4ZPVR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
total genus 45
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zpvR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zpvR01
3SCIE 4QZVB 3D0HE 3BGFA 4ZPTR 4L72B 3D0IE 4KQZA 5DO2A 3D0GE 4ZPWR 2AJFE 4ZS6A 3SCLE 3SCKE 4XAKA 2DD8S 4ZPVR 2GHVC 4L3NA 4KR0B 2GHWA 3SCJE
chains in the Genus database with same CATH superfamily
2CPIA 4FZVA 4BDPA 3HHKA 1I1GA 2WK4A 3GFYA 3AH6A 1DAXA 2OUGA 3PX0A 2BKPA 1JJ4A 2YBVA 1SR0A 3ARTA 4KJIA 4NEYA 2KI3A 1QVGR 5EGYA 2B9WA 1P9YA 2KZMA 1T9UA 5LMUF 5IT9U 4OJ3A 4PZVA 1NWTA 3KCEA 2Z4PA 3AB4B 2K8GA 3NWGA 4DSLA 1DRZA 2KE0A 1B99A 2IRUA 5FIIA 2LMIA 3KG0A 1MG7A 4YB1P 3I0RA 4NASA 1NHVA 2L48A 1F6TA 2R3VA 3W5XA 1WC4A 2DGOA 3UFCX 5D4OA 3DLEB 5D0RA 1LWEA 1QVFR 2AHOB 2XYGB 3KUEA 4C0BA 4DFMA 3QMQA 4U95A 4JYAJ 3WD4A 1J6YA 4IT6A 4W5UA 2MZ1A 4RUCA 1FVSA 4DV4J 2GIFA 4KGKA 2J9DA 1L3KA 4LVNP 2ZR4A 2W2OP 2KG0A 3D0IE 1CEZA 2Q6BA 3VAWA 2ZITA 5IC6B 2FTRA 5CAAA 3T3FA 3ZZZA 3DDIA 4LIRA 1FERA 4PWDA 2QX0A 1HNWF 2DHSA 4O4GA 2Q5AA 2HVEA 4X84A 3NNHA 1VCTA 4KPYA 4ELTA 3HX9A 4LSNA 1LW0B 3CIZA 2BEFA 4DR4F 1RTHB 1YJWS 1I5OB 3P5TL 1HNVA 2WB4A 3LP0B 4FKXA 1WC0A 3ETMA 3KADA 4DL7A 2WOMB 5DZ6A 3MEDB 5LL6d 1UVJA 1FJEB 1L3UA 3KK2B 4QBUA 2YNHB 1GEHA 1UEVA 5DETA 3VZIA 2ZC4A 2XZWA 2W7AA 4ES3A 1OSCA 5CQGA 1VC0A 4ED3A 2M7SA 1RU1A 2A3CA 1TKZB 1ITXA 2ADCA 1WUUA 5A2QY 5CYMA 2DNNA 4MNKA 1Q7LB 3C15A 3QJJA 4B9VA 4EO8A 4OZ1A 2HHQA 2CDQA 2CQCA 2CPYA 2HBQB 5B0GA 2HQFA 3QQCD 4LREA 3W60A 1K9TA 4IKAA 2C2ZB 3OL9A 3QPIA 2GZOA 2NCKL 2DNQA 4OX6A 1XNRJ 3NAHA 2NYHA 4NZCA 1RAJA 4C0OC 4J37A 4CTAA 4NE9C 5IZHA 3HPOA 3KLEB 3T1YF 2K7KA 1X4DA 3QGPA 2MLZA 4D3GA 4EZ6A 4OMFG 1LK5A 3RG6A 3DU5A 2PN0A 1N32J 4QWCA 3MFIA 1C4AA 1OMSA 3CJ3A 4UY85 4OX9J 3QFHA 1T05B 4DV1J 1WTBA 4QIEA 5C24A 1JJHA 2AWGA 3U27A 3L7UA 1C1CA 2E1CA 3TAPA 3G82A 3MM7A 4X62F 2KFNA 1RWKB 3FVYA 2P9GA 2R42A 1MU2A 3IK8A 1IKWB 3WKZA 4X4TA 3DRSA 4C98A 3AS2A 1KN6A 3ZTSA 4RUBA 4JI3F 2P5VA 3FKBA 3R2CJ 1QUVA 4IG3A 2VDIA 2QL5B 2HNYB 3JAMY 1NU4A 2VA2A 3DRPB 5HL7Q 2VC1A 1X6NA 3KHHA 1JNEA 1OY8A 3TVZA 4XDCA 2CA9A 2DR9A 1VQKS 4MAVA 3PJ9A 3OFGA 2NXEA 1KOOA 1K44A 1Y3KA 3VQTA 2I1RA 3SDEA 1S0OA 1D7JA 1SUQA 2ZBRA 4A8QA 1RWVB 3CDUA 1UVNA 2N4DA 3CHDA 1DQAA 3GG0A 3RBEA 4ODKA 1EIBA 5I3QA 2XP9A 1JNDA 2C2RA 4ODNA 1X4CA 2CXEA 3LW5C 3MDFA 4K5SA 2R9LA 1FKIA 1KS2A 3QNWB 2DGWA 1X8DA 3ENVA 1K9MT 4HTJA 3N28A 1FF2A 3HM9A 3ZZOA 1YBUA 4EK2A 1CS4A 2W9BB 4X64J 3HD2A 4C4WA 1SJ1A 4L3NA 2QC3A 1S1WB 4FP9A 4I0WA 3CCVS 4V19X 4B3MJ 1LV5A 4DFKA 2ZH5A 5CYQB 4J90A 3DLGB 1EX8A 1KQSR 4H4MB 1C0UA 3D66A 4NI2B 2B31A 1I94J 2UUTA 1CJVA 1RT5A 1RA7A 1S6UA 4WJXA 5L46A 4IQMA 3QIPA 3MEKA 3AD9C 4DX6A 3PW0A 1S1VB 1QM9A 1JK9B 5L1JA 2RMLA 4O3SA 2J9CA 2E5HA 1IVZA 1RWOB 3M9MB 3PO4A 2EPIA 1X4FA 3BZQA 3D0HE 1RT4A 5EX0A 3DLHA 3QO9A 2G4BA 2ZWPA 3AQPA 2OLHA 5L39A 3WIJA 3I0SB 4ZPWR 2COLA 3AXKA 4NYZA 4WKYA 3MFHA 1TMMA 2DPIA 3WX4A 2Y1IA 2HHXA 3IBCB 3VAIA 4R8UB 1Z2ZA 4M5JA 4WXOA 4ODRA 3E01B 1GMVA 4KHMA 2PFDA 2DSUA 3BQ1A 1U1RA 3QGIA 3BN4A 4QJVA 3US5A 2MB0B 2UVRA 2W4CA 3CD6S 1QPLA 3UE2A 1TR0A 4FN5A 1G1XA 2N7CA 2HBZB 1T9VA 1XN9A 2HGNA 3RAQA 2XMTA 4P52A 1HHTP 5GMDA 1TL4A 3GTYX 2VHGA 3TX8A 5E3CA 4OJHA 2B6AB 3PJWA 3RM4A 5L9NA 2FLOA 2B9YA 1L3SA 1HNIB 4GO5X 1TL5A 4C3MA 2XM3A 5LMNJ 3CZ8A 4DR2J 5DLFA 2BM1A 1EP4A 4DSKA 1FT8A 3AT1B 2XB2D 3RW7A 1DTTB 2EK6A 4Q44A 2ZQVA 4KO0B 5DDQC 1UP1A 3A1YG 2AGOA 3DN9A 3PHTA 2FJEB 1TKTB 3AB2B 4DV0F 2V6AA 3CO9A 1UMJA 1QAJA 3CCES 2OTLS 2GS8A 4JI2J 5LJ3Y 5KT5A 4USIA 1K1SA 2HKEA 5K8NA 1FKPB 2NSBA 3A8JA 1HNZF 2H5JB 1TKXB 1CLFA 3T41A 1W1VA 1LG1A 2GAHC 5E3AA 3WD2A 1EIYB 4LBHA 3OSPA 4MH8A 1KEKA 4U7UD 5D4LA 2OEKA 1X5TA 1HHQA 4WJBA 1HW9A 4F02A 2W7OA 5KFPA 3WIVA 3Q89A 1NK8A 2XULA 2DXFA 5D78A 2ADBA 2A0FB 2W1BA 2XSFA 1C0TA 3LAKA 3QJPA 4DN0A 4FYVB 4CNZA 1ZAVA 5D0GA 4ZLJA 3ZC4A 4CLZA 1Y00A 3F44A 2AJ1A 3MCMA 1RT6B 3KAHA 2BJ8A 5DQGA 3J80U 4Q43A 1AB8A 3ITHA 2BDPA 4HBOA 2MKCA 2XCPA 5KFXA 4YFUA 4FYWB 2PPNA 1UVLA 2ZWOA 1LG2A 3ARZA 3ARSA 4NLYA 1M90T 2WLYA 3RUBL 1RUSA 2EC0A 2YKOA 5E7OB 2FVQA 2CPEA 3PFOA 3BO3A 3MPDA 4RW9B 1RAAB 1CPZA 2WVCA 1RT2B 4LAXA 4I2QB 4ZCLA 3LTOA 1Y5IB 3N6LA 2GVZB 1HJWA 2CIMA 3BJYA 2ZHBA 4MK7A 2IAJB 4UOCA 1M5HA 2XS5A 3V6DB 4TY8A 3D1HA 1GTEA 1QAYA 3CD0A 1GXUA 5HMXA 2N82B 4CNYA 3CO0P 2J0XA 2B43A 1Y3JA 4F25A 2ZJPQ 4JI1F 3EXCX 3MPUB 3IFEA 1IR0A 4MSPA 3TVYA 4QPXA 4CCHA 2YKPA 3N9UC 1OPIA 5DM7Q 1OQ3A 2LXIA 1QPFA 2QE5A 2XLIA 2FVSA 2E9RX 3M1VA 2HHSA 4ECWA 5KFIA 5IC4B 1P1TA 2E1PA 3MURP 1S1XA 3D67A 1XK8A 4W98A 4C3LA 3BR9A 3DM2A 4ML4A 4JI6J 5D6GA 3K2YA 1NLKL 2DTJA 2CZ9A 1E6VB 2KXNB 2WVBA 5DDOC 4TNOA 1WNEA 1RT1A 1FKFA 4B9TA 2UXCF 1U47A 2V68A 2RKIA 4EFAC 2PMZD 3O5FA 4USVA 3M8PA 4JI5J 3R2DJ 3VZHA 3MM6B 2W4DA 2DT3A 1U1QA 1YWXA 3W3SA 5IV3A 1RB0A 2FHKA 4PEOA 3LUOA 4LR7A 4DCJB 1AFJA 1WC5A 4Q7NA 1M0SA 1HPZA 4F3QA 3O5KA 3TP2A 4GKJF 4XO0A 3CCZA 4I4BA 3B9EA 4LRFA 1H0IA 1LEOA 4Q45A 3J7AN 2XMUA 3H42A 4K50A 3FFIA 4USUA 4DRPA 4JYAF 4U9RA 1VBKA 5KFYA 4JB8B 4DV4F 2VG5A 4Y65A 5BXIA 4DOZA 3PRAA 1D8ZA 4RO0A 4S3JA 4XIUA 2UUAJ 3CGMA 1RT3B 3M9OB 3LPYA 4WPAA 4MYUA 1VQ5S 1N33J 2BVZA 4IT4A 2G41A 4ZK7M 2A3AA 4O3RA 4IQXA 4A8MP 2E5GA 3TUJC 3Q0AA 1BUXA 3S1TA 1W9UA 3IGNA 1LQ9A 3RBDA 2BYCA 3WBZA 1HR0J 4DQRA 3E2EA 4DU8A 1Y5LB 4R0EA 1CVJA 4ERDA 1UVMA 2XP6A 4C2MA 2R8HA 5HW8A 5A6PA 4Z2JA 2YWWA 2MGZA 4USWA 2QFJA 3J7Z5 1U2FA 2WCXA 4RPFA 3PYGA 2IDLA 4C8OA 1D0EA 3KWMA 4JFMA 2OH2A 2KR7A 2DY9A 2AYBA 3E51A 3B4MA 4LF2A 2FY1A 1ZAWA 2AP6A 1NRKA 4QZVB 4G2PA 2GQCA 2MKYA 1TK5A 2UUBJ 1XNRF 4KQZA 1MROA 4MNJA 3DC2A 3GFHA 4NX9A 1IBMJ 2JDJA 4DG1A 3P45B 4USJC 1FJCA 1MN7A 1XMOJ 2HQGA 3IHZA 3RJMB 1N32F 2B3TB 4QR2A 3CJKA 3OVBA 4IO1A 3PFEA 4OX9F 9ATCB 2Z2MA 1PC4A 4AL6A 2HURA 4DV1F 2OPQB 4OI6A 4P2SA 4KKOB 1S6QA 1RWPB 3JSBA 2DR6A 3G87A 1W7WA 2PMWA 2VICA 1SIWB 2A3BA 1FJDA 4XK8C 2RF2A 4KGMA 3BGRB 1NK6A 1N0VC 3RU0A 3VALA 1QUPA 4RJVA 2F21A 2XP7A 1VRTA 1U4BA 4CQ1A 4DDFA 2AV5A 4PCQA 1KT1A 1VQ8S 3HSJA 2OGUA 5KFTA 4MFBB 2HVIA 3KTQA 1WAWA 2BJDA 2A2CA 3H5UA 2HNZA 3T5LA 3KDOA 2XP3A 2XNQA 2FAPA 1FKRA 2ETNA 3EICA 3A8EA 2CG8A 1S0MA 1NH7A 1X60A 3UPFA 4PG8A 4DX7A 2FHMA 3BGUA 2Y0SD 1GMUA 3BPDA 4L76A 3IA0A 1N0UA 5IXUA 4Z2LA 2FYXA 1IXKA 5C25A 4K4UA 2KT3A 1VR6A 1SC6A 2I5JA 2EFNA 1R0CB 3N4WA 2ALZA 1DQ8A 4DSFA 1RGVA 1F3VA 2C2MB 5DEZA 2MJUA 1HQ2A 2ZH9A 1QE1A 2I9SA 2EKYA 1YJ9S 4Z2HA 4J9PA 4M5NA 4BWMA 5L38A 3GWCA 1UPPA 3M32A 1TQLA 1VC6A 3LP1B 4NLDA 1RTDB 4DL6A 3EZ5A 4DQIA 5GAHU 2J9DE 2HHHJ 3TX0A 1PINA 1WI6A 2XLKA 2GQQA 4B3MF 5B0DA 2FB0A 4DV7J 3MCNA 2ILYA 2FGCA 3R7SB 1S57A 3C14B 2QFIA 2LPVA 1EZZB 3CUNA 1YLXA 3I9V9 3IMQJ 3KJFB 1FEEA 4Q2MA 1NUEA 4EBEA 1I94F 3PKMA 1SB6A 2HHUA 3A3OB 1JLBB 4DLEA 5GMKa 2IIHA 1Y10A 5AE2A 1E6RA 1H98A 2HLTA 1KQGB 1VLOA 3G6MA 3ARQA 2E9ZA 4RW6B 3HJFA 3QSIA 1PYSB 2RDJA 1RKJA 4Y34A 2I6WA 4F4KA 3MEEB 3MMAB 2K3IA 2AQ4A 1R6YA 2F4EA 1NJWA 4MNLA 1UZDA 1RTJB 3LP2A 2PI5A 3RB3A 3HKWA 2VODA 1UWBA 1RAFB 1Q8KA 1F2HA 1Y11A 3H2VE 1YJRA 2OI2A 4E2FB 4MAKA 2PT0A 3ZXWA 4I2PB 1RI7A 2ZD1B 3H20A 3BXWA 5BJRA 4NLPA 3NS6A 3KHGA 3KHLA 2HS4A 2DHXA 4NXNF 2AYGA 4X4QA 3GZ7A 2J8AA 2CDRB 4DWSD 4C8LA 4ED5A 2WHOA 1G7CB 4KV8B 1HBUA 2CWXA 1FKLA 3TEGA 1HWIA 5A8WB 4IFYB 3GJTB 4QYZJ 1HFEL 3Q23A 3HO1A 1KT0A 5LMNF 1S97A 4CIOA 2G0IA 3CJ0A 4RW8A 4TU8A 3EMTA 5IV4A 1O6XA 1KLMA 1HBOA 1HQUB 4I6AA 2GIRA 1NPRA 4RU2A 2VG6B 1RCOB 1NK0A 1RHMB 5A8RA 1PYTA 4C8MA 4K4WA 2HRTA 4N19A 4WK3A 1HW8A 2UVUA 4ZP9A 3DRRA 3KG4A 2XYHB 1LW2A 2JFKA 3HT3A 1NZAA 4OZ3A 1HKMA 2VH7A 4N41A 3PVXA 3CB4A 5I42B 2Y8WA 5IWAJ 2F4FA 3ZTQA 1GUVA 1BQNA 3M2RA 3P5BP 2PV3A 4PYAA 4CO2A 2QL9B 3CDAA 2D41A 2C3PA 1HLWA 3SXLA 1UWAA 4DRHA 4QWEA 4CH0S 1S76D 4PYDA 3CULA 1UVKA 4J7CA 4USTA 3D6FB 2YKQA 2MZQA 4M5LA 4NWBA 3NS7B 4N47A 3CD7A 2YVSA 1WKKA 1B7FA 5KG0A 4DV3J 1JCHB 4TW8A 4TLQA 1K0TA 3I0RB 4A8WA 2V9WA 4JFLA 5C2GA 4DRKA 3WHIA 4AUKA 3MMJA 1S4EA 4W9OA 5KAKA 2RDIA 5GAHI 2RD5C 1LWEB 2F65A 1HMVA 3TNVA 1M5KC 3OTBA 4ZVHA 5HMYA 1NEEA 4L75A 5LXYA 5RUBA 4A8SA 5B0BA 4QW9A 2B51A 3TZYA 2VPXB 5GAGU 4X4RA 2V2KA 3OHAA 4PWDB 2ZZNA 1WC1A 1VRQC 2EI5A 4X4UA 3V6HA 4O4GB 2XCAA 1UFLA 3UNGC 3UCUP 3QRQA 4AXIA 1XTZA 4DSJA 3UQBA 3LGHA 4LSNB 4ZMMA 3QATA 3DOKA 3GJQB 2DGSA 3K8VA 2IVMA 1FD2A 2OKQA 2BKOA 3UVJA 3Q2SC 1JLGA 1HNVB 2WW8A 3MGJA 4TLRA 1X4EA 1FFGB 4CLKA 4J5OA 2DBBA 2B8QA 2VU5A 4NXMJ 1C9HA 3IXQA 1RZMA 5DGAA 4UW2A 5HSPA 4DX5A 5G0RA 2VCDA 1MWQA 1NJYA 2J5AA 3KAFA 3F73A 4URSA 5AXNA 5DG8A 2CFXA 4DV5J 2AZ1A 2EVZA 3FRYA 4O4RA 2XTJP 3J7A1 2JSXA 3B7XA 4P8WA 3WH0A 3H40A 2VPYB 5CYMB 2Q1LA 1E6ZA 2V4QA 3C15B 3KK3A 1JQGA 1TP7A 2HK3A 4JI5F 4LMZA 1VI7A 1PJ6A 2CNLB 1Q4RA 2DKOB 1R43A 1MMLA 3NLCA 1M5OC 2H48B 5HQ8A 4DRNA 1VQ7S 4BWJA 5KG3A 4P72A 2JFDA 3M2VA 4ED1A 1MNEA 4DRJA 3RB6A 2W7PA 4CTAB 4TKTA 3BN7A 2NPIA 1NWRA 2X3DA 4NYPA 3R5JB 1VQPS 4DSIA 3VVUA 2XHWA 2B7CB 3O5JA 2L41A 4CM0A 3OR2A 1RHQB 5C24B 1C1CB 1PSDA 2UUAF 3G82B 4I56A 3MM7B 4UQTA 2DNOA 3MD3A 3QZ8A 1S4FA 3G6VA 1D1UA 1U24A 2XSJA 4RR5A 2B9EA 1S7HA 1MU2B 1VQOS 1N33F 2V34A 3DRSB 2V8VA 2OEJA 4QCLA 3G6LA 4ODPA 4H54A 3TO8A 2RUCA 4ODLA 5DZ7A 1W1TA 4M95A 3AA9A 4IG3B 1ROTA 4MYTA 2YNGA 5HP1A 1DY3A 1FKTA 1LL4A 2LXUA 2ZH7A 1K47A 3UDLA 4KHRA 4XDDA 1TK8A 1HR0F 4C8ZA 3JSMA 4ZVUB 4YB5A 5BYSA 1NJZA 4Z2IA 1U25A 3SDEB 1SUQB 2VN1A 2Y1LB 1IR2A 2FHJA 3L3CA 2O01C 3CC2S 3D9BA 4WXWA 4ID5A 1P27B 3JYTA 2GJ2A 1UL3A 3FRZA 1W2IA 1O8BA 1UFKA 1JLEA 1YJTA 3WQVA 1J5EF 4ZITA 4R5EA 1KOHA 3BSAA 3PEHA 1S9GA 2CJAA 5E2QA 4JV1A 3O5EA 1P8GA 2UUBF 2JEFA 3RRGA 1CS4B 3FSYA 3KXDA 4QR1A 4YR2A 1IBMF 3DOLA 3TYTA 4OZLA 4ZLLA 2NS1B 1X0PA 2YNIA 1RWNB 5KFKA 4M94A 2ZM6J 3POTA 4A8YA 4DPYA 5GAGI 1C0UB 3MXHP 3O2IA 4QIWD 3BYPA 2DPEA 5F8JA 1K8AT 1W26A 5ETVA 1OQ6A 1CJVB 4Q2LA 2I38A 2DO0A 1RT5B 3QIPB 3TEHB 1WI8A 5ETNA 1BD6A 1N88A 3R1HA 1BHNA 3RM9A 2FY8A 2UP1A 2NXUA 2MQQA 3FZBA 5HAOA 3HVWA 4F36A 3SZ2A 4P10A 1SL1A 5KG1A 2R2RA 3SSRA 1RT4B 3HVTA 3QO9B 2DVIA 4CDIA 1L5UA 1VQ9S 3CSKA 1NKCA 4ATNA 5H9FJ 3P8BB 4YY3J 4HI2A 5HW7A 3R5AA 1LOUA 2QRRA 1RWWB 1F9HA 4LBIA 2GO8A 4DQPA 2DH7A 1TKDA 4J4NA 2YH1A 4LF6J 2CQGA 4KY3A 3BPSP 3TZWA 1BY9A 1ZAXA 3PW5A 1LQ0A 2ZHOA 2GQ2A 4QWAA 1KC8T 3OW2R 4F0KA 4X66J 1N5VA 4X4OA 2ZOGA 5DIVA 2KRRA 3GV5B 1IM4A 5D4NA 2KU7A 4GKKF 4Z37A 3PRVA 3DMJA 3PCOB 1F60B 4DR7J 5HJYA 3H0PA 3W2WA 2IC3A 3BF4A 3OPKA 5E3QA 2HHHF 4NA1A 4YEAA 3N5BA 4JFJA 1H3DA 1EP4B 5AE3A 2LXFA 4DV7F 4ZIVA 2AJQA 2MSSA 4TX0A 1WEXA 2W9AA 1VQ6S 4JP8A 1VQSA 3G8QA 4OYIA 3IGVA 1TL3A 5FD1A 1EQ0A 3M4XA 3RB4A 1O0PA 2GHPA 4NLGA 3OQ2A 3OT9A 4JI7J 1Y0OA 1VF8A 4ZJOA 4IOAQ 1FESA 3GG1A 4KH1B 2JC0A 3U1NA 2AW0A 4L74A 2WK2A 1U0HA 3H5SA 4EI2A 2XBPA 3W5ZA 1JXLA 3O44A 2CVIA 3D5MA 2X51A 2Z2YB 1J4HA 1RTIA 2V5HG 4B9SA 1U79A 1C0TB 4ECSA 2Q66A 3UR0A 4P2FA 4S3KA 1JLAA 2YX7A 1S1TA 4YR3A 1XJWB 3UCGA 3I6CA 3NNAA 2R4FA 1Q53A 2BRKA 3N01A 3V2UC 3J7YU 1U6BA 3R7NB 2VQFJ 2QEXS 3ITHB 1FJ7A 1G2EA 3QT7A 1WHYA 2L3MA 3MPYA 4P2XA 4WFXA 3EZUA 3PG9A 3H59A 4BC9A 4R5PA 2MHNA 2XMWA 4MKBA 3PV8A 5B0FA 5IT9Y 3IN5A 4EBCA 4M5DA 1X5PA 4Z2GA 3CNQP 4I7FA 3R6LB 2RHQB 2ITKA 4RNNA 3G6XA 1X4BA 4IRDA 5BXJA 2CJYB 5HN0A 4TY8B 1WSRA 1CSJA 3D6TB 1X9WA 3BGLA 4L6V3 5HUAA 1VIXA 1S5ZA 1FRMA 5K5MA 4W9QA 1WEYA 1UKUA 2DGUA 5KFCA 2CNNB 5KFRA 4CT9A 3M6XA 2JEJA 1OWXA 3A8IA 1FEHA 2WONA 2Y78A 3AXMA 4JI4J 4NCGA 4JUZA 1E6NA 1WELA 5IWAF 3MPVA 3M1VB 1GRJA 3P3DA 3RR7A 3IRWP 1Q6HA 2BW2A 1S1XB 3DM2B 1T9YA 3MCSA 2BR0A 4KGVB 4R25A 1RT1B 4RW7A 2DRBA 1RKIA 3C6UA 2UXBJ 1JLFA 4M63A 2RKIB 1VISA 2CKWA 3I32A 4DEZA 5KFJA 1DLOA 3FCWA 3M8PB 2YXLA 2POKA 1NPKA 1GH8A 2J76E 1X7VA 3NGRA 3OTEA 4DV3F 1N1AA 2W4PA 3AHPA 2KYZA 3EPGA 1HPZB 4O3NA 5E0OA 4ZN1A 4LRCA 7AT1B 1CQMA 3FAPA 2Z58B 1X6LA 3FFIB 2QLFB 1FDDA 3F41A 3NOCA 3LA0A 2IA6A 2VG5B 1CJUA 3SYZA 3ILOA 1H2UX 3SV3A 4X2BA 1IQZA 3BDPA 1NK4A 2HFVA 3VGVA 3UW1A 2VONA 4KE5A 4ETZA 4NLXA 3HXMA 4ILMA 1EQMA 3QFWA 3MM8A 3VGSA 2CWKA 4WKAA 3FSIA 3AOBA 1RAHB 1DFDA 2DJWA 2RUGA 3PY8A 2ZH4A 4TW6A 2B5UB 3ET6A 2AJ0A 2GMJA 4DCPB 1L1PA 1WHVA 3HFVA 5KFGA 3DXSX 2B7BB 1F5BA 1HWLA 1NB7A 3DRYA 4NXMF 3CDBA 4NEZA 4OV6A 4BF8A 2CVEA 2RRNA 2K1RA 1W1YA 2X1BA 5C42A 1T9TA 4KPCA 1RCXB 2G2OA 2ZQUA 2DB1A 4ILRA 1YITS 4DV5F 5L1LA 1ZL1A 2CJKA 3N5FA 3MEGA 4X4NA 3AJDA 1L3VA 1NSKL 3PW7A 3SEOA 5F8GA 3D3BJ 2H54B 3DRXA 3GCWP 2A3EA 2AWZA 2VBWA 3MMCA 3J7YI 2MGZB 2IHR1 2H3EB 2OHDA 3IRXA 3FUYA 3W9IA 1NO8A 3I5AA 3A4TA 2MDAA 4QIFA 3BREA 3TZZA 3S7RA 4K0KJ 4WK1A 2G2ZA 4P71A 3NEKA 5KFLA 1MROB 3DDKA 4QYZK 3PX4A 4XAKA 3L4BC 4DG1B 3IWNC 2DR7A 2HWTA 1JXVA 1KRPA 3CJKB 3MUVP 1IKXA 3FQLA 2HFSA 1OGBA 5DIUA 2AF6A 2EKNA 3BQ2A 3RGCA 1CTNA 3CC4S 4ETXA 2WSFC 4DX8H 1PG5B 1S6QB 3CCWA 3MR5A 1VMBA 4OHWA 2VUGA 1FNXH 1T03A 1XR5A 2BJ9A 3T6BA 1ZBVA 2PI6A 3C16A 2YWEA 4N8NA 3Q8YA 2RF2B 3X3UA 2OSQA 1ZYQA 3NMRA 4A8OA 4FAPA 2AJ2A 1FAPA 3MAQA 1VRTB 4ZPTR 1KLNA 4HH0A 1RADB 4BBYA 2O66A 2WAQD 1H6KX 5KFHA 4QPTA 1VBXA 4KC5A 2I8EA 2KDOA 1VDHA 2O67A 3GFZA 2W9CB 4DL5A 2HNZB 1DQ9A 3MUMP 1N4LA 3R5BA 7FDRA 1HD1A 1X4AA 1JLQA 1GPFA 1VHIA 2E5JA 1VGYA 5KT4A 2HRYA 2F63A 1D2KA 5C25B 2UUWA 2D3O1 2I5JB 4ECTA 4WKHA 1N52B 3KAIA 1OSDA 2XO6A 4RLEA 1QE1B 1RXOB 3KJVA 1NK7A 1FCAA 3M32B 2GJFA 1U1KA 4IPXA 2LQ9A 3ZZPA 2BQ3A 1U48A 4J9MA 3LOUA 2IMWP 4OZ0A 3IG1A 2ATCB 5LJ5Y 2ZM6F 5KTQA 4JOUA 1BQXA 1EETA 1KSPA 2VBYA 1GX6A 3DDNA 1R9HA 2AKWB 3UI4A 2RU9A 2XMJA 1KBRA 4N5SA 2V69A 3CMQA 5A6WA 1SJQA 3GR0A 2A18A 3TUPA 2VD3A 1DZ5A 4OI4A 3KJNB 4KGXB 3W62A 3FNNA 2R7SA 4PWWA 2KYXA 4Y0FA 2LKNA 2R2TA 3O5GA 4OYZA 1U2CA 4AY1A 1AYEA 3IS9A 2FDMA 5KFDA 1BGXT 3QSYB 4QR0A 5MLCV 1X31C 5KOXA 1ZBCA 1NBEB 1FKOA 4Q22A 4MTPA 2HFOA 1ULRA 2J6UA 2DNLA 1JB0C 4O23A 2UUCF 4YY3F 1FFQA 1S9EA 4WFBQ 3LP2B 3DYAA 2ZH8A 2EULA 1E9LA 2MYFA 3FEXB 4AD6A 1RLDA 4OFZA 1UWBB 3A8KA 2H51B 1TUWA 5E3PA 3HZGA 3HHDA 3Q8RB 2CRLA 2QL7B 4UZBA 2GFFA 2KM8C 3TJAA 1TK0A 4TNSA 1XNQJ 5H1SV 2V2VA 3CJTA 1PBAA 3QYYA 4FF4A 3AS0A 4X66F 1YJ7A 3ILIA 4AE5A 3OUYA 3ZNJ1 2FKEA 4DPOA 4ES2A 2ZEJA 2FJBB 3QT8A 1HBUB 3G4SS 2FD2A 7FD1A 4Z7CA 2E9TA 2AOSA 4PUOA 4B3TJ 4DR7F 2DSWA 2FPHX 4ZCKA 2A10A 1Y4ZB 3J80Y 4NLSA 1URNA 4TY9A 3C19A 4ZVFA 5GQBA 4OI3A 1QSLA 4RW8B 1KLMB 1HBOB 1FKDA 1S1UA 5T41A 4CO0A 2GMHA 4WU2A 3GJRB 4ED8A 5A8RB 2G0JA 4Y00A 3RRKA 3OR1A 2M08A 3MPWA 3DRRB 4PABA 1LW2B 1JVWA 4U84A 2DNZA 1YRXA 2QSFA 5A0YA 4JI7F 2IVFB 3DKDA 2MZSA 2QLXA 3CCTA 1SYTA 3GV7B 1K1QA 3FK4A 3PYDA 4MJKA 4LSLA 1BQNB 2HGMA 2QA2A 1UAWA 4U8YA 3M2RB 4DMZA 4ANDA 4IH6A 4F4YA 2VBZA 5C7PA 2R7UA 3VHQA 4JV0A 3VWSA 2X1FA 1M1GA 3CJ2A 5LSLA 4ICLA 3NGTA 4F0HA 2HGLA 1UEUA 2LQJA 3KNGA 2MSTA 1ZA1B 2GA7A 1X9SA 1TFYA 2A6MA 2PFFB 3AFGA 3CJ8A 1PJ7A 4ANEA 3QGGA 5DGBA 2V4RA 1R0AA 1HJXA 4JI0J 2CYYA 3W2VA 4C11A 1KTQA 4OYMA 4TU7A 4GGQA 4URIA 2B4VA 2J7KA 4EYIB 2AMCB 2GGPA 3FBBA 3JYJA 1LXNA 2YNFA 4DR1J 4O3OA 2F3JA 5M2UA 2CQDA 2X1AA 1HMVB 2GVDA 1YATA 2DGVA 1B0PA 4ED0A 3T9NA 3ZTPA 1FTCA 1MSWD 6FDRA 1U1OA 2D3OR 1GOIA 2APOA 2YH0A 4FF1A 3KMSA 1YKWA 3FQKA 1RYRA 2IUZA 1CC8A 4I6WA 1H74A 2VFTA 1VFJA 1XBWA 1FNOA 2R8JA 4MNMA 1RLCL 4IG0A 2ACMA 4NPOA 4O3PA 2B4UA 4B3OA 3DOKB 1ZTWA 3UVJB 1JLGB 3RFWA 2XNRA 2PA8D 1DURA 2HEKA 3EGVA 4RU9A 3CGIA 4JI4F 3L95X 5ETQA 3O5OA 2BX6A 2CPDA 1VIOA 2VF3A 5G0RB 5M2PA 3M8RA 3GV8B 3VTIA 3I4PA 4X4VA 3GYXB 3BKUA 3CC7S 3TI0A 5LM7E 2XWXA 1J4RA 4DJBA 4ANCA 3G6YA 3JSYA 1IKYA 2E1AA 2UXBF 1XWLA 4QIBA 2D3UA 1CJKA 3KK3B 1ZH5A 2DIVA 3OL6A 5CH7B 4K4ZA 3TQ1A 1U02A 4X4PA 1JXEA 2KM8B 1OJ4A 4K2JA 2VKRA 1FD8A 4M1KA 4H4KA 4TYAA 1X5OA 2A2DA 3M2VB 2RNEA 1UW9A 3CXCR 3GIIA 2ZQSA 1HBNA 4ITSA 1XRVA 3QAEA 1ZB5A 2F7VA 2GAGC 3PW2A 3H5YA 1GK8A 2OFHX 1M5SA 3BBCA 4DR5J 4J9RA 3NTPA 4DU7A 3OR2B 1U8WA 2HBRB 2V8DA 4UOGA 3AQUA 4NZ0A 1REVA 2PEBA 3OBIA 4D3HA 3WC2A 5L1IA 1H38A 3SIPB 2HNDA 3H4BA 1W25A 4HR2A 3RTVA 2PEHA 1D3WA 2XSJB 5KFBA 4IYQA 4B9NA 4W9PA 4DZ6A 3JTOA 4OV1A 2VKZG 2XMAA 3NGSA 1Q5VA 4TYBA 2YNGB 5HP1B 4OZ5A 1KQFB 4PQUA 3B54A 4DRMA 5D0EA 3C2PA 4GRSA 3CHEA 4JI8J 2RQSA 3TWZA 1PYOB 3BKFA 1CJTA 3CF5Q 2JLEA 5DG9A 4AT1B 3FCHA 1RSCA 4PKDB 3JSMB 4EWTA 2V4JA 5ETKA 1HI0P 2QIFA 5IM0A 1U45A 3JQMA 4LF7J 2C2OB 1Z2LA 3O5DA 4ZP6A 2V67A 2BQUA 4EUVA 1KTVA 2RUDA 1F5CA 4ID5B 4OHXA 1T95A 2IF4A 3TA2A 3JYTB 3AS1A 2DHAA 1VBYA 3NGDA 4FYYB 2QA4G 3W64A 3VAGA 1JLEB 4DL4A 1HARA 1AXQA 2U1AA 1LL7A 4WU3A 3IKGA 2FVRA 2VQEF 4K0KF 3CPWR 1S9GB 1GQEA 1RAEB 4ODOA 2CJQA 2W2PP 2ZFHA 2OD4A 5F9LA 4HLBA 2MKIA 1JNRB 1NK5A 3DOLB 2AX1A 3D4JA 2VPZB 2J7WA 4NSBA 2JC1A 1ICEB 1S59A 2YNIB 3M8YA 4ECQA 3POTB 4WP8A 3GQCA 3ZZ0A 1U1LA 3LANA 4K5RA 4EBDA 1HNIA 2XGPA 2BW7A 1FKKA 1FO1A 4OZ2A 2EK1A 4ALZA 2WLZA 2YQ3A 4F50A 2Y3YA 1FDBA 5AT1B 3QWPA 3IWLA 3DLLQ 2J0QD 3TUIC 2HSEB 1VS3A 5D15A 3EY6A 4TU9A 3MR7A 3IR6B 4OIXA 1TFWA 4PPZA 3HVTB 1RAOA 5EWGA 2M52A 4LF9J 2LA4A 1KD1T 1SC1B 4MIWA 1WHWA 2D3ZA 3CVKA 4BS2A 3K17A 1EKSA 3ZFVA 4FYXB 2OTJS 3RM8A 1HKIA 1FRKA 1OY9A 2RJZA 4HHJA 4WYLA 1CULA 1P6TA 4JV5J 3KMQA 2PGCA 2ZH3A 2NREA 1A7GE 1Q86T 4ZVGA 4F0MA 1X0FA 1RT7B 2OAUA 4EEYA 2VASA 4ZLPA 2UZAA 1SQEA 4CYUA 4J9LA 3RAXA 4DLGA 5EN1A 3A3PB 1KVIA 1SQGA 4ED4A 5JVGQ 2ZBCA 3RMEA 1SKWA 4HKQA 2W2MP 2FDNA 5IQ6A 1YBTA 4KYZA 3DMJB 3BBFA 2HK2A 4DL2A 2GHWA 5K9FA 4C8YA 1X4HA 3W2WB 2IC3B 3GPKA 1UETA 3NXZA 1CC7A 4ZOSA 1CQNA 3MOJB 1UPMB 2IPOB 1ROFA 4QIGA 5KFOA 1IR1A 2H4WB 4YS2A 2RQMA 1Q8BA 5LSOA 4CO3A 2RILA 2DRDA 2JNJA 2ZHAA 3ELHA 2FUG9 1Q8LA 1T9WA 4CO1A 2ROGA 2IDEA 1TL3B 4F3OA 2VC0A 3MTKA 4ZVOB 4PQAA 2FHOB 2DITA 2B4PA 4IDKA 4DWSA 3FDSA 1KWMA 2HQIA 4NLQA 3CMES 4FYDA 3UNYA 1U0HB 4RL1A 4EGLA 4Y2IA 8ATCB 4DCOB 4DR4J 1DJ0A 4IR1A 4PTMA 3UN3A 2JL9A 1U6ZA 5KG5A 3W61A 2BANA 1JNZB 1RTIB 5LSRA 4Z2XA 2RRBA 2XWYA 2DGTA 1JLAB 2LQ8A 2O3DA 1S1TB 2UXDJ 4KGZB 2J9EA 3H2UB 5HWBA 5DDRC 2EFGA 2LQ5A 2UVWA 2I2YA 4Q0BA 2PV1A 3T1AA 1UVIA 2G8ZA 3MHYA 3I55S 2XGQA 3DNCA 3I87A 5L1KA 2HPUA 2ZR6A 4AQYJ 4R5PB 3T9ZA 3BSNA 1GX5A 2YWFA 1KKHA 4LBPA 2JZVA 3NRBA 4B3TF 2E1RA 4Q8FA 2CQ4A 1RJJA 4M5DB 1L3TA 2RQKA 1HI8A 1ZCNA 4ZCMA 1LXJA 2K7JA 4CLLA 4U67Q 4I7FB 1EQ3A 4IR9A 1HXVA 3UCZP 2ZH6A 1AT1B 3ZZTA 3GYNA 1UA0A 3TAMA 2PI4A 5D8HB 2E7VA 2EFVA 2DG4A 2DISA 4CLYA 2W25A 3ICLA 3MR6A 3NWRA 3GP9A 1AA1B 2ZUGA 4DPTA 1PILA 3IAM9 1NH8A 1MLAA 5DQHA 1RHJB 1YZ7A 1NSAA 4FDFA 1JWWA 8AT1B 4KHPJ 1HNXJ 1HHSA 4Y6IA 4PG5A 1QJHA 2BE2A 2WONB 1P9QC 1ZBWA 1H2VZ 1UZHA 4NCGB 3ETOA 1RBAA 4HT7A 2DR5A 1HKAA 3AA8A 5U47A 2PPPA 4CH7A 1UA1A 1T9XA 1EJ7L 4NRUA 3G96A 1HL6A 2DY1A 4RW7B 2BE7D 3C6UB 1MMNA 1NSPA 1JLFB 3BKTA 2MY7A 1DLOB 1WJ9A 1E15A 1FX2A 2HHWA 2M4MA 1JX4A 4BLGA 1PGZA 4JI0F 1SJ3P 1F8AB 5IFMA 3QZ7A 3W9HA 1HI1A 3R8YA 3THPA 1SH3A 2HHPA 1QTMA 4Q7AA 1ZA2B 1R8AA 2P6SA 3U1MA 3T1HJ 2MKHA 4RNMA 4HH1A 1IJEB 1FWPA 3NBPA 2QSWA 3FCVA 4DR1F 4QOTA 4FPRA 2V2QA 1M1HA 5J2MA 3TJ8A 3K89A 2Q79A 2QJ3A 4DR3F 1UEKA 3R5DA 4FS2A 2R7TA 4USMA 5F8MA 5J6EA 4J9VA 1CJUB 2F40A 1DBDA 2E7WA 4NL5A 2M5YA 3EE3A 3LGMA 1IBLJ 2DYAA 2XP4A 2W24A 1H0GA 2K3KA 1UJ4A 1WC6A 1Y0HA 3MM8B 2WZ1A 5F8HA 4PXDA 2DCLA 2Y9HA 4K7QA 4WTOB 4RZRA 2FJXA 1HWUA 2YQ0A 4CLTA 3ET6B 3H4DA 2C22A 2JH3A 4PPDA 2MLYA 2C2KB 1UJ6A 4CLPA 4DPWA 1N34F 3ARPA 1NM2A 1ZETA 2HZVA 5BYQA 4RW4A 1A9NB 4WFZA 2DHGA 2WBMA 4IQ2A 2PO4A 4MKYA 5CCLA 1H72C 3ISZA 5DM6Q 1FXDA 1IBKJ 2K1RB 3SFUA 5C42B 2CPFA 2ZKTA 3KLGA 1RA6A 4OYOA 1XC9A 1TVRA 2G1HA 4DF8A 3NY0A 3HI9A 4DR6J 2DH9A 2XP8A 2E29A 3MEGB 2GX8A 3EVMA 2BJ3A 1SIZA 3OJUA 4Y28C 2DHHA 1VJQA 3MMCB 2XY6A 5C2CA 2Z2ZA 3IRXB 4LR9A 2DG9A 3MMBA 1NKBA 2IRXA 1TCOC 3SCIE 5HVFA 1AFIA 4J91A 3UI5A 4DZDA 1SC4B 4USHA 2P9CA 3A3NB 2BZ2A 1V6HA 1R0BG 2IJFA 1M5VC 4K4VA 1WF0A 1C4CA 3TR5A 1QY7A 4QWDA 2XG8A 4ZA1A 1KFDA 2CADA 4WE1A 4AFFA 2Y0BB 4DR5F 1EB0A 2IJNA 5T7LA 1IKXB 1NB2A 4J9OA 3WQPA 4CWBA 1TMJA 1GT8A 4N77A 1YDLA 2N7YA 4J9NA 1XR7A 1SKSA 3QGHA 3MOZA 1WORA 1U0SA 2AEMA 1T03B 4K4SA 4LGXA 2LEPA 3EUNA 3C16B 2ZNYA 4LAWA 3BSOA 2L9WA 4J9QA 1LWCA 4P8UA 1TU0B 1RQ0A 1I51B 3BEGB 3SCJE 3PR4A 2RE1A 4WIWA 2BRLA 4OI2A 2CJXB 4FKYA 4Q5VA 4U8VA 2ZDOA 4Z2KA 5DG7A 2MJNA 3R5CA 1Q16B 5KFVA 4JI8F 2V9KA 2R7QA 4K4XA 4MIAA 4CP5A 2EG2A 3OL7A 3CE8A 2AYEA 2OPSA 5HROA 3SFGA 2XPBA 1KONA 1VQYA 5J2QA 3G71S 1JLQB 2MLXA 4LF7F 3DOMA 4ID8A 4NLTA 2FGOA 5DQIA 3CCQS 1X9MA 3OA5A 2JX2A 3MECA 4DWIA 3FGVA 3LO3A 2UZ5A 3K5PA 2AEFA 2L2SA 4HTIA 2EBEA 1ZBTA 3I9ZA 3KJVB 2ZDPA 1WKJA 2PA3A 3CDWA 4LJMA 1E6YA 1CBKA 4DFPA 4I2PA 4IRCA 3AD7C 4B17A 3CCSS 2ZD1A 5HTGA 2O92A 3S8SA 2CQPA 5HLFA 4BC7A 5KFWA 2V8PA 3O5LA 3UI3A 4LFAJ 3HZEA 3IG1B 4FF2A 1SPBP 5J1EA 1YZ6A 3H2LA 1ZBKA 1EETB 3C6TA 1K73T 2IY5B 5HANA 1PAUB 3KLIA 1U1PA 1LKZA 3M6UA 4JV2A 1FK9A 2ZBIA 1NNDA 1IUJA 3BM7A 4OL8A 1SJFA 2YTCA 5LT5A 2DH8A 2FLPA 1YK9A 2GO9A 1WOPA 4U86A 3LWLA 1W1PA 3IS9B 1IX5A 1G6BA 3GSIA 3PRBA 2VV5A 1MWYA 3OTCA 1FKOB 4LF9F 1VLYA 3ALGA 2QZ8A 2PPOA 2Q43A 3UD5A 4E98A 3V81A 5HO4A 1S9EB 2ZKUA 1J5OA 4JV5F 3DYAB 1TELA 2ASDA 2J7UA 3T5JA 2EBGA 3D7SB 3ENAA 2JOQA 4HARA 1KP6A 3AROA 3QBCA 5AXLA 2YX4A 2F8EX 4RBUA 5B08A 3TJ9A 4X64F 1NDPA 2AU0A 3PACA 4H4KC 2P6TA 3RB0A 2UXCJ 2EC2A 3FEYB 3MM9A 1VRUA 3FMBA 2DK2A 4LSZB 2R8GA 4G1QA 1OO0B 1PBKA 3OUYB 5B7WA 3L7OA 2QMUB 3QRPA 1Q6IA 3GIMA 4I68A 4PUOB 1D6OA 2QLBB 1JKHA 3QT6A 3R97A 4G6VB 2WRMA 1QSYA 4ZP8A 4GKJJ 4TYOA 1T8EA 5GADU 1T7PA 2GCFA 3G86A 2ASJA 1NK9A 4LVOP 1S48A 1BLUA 2BA9A 2DEJA 2KHDA 2KO7A 4XPCA 3M05A 3TRGA 3CCUS 3CTRA 3EDQB 2NLWA 3D6MB 2C1EB 2OLWA 5F9NA 5HQMA 1JMTA 1S1UB 1HBMA 4EYHB 3W4RA 2LLZA 4WK9A 3TZXA 4TN2A 2X1GA 3OR1B 3BSCA 3DHXA 1R7IA 5A0YB 1WC3A 2XI3A 1IBCB 1U26A 4RUAA 4P73A 1W9VA 1YIJS 1BXNA 3RYLA 4U6PA 4PRFA 1FRHA 2EFPA 3HSZA 4LSLB 2DXDA 2MQ8A 4GO7X 2GV1A 3Q8QB 1D9DA 4OHYA 3SV4A 2BQRA 4C3KA 3CJ5A 3NKYA 3CCJS 4ICLB 1KVKA 1FKJA 3M9NB 2XQCA 3HCXA 4RBVA 3C46A 2E7XA 3C3LA 2RRAA 2JJ4D 1QLNA 2HLUA 4RWWA 2UXDF 1EAYC 1R0AB 1S6PA 5HBMA 2RB7A 3JTNA 5HW6A 5CA5A 4NCBA 1F9FA 1H0HB 3WZ0A 3KYLA 4LRBA 3W2VB 4MK8A 4C11B 3X1LB 3CCLS 3NGUA 2A3JA 4WFAQ 4NLUA 1WF1A 3HFZB 4DR2F 2GGPB 4B3SJ 4UQGA 3IM9A 5L9XA 1Q0NA 2E44A 2YNFB 1TTHB 1FRLA 1IQTA 5KG7A 4AQYF 4URGA 5D0HA 3ARYA 3GMGA 1YGYA 2GVDB 3TC5A 3FC9A 2YWHA 4JI2F 4GVBA 4NZ6A 3FMWA 1S12A 2P8IA 2DNRA 2M3DA 2R8KA 3K7RA 2RH3A 4KT0C 3OTDA 4YDDB 4HACA 1FD9A 4ECVA 4FXVA 3OXFA 5CZVA 1ZU8A 1SCJB 5MAOA 4CLUA 4JFKA 5F8NA 3UD3P 2PE8A 3V5RA 2YKNA 3UDEA 4IG0B 3NOGA 4DV6J 2CPZA 3OSNA 2WVFA 4B3OB 1A7XA 1VQ4S 2B56A 4UTGA 2M88A 4ZN3A 3DLKA 1JLCA 1QTNB 4KHPF 3WDOA 1HNXF 1REGX 3ONQA 3I6PA 2LKZA 3H25A 4ZVSB 1ZOTA 1TL7A 1N5SA 2C42A 1S0NA 3NRKA 1NMVA 4C8KA 2XP5A 5K8OA 3UWTA 1B64A 3SI8A 1OGGA 2LU1A 2HQ3A 3OTOJ 1AUDA 2FC8A 2EWHA 3OLBA 1S9FA 1IKYB 1HIYA 2LYVA 2C3OA 1FRJA 2MQLA 4U7CA 1CJKB 3B9AA 1D9AA 3KDNA 5DDPC 1EHWA 2F8HA 5B09A 4OQJA 2JLGA 3BO2A 1NCLA 1TAUA 4J9KA 5H9EJ 4HT5A 1HD0A 2BUNA 2KTQA 4P7TA 1OS5A 4YMEA 4KTQA 2EEYA 3OL8A 5HKGA 1RISA 2XY5A 5CXTA 3Q8SB 4DS4A 3T6JA 4IH7A 5I3UA 4FS1A 1HBNB 3BO4A 1GAOA 3T1HF 2XC9A 4FBTA 5IS2A 2Y8YA 2B9XA 3N0VA 3SQGA 2QLJB 5GADI 4FBUA 1UJ5A 3W5YA 5JUMA 4YB7A 2LDIA 2WM0A 3CW2C 2CZVC 1IBLF 4F2RA 2C2DA 3AS3A 2NSCA 1PC5A 2XZDB 3PM9A 1E44A 2RS2A 1RD6A 4WIQA 1REVB 3VR1A 2BJ1A 2QN6B 2HNDB 4DWSC 2PC6A 2DT2A 2HAFA 2GW8A 3DFEA 3SCKE 1R8PA 3K58A 5IT0A 1ZS6A 4JI6F 2DNMA 4QT3A 2OO4A 3OJSA 4PQUB 2E5IA 2M8DB 1BKFA 4LFBJ 4WWSA 1FE0A 4ES1A 2QTWA 1UCNA 3GE9A 1FFRA 1IBKF 2HVDA 3D54A 1FFSB 4KH0B 4Y3CA 1CJTB 4IOBA 2ZR5A 1KNZA 4M5GA 1Q5YA 1JNSA 4P74A 1FHTA 2MQOA 4KRWA 1LFPA 2V4JB 4DR6F 5IM0B 2YBTA 3DU6A 4NLOA 5T14A 3CCMS 2DEIA 4CZCA 2H1YA 1DHMA 3WL0A 1BQMA 5GPGA 2R7RA 2VFRA 1SXLA 2HAIA 4LQ9A 3I5CA 5ETMA 1TUVA 2MKJA 3QOKA 3IBWA 3OVAA 1C1BA 2J8SA 4AL7A 1YBAA 3AJ1A 2F4VJ 3OV7A 2X7IA 2C28A 4J4OA 1LK7A 4OLPA 2YX1A 1UR8A 5EWEA 5DO2A 3BGOP 2WTFA 1NMWA 5ETPA 1WG4A 3OFFA 3GB0A 4N56A 4P8XA 2GHVC 1VK3A 2GIQA 4NXNJ 2AJ4A 5D75A 4EU0A 4N76A 2PIIA 4KBIA 2IM2A 3HSGA 3PYEA 3KG1A 1B0VA 1S79A 4ZDNA 2BXJA 4I67A 4B3RJ 1V3RA 2KB2A 3UN2A 2Z8QA 1A6LA 3QWUA 2FLLA 5K8MA 4W90B 1VQMS 5JH8A 3KK1A 1YRTA 2CNKB 1EARA 2DNYA 3CDEA 1BWEA 2YKMA 1MWZA 2MMYA 2F23A 4PXCA 3CEDA 3O5TB 4F4XA 1SV5A 3DGVA 5GAEU 3FBFA 4P6QA 3UQAA 2QA1A 4ED2A 2BKNA 3GIRA 1CULB 4EO6A 5HT1A 4G65A 2AT1B 4IO9Q 1RWXB 3GIJA 1V5IB 2LP4A 1VBZA 2JWNA 2J6SA 4U85A 1VQLS 4CYUB 5KFSA 2ZJQQ 1WG1A 4ZPBA 3HF5A 1ZK6A 1U8SA 5DRKA 5FLXU 4WCEQ 4KIAA 4L73A 3HHEA 4BHQA 3QRRA 1OPZA 4Y2CA 5HJXA 1XMOF 3UDVA 2MQPA 1FDAA 2ZJRQ 5B0EA 2DSZA 2IM1A 5E33A 3JB9k 4YR0A 1T3OA 3KOAA 1SC3B 4QW8A 1RHRB 2FC9A 3R7BB 3BDEA 4USKA 4MK9A 5LOQA 3IO1A 5I4MA 4LFAF 4I6YA 4B02A 2F9DA 5G4DA 2NQPA 1BL4A 5D4PA 3ALFA 4X4SA 4BCAA 4OYWA 2IA0A 4YN3B 2P4VA 2LECA 4ENOA 3FBCA 2KT5A 4DUZJ 4IQCA 2HZCA 4LUBA 4IDKB 4OYXA 3EGWB 4DWSB 2DPJA 2QF8A 4ZVEA 3CJSA 4LFCJ 4UOHA 1PAEX 4JFIA 5LXRA 1NXIA 2LDYA 4CLSA 3G2XA 4S0MA 3JYMA 4MMOA 2KGJA 2XS2A 5JJBA 2QG9B 1JJCB 4M5KA 3HJVA 2CPXA 3KLHA 2KJVA 3J81U 2E5LJ 3HMJG 5A8KA 1SKRA 3N79A 4QT2A 4YUDA 1YX2A 2BANB 4WIIA 4ELVA 5KG2A 4QYRA 1FKBA 3ZNUA 3LH2S 2HMIA 1LWFA 2ABYA 5CD4A 4K8RA 2BJ7A 2LFVA 4UUWA 3P6YC 2DG3A 1Y7PA 4CLWA 3BQ0A 3CT9A 3TUZC 4Q0BB 2PN6A 5THWA 1T94A 2V8HA 4NYOA 5KT3A 3CCRS 2F5GA 3RRHA 1URRA 3BR8A 3B4DA 1Q6UA 2IRYA 1FNMA 3AJ2A 4PR6A 4NMXA 3V6JA 3PDNA 1HWKA 1TZ0A 2VBXA 3Q2TC 3IWXA 3W66A 3B78A 3I82A 2PDAA 4I64A 3JSRA 4LF4J 4ECZA 3D1QA 3IC1A 4ECUA 3VAJA 1QD1A 1RDRA 3GR1A 4FXDA 3TAMB 2IYIA 4TQSA 3RGIA 4ODQA 3JS9A 2A1BA 1YI2S 2I0XA 3EYZA 2IMOA 2V94A 4F7VA 3TA0A 4UDMA 4YB6A 4B9LA 4F4ZA 2V0NA 4Y2KA 5A76A 2AGPA 4ZVTB 4GVLA 5E3RA 3FJ2A 2BE2B 4RNHA 4ZIWA 5GAEI 2YKAA 2FJWA 3SCLE 4PXBA 3PIOQ 3PXGa 1FWLA 2DRAA 1SL0A 2J6TA 2XZTB 2ASLA 3VCDA 4NOHA 1IKVA 4ZJQA 1PJ5A 4C8NA 3MZIA 4LRDA 3M8QA 4A47A 3RBZA 4OI1A 1Q79A 1YJUA 3MI7X 1OYEA 2JVRA 3D1OA 3KLVA 2PSZA 4R0JA 2EFQA 5KFUA 1AROP 1J2VA 2AEJA 3NL0A 3BH7B 3Q8VA 1T0TV 2VPWB 1XR6A 3I31A 3T5HA 2CQBA 3W9JA 4B3SF 4ZPDA 2XHCA 2VJUA 4OJ1A 4DUYJ 3NBPB 1NMEB 1TFVA 3SSQA 2YY3A 3H7HB 3MM5A 4A4JA 4AXJA 5J2MB 1WHXA 3E8OA 3EZOA 1J5EJ 4HHUA 4N8OA 3K57A 4WP9A 2IM0A 2KI2A 1TV6A 3KJQB 3JXOA 4YQWA 1Q1CA 2B0GA 3QAUA 3A12A 3BV8A 1UW4A 2WVEA 5DITA 2YWGA 2YBUA 3RZAA 2NYIA 2YPYA 2CQIA 2OPPA 5AXMA 3CJQA 2WB1D 1OIAA 2ZH1A 4IFVA 1S49A 2IYGA 1OY6A 1WD6A 2R7VA 1RAGB 3MCOA 2V2ZA 1B4SA 1RYSA 3CD5A 2CQ1A 2KXHA 1WDDA 2VA3A 3HT0A 3FEZA 1NSQA 2PD1A 4DV6F 2BACA 3IR7B 5A2QU 1SH2A 1HQEA 1XIQA 3W7BA 3PRDA 1ROUA 3MDYB 4RW4B 3HFKA 3S6EA 1WDTA 1U1MA 2Z57B 3QLHA 1AZSA 1SH0A 2HQCA 4NLVA 3PTWA 1UFWA 1FJGJ 5J2PA 2MQMA 1UTAA 3N6MA 3KLGB 3R1LA 4MKVA 1ZM3A 1TVRB 5D77A 1S0VA 2CQHA 2WVDA 2LEAA 1RTZA 3OTOF 1TL1A 2IFXA 2PBCA 3HHNB 2SXLA 5K8PA 4M8LA 4H4OA 2ALYB 5AE1A 2L9NA 3TDBA 2E66A 1N5YA 4F2SA 2LU2A 2W9CA 3IM8A 3MMBB 4C0HA 3PW4A 2HYIB 3D68A 5J1PA 3PR5B 3HLUA 2VG7A 1VK8A 4QWBA 1B0TA 2FQQB 4ZS6A 2KN4A 5AJ3J 2C3MA 3MD1A 2QYCA 4A46A 1N5QA 5EX3A 3J81j 3ARXA 3UDCA 2PMHA 4WE1B 1RWMB 2O9OA 1P5QA 4ZPCA 4CRJA 3MAAA 2O1PA 4FXWA 3GPAA 5T7LB 4GKKJ 5DS7A 1IM6A 4HYKA 3JAMU 1GNKA 2M0GB 5DF0A 1NH6A 4WYWA 4L3KA 3K5OA 4ZHRA 4ZVPB 2MPHA 4DROA 4LAVA 2DT1A 2YQ1A 1ITPA 1WOOA 3CWJA 3HVAA 2KFYA 1RHKB 1LWCB 1O6IA 1N6QA 1KR4A 4K59A 4DFJA 4DN9A 4DIPA 5KT7A 3UN5A 1DTQA 3W63A 2Z30B 4OZJA 2GMLA 4N7TA 3M8ZA 2A6OA 4KR0B 2DT9A 1K0VA 3M7VA 2G2YA 5B0AA 2YPZA 4LIWA 4WBFA 4LFBF 2DGXA 2HBYB 4CO5A 1U1NA 1FI4A 1U7LA 2AD9A 2HS3A 4Q8EA 1NDKA 3F0NA 3KUHA 5KFAA 2BM0A 2ROPA 4B9MA 3M30A 1RK8A 2OPSB 2NXCA 5HROB 3PEJA 2QMXA 3VAHA 2L08A 2MKSA 5J2QB 1S99A 1BMQB 4C7QA 4OHZA 3HHLA 4HI1A 1IN0A 3PA7A 1YG0A 3DOMB 4ECYA 2QLWA 4QU7A 2UVVA 4RX6A 2MF9A 2BJEA 2Z56B 3MECB 5K14A 2WSCC 3HDSA 2RURA 1FKHA 2HIQA 3TW0A 4O0IA 2F4VF 1E6YB 1Q1KA 2OPRA 2OP5A 2ASYA 1BC6A 5HLFB 3S01A 4UZCA 4P75A 3R27A 3BBBA 5J1EB 4G1IA 2XO7A 2NUHA 3K0JA 4ZVRB 3C6TB 3OFHA 2VIHA 3UF8A 2ZE2A 3I56S 2MNTA 2FJAB 3KLIB 2R7XA 3TOQA 2RS8A 3O6QA 1FK9B 4KFBA 2IBOA 4B3RF 3GU0A 2ZBPA 3WD3A 2KKHA 3AOCA 4UF4A 4AYBD 3GYGA 1Q81T 4ILLA 3DCAA 3U1LA 3G9CA 3HK2A 1XERA 3LUYA 1LFWA 4ED6A 1Z4UA 3D0GE 1IJFB 5HMWA 1XEZA 3AQOA 1S6OA 5DLGA 3V81B 1HA1A 1RABB 3BS9A 1EHNA 1J5OB 2HFUA 4PG7A 3RW6A 1PIEA 3FZ2A 3OD2A 2HWIA 5JXSA 3DLJA 4X65J 1M5PC 5H9EK 5F0WA 1HKKA 1WB0A 2W2NP 2VB6A 2KFWA 3KAGA 2D69A 1V5VA 1UR9A 3HVRA 3NS5A 5KFQA 4UOFA 3MM9B 3O5MA 1U49A 1VRUB 4ODMA 4Z7YA 3W1YC 2IVYA 1Q78A 3R6GB 4G1QB 1X5SA 3M2UA 1S72S 3KLFA 3EX7B 2MXYA 1F1BB 4DRQA 1HYSA 3DGPA 2FLNA 2CPJA 2KRBA 1JKHB 2HW3A 4OX7A 4OLOA 1NWSA 5KOWA 2GNKA 2B5JA 4K2XA 3K5MA 3M6WA 5I98A 3T5KA 2LCWA 4MPKA 2JLFA 2CQ2A 1SJRA 1AW0A 5DJBA 2R7WA 1EDQA 3V4IA 4O44A 4WKRA 3K5NA 1FXLA 5J2NA 2RUQA 1HBMB 3AD8C 1H7WA 4DUZF 5D3GA 5HWCA 1V3ZA 3AAWB 5HATA 2QV6A 4LFCF 4A8KA 1EYMA 3JTPA 3PIPQ 3VGTA 1PBUA 2N4CA 3DI6A 3EDRB 5FDLA 2OMOA 2E5LF 3QIDA 4ZVQB 2BMBA 4LF6F 1KHWA 4CT8A 1YJVA 5KFZA 2KHCA 4EZ9A 5BR8J 1NZ8A 2DR8A 3Q83A 4YHHJ 3W8PA 1SVDA 4LRAA 4ZCIA 3V6KA 2RHSB 3RAMA 2UU9J 1AUSL 2WBRA 1RBLA 1S6PB 5HBMB 1GXLA 5EDWA 4O0NA 3JQJA 3ULHA 1RACB 4TQRA 4FNHA 6FD1A 1XMBA 1VYAA 2LQBA 1WWHA 2H5IB 3DLEA 2DIUA 4M5IA 2KVIA 3FBEA 2W01A 4ER8A 4NRTA 2JHEA 2VJVA 2G1DA 3K59A 1FX4A 4GVBB 2FIUA 2XY7A 2VFUA 2KH9A 4ZPVR 2VL1A 3CGNA 4IOCQ 4LF4F 2CNOB 4L72B 3N6NA 2W8LA 4HACB 3OXLA 4MKAA 2H4YB 2ESCA 4DS5A 1FA0A 2YKNB 1LW0A 2QT7A 4NLRA 2LEBA 3W8GA 4FNIA 1RTHA 3EWGA 1NAQA 1TAQA 3WIUA 4TW7A 3LP0A 3Q8UA 4ELUA 2U2FA 5FJ4A 5B0CA 3DLKB 1JLCB 2IM3A 2DNHA 2WOMA 4NA3A 3MEDA 2M70A 4F26A 2R2UA 4LR8A 2XMKA 2D9OA 4P9SA 3KK2A 1TUGB 2R2SA 1B6CA 4DT4A 4HVZA 1MW7A 1TL7B 3T19A 5GMEA 2H5EA 2YNHA 1WF2A 3BB5A 5EWFA 4UUXA 1PCAA 3JXVA 1WSVA 4ZKAA 3VAMA 2P9EA 1BE4A 4O3QA 2HG4A 2CPHA 3O3LA 2VQFF 1FXRA 1TKZA 4V1Ak 4OI0A 3R5GA 3VGUA 4MT1A 2DNPA 1O51A 3QT5A 2HHTA 2ZZTA 1FVQA 2XMMA 5E5NA 1N56A 2CZ4A 1VC5A 4P2MA 3G8TA 2C3UA 2MZTA 3THTA 4HDHA 1RU2A 1RP5A 1D9FA 4YDXA 1NKEA 1FTRA 2HS0A 2CJBA 3TARA 2QYGA 1B70B 5I3UB 1ELOA 3KLEA 1Y9OA 2M2AA 4U7UK 4OHVA 4DUYF 1G3OA 2JRSA 5CCMA 1OWQA 3SBMA 5IQQA 5KFEA 5KT2A 3SQGB 2EW9A 3I4HX 1T05A 2UV8A 2WW4A 1YW5A 3EIPA 1Y5NB 4RNFA 3KNAA 5KG6A 2IBKA 4G1PA 1X4GA 4DV2J 5H9FK 4DQSA 4WP3A 1U6FA 2MZRA 2AIRB 1W2BR 1O5JA 3B8SA 4RNOA 1IKWA 2BV3A 2QMWA 1IWGA 4LF5J 3NCPA 1SI9A 1VJWA 2ERRA 5F41A 1QZ2A 2HNYA 3P96A 2YWKA 3L7PA 3DRPA 1N48A 4FVMA 1U09A 1ZPVA 1XMQJ 1H73A 5BYRA 3ISND 2BOAA 3Q86A 5KFNA 4PG6A 2DNGA 3NI6A 1FRXA 2R7OA 2ZVIA 4DPXA 3WC0A 1D7HA 3ENWA 2G13A 2O5DA 1FJGF 2B4OA 2ZZMA 4C6AA 4F4AA 3LALA 1PKUA 1Q7YT 4JYSA 2ZC3A 2ATLA 3DXBA 2ZH2A 4MIBA 4DF4A 4C02B 4URQU 3RBXA 3GFXA 1I3OB 2UUCJ 1BQMB 1NDCA 5JMNA 4MTVA 3GILA 1KFWA 4TXSA 4W92B 1R27B 4PAAA 4DQQA 4DXLA 2Q3PA 3HP6A 1RT7A 4M5HA 5J1NA 1YJNS 1N54B 3D28A 1M1KT 3BYRA 2VOPA 1C1BB 1WEZA 4Y2AA 2HVHA 1FRIA 4I69A 5AJ3F 2N3LA 2W9BA 3FY1A 1RHUB 2OD6A 4WF9Q 3PKYA 2KVQE 2LVWA 4OX8A 1S1WA 2EXUA 5CHCB 3EJMA 3F56A 2P2CB 2V50A 4LF8J 3W65A 5CYQA 5F0UA 1M5YA 3Q24A 3KZ7A 2QA4S 3DLGA 2ZQTA 4RBTA 4H4MA 2K8IA 1T11A 3GJSB 4NI2A 4RUHA 2HIYA 2NZCA 4F8RA 3C8YA 4MGVA 1RBOB 3EXYA 3TCZA 4G3IA 3MR2A 1GMWA 4JBCA 1F3FA 1OYDA 3RR8A 3WD0A 1S1VA 2ZOMA 2VDHA 3TAQA 2B8PA 2RAQA 4DBQA 1N36J 3KK1B 2XS7A 3NCQA 5F8LA 3KACA 3GLJA 1ZM9A 3OHBA 3LQVA 1LNQA 3M8WA 1I6JA 2OELA 3KHRA 5GPRA 2YKMB 3ILJA 3P4UB 3I0SA 1XHGA 3VVTA 1SV5B 5I3PA 3H90A 2OFGX 2OIHA 2IJRA 2D74B 3PYFA 1F5AA 1SJ4P 1YTYA 4R8UA 2VOOA 3E01A 3U02A 4OZNA 2K2PA 3ZO7A 2CG4A 2BABA 3MR3A 3SSSA 1FKGA 3CHCA 3B82A 3ZZUA 1YHQS 1F40A 1R8BA 1KFSA 3HD1A 5ETSA 1GFWB 3CJRA 3VAKA 4RKUC 2NXNA 2L9DA 4HDGA 1ZTTA 1D09B 2CUYA 3LGNA 4A48A 2RVJA 2FJVA 3Q22A 2B6AA 4WTYA 2D1CA 2OSRA 2MPUA 1H2TZ 2X3GA 5EUHA 2KT2A 5HVHA 2HFZA 3ISNC 2ZUAA 2RT3A 4UY8T 5B8IC 3HSDA 3O5QA 4DPUA 3NMAA 3HHLD 2OMLA 1WG5A 1DTTA 3EGNA 1B3TA 4FF3A 4F04B 1FKAF 3IAS9 4KO0A 1FE4A 2DO4A 1SBRA 1TKTA 2DXEA 3H9RB 3GONA 4NA2A 2RQCA 4PWUA 3WL1A 1GXTA 1FKPA 2F8MA 4A8XA 3LPEA 4J9UE 4CO4A 3IP0A 1TKXA 4A8FA 2KFZA 2BOPA 3GCXP 1RAIB 1J27A 3UQSA 4ZLNA 1VHFA 3UR3C 1N8RT 1YQHA 1N5TA 2Z0GA 3KLHB 4ZJLA 1D8YA 1FWKA 1VOMA 4W4MA 4GC6A 5A8KB 4P8VA 4ECRA 4Y2MA 2MKKA 4J9SA 2DD8S 4K4TA 3D2WA 1JNTA 3Q8PB 2Z2LA 4DZ2A 1NPPA 4LAYA 2HMIB 5IT4A 3VV2B 5SZTA 5LMUJ 1JIHA 1LWFB 4X65F 2ACYA 1R89A 1RT6A 4NLWA 4DRIA 1RWUA 1ZZFA 5SUHA 2C2NA 2KG1A 3U7JA 3OXGA 2FZGB 1C2PA 2G0CA 4WZMA 1S10A 2KO1A 3EVOA 3PO5A 1RE1B 5C5JA 2M2BA 2VFSA 5HI7A 4HHHA 2LA6A 3B9DA 2XYPB 4OYAA 4RW9A 1Z1ZA 3UD4P 1J4IA 1RT2A 4I2QA 4WFYA 5ADZA 9RUBA 2GVZA 2M1IA 2IAJA 3NGKA 3ZZRA 3V6DA 2ZVSA 4PXEA 2FVPA 3NP5A 3CIMA 1ZZNA 1HNWJ 2KL8A 2DSVA 2EG1A 3HKZD 2RQ4A 1SKUB 3H8YA 2XLJA 4XPEA 3D3CJ 4IUFA 4DL3A 3K5LA 2MY8A 5HQLA 4C48A 1LJYA 3G8SA 4OYBA 1D7IA 3PHEA 1F2GA 3OLAA 1E6VA 3LWMA 2CJ9A 1R3NA 1IKVB 2F9JA 5BR8F 2VFVA 3HHLC 1XNQF 1NDLA 3G6ES 2RSEA 4YHHF 4GC7A 3M8QB 4DHVA 5EHHA 1P1LA 3ENQA 2LGOA 3EM1A 3CMAS 4QQBA 1NSGA 1MMDA 3MM6A 1WKLA 4AL5A 3I5BA 2UU9F 2C2EA 4NNRA 3VF0B 4YOEA 1FDNA 1FFWB 2HWHA 3OVSA 1HKJA 1YVFA 3R9LA 3ZTOA 3CH9A 2ILZA 3M8SA 3T1YJ 1WOSA 1ZPWX 2FJDB 2CAJA 4NCAA 2XI2A 1F0XA 3MM5B 2C3YA 2NXJA 4TVAB 4QIVA 2NPFA 2Q6CA 3NAIA 1TV6B 2VQEJ 3D6HB 2BE9B 5L8RC 5E41A 3IKDA 4F67A 1S7IA 2CQ0A 3NNCA 4CLFA 2H9ZA 2JZ5A 4GMKA 2OPPB 2W8KA 3L9ZA 4OJGA 1KVJA 5K20B 4X62J 1RT3A 4B9UA 1T3NA 4IFVB 4CH1A 1U2RA 2D9FA 2RIJA 4ZPAA 2MQNA 4B08A 3BMBA 5AXKA 1QAXA 2XEXA 4JI3J 3TA1A 2CQ3A 4HL9A 1ZM4A 2DT0A 2AGQA 1QSSA 3V4MA 1HQEB 2FZKB 4DI6A 4IH5A 3BGFA 3R3TA 2FVCA 2EFOA 1NHUA 3QLHB 1AZSB 1YRUA 4NMLA 1R8HA 2QGFB 5J2PB 4F3MA 3TANA 2RUSA 8RUCA 5GVQA 4P7VA 5M2RA 1TL1B 4WKFA 3KABA 3ADAC 3OFEA 3CJ4A 4H4OB 1NHKL 2AX0A 4DH0A 1N5YB 3PR9A 2N87A 4FPIA 1WNOA 2F2DA 1EKRA 3H5XA 3SQOP 4LF1A 3WD1A 2J0SD 2VG7B 2GJIA 3PX6A 3KFWX 4E8UA 4EMDA 3I96A 2D9PA 1APSA 2JEIA 3EGZA 3IBFB 5CZXA 1R31A 3MAAB 4DZ3A 3WX8A 3DLBA 2OPQA 4IRKA 1HJVA 4KKOA 2HRUA 4ITZA 1HWJA 3O5PA 4ZHRB 2M9KA 3UI6A 1W9PA 4YP3A 2MHEA 2RSQA 1Q95G 4DV2F 2DNKA 1MN9A 3K8WA 2NR0A 4KAIA 3BGRA 1NJIT 5JVHQ 2FHJD 3ARUA 2RDDA 1VQNS 3UQIA 1N6QB 3VQSA 2AJFE 5HMZA 3KUGA 1IWAA 4LF5F 1R6VA 2QO3A 1G4CA 2MTLA 1DTQB 1R8CA 1KHVA 1WACA 1NJXA 3ARRA 2VZ9A 4MFBA 1XMQF 1LL6A 4DSEA 2HHVA 5HBFA 2LJ4A 5KG4A 5CD4H 2MEWA 2DGQA 2ZOFA 3ODKA 4KB7A 2NUUG 3E3XA 1SQFA 4FN2A 2K06A 3M30B 1Q82T 3EPIA 1KQKA 3SMZA 3KKFA 3HHLB 1YSJA 1A0OB 1LWXA 1T02A 3O5IA 4ED7A 2F1FA 2UV8G 4NZ7A 1ZM2A 3UO0A 1GTHA 3MUTP 5KFFA 3L09A 5K14B 4HBEA 2J0WA 5ETTA 3LP1A 1RTDA 2OPRB 2ZBQA 4XTTA 5CYJA 2OJ3A 4I1TA 4WZQA 1DARA 4GIVA 3B8HA 1BWVA 4DL0C 5FLXY 2BBEA 2G9OA 2JVOA 4LF8F 3B6BA 3ILLA 3C14A 2W2QP 4V19J 3HULA 2R8IA 2MZJA 1S77D 2HZAA 2ZE2B 4DV0J 1NWUA 4OYPA 4F4WA 5ETRA 1Q8IA 3VAFA 3A13A 3NCRA 2PV2A 1JLBA 4C97A 2NZ4A 4KFBB 1HNZJ 1F9EB 3ZTRA 3EVWA 1ACMB 3TQEA 2OEMA 1N36F 1V9OA 1B7YB 3NG8A 3IR5B 4M5MA 3C66A 4RW6A 3AOAA 5F3ZA 2KZZA 6AT1B 5F8IA 3GIKA 3MEEA 3JQKA 4LQ3A 3ARVA 3MMAA 3AY0A 4ECXA 4E0DA 2V8GA 3PZPA 4O2TA 4WFNQ 1RTJA 5ETLA 3MTJA 1WTFA 2OFNA 1SL2A 4ZP7A 2AYMA 3QJLA 2HFNA 4KSEB 1GMWD 2XPAA 4R0XA 3H98A 3THVA 1H7XA 5HVGA 3PJXA 3ARWA 3J7ZT 3BH6B 3P49B 2DCUB 1E6PA 2HVZA 3J81Y 3PNIA 5KT6A 2WSEC 5ITHA 4K4YA 3OOBA 4HEA9 2ZNZA 3O1LA 3FXYA 3CHFA 3M2UB 1CG2A 3KLFB 4U96A 1PO6A 2N3OA 4KV8A 4PG4A 1HYSB 2KJWA 4RWXA 3O5RA 3DGPB 5A8WA 4IFYA 4CI0B 3O8WA 4FVCA 4DUTA 3LF0A 3LAMA 2B5JB 5IOLA 1QAIA 3FSXA 1FKSA 3MAHA 3MF5A 5F3TA 2RU3A 3AODA 3V4IB 2V63A 4O44B 1HQUA 2FZCB 4CM2A 4DR3J 4QU6A 5J2NB 2VG6A 1V3SA 2JEGA 2GC8A 3DHWC 2Y1RI 4JI1J 5HK4A 5D3GB 3GSDA 3MWBA 2XMVA 4G50A 5CABA 3ZZYA 2KXFA 1XQIA 5KFMA 2H65B 5I42A 2AZ3A 2E1MC 2HQDA 3DI6B 2ROEA 3TVKA 1JJ2R 5FDLB 4UT4A 2Y1JA 5ETOA 3M6VA 4LT6A 3WQWA 1QDUB 4C9DA 1N34J 1KDNA 2M8HA 2D7SA
chains in the Genus database with same CATH topology
2KFYA 1LWCB 4ZCMA 1O6IA 1LXJA 2CPIA 1JLEA 4FZVA 2K7JA 1N6QA 1YJTA 4U67Q 4I7FB 1EQ3A 3WQVA 4BDPA 3HHKA 1KR4A 1I1GA 2WK4A 1J5EF 4IR9A 4K59A 4R5EA 1HXVA 1KOHA 3GFYA 3BSAA 4DFJA 3UCZP 3AH6A 1DAXA 3PEHA 4DN9A 1S9GA 3PX0A 4DIPA 5KT7A 2CJAA 1DTQA 2ZH6A 1JJ4A 5E2QA 4OZJA 4JV1A 3O5EA 2GMLA 1SR0A 3ARTA 1P8GA 3GYNA 3ZZTA 1UA0A 2UUBF 2JEFA 2KI3A 3TAMA 1QVGR 3RRGA 2PI4A 5EGYA 4KR0B 2B9WA 3FSYA 2DT9A 5D8HB 2EFVA 4QR1A 2KZMA 5LMUF 1K0VA 2DG4A 5B0AA 2DISA 4OJ3A 1NWTA 2W25A 4YR2A 3KCEA 1IBMF 4LIWA 3ICLA 3MR6A 3DOLA 2Z4PA 3TYTA 4LFBF 3AB4B 4OZLA 2DGXA 4CO5A 1U1NA 2NS1B 1U7LA 2K8GA 3NWGA 4DSLA 1X0PA 2YNIA 2HS3A 2ZUGA 2AD9A 1DRZA 1PILA 2KE0A 3IAM9 5KFKA 4Q8EA 4M94A 1NH8A 2IRUA 3POTA 5FIIA 1Q82T 4A8YA 2LMIA 3KG0A 5DQHA 5KFAA 4YB1P 5GAGI 1JWWA 3I0RA 2BM0A 2ROPA 4B9MA 1C0UB 3MXHP 3M30A 3O2IA 4QIWD 1RK8A 2OPSB 1NHVA 2DPEA 3PEJA 5HROB 5F8JA 1HHSA 2L48A 2QMXA 4Y6IA 1K8AT 4PG5A 1QJHA 2L08A 2BE2A 1W26A 2WONB 1P9QC 2MKSA 3VAHA 1OQ6A 1S99A 2DGOA 3UFCX 5D4OA 1ZBWA 4Q2LA 1H2VZ 2DO0A 2I38A 3DLEB 3HHLA 4HI1A 4OHZA 4C7QA 4NCGB 3ETOA 1IN0A 1RT5B 4HT7A 3PA7A 1YG0A 1LWEA 2DR5A 1QVFR 4ECYA 3AA8A 4C0BA 4DFMA 2QLWA 3QMQA 5U47A 3QIPB 3WD4A 1WI8A 4QU7A 1J6YA 4IT6A 1BD6A 4W5UA 2PPPA 2MZ1A 4RUCA 1FVSA 1N88A 4CH7A 2UVVA 4RX6A 3R1HA 1UA1A 2MF9A 3RM9A 2BJEA 2UP1A 2NXUA 2MQQA 4NRUA 3FZBA 2J9DA 4KGKA 3MECB 1L3KA 3HVWA 4LVNP 2ZR4A 5K14A 3G96A 1HL6A 3SZ2A 1SL1A 2KG0A 3D0IE 1CEZA 2Q6BA 2WSCC 3HDSA 4RW7B 5KG1A 3VAWA 2RURA 3C6UB 2R2RA 1MMNA 1FKHA 2ZITA 3SSRA 1RT4B 2FTRA 1JLFB 2MY7A 3HVTA 3QO9B 2HIQA 3ZZZA 3T3FA 3TW0A 4LIRA 4PWDA 1FERA 4O0IA 2DVIA 2F4VF 1DLOB 1E6YB 1Q1KA 2OPRA 2OP5A 2ASYA 1L5UA 1E15A 1HNWF 2DHSA 4O4GA 1VQ9S 2Q5AA 1BC6A 3CSKA 1NKCA 4ATNA 4X84A 5H9FJ 5HLFB 2HHWA 3NNHA 2M4MA 1JX4A 3S01A 1PGZA 4JI0F 4HI2A 4KPYA 4ELTA 3HX9A 4LSNA 5HW7A 1LW0B 1SJ3P 3CIZA 1F8AB 4DR4F 3R27A 5IFMA 3R5AA 1RTHB 3QZ7A 1HI1A 5J1EB 1YJWS 3P5TL 1LOUA 2QRRA 1HNVA 4G1IA 2XO7A 3THPA 2NUHA 1SH3A 3K0JA 2HHPA 2WB4A 2GO8A 3C6TB 3LP0B 1QTMA 4Q7AA 3OFHA 3UF8A 2ZE2A 3I56S 2MNTA 2FJAB 1R8AA 2P6SA 4DQPA 3KADA 3U1MA 2MKHA 2DH7A 4RNMA 2WOMB 4DL7A 3KLIB 4HH1A 3MEDB 1IJEB 1TKDA 3NBPA 4J4NA 2R7XA 5LL6d 2QSWA 3TOQA 1UVJA 2YH1A 1FJEB 1L3UA 2CQGA 4DR1F 4QOTA 4FPRA 2RS8A 3KK2B 5J2MA 1BY9A 3O6QA 1FK9B 4QBUA 2Q79A 4KFBA 2IBOA 4B3RF 1ZAXA 2YNHB 3PW5A 3WD3A 4DR3F 3R5DA 4FS2A 1LQ0A 2ZHOA 1UEVA 5DETA 3VZIA 2GQ2A 4QWAA 2R7TA 2KKHA 3OW2R 1KC8T 3HVAA 5F8MA 5J6EA 2XZWA 2ZC4A 4AYBD 2W7AA 4ES3A 1Q81T 1N5VA 4ILLA 4X4OA 2F40A 2ZOGA 3DCAA 1OSCA 3U1LA 5CQGA 1VC0A 1DBDA 5DIVA 2E7WA 2M7SA 4ED3A 4NL5A 3G9CA 2A3CA 2KRRA 2M5YA 3LGMA 3GV5B 3HK2A 1TKZB 1IM4A 5D4NA 1ITXA 1XERA 2KU7A 4GKKF 3LUYA 2ADCA 1LFWA 5A2QY 5CYMA 4ED6A 2XP4A 2W24A 2DNNA 1Z4UA 4Z37A 1H0GA 4MNKA 2K3KA 1Q7LB 1UJ4A 3D0GE 3QJJA 3DMJA 4B9VA 4EO8A 1Y0HA 3MM8B 2NR0A 1IJFB 4OZ1A 4PXDA 2DCLA 5F8HA 5HMWA 1F60B 1XEZA 2HHQA 3AQOA 3W2WA 2CDQA 2CQCA 2IC3A 3BF4A 3OPKA 4RZRA 2CPYA 2FJXA 5E3QA 1HWUA 1S6OA 5B0GA 2HHHF 4NA1A 5DLGA 4YEAA 3N5BA 3H4DA 3V81B 2C22A 1HA1A 2JH3A 4PPDA 4JFJA 2MLYA 3BS9A 1H3DA 1K9TA 1EP4B 5AE3A 2LXFA 1EHNA 4IKAA 3OL9A 1UJ6A 4DV7F 1J5OB 4PG7A 3QPIA 1N34F 3RW6A 2AJQA 2MSSA 2DNQA 4TX0A 3FZ2A 4OX6A 3NAHA 3ARPA 1WEXA 2HWIA 2W9AA 1ZETA 1VQ6S 4NZCA 1RAJA 4C0OC 5BYQA 4J37A 5JXSA 4CTAA 3DLJA 4RW4A 5IZHA 1A9NB 3HPOA 4WFZA 3KLEB 3T1YF 1VQSA 2DHGA 2WBMA 2K7KA 1X4DA 3QGPA 4IQ2A 2PO4A 1M5PC 2MLZA 4D3GA 3G8QA 4MKYA 4EZ6A 5F0WA 5CCLA 3IGVA 1TL3A 4OMFG 1LK5A 5FD1A 3ISZA 5DM6Q 1FXDA 3DU5A 1HKKA 1WB0A 2K1RB 3SFUA 2VB6A 5C42B 4QWCA 2KFWA 3KAGA 3M4XA 3RB4A 2CPFA 3MFIA 1C4AA 1UR9A 1O0PA 3CJ3A 3HVRA 3NS5A 2ZKTA 3KLGA 1RA6A 2GHPA 4NLGA 5KFQA 4UY85 3OQ2A 1XC9A 3MM9B 3O5MA 1TVRA 4DF8A 1VRUB 4ODMA 1U49A 2IVYA 1Y0OA 1VF8A 3HI9A 1Q78A 1T05B 4IOAQ 1WTBA 4G1QB 1FESA 1X5SA 2DH9A 2XP8A 3GG1A 3M2UA 4QIEA 5C24A 1S72S 2E29A 3MEGB 1JJHA 2GX8A 2JC0A 2AWGA 1SIZA 3U1NA 2AW0A 3U27A 2MXYA 3KLFA 3EX7B 1C1CA 3OJUA 4Y28C 2E1CA 3TAPA 2WK2A 3MM7A 4X62F 2KFNA 3H5SA 3MMCB 4DRQA 1HYSA 2XBPA 3DGPA 3FVYA 2XY6A 2FLNA 2P9GA 2CPJA 1JXLA 3O44A 2KRBA 1JKHB 2HW3A 3IRXB 1MU2A 2DG9A 3MMBA 3IK8A 2CVIA 4OX7A 1IKWB 4OLOA 3WKZA 3D5MA 2X51A 3DRSA 3AS2A 4C98A 4X4TA 1NWSA 2IRXA 1NKBA 1KN6A 1TCOC 1J4HA 5KOWA 3SCIE 1RTIA 2GNKA 2V5HG 1AFIA 2B5JA 4K2XA 3K5MA 4JI3F 3UI5A 2P5VA 3M6WA 4B9SA 1QUVA 4USHA 1U79A 2P9CA 5I98A 1C0TB 2BZ2A 3T5KA 2LCWA 4MPKA 2JLFA 2CQ2A 4IG3A 1V6HA 1SJRA 4ECSA 2Q66A 2IJFA 3UR0A 1AW0A 5DJBA 1M5VC 2R7WA 1EDQA 4S3KA 4K4VA 1JLAA 1WF0A 2YX7A 2HNYB 3JAMY 3V4IA 4O44A 4WKRA 1S1TA 4YR3A 1NU4A 1C4CA 2VA2A 3DRPB 3UCGA 5HL7Q 3I6CA 2VC1A 3TR5A 3NNAA 3K5NA 1FXLA 5J2NA 1QY7A 2R4FA 4QWDA 2XG8A 1X6NA 4ZA1A 2RUQA 1KFDA 3KHHA 1JNEA 1HBMB 1Q53A 2BRKA 3N01A 4WE1A 3TVZA 3V2UC 4XDCA 3J7YU 1H7WA 1U6BA 4AFFA 4DUZF 2QEXS 2DR9A 1VQKS 5HWCA 3ITHB 5D3GA 4MAVA 4DR5F 1V3ZA 1FJ7A 3AAWB 2IJNA 5T7LA 1G2EA 1IKXB 4J9OA 1WHYA 2L3MA 3MPYA 1KOOA 3OFGA 1GT8A 2QV6A 1Y3KA 3VQTA 4LFCF 4N77A 2I1RA 3SDEA 1S0OA 1D7JA 1SUQA 4WFXA 4A8KA 3EZUA 1EYMA 4A8QA 3H59A 3JTPA 4BC9A 3PIPQ 2N7YA 4R5PA 2MHNA 2N4CA 2XMWA 3DI6A 4J9NA 1XR7A 1SKSA 3QGHA 3CDUA 1UVNA 3MOZA 4MKBA 2N4DA 3CHDA 1T03B 1DQAA 5FDLA 4K4SA 3PV8A 4LGXA 3GG0A 2LEPA 5B0FA 3EUNA 3RBEA 4ODKA 1EIBA 5IT9Y 5I3QA 2ZNYA 2OMOA 3IN5A 2XP9A 1JNDA 1X5PA 4LAWA 4Z2GA 1KHWA 2L9WA 3QIDA 4M5DA 3BSOA 4CT8A 4J9QA 4ODNA 1X4CA 3LW5C 1YJVA 5KFZA 1LWCA 3MDFA 4P8UA 4K5SA 1RQ0A 2KHCA 3SCJE 3BEGB 2R9LA 1FKIA 3PR4A 1KS2A 4I7FA