q86T 1S49A 2VBWA 3GR1A 1HPZB 2HIQA 3T9ZA 3ZZRA 4Z2XA 2XCAA 3JSMA 3KMQA 5EUHA 3I0RB 2NQPA 4ZPDA 1PILA 2K1RB 3DMJA 4UUWA 1Y3KA 4E98A 1U45A 4WF9Q 1N5QA 1J4IA 1JLAA 5J2NB 4TXSA 2PC6A 2YKQA 3PW0A 5JH8A 1L3KA 3EXCX 4I7FA 4IFVA 1VBYA 2R2SA 3FSXA 4KKOB 2OIHA 2KT5A 3ARZA 1AROP 4FPRA 1XMQF 2GFFA 2XP4A 3PW4A 5LSLA 3KLGB 5CYJA 1UKUA 5A8RB 2CQ3A 5IS2A 2KKHA 5GAEU 4DV0F 4RWXA 4CT8A 3FDSA 1T7PA 4XDDA 2CQHA 2VPZB 1TKDA 1MU2A 4G1IA 3BDEA 5I3UA 2F9DA 3PIOQ 5EN1A 4QT3A 3B9DA 1KS2A 4OJ1A 1S6PB 1D8ZA 2LMIA 3N6LA 1JNEA 2GMHA 2AJFE 2EBGA 3OV7A 3OVAA 2KU7A 3RR7A 2GX8A 2OPQB 3CVKA 5EX0A 2V5HG 2ZHOA 1KT0A 3MMBA 5GMKa 3EX7B 4DWSC 1KEKA 4DRJA 4DRMA 4I2PA 4QPTA 4C11B 2FVQA 4PUOA 1FD2A 4KAIA 2YWHA 2KRBA 2LLZA 4AYBD 4FN5A 4QIEA 1FDBA 4ECUA 5KFEA 1FVQA 2RSQA 4A8WA 5F9NA 5EHHA 4OJGA 4DR6F 1TFVA 5JJBA 1JXEA 3Q8QB 2ROPA 2KXHA 1HNWF 1KHVA 2CPXA 2QSFA 4OZ5A 5SZTA 2KN4A 2BJEA 4U7UK 2M8DB 4NXMF 1TFWA 1LK5A 3CD0A 2DSWA 2J6SA 1YHQS 2KG0A 4DSIA 4HI1A 4OX7A 5FIIA 4UQTA 5HW6A 3BN4A 3WDOA 5HKGA 1U6BA 2XNQA 4OX9F 1JNTA 2J8AA 1BD6A 1OO0B 5L39A 2MGZA 3KKFA 1V3SA 2R7QA 4O0IA 3VAKA 1RT2A 2M7SA 3DYAB 2IYIA 3CJ5A 4MFBB 1NU4A 2M2AA 3H25A 4YOEA 4K5SA 5DEZA 4YMEA 1T94A 4KSEB 1BKFA 5C5JA 2VH7A 2W9BB 1JJ4A 1RTDB 3HJFA 3KCEA 1Q8BA 2Q79A 4HH1A 2DO0A 3TW0A 2IM0A 2YBUA 1D7IA 1WHYA 3JYTB 2MQMA 3HZGA 4I4BA 1ZETA 1VQLS 4C7QA 3DHWC 2DSZA 1FF2A 3N28A 2AOSA 3G86A 4ED3A 4F2SA 3UQAA 3I0RA 2XMUA 3QIPB 3M30B 4USHA 2PIIA 1PINA 3M6UA 2UV8A 1ZZFA 5CQGA 5FDLA 5CXTA 2B4UA 3KZ7A 1U1KA 3RB4A 2F3JA 2ZOMA 2OD4A 4C8LA 2DGUA 1HMVB 5KFCA 3NTPA 2OPSB 1HJWA 1DRZA 1P6TA 1NZAA 1N5VA 4IFYB 2NREA 4RU2A 3H5SA 5KOXA 1YIJS 2E5LF 2XY5A 1H0GA 1FKPA 1S1XB 3UCGA 4BHQA 5JVHQ 2ERRA 1LWEB 1JIHA 4DWIA 3ARYA 2YH0A 2COLA 2C3YA 3MCSA 3IG1A 3BN7A 3UWTA 4CO5A 2XO7A 3OUYB 4DL0C 1NK8A 4OX8A 4A8OA 3HX9A 1M5YA 4RBTA 3VALA 1VC0A 3V4IB 2ZD1B 2OTLS 2ZKTA 4O4RA 4DX8H 1T11A 3H8YA 4XPCA 4HI2A 3OL8A 3UD3P 4MAVA 1SI9A 1SUQB 1E6PA 1HI8A 1S0NA 2XWYA 4OJ3A 1UWBA