4ZPVR

Structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 2)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
208
structure length
208
Chain Sequence
b'VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D12 Fab Heavy chain
publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein/immune system
total genus 45
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zpvR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zpvR01
5DO2A 4L72B 2AJFE 2GHVC 4ZPVR 3SCIE 3D0IE 4QZVB 4ZS6A 3SCKE 3BGFA 4KR0B 4XAKA 2GHWA 4ZPWR 4KQZA 4ZPTR 2DD8S 3D0GE 3SCJE 3SCLE 4L3NA 3D0HE
chains in the Genus database with same CATH superfamily
3O5MA 4Y2MA 2BMBA 1LL7A 2OMOA 3KFWX 4TW6A 4CT8A 3I5AA 2E29A 3ZFVA 4YUDA 1L3TA 4KHPJ 2ZBRA 2EPIA 1SXLA 1NJWA 3TNVA 3WD1A 1U1QA 2OSRA 3CEDA 5I3UB 4LREA 2B9YA 4A8OA 3ARWA 1ZS6A 3H5YA 3RRHA 3I0SA 2QLFB 1ZM2A 4OYOA 4PXDA 3NNHA 3CIMA 4P8UA 5GADI 5IV4A 1SIWB 4ZA1A 4JFJA 2QSFA 1WF2A 3NCRA 1AZSA 3MFIA 2ZOGA 4J91A 3P8BB 1LNQA 2QMUB 1FKOB 1B0TA 4R5EA 4DUYF 2DITA 4B9LA 3PZPA 1NWSA 2DNZA 5KFRA 3HP6A 1IBKJ 2V8GA 4KE5A 2D69A 2DXDA 2DNMA 1A7GE 3D6MB 4K4XA 1UJ4A 3O5KA 3JSMA 5DLGA 4CH1A 4CLYA 2RUSA 1FRXA 2B9EA 3MMAA 1SH3A 3PX0A 4WIWA 4GGQA 1HBMB 3U27A 2VBYA 2BR0A 1FKBA 1AA1B 1JLFB 2JLEA 3W65A 4ZOSA 1S99A 1U47A 4JI5J 2ZH9A 3VAIA 3T1HF 2GIRA 3TARA 2KM8B 2HHXA 3ISNC 4LRDA 1B64A 1FKHA 4WTOB 3NGUA 2D7SA 3P4UB 1F5CA 3QO9A 2DNGA 2UZ5A 2NR0A 4Y6IA 3CD5A 2GHWA 1TP7A 1PILA 1NLKL 3A8EA 1FKDA 2OGUA 1TKTA 2A6OA 1N5QA 5KFZA 5KFOA 3RR8A 4LJMA 2P9EA 1I3OB 2LQ5A 4X4SA 1FDAA 4DL3A 5F8NA 1GTHA 4IQCA 3W2WA 2XS5A 3KAGA 4M5NA 3G6LA 1HNVA 4F04B 4AQYJ 2RSEA 2IPOB 3L7PA 1SC3B 4CLTA 3J7YI 3Q0AA 2F4EA 3W66A 5LMNJ 3NGTA 3GG0A 1X4AA 5A2QY 3B4DA 3IR7B 1LW0A 1C1BA 1NJXA 2H4YB 3QOKA 1E6RA 4P52A 2QMXA 4DV1J 2GA7A 3KUEA 3MF5A 1NDLA 2YQ0A 1WF1A 4OV6A 3AOCA 2WLYA 3KLEB 2JZ5A 3NKYA 3S8SA 1N6QA 3RR7A 3DOKB 2JLFA 2VG7B 4JV0A 5HANA 3A4TA 2C2KB 4GO5X 4ZVSB 3OJSA 2RVJA 1ZA1B 4RBUA 2RIJA 3CNQP 1RADB 1FRLA 2F63A 3KJVA 3MAHA 4XDCA 5SZTA 3V6JA 4QIFA 3MECB 3RBXA 1U79A 1TMJA 2CJQA 2Y3YA 1QE1A 1BL4A 5GMEA 2PPPA 4ILMA 2KJVA 2XMJA 1M0SA 3HT3A 2C2OB 2OFNA 3MEKA 3CCZA 2BUNA 2KU7A 1Q53A 4L6V3 2AYEA 1P5QA 1NDCA 1JWWA 4KHPF 3OR1B 1JQGA 2D1CA 4DCJB 2F40A 2FJBB 1OSDA 1CG2A 4AT1B 1WI6A 5F8JA 3AD9C 2XMUA 5LJ3Y 2FDNA 2I9SA 5K14A 4B9TA 1SJ1A 2C3MA 4FF2A 1ULRA 2X3DA 4M95A 1LL6A 2V2VA 3N9UC 1CULA 3EDQB 2B56A 4LF5J 4F25A 3UI5A 2HNDB 2M70A 4DN9A 3NL0A 2K8GA 5KFHA 2KXNB 3OLBA 2HGMA 2DR5A 1RTZA 4ZHRB 1FNMA 1HKAA 4FXDA 2VBWA 1FTRA 2DGSA 2V8HA 3ARZA 3PYGA 4K4WA 3AT1B 4DLEA 4C8NA 2O66A 5JXSA 5HMYA 2M7SA 4F4WA 1VQNS 1H73A 4Z2XA 4F4YA 1WOPA 1QPFA 1RAJA 7FD1A 3PVXA 2XI3A 3I96A 3DXBA 2AMCB 3D28A 3ETOA 1N36F 2OPSB 1KSPA 1HYSA 5HQ8A 2FPHX 2UXDJ 1LW2A 2CPIA 2VG6B 3VCDA 4P75A 3VAWA 4K8RA 2WTFA 3M8QB 5A6PA 2RKIA 2IDEA 5J2PB 4LQ9A 5LXRA 3I9V9 2KFWA 4E98A 1S7IA 1ZA2B 4WYWA 1FAPA 1HI0P 4MK8A 1S79A 1JB0C 1TMMA 2DSVA 2AX1A 1DY3A 1YRXA 2DGTA 3Q89A 2XP9A 1WACA 2MKYA 2R7OA 4QZVB 4HDGA 4DV3J 1N5TA 3W5XA 4HT5A 1C0TB 4WXWA 3KDOA 4I4BA 1WC0A 3KKFA 4E8UA 1GXTA 1KBRA 1UEVA 2VN1A 2ZHAA 1DLOA 2GMHA 2XP8A 3K2YA 2YTCA 2YKOA 1VRUB 1NCLA 4RBTA 3D2WA 1PYOB 2IM3A 5EWGA 4CO0A 3JAMU 1FJDA 4DEZA 3K59A 2QFJA 2BW2A 2HFSA 1CS4A 2HNZB 3DI6B 3OFHA 4DV1F 4OZ5A 4OJGA 4F4KA 3O5DA 2FZGB 4NI2A 3K89A 3KHLA 3K7RA 1UA0A 3VAMA 1F5AA 1RZMA 3FBFA 2XZDB 3POTA 3A8KA 4J9OA 3GYGA 2ZR5A 2QE5A 2Q43A 2WVBA 2K06A 4DV0J 3VZIA 4LR7A 1Q79A 2OEMA 4CNZA 3SDEB 2F23A 3AODA 1YJ7A 1T03A 5A8WB 3M1VB 2B3TB 3DGVA 1S0OA 2VCDA 3MR2A 4F3MA 4CP5A 1EP4A 1FKPA 4YQWA 3IA0A 1LFPA 4F02A 3EWGA 2DNKA 3V6KA 2AZ1A 3H25A 1LJYA 3ARPA 5GPRA 2ZQUA 2QA1A 2ROEA 3QT6A 4RLEA 3ETMA 5HJXA 1UVLA 1HJXA 3GYNA 3O5RA 4J9VA 3GSIA 1EHNA 4L72B 4IQMA 2YNHA 4ES1A 1X9WA 1X4DA 3DN9A 3WD3A 2W8KA 1B0PA 5DIUA 2UUCF 2MKJA 3RM8A 1S1VB 1RT4A 3DM2A 3M9MB 3UVJB 2BQRA 5GPGA 3KABA 1N4LA 4CTAA 3WQWA 2FJAB 4FZVA 3TZWA 1H2TZ 2VHGA 1H0IA 3UD4P 2GIFA 1N34F 3FRZA 3TA1A 4RW4A 1KQSR 1YBTA 5DG9A 1RT2B 2XLJA 4UZBA 1TKDA 3MM6A 1W1PA 2H65B 5D4OA 3BS9A 3ITHB 4B3SJ 4USIA 2XHWA 4AFFA 5KT3A 3EXYA 2X7IA 1SH0A 1FKFA 3HHLD 5F8LA 4EGLA 4L73A 4WWSA 2EFGA 2B4VA 4PQAA 4OX9F 1G7CB 4WU2A 3FCHA 3FCVA 4DI6A 2QC3A 3UN5A 1RTIB 1Q7YT 2MZQA 1VHIA 4DBQA 2B7BB 3KK1A 3KLVA 3TZYA 2YWGA 1OY9A 2UUTA 2ESCA 1RHJB 1XR5A 1MU2B 2J9DE 3IBFB 2O92A 4ZLNA 2HQIA 2IM1A 3N5BA 2WONA 3PEHA 3OSPA 2FHMA 3BN4A 4ZITA 3F73A 2Q1LA 4KFBB 4YY3J 4S3KA 4CIOA 2UXDF 5BR8F 3KMSA 4C8MA 2N82B 3PACA 4C3KA 4OIXA 1REGX 4X62J 2E5GA 3SQGB 1GT8A 1S6PA 2KHCA 1OWXA 2WAQD 2C2ZB 3RM4A 3RBDA 1KQKA 1R8AA 1SV5A 5IM0A 1VHFA 5LSLA 5KFTA 2JL9A 4LF7J 3GQCA 1WHVA 2XP3A 3G82B 1HMVB 3SQOP 2GV1A 1NH8A 2OFGX 3MURP 1P27B 4JI3J 2DHXA 5L9NA 1FJCA 4DV3F 1KLMB 1K44A 4QW8A 3I0SB 2BQUA 2PV1A 1WG1A 2YKQA 1IQTA 4NZ6A 4GKJF 2L2SA 4NCGB 2RF2B 3TYTA 3R5DA 1SC1B 1NWRA 3SMZA 1NDKA 2GIQA 3N79A 3E8OA 4DWSB 1MWYA 3UI6A 4BWMA 1AZSB 3G87A 4O3NA 1QAIA 5KFJA 3ZZYA 3CCMS 1JLEB 2MKCA 3PA7A 2AJQA 3GIJA 2HFVA 2YWEA 4NLTA 4RW9A 1R7IA 3TJAA 5CXTA 4HDHA 2YQ3A 3MAAA 3AS0A 1BD6A 5IC6B 4DR4F 4E0DA 4FAPA 3HHLB 1R0AB 3D3CJ 2F8EX 3VVUA 4PR6A 3FSYA 1EZZB 4F50A 1UFKA 1REVB 2UXBJ 3CWJA 2WW8A 2GAGC 2LMIA 4KPYA 4Q7AA 3CJKA 3B9AA 1WC6A 3LUYA 3MD1A 3C14A 4TU7A 1FE4A 2HVEA 3MTJA 1HNIA 5BXJA 3OLAA 2OD6A 3TANA 1GMWA 2HFNA 1GPFA 3DLGB 3LGMA 1T9UA 3S6EA 1FCAA 4ZK7M 5K5MA 1T9VA 5ETTA 5A8KB 4D3HA 1MN7A 1UVNA 3M2VB 5D6GA 4NCAA 3DRPB 2A18A 2YVSA 4TU9A 1AUDA 4IT4A 3AB4B 3GWCA 4J37A 4MTPA 4JOUA 3PX6A 3Q86A 4NYPA 2MSTA 3G8TA 2OH2A 2MY7A 3JXVA 3V4MA 5I42B 1IBCB 1VLYA 3JYTA 1XNRF 4WP8A 4Y2IA 4DR5J 4NPOA 4X64J 2B51A 4LF1A 4ES2A 3IM9A 4LGXA 4I2QB 1R3NA 4K2XA 2XMVA 4LAYA 3IO1A 2QT7A 5HROA 1HARA 5DZ6A 2LJ4A 1VQ9S 3MPUB 1ZL1A 2LA4A 4DROA 1H7XA 2ZH4A 2DSUA 4HACA 4P2FA 3OL7A 1GRJA 4CRJA 4RNOA 2IJNA 2OEJA 2BABA 1EQ0A 2KVIA 2VC0A 4ED5A 1IKVB 5FLXY 4U7UD 2NXNA 2VPXB 1WKLA 3UDEA 5GMDA 4Y00A 4F8RA 2EKNA 1B70B 1NHUA 1EQ3A 3EVOA 2M0GB 4PAAA 1HWJA 4OHXA 4DFKA 4DX5A 3V4IB 4LVOP 3TZZA 3LO3A 1IBLF 4WTYA 4WIQA 5HN0A 3OXFA 5H9EJ 4HTJA 4D3GA 2UXCF 1R6YA 4YY3F 4W92B 2KYXA 1M1HA 3IP0A 2CUYA 1FF2A 2GMJA 4U9RA 3ZTPA 4X62F 4BC7A 4U7CA 1KRPA 3V2UC 1RT7A 2G8ZA 3QRRA 1H7WA 4DL7A 2AU0A 2O9OA 2MQMA 1RA6A 4O3OA 3QT5A 3NRKA 1IM4A 2NSBA 5KG5A 4DR6J 2ERRA 5CD4H 1R43A 5J2MA 1N33J 5KT7A 3KYLA 4RL1A 3I5BA 3ARRA 1RTJA 1P9QC 2OPRB 4J9PA 1WEXA 5D75A 1S1WB 2KRRA 3HK2A 2BANA 2VU5A 5C24A 3CJ5A 1RWXB 2PEHA 1QDUB 4H4MA 2BE7D 1L3VA 3T41A 4ECRA 3CJ0A 3I56S 4I6YA 1X5SA 4QPTA 4FN5A 3R7NB 3BBFA 2IBKA 5D8HB 2WVEA 1FKJA 4YB1P 1FHTA 2MB0B 1RHRB 3E51A 4HHUA 4NLRA 2MEWA 1WI8A 2JFKA 5THWA 2AGQA 3GR0A 3VR1A 4PQUB 2FIUA 5AJ3F 4NXMF 3MPWA 1UA1A 1SQGA 4LF4J 2W2QP 3FKBA 2ZZTA 3H20A 2KH9A 3EXCX 3TRGA 1B4SA 2XI2A 1QVGR 4LT6A 3KK2A 4U85A 2I0XA 2O67A 3A1YG 3OTEA 1V9OA 1IN0A 2CRLA 4EBDA 1TVRB 2O1PA 1HYSB 2R7WA 5H1SV 1NK9A 1BQMB 1U8WA 3FC9A 2CG8A 3M32A 2A3CA 4NA1A 3D0HE 3QWUA 3UN2A 1C1CB 1HQEB 2DEIA 2KZMA 5G0RA 3OJUA 1QSLA 1NUEA 1FVQA 4K4ZA 5LOQA 2PIIA 4H4KA 2W9AA 4ATNA 2QGFB 3SFUA 3LALA 2NXUA 4MSPA 4PWDA 4O3RA 3CCSS 2HQGA 4IQXA 2EG2A 3US5A 1NM2A 4C8ZA 2G9OA 1LXJA 3PXGa 4N41A 4AL6A 3UCZP 3UR3C 3BXWA 4H54A 5CHCB 5J2QB 4IQ2A 4CWBA 2AT1B 3PO5A 3HKZD 4DR5F 2B6AB 2IAJA 4X64F 2ZM6F 3SCIE 3MEEB 3O6QA 2UVRA 2ZOFA 2I6WA 5EDWA 4Y0FA 1VQKS 1O0PA 5HMZA 4DR3J 4Q5VA 4MGVA 1BUXA 4NRUA 4ERDA 3PIOQ 1V3SA 4NLQA 3OFGA 1UEUA 3GILA 1HFEL 5FJ4A 1ITXA 3TUJC 5KFFA 4DRKA 5HJYA 1ROFA 3KLIA 3JXOA 4QT2A 1YBUA 1YJ9S 3KXDA 3KNAA 3W9HA 1CQMA 5HW6A 2AJ4A 1D6OA 4DR1J 1Z4UA 4C2MA 6FDRA 2R7XA 2KKHA 3L9ZA 3AROA 4CCHA 1BWEA 3KAFA 2DISA 2P6TA 2RU9A 4AUKA 4PYDA 4LSLB 2HBRB 4N77A 4LR8A 4YDXA 3PKYA 2OLHA 1XBWA 1JLQA 3ARTA 3NWRA 2KB2A 4IH7A 2AEFA 5KT4A 4QT3A 1FXDA 2F8HA 1HBOB 4QJVA 4F3OA 4FPIA 5JVHQ 1E6VA 5HBMA 1TKXA 3BZQA 4I1TA 4LAXA 3O5IA 4UQTA 4DR6F 4DV6F 1HJVA 3KJNB 1KHVA 4RUBA 1Z1ZA 4ZVEA 5B8IC 3FUYA 3I4HX 1VCTA 3WHIA 1OJ4A 3QYYA 1HA1A 4LF2A 4QIBA 4HKQA 3BEGB 5A76A 2VOPA 2BKNA 4UUWA 2Z58B 2GJIA 1JIHA 1VBKA 1L5UA 3TUZC 4IR9A 3KHRA 3RBEA 2ZR6A 2HWIA 3UDCA 2V5HG 2BBEA 3MHYA 4XPEA 1X4FA 2NREA 1R0BG 4C0BA 1YWXA 5CCMA 2NPIA 1T0TV 3M8WA 3EPGA 4ZVPB 5T7LA 3AJDA 4ECSA 3A3PB 2HHVA 1ZPWX 4N8NA 1WF0A 1LWEB 1WDDA 3ARXA 2FLLA 2R2UA 4LF4F 1U0HA 4FF3A 4LSNA 2WVFA 4IFYB 5IXUA 1RAGB 5LMUJ 4QIEA 3D68A 2CZVC 2HHTA 5DQIA 2KFZA 3FEYB 4EBEA 4KH0B 1FKAF 4B3RJ 1FXRA 3RZAA 1SL2A 2W4CA 2DJWA 5KFVA 5IZHA 2M08A 4I67A 1UW4A 1W2BR 2J0WA 5J1EB 4KHRA 1TK5A 2VFRA 4DSFA 1K1SA 4K5RA 3OFFA 2RE1A 3SCLE 3M9OB 1H0HB 2W9BA 4A8SA 5CH7B 2V8DA 2CJYB 5ETVA 3N5FA 4NZ7A 5GAHU 2IY5B 2M52A 1NK7A 4HBOA 4ODPA 4IOBA 3PJ9A 3W63A 4ED2A 1Y7PA 3HPOA 3A13A 4USMA 1S1TB 3BSCA 2WSCC 2VKZG 2CPXA 2Z8QA 3RTVA 5DO2A 1LQ9A 1KNZA 3MMCA 1H3DA 1WELA 2MYFA 2SXLA 3CJ4A 2LQ8A 3CMQA 3DRYA 3EZ5A 3WC2A 1QSSA 4JV1A 4QW9A 2PI4A 3DDKA 3SXLA 1FRJA 3LP2B 1C4AA 4OJHA 3RU0A 1RUSA 1OYEA 3CC7S 3ZZPA 2JC0A 2HK3A 4M8LA 2CQBA 3DLEB 4XIUA 3HVTB 3M6UA 4DR3F 3GG1A 4A8MP 3TUPA 2PBCA 1Q78A 1WDTA 1RAIB 1GAOA 2MDAA 4C9DA 3R5GA 3BSNA 3E3XA 1IKXA 4AYBD 4DV5J 3BGRA 2RDIA 4IRDA 1FKKA 1F9FA 3V6HA 4EYHB 4O44B 2DIUA 4XPCA 1ITPA 2AEJA 1SVDA 2W2OP 3LPYA 1TUVA 4DR1F 3PW2A 1YZ7A 3CGMA 2QLXA 5BYQA 4LF8F 2RD5C 4DSKA 4WFZA 1XRVA 1IKYA 5GADU 2GJ2A 1KVIA 2YNIA 3JQJA 4K4TA 3ZO7A 1S6OA 1D0EA 3D0GE 1Q8KA 5D4PA 2FVSA 2CJBA 2H1YA 1AFIA 1HNIB 3T1YJ 3DDNA 1A0OB 1GMUA 4B3MJ 2ZBQA 4WKFA 4WP9A 3BQ1A 2GW8A 3NGKA 2J6TA 1YDLA 3NWGA 1UVJA 2Y1RI 2DRDA 1XWLA 1BXNA 2M4MA 2VG5B 4I6AA 2OO4A 3U1NA 3LTOA 2C3PA 5JMNA 4TY8A 2R7QA 4W98A 3JB9k 2AHOB 3M05A 3UFCX 3HD1A 2DRBA 2P6SA 4DX8H 2EFQA 1RB0A 5HTGA 4I7FA 2CZ9A 3ARSA 1JNSA 4PUOB 1RT1A 4NRTA 1W9UA 4PPDA 1NEEA 3PR5B 4AE5A 2W9CA 4ZP7A 3FNNA 2G4BA 3M30B 3PHEA 2LVWA 3RM9A 1T95A 1X7VA 5KFCA 4DL5A 4BDPA 2B9XA 3KCEA 2HVDA 1RWPB 4P7TA 2EC0A 2WRMA 3QBCA 2QRRA 3AQOA 1S49A 2IM2A 1AFJA 2V2KA 4TKTA 3FSXA 3M6VA 3MMBB 3NY0A 1CJUA 2HBQB 2J0SD 1CQNA 2YXLA 1FK9B 4H4OB 5RUBA 3TZXA 4Q0BA 4MNKA 2NLWA 3CSKA 3I31A 2ZUGA 3VHQA 2W01A 1ZM3A 3C16B 3QATA 4MIAA 1PC5A 1NSPA 3AJ1A 3BMBA 2XPBA 4P8VA 3DOMA 3J7YU 3B4MA 4B3RF 1S77D 1CJTA 3QIPA 2FY1A 4N76A 2Z4PA 4EI2A 2XY6A 3M8ZA 2X1FA 1R89A 3PRBA 2AWGA 5CABA 2MQPA 5B0CA 1JLGB 2MTLA 5F8HA 1JMTA 2WSFC 2CPZA 1U1LA 3FQLA 4EFAC 1O6IA 3VVTA 2RT3A 1HR0J 2XLKA 1U24A 8ATCB 2OLWA 3MI7X 4ECZA 2RB7A 3GTYX 1IKWB 1R27B 5B09A 2VOOA 1K9MT 2ZQSA 1Q8BA 2F1FA 1RCOB 5D3GB 1CTNA 3EGWB 4ILRA 2VBZA 2YNFA 4HARA 2MMYA 1B0VA 4RX6A 3UN3A 4KIAA 5HVHA 1Y5NB 3ADAC 2JEIA 4JFKA 3DRXA 1L3UA 2HIQA 1H2UX 3VGTA 1WORA 2BX6A 2YNGA 2MGZB 4DV5F 4FBTA 1LK7A 1VC0A 1WB0A 1W9VA 5HAOA 1KP6A 2YBVA 4WYLA 1CJVB 2QSWA 4JI2F 2MXYA 4FDFA 1WG5A 2VDHA 4DL2A 1S76D 1TELA 4X84A 1JNZB 1JLCA 3I4PA 3MTKA 2H5EA 3OTCA 1GQEA 3H7HB 4NLVA 2HBYB 3CDEA 3FZBA 5D0EA 1NAQA 5KAKA 4BBYA 2QFIA 3M4XA 3M2RB 4B3MF 1MN9A 1FRMA 2A1BA 1IUJA 4EWTA 3LP0A 1F1BB 3V6DB 5E3AA 5DEZA 4WU3A 1ZTWA 1R8BA 1TR0A 3C66A 3JQMA 2L9WA 4DG1A 2J7KA 2I2YA 2Z56B 3A8IA 4HHJA 1ZCNA 4OZLA 4QCLA 3H0PA 3QPIA 1TKZB 5ETSA 5B0GA 4LFBJ 5AE1A 3ILIA 3HSZA 5KT6A 1SJRA 1HQUA 3SV3A 1SH2A 3EZOA 2ZUAA 1BQNB 2GO9A 4RW7A 1XNQF 3BKTA 1B99A 2BZ2A 3GJTB 2A3AA 4HVZA 1YRTA 4G3IA 3BGOP 2QYGA 2WVDA 1H98A 5KFBA 1RTDB 1SIZA 2A10A 2BE2B 2HRYA 4JI8J 3LANA 3GJRB 1IR1A 2CVEA 2YPYA 4LF6J 2NYHA 1AXQA 4EO6A 2G2OA 2V50A 2U1AA 2R2SA 3EVWA 1U45A 5I3UA 4LIRA 3W8GA 2IUZA 3CJ8A 3GB0A 1QY7A 1T3NA 1FJ7A 2MHNA 2P2CB 2OP5A 2JDJA 5C7PA 3DFEA 3IK8A 1L1PA 4KV8B 1RD6A 1TUGB 4V1Ak 2RRAA 1UEKA 5L8RC 4YS2A 3GIIA 3H4BA 3M6WA 3GFHA 1RBAA 4ECQA 4NLGA 2AYGA 4OI0A 1UKUA 1UR8A 4HYKA 3S1TA 3VGSA 3J81Y 4ED4A 3KLFB 2G2ZA 5AE2A 1SI9A 5HVGA 3IG1B 5B0FA 3PO4A 2MQ8A 1YIJS 2M3DA 3G8SA 1WHWA 2QA4G 4ZMMA 3U02A 4UOFA 1DQ9A 2H3EB 1Q82T 1S9FA 4KTQA 2UUWA 2GQQA 3UWTA 3EPIA 2YKNB 2KXHA 1HBMA 3BGLA 1X0PA 1E6PA 2ACYA 1JLFA 2EC2A 4F26A 1ZU8A 5DQGA 3BBCA 3TA2A 1VQPS 2HK2A 4HEA9 2KO7A 5AE3A 3R27A 4CM0A 2E9TA 3UR0A 1N52B 4QR2A 3HXMA 1NKCA 1ZBTA 5I4MA 3SI8A 2B8QA 5DDPC 4DUZF 2LKNA 4H4KC 2LXFA 4ZPCA 1U49A 3EIPA 3W64A 2HGLA 4M5HA 3CZ8A 4S3JA 2L48A 2R8GA 4KKOB 3MM7B 4OL8A 5T7LB 1RXOB 1KLNA 4AY1A 3QIDA 4HR2A 4F0KA 1NH7A 3IR6B 3Q8RB 4EYIB 2IHR1 2FZCB 1S1XA 4KO0B 3ODKA 3R3TA 4LSNB 4N47A 4X66J 1FRKA 4MFBB 3KMQA 2CQIA 5M2UA 4OZ2A 2MKHA 1T9WA 4JBCA 3OTBA 4ZPAA 1XK8A 4B02A 4JYAJ 3CJTA 6AT1B 1U6FA 1KKHA 3IHZA 4A8XA 3RMEA 2R7RA 4WZQA 5CZVA 2AD9A 2EFOA 2QG9B 4EZ6A 4A48A 4FYWB 1B7FA 5H9FJ 4LRFA 4X65F 4TYAA 4DRNA 1HL6A 2XP6A 2R3VA 1B6CA 2W9BB 4Z37A 4OLPA 2VG7A 2IA0A 1HW9A 2BXJA 2ATCB 1E6NA 2D3O1 3KHHA 4DPWA 2HHPA 4DR2F 2XZWA 4NE9C 1U4BA 4LFBF 1L3KA 1X9MA 4Q43A 5F0WA 3HJFA 4FN2A 1ZBVA 4LRBA 3C6TB 3CCES 1GXUA 4WF9Q 1TQLA 2BKOA 3MECA 4G1IA 5D0GA 1UPPA 4LF9J 2HHSA 3WD0A 4DIPA 5A8RB 4AXJA 4OI1A 5IQQA 4JI8F 2QN6B 1GOIA 2WW4A 3OR1A 3RGIA 1BLUA 1NK8A 1HW8A 1X5TA 2L3MA 3AD7C 2JZVA 3VAJA 3QGGA 1NHVA 2VQFJ 4QR1A 3Q22A 2JH3A 4N8OA 1SJ3P 3CMES 3PRDA 3HFVA 1O8BA 2XYHB 4DRMA 5AT1B 2FC8A 2R8HA 1K1QA 4QYZJ 3CIZA 2MNTA 4ZVFA 2HVIA 2HMIB 1RKJA 2WBRA 3FEZA 5KFKA 2KG0A 3G6YA 4P2MA 3ZZ0A 4ZHRA 3Q8SB 1YI2S 5CAAA 4B9MA 3KJQB 3ICLA 1YSJA 5CZXA 3IRWP 2R7VA 4IH5A 3LWMA 1N48A 2DGQA 2CJKA 5J2NB 2MY8A 2K7JA 1AW0A 2KI2A 4P7VA 4AD6A 3BDPA 3OQ2A 1U1NA 5KOXA 3G6VA 4P2XA 2FAPA 2OPSA 3MZIA 4ECVA 4X4UA 2LA6A 2YWKA 4W5UA 3ZXWA 5IFMA 4MYTA 4LFAF 4YMEA 2CQGA 4XDDA 2ALYB 1AUSL 2HSEB 2VG6A 2PA3A 2X1GA 2VFVA 1VQ8S 2B7CB 5HQMA 3M8QA 5I3PA 5CA5A 5J2PA 2OFHX 4YR2A 4ANDA 2ZQVA 2W24A 3PFEA 1N8RT 2ZNYA 2N3LA 2ZC3A 3DDIA 1HQ2A 4UY8T 3WKZA 2YBTA 4U95A 3NGRA 1J4RA 2BRKA 5MAOA 3MOJB 2XEXA 4WKAA 4ZVRB 4OHWA 3C2PA 2NCKL 2YKMB 5EWFA 2RURA 1VIXA 2KYZA 3M6XA 1CJUB 1X5OA 1C0TA 1F5BA 1T94A 2IRYA 3RRGA 3OSNA 2FLNA 4BF8A 2AV5A 1MNEA 3MDYB 4BS2A 2FVCA 2A2DA 1VRUA 3UI4A 2ZOMA 3M2UA 3BGFA 4NZCA 2H4WB 1U25A 3JSYA 1OY8A 4AL7A 3QT7A 1HPZA 3EM1A 4PG6A 3BGUA 2DIVA 2XCAA 2HNZA 2X1BA 3DGPB 3SFGA 2FJXA 4USVA 3DI6A 1U8SA 1XIQA 4DUYJ 2XP4A 2PA8D 3O5JA 1ZM4A 4GKKF 4UOHA 2XMWA 2COLA 1WC4A 3T9NA 2ALZA 1SKRA 2VA3A 4ANEA 1PJ7A 1Y0OA 2HLUA 2UU9F 5DRKA 2NSCA 4ODKA 4CZCA 2B5JB 1X6LA 3CGIA 1RHUB 3AQPA 3OBIA 4CYUB 4JI6J 3O5LA 3SDEA 4RNMA 2U2FA 4BWJA 2ZD1A 3CCUS 1Y9OA 5DGAA 3IKDA 5A8WA 1HKMA 2JEGA 3MAQA 3M1VA 2EFVA 1URRA 3K0JA 4C8KA 1FKRA 1LG2A 4LF9F 3J80U 4ZPWR 5LL6d 4ER8A 1FDDA 3RAMA 4DLGA 1S1UB 4DFMA 4DJBA 3T1HJ 5I3QA 2KT5A 1TV6A 2HRTA 1M5KC 4NSBA 1NZ8A 2Z2YB 3D9BA 2Q66A 4EZ9A 1S6QB 3NS5A 4PXEA 3GPAA 3VGVA 1XMOF 4MAKA 1A6LA 1GK8A 1FVSA 2FVRA 3NNCA 4Y2AA 2CDQA 1YATA 1FT8A 2HHHF 1NMEB 1FI4A 3D1OA 4K4YA 5KFUA 3VAGA 2Q3PA 2PSZA 2EVZA 4FPRA 2VQFF 1PG5B 1S1VA 4Y34A 2DNPA 3UVJA 1D7JA 2MQLA 3OW2R 5KFWA 2IVYA 1N88A 2ZHOA 1RT2A 4FVMA 3EX7B 1KQGB 4DQRA 4GC6A 1FJGJ 2C2MB 4FBUA 3VQTA 1CC8A 3ITHA 4NLOA 2F9DA 4Y65A 1MMNA 3MGJA 5HSPA 2HWTA 1KT1A 3TO8A 1S9GB 2CKWA 1BY9A 2UVVA 3NCPA 1UL3A 1RWMB 2C2EA 1RTIA 2YWWA 1Q1CA 3NS6A 4B9NA 2ACMA 4J9UE 2KI3A 3CJ3A 2WCXA 4CO3A 1HBUB 3G4SS 4B9SA 3K5NA 1MU2A 1RHMB 3R6GB 3N01A 2CVIA 2AJ2A 3HM9A 2B4OA 3UD5A 4KFBA 4C8YA 2ZR4A 2J7UA 2ITKA 1BQXA 1U1MA 5F8MA 3SQGA 5C25A 3ZTQA 4OJ1A 2B9WA 2HZAA 2XBPA 2J7WA 5LM7E 5KFGA 3QLHB 4GVBA 3MMJA 4WKHA 3MCOA 4HH1A 5DG8A 2WLZA 4USWA 3IBWA 3DU5A 3G82A 1HMVA 1UP1A 4ZCKA 2XZTB 4OZNA 2PPNA 1RGVA 5BYRA 4FP9A 1FEHA 2XNQA 2XY7A 1NB7A 2R8JA 3MXHP 4DQPA 1QUPA 3FBEA 1KLMA 2NPFA 1OO0B 1EIYB 4N7TA 3T5JA 2PD1A 2D3ZA 2WVCA 4IO9Q 1XERA 4NCGA 2RF2A 4NYZA 5AXNA 1X8DA 2HS0A 3BJYA 4ZLJA 4DWSA 4B9UA 4ICLB 1LOUA 3DRRB 1RQ0A 2LXIA 4OLOA 3G2XA 2E1RA 2D9FA 1JLEA 2EFPA 1LWCB 2XC9A 3BO2A 3R5AA 3KJFB 4ODRA 4YB6A 1XR7A 5A6WA 2RSQA 2KN4A 4WBFA 3CE8A 3HHLA 4WFNQ 5ETLA 1R0AA 1WNOA 1OY6A 3TX0A 2RHQB 1G4CA 1REVA 2KDOA 2YBUA 2GHVC 4JI6F 1Q6UA 4R5PA 2OTLS 1N36J 5KFAA 5K8MA 4IG0B 2J8AA 2BOPA 4ZVUB 3KAHA 1PBKA 2LECA 1WUUA 3RRKA 4W9OA 1HKIA 1YKWA 3DLGA 3R97A 1FFRA 2DNRA 1X4HA 4C3MA 3BSOA 4M63A 2ZITA 2LU2A 3W5YA 3O5EA 5A8KA 2MSSA 3M2VA 1VC6A 3FY1A 3I9ZA 4ELUA 2FGOA 3DRPA 1IVZA 3K17A 2E5JA 2VODA 2N7YA 4HHHA 2ZE2B 3B54A 4G1QB 3FDSA 3AOBA 5I42A 4A8KA 1J5EF 2OTJS 4Q22A 2Y1LB 2HRUA 2CXEA 3H40A 2JHEA 2P5VA 3OA5A 2Z30B 2BOAA 4CDIA 2QJ3A 2GMLA 2XYGB 1S1XB 4I2QA 3R2DJ 5LXYA 1RWVB 2XS2A 4R25A 3CJRA 4OX8A 1Y5LB 1R8CA 2B43A 4DPTA 3Q83A 1FJGF 3ZNJ1 4DOZA 4X4QA 3R1LA 1SUQB 4DXLA 2NXJA 2JSXA 2LU1A 2ZNZA 3PW7A 1XR6A 2DBBA 2Y0BB 3KLHB 1IKVA 2JRSA 1I5OB 2NYIA 2DVIA 4KR0B 1TL7B 3HHKA 4OYBA 1X5PA 1QAJA 4CLZA 1ZAVA 1WSVA 3AS2A 3EGNA 1AB8A 4ZCMA 1TFYA 1LEOA 5A0YB 4J9MA 3HVRA 2D9OA 2DR7A 3CCWA 2M9KA 3V4IA 4MIWA 5U47A 2AJFE 3UD3P 1KOHA 4P10A 2IM0A 1LL4A 5JVGQ 3LQVA 2YX1A 1HJWA 3I0RB 4NX9A 1C0UB 2DGOA 2VD3A 5DIVA 3IM8A 4ZJOA 5FD1A 3MEDB 1VMBA 1WHXA 2E1PA 1PKUA 2YPZA 2BJ9A 3NBPB 3CMAS 4DZDA 3CDUA 3OD2A 1Y10A 1QTMA 4ED1A 2KHDA 3U1LA 4DFPA 5JUMA 2CQHA 5HLFB 3GSDA 1V5IB 3DMJB 3TJ9A 1SL1A 5ITHA 1ZBCA 3D3BJ 4IYQA 1KHWA 1S10A 3LUOA 5HMWA 4GC7A 1HWKA 2DPJA 2AP6A 2V9KA 3AB2B 2CQ2A 3ARVA 5LJ5Y 4DQSA 3OT9A 3ZZRA 2G1HA 4RUAA 3GCXP 2HGNA 2PE8A 2UUCJ 2BACA 2OPRA 3HFZB 2KVQE 1IR2A 2RQ4A 1S1WA 2YKAA 4JI1J 4JFIA 1U1PA 1DBDA 1XMBA 4YOEA 1N34J 1VQ7S 3M8PA 4YR0A 2KM8C 4K2JA 1ZAWA 1EX8A 1NWTA 1KFWA 1QPLA 2UP1A 1VRTB 5GMKa 4LIWA 1R9HA 2VBXA 1NJIT 2R2RA 4YB7A 4TXSA 3WL0A 4ZVHA 4WE1B 2XY5A 4DR7J 2AKWB 4K59A 4OX9J 2LKZA 1T7PA 1JXEA 3MR5A 1XC9A 4PQUA 3AS1A 1HKJA 3FVYA 2W25A 1QD1A 2DPEA 3MM5B 2DR9A 3LH2S 2WB4A 3CF5Q 3KZ7A 1MROB 3HSGA 2I5JB 4CO4A 1RWNB 1DFDA 4DS5A 1TVRA 3QJLA 1OQ3A 3UQAA 3PJXA 1BQMA 2ZVSA 1UFWA 2C2DA 4LRCA 3UNYA 5BR8J 1HBNB 2KZZA 2GVDB 2MLYA 4NLPA 3S7RA 1ZETA 1C1CA 1HQEA 3T3FA 4DPYA 2ZJRQ 4PG7A 4UQGA 2J6SA 2QIFA 1MMLA 4NLDA 4ZJLA 3FQKA 1RK8A 4DF8A 3IWXA 1RLCL 3EMTA 1EKSA 1R0CB 2QYCA 3LA0A 3GU0A 3O1LA 4A46A 4ZVQB 3IWLA 4KQZA 4CLKA 1R8HA 4G2PA 2XHCA 4PWUA 1T11A 1W2IA 2RNEA 3SSSA 4RZRA 4OI3A 3P45B 3MPYA 1RAHB 2OKQA 3IKGA 2OHDA 3BF4A 3LW5C 4E2FB 4M5DB 3H9RB 4Z2IA 5A2QU 5J2QA 5CYMB 2HG4A 4G50A 2B6AA 2Q6BA 3MEEA 2IJRA 4LBIA 3IAM9 2ZQTA 5AXMA 4GKJJ 1NSGA 2QLWA 3DHWC 4DZ3A 4R0EA 1ROTA 3M2UB 4A8WA 4DMZA 4QIWD 5EUHA 2N3OA 3PYFA 5KFMA 3MEGB 2V67A 2AJ1A 1HPZB 3DYAB 4Y3CA 4UY85 3H2UB 4QPXA 1U1OA 2PI6A 2K1RB 2VH7A 3PCOB 4QR0A 2WOMB 2M88A 4WP3A 4ZN3A 2ZH7A 3LOUA 4DR4J 1VQOS 2DYAA 2RUGA 1U2FA 3ULHA 4OJ3A 3CPWR 1RYSA 1TL5A 4LMZA 5JJBA 3TVKA 2EFNA 1HWUA 1WTBA 2DG9A 1Q6HA 2B0GA 3A3OB 2CQ0A 1FO1A 4OYWA 2XGQA 3NI6A 4LSLA 2ZD1B 2G1DA 1HD1A 4P73A 1N0UA 3DLJA 4OHYA 4ZS6A 2Y8YA 1WWHA 1LK5A 4AL5A 3RBZA 3BYPA 5DS7A 1EETB 5L1LA 4MNLA 1GEHA 4P9SA 1HBOA 3HD2A 3EYZA 3VGUA 1TV6B 1OPZA 4I2PB 1S4EA 2Y8WA 1WJ9A 3EICA 2KG1A 5DG7A 1GMVA 2DO4A 5HMXA 5KG6A 2MKIA 1LWFA 5DDOC 4RUHA 4OI6A 2K8IA 2ZBCA 3K8WA 1FKTA 3D6TB 1XNRJ 1JK9B 3OVSA 4YEAA 4IUFA 4HL9A 2A0FB 1RAEB 3PY8A 4JI1F 2GNKA 3K57A 4B9VA 4U7UK 3MM8B 1XQIA 3QGIA 1URNA 1M90T 4OZJA 2LGOA 1V6HA 3AH6A 2DT0A 2VL1A 4K4VA 3JYJA 1QLNA 1IWGA 1SQEA 1NU4A 4U8VA 3BPSP 5D78A 2RILA 4USTA 4OHZA 2B5UB 1H2VZ 1T9XA 4WFXA 4DR7F 1JLAB 1LWEA 2CDRB 1S57A 4PG8A 4M5LA 1QAYA 3PYDA 4IFYA 5KG1A 1RHKB 1IBMF 5F41A 5J6EA 3HVWA 5B08A 3CCRS 3KK3B 1GX5A 4I6WA 1OWQA 3ET6B 1O5JA 1D7HA 4B17A 2N87A 5L1IA 5E5NA 2DT3A 1IBLJ 3CHEA 2EG1A 1U26A 1OGGA 1C4CA 2UXCJ 1H74A 4A4JA 3UF8A 3PNIA 1DZ5A 2PT0A 2ZH3A 5EN1A 2NXEA 5J1EA 3UQBA 4WK1A 3C8YA 3WIUA 4DL0C 2BEFA 5C25B 2CQ4A 1QSYA 2ATLA 5KOWA 4WFYA 4DV4F 4IT6A 1NPKA 1FFSB 1M1KT 2DGUA 4GVBB 3D6HB 1ZTTA 1K8AT 1IX5A 2JJ4D 3X3UA 1Q95G 4NEYA 1S1TA 4TYOA 3ENVA 2LDYA 3RYLA 3SCJE 3WDOA 2GAHC 4DPUA 3S01A 3GONA 2F5GA 4O23A 1IWAA 2O5DA 3DRSB 4G1PA 3K5MA 3GR1A 1RSCA 1IM6A 2KTQA 1UAWA 4QQBA 3M8SA 3PKMA 3LP2A 2R42A 1NSQA 3DLEA 3HULA 3HVTA 2CQ1A 4K0KF 4FNHA 3PDNA 2J0XA 4IOCQ 3FFIB 3ARUA 4KBIA 2UVWA 4FXVA 1QAXA 4IOAQ 4K5SA 1M5SA 4MKVA 1PIEA 4O44A 4Q2LA 4NEZA 1S72S 3G6XA 1EIBA 3WBZA 3G8QA 5AJ3J 4ZP8A 4NXMJ 2CPYA 4K4UA 2ILYA 1T05B 1Q6IA 2Z2LA 4PG5A 2EI5A 4Q45A 2DGXA 2X51A 3EDRB 1M1GA 4QOTA 4MAVA 3CJSA 4J5OA 3ISND 4GRSA 2BJ8A 4R5PB 4DL6A 4OI2A 4FS2A 2OEKA 3FBCA 5KFYA 4ZP6A 3NMRA 2E1MC 4KJIA 4WK3A 4TQRA 1CJKB 1WKKA 2GQ2A 3EJMA 3OTOJ 5HP1A 2E9ZA 2LEPA 1Y00A 4CT9A 3NLCA 2AYBA 1OGBA 5C42B 4LR9A 3W9IA 1X0FA 3MWBA 3DLHA 1NXIA 1UR9A 3CHFA 5LSOA 2VG5A 1S9EB 3H2LA 1BE4A 4DL4A 4PCQA 3N6LA 5GVQA 4C6AA 4UT4A 5H9FK 3LAMA 2RRBA 4ELVA 5HVFA 2CPEA 1QUVA 2PEBA 4PUOA 1OYDA 2K7KA 1M5OC 1NK4A 3M30A 2RQSA 4ID8A 2J76E 2Z2MA 2OI2A 2OIHA 4DQQA 2IC3B 4LSZB 2ZM6J 4MIBA 4RWWA 2LQJA 2MZJA 3J81j 1ZPVA 1YRUA 5B0EA 2ASLA 3BH7B 1HD0A 1I94J 3HI9A 1KWMA 5B0AA 2E7XA 1G1XA 2ZDOA 5K9FA 4I68A 3UNGC 3TX8A 5LT5A 3Q8QB 3WQVA 5HATA 3MMBA 4O0IA 2DSZA 1HI8A 2O3DA 4XO0A 3N0VA 2V2QA 3CVKA 1FK9A 1VYAA 4H4OA 4IFVA 5KFEA 2C2RA 2BRLA 2BM0A 1SC6A 5KTQA 3C16A 2QO3A 3IFEA 3DOLB 3NTPA 1XJWB 2FQQB 3CT9A 2CPDA 5D15A 1U0SA 1DTQB 3VV2B 3K5OA 4QIVA 3T5LA 2J8SA 4DWSC 5KFDA 5GAHI 3R8YA 2MF9A 4QYZK 2J9EA 4FYXB 4C7QA 1JLGA 3CC2S 2QLBB 1RWKB 2JX2A 3PR9A 2GS8A 2E7WA 2J6UA 1XN9A 1RT5B 1T02A 3NGSA 2KT3A 4PEOA 4MT1A 1HI1A 2M2BA 4OI4A 4WFBQ 3BO4A 3TQEA 2DT9A 3HHLC 4V19X 3HCXA 2Y0SD 4DSLA 2A6MA 1IKWA 3BH6B 2ASYA 3CJ2A 3L95X 4DV6J 3Q2TC 3H4DA 3M7VA 2V4JB 1FRHA 3BKUA 5ETKA 3SSQA 5D3GA 2EK6A 4BHQA 3LP1B 2J0QD 4OYZA 4U6PA 2VONA 4JP8A 1HNWF 1D09B 2QL5B 2LPVA 4ED8A 2DNLA 5DZ7A 4KYZA 2BM1A 2M2AA 3NGDA 4DV2J 4C48A 4WCEQ 4HI1A 3M8PB 5GAGU 2IYIA 2CZ4A 4KGKA 4A8YA 3CGNA 2MGZA 3O5GA 3BQ2A 2FHJA 3UCGA 1O51A 1OSCA 1KEKA 3IS9B 3HKWA 2MZRA 1CJVA 4IG3B 3OUYB 1KFDA 3IAS9 1YTYA 2VPWB 2QA2A 3OPKA 4IKAA 1LXNA 2HNYB 3THPA 2IDLA 1FERA 1J4IA 2CADA 3UDVA 3DLKA 1N32F 1SJFA 3NXZA 4MMOA 2ROPA 2L9DA 2OUGA 1YJRA 1IJFB 3EGVA 2CPHA 4ZCLA 3TCZA 4ODLA 3H42A 4DWIA 2GJFA 2R2TA 5IWAF 4RW6B 3MR6A 1TU0B 5E3PA 3SSRA 1DQAA 3CD7A 4TQSA 2LP4A 3E01B 4TW7A 3NRBA 2LEBA 5HBFA 1NO8A 3T6JA 3OTOF 3MDFA 3M2RA 4Z2KA 1KTVA 4O4GA 2CAJA 3CDAA 4NL5A 2OPPB 2C3UA 3BR8A 2FHOB 2XSJB 5DETA 2ZZMA 3V6DA 2KE0A 4J9SA 1VDHA 1P1LA 2XWXA 4F67A 1M5VC 5KT2A 2Y78A 4MYUA 4G65A 8AT1B 3GIMA 3B82A 5KG4A 3WL1A 1VK8A 4P6QA 1TKZA 3QMQA 2VA2A 5KG7A 1R8PA 5B7WA 1FD9A 2QEXS 4DH0A 1YJVA 3WIJA 1X31C 1BQNA 1Q8LA 4UOGA 2BW7A 2K2PA 1SJ4P 2F4FA 3AS3A 3WX4A 1TTHB 2RHSB 1BHNA 2MJUA 2HHUA 1I94F 5FLXU 3V5RA 4J4OA 2HFZA 2H5IB 5CYQB 4N56A 4KRWA 1RTDA 1PYTA 5ETRA 4QWEA 2BE2A 5E41A 1SCJB 3FEXB 1SB6A 2DXEA 3VAHA 3P6YC 3F56A 3DLLQ 2J9CA 1RTHB 1YX2A 3THVA 1YHQS 3QFWA 4KV8A 4LF8J 3CB4A 1MLAA 3TP2A 2ZZNA 3IWNC 4UUXA 3PX4A 3SZ2A 2MQOA 1NZAA 3W5ZA 3QSIA 1EKRA 4WXOA 2C22A 5B0DA 1CBKA 3JAMY 1ZH5A 2V9WA 4URIA 4IPXA 3KLFA 1HNXJ 3IG1A 2RMLA 4TW8A 4C98A 3C3LA 1H6KX 4X4OA 1LKZA 3GJQB 4QWDA 5E2QA 2VPYB 4RW8B 3WIVA 4YDDB 4EO8A 2JEFA 3HLUA 2IBOA 1RBOB 4MJKA 3W2VB 2DT2A 3GP9A 5F9NA 1XEZA 3HHNB 2YKNA 3B8HA 1LWFB 3IRXB 5F3TA 3JQKA 4MKBA 4OYIA 5GAEU 2VPZB 2ZWOA 1V3RA 2VJVA 1D9DA 1JXLA 4CI0B 2F21A 1Y4ZB 3HDSA 1HKKA 1X60A 3PW4A 5K8NA 4IRKA 3D0IE 3NEKA 2F3JA 4CLSA 5M2PA 1AROP 5C2CA 3Q24A 4MPKA 4PZVA 2EEYA 4RO0A 3BYRA 4DV2F 1VJWA 2HEKA 4O2TA 1JNTA 2XB2D 4TX0A 5FIIA 3QGPA 3MPVA 4NMLA 1RE1B 2C1EB 4RPFA 1D3WA 1F9HA 2M1IA 1BWVA 5AXKA 1IJEB 4HTIA 1RBLA 3CTRA 3PG9A 2ZH6A 4F3QA 4KKOA 3MM7A 2OSQA 4P2SA 4F4ZA 3KHGA 2RH3A 3OFEA 1RJJA 1UPMB 3C15B 3G86A 1S0VA 4KO0A 1NRKA 2BJEA 3D54A 1F0XA 1PAEX 4MFBA 4TY9A 2FZKB 4CLPA 1PO6A 1VBYA 1DARA 2XGPA 1ZK6A 5FDLB 3P3DA 4ILLA 4JI4J 4C11B 2V94A 2D9PA 2CNKB 1Q5YA 1PJ5A 4DCPB 4CLUA 4NYOA 2AW0A 4TLRA 3KTQA 1IBKF 4URGA 4ELTA 3OXGA 1F6TA 1IXKA 3B7XA 4NA3A 4X4VA 1TL3B 4ALZA 4DRQA 4USUA 5IC4B 2D3UA 4QWBA 3W60A 3FXYA 4KGXB 2QMWA 1UJ6A 4PG4A 1RCXB 2RQMA 5E7OB 1L3SA 1VQLS 4JI5F 3MR7A 1ROUA 4B3TJ 2JFDA 5IS2A 3PYEA 4A8QA 5HWBA 2HAIA 3SIPB 4KAIA 3C6TA 1VRQC 2DHGA 4R8UB 4NMXA 2NQPA 1T9TA 1G6BA 3ISZA 2V2ZA 5C5JA 3HF5A 1SL0A 4K50A 5CQGA 1VQMS 2RQCA 2GVZB 4QYRA 1VFJA 3TVYA 2V68A 5A8RA 4B3OB 3ENQA 2VJUA 3PM9A 2PFFB 2IMOA 1G3OA 1FDNA 2L41A 3P5TL 4URQU 4A8FA 3TC5A 3TAMA 2KRBA 3HHDA 1JNRB 4RKUC 2ZH1A 1WHYA 2ZBIA 2R4FA 2DEJA 2DH9A 4RU2A 3R7SB 4ZVOB 3HZEA 3RAQA 3H5SA 3OR2B 2Q6CA 4JI2J 2VB6A 4AQYF 2LEAA 2LQBA 1F40A 1K47A 4DRJA 2UUBJ 5LMNF 4EU0A 2KXFA 3ZTRA 1KN6A 1TL1B 1VS3A 2B8PA 5IV3A 1HHQA 5L1JA 4DV7J 4C3LA 1PINA 3NCQA 2HMIA 5E3RA 2E44A 4WPAA 2VDIA 1TK0A 1GUVA 4ID5B 5HP1B 1FXLA 1PBAA 4FXWA 1HNXF 2ZFHA 3R6LB 3HHEA 3OHAA 4ITZA 2K3KA 5J2NA 3AAWB 1J5OB 4ITSA 1DURA 2PN6A 1U1KA 2C3OA 5JH8A 4OZ3A 3GFXA 4CLWA 2YWHA 1SPBP 3GIRA 3KWMA 1UJ5A 4JUZA 3BSAA 3I55S 3QAUA 1DJ0A 4JI0J 5L9XA 3QRQA 2V4QA 2VQEJ 2OPQA 1GFWB 1UWBB 2KL8A 2L08A 4USJC 2GCFA 1FESA 1U48A 3MM9A 1XNQJ 3G6MA 3AA8A 3C6UB 2HHWA 2XP7A 2E9RX 1UTAA 5L46A 4ED3A 4ZVTB 1VBXA 2VC1A 1AYEA 5K8PA 4IDKB 4L74A 4ML4A 3N28A 3NG8A 4FYDA 1ZOTA 4ODNA 4C8OA 2DK2A 1NWUA 4UZCA 2B4UA 2PFDA 1PBUA 5HKGA 4FYVB 2YKMA 2FKEA 4DWSD 2WB1D 4WJXA 1ZBKA 2MPHA 2ZKUA 2Y1JA 2F8MA 4ZN1A 2DY1A 3QNWB 3ZNUA 1YK9A 4JV5J 1JXVA 4ODMA 1UW9A 1Z2LA 2DGWA 4A47A 4IFVB 4LF5F 4WIIA 3QZ8A 3Q8VA 4RBVA 1YZ6A 5IT9U 4UTGA 3VWSA 1D7IA 3MCNA 1KTQA 4N5SA 2CJXB 1W1TA 1YG0A 2WSEC 3GJSB 3OHBA 4OYPA 2PDAA 3GFZA 1ICEB 2FJDB 4JI4F 4C0OC 3WD2A 2VICA 4M5IA 2HQDA 1E6YB 2CIMA 4OZ0A 4M5GA 3QJPA 3DGPA 4MH8A 4CNYA 1Y0HA 1WNEA 5ETMA 1LG1A 2LQ9A 2Z0GA 2G13A 3J7AN 2ZKTA 3UPFA 5F3ZA 4NASA 1DTTB 2B5JA 1NMVA 3FCWA 2G2YA 3GPKA 2AQ4A 4CYUA 2W8LA 2E66A 2MJNA 2CPJA 4B3TF 4FYYB 4HH0A 4OFZA 1RT6A 1W25A 3O3LA 2AOSA 2P9GA 1HIYA 4KHMA 4KGVB 4LRAA 1S1UA 4O3PA 2EULA 2R9LA 3CCLS 2VV5A 4NLSA 1RA7A 2VASA 2HURA 3CO9A 2DNOA 1S6QA 3TOQA 1ZM9A 1UVMA 2JC1A 3AOAA 3CULA 4B08A 1GX6A 3O5FA 1P1TA 4DUZJ 1KVKA 2IVMA 2NS1B 1NH6A 4Z2JA 4NLWA 1KVJA 2OELA 4QWAA 4YHHJ 4BC9A 3JSBA 4ZLPA 5E3QA 4FKXA 2UUBF 2DNYA 3DLKB 3RB6A 1FFWB 1CC7A 2HQCA 1MMDA 3DXSX 2IJFA 2XTJP 4DV7F 3B6BA 1J27A 1FDBA 3JYMA 2BJ3A 3LGNA 2E1AA 2DPIA 4DDFA 2IRXA 1RWWB 1SC4B 4Q8EA 1C9HA 2XNRA 2D41A 2RDJA 2DB1A 3MUTP 3FMBA 4O4GB 1TL4A 2BQ3A 4I69A 2X1AA 4X65J 1YJNS 3BBBA 1S9GA 3JSMB 3N6MA 4ED0A 3D4JA 1Y3KA 2HWHA 4DV0F 5KG0A 3MMAB 2CFXA 2DD8S 2YH1A 1LQ0A 3KOAA 1HBUA 1NJZA 3BREA 1N5YA 1VOMA 1NKEA 4DR2J 4UDMA 4ZJQA 1S48A 4W9QA 2F65A 4JI0F 2WK4A 1RT3A 4MNMA 1W1YA 1FFGB 4PXCA 2KGJA 5T14A 2VQEF 1E9LA 2PN0A 1RAAB 2J9DA 2JNJA 2EK1A 5KFLA 3UQSA 4CLLA 2XCPA 1UZDA 3EZUA 3QO9B 3QLHA 1XMQJ 1KS2A 3O5OA 2LLZA 2UZAA 1TKTB 3PEJA 3R7BB 3OTDA 1KDNA 1D1UA 5HW8A 2KO1A 2N4DA 2AX0A 3RB4A 3DHXA 4N19A 5HI7A 5G4DA 3TR5A 3W2WB 3D7SB 2OMLA 2JVOA 1X9SA 3UO0A 1HNVB 5C2GA 5B0BA 4JV5F 3GV7B 4WKYA 4RUCA 3RGCA 3PTWA 1TAUA 2YH0A 2PPOA 1U1RA 1YJUA 2DNNA 2GX8A 1A7XA 2BVZA 4J90A 1VJQA 4YFUA 1LW0B 1C1BB 4ICLA 3W7BA 4B3SF 1JNDA 3DRRA 2DH7A 4CH7A 2PMHA 3PW5A 4DRHA 2CWKA 2MQNA 4NLXA 4NA2A 2RU3A 4FNIA 2VKRA 1LWCA 3CD0A 4I0WA 5IT0A 2FB0A 5L1KA 1N6QB 4CO5A 1NPPA 1Q4RA 2PMZD 4DRIA 1FD8A 3QAEA 2OAUA 1X6NA 4F4AA 1G2EA 1F2HA 3NOGA 1U6ZA 2DRAA 3KJVB 1TAQA 1OIAA 1FX2A 3D67A 4J9NA 4MTVA 4IG0A 2G41A 4YN3B 4V19J 5EX3A 1PYSB 3RJMB 2IFXA 4RNNA 2JWNA 4URSA 2QL9B 4Y28C 4LFAJ 4QU7A 1NK6A 1QE1B 3CDWA 3VF0B 1QM9A 2FGCA 3TWZA 2FYXA 5IOLA 4LF7F 1S7HA 3J7A1 3DLBA 4F7VA 2YKPA 4W9PA 2KR7A 4WKRA 5HW7A 4Q2MA 3TEHB 3KAIA 1RI7A 2LFVA 4JI3F 1FA0A 1W26A 1NDPA 1YBAA 5K8OA 2OJ3A 2ZE2A 1K0VA 4G1QA 3T5HA 5K14B 5HT1A 3RUBL 1SR0A 4YP3A 2W7OA 4ANCA 4YHHF 5SUHA 1HWIA 4NOHA 2CG4A 1CULB 1HWLA 3THTA 4O3SA 5ETPA 3R5JB 3UE2A 3HMJG 3P96A 4YR3A 1TCOC 2KT2A 2A3EA 2UV8G 3TAPA 2BYCA 4M5MA 2ZJQQ 5DF0A 3CCTA 4ZPBA 2UUAJ 1SUQA 5DM6Q 3SCKE 3IR5B 3KLHA 2QL7B 4EEYA 3CJQA 4RNFA 4GKKJ 4Y2CA 3TJ8A 2UXBF 5MLCV 1VLOA 2VFUA 1TL7A 2JVRA 2UU9J 1Q1KA 1FNXH 3CW2C 5F8IA 5A0YA 3Q8YA 2G0IA 2AGOA 2FJEB 2DSWA 2UV8A 1TK8A 1LW2B 2A3BA 1NK5A 5D4LA 2DKOB 2CQ3A 2RKIB 3UQIA 5E0OA 3WC0A 3I0RA 1FTCA 1C0UA 3Q8PB 4YB5A 1WAWA 4Z7CA 2GGPA 2M5YA 3MEDA 4ZCIA 4DX6A 2B4PA 4X4PA 3PIPQ 4TLQA 4PABA 2MKSA 4J9RA 1D2KA 3NBPA 4HLBA 3GFYA 3RB0A 1XMQF 1FD2A 3JTNA 5HLFA 3BDEA 1PCAA 3TAMB 3DMJA 1XMOJ 2IIHA 4USHA 3DU6A 4EMDA 2XO6A 5KFPA 2C2NA 4M94A 1SKSA 2V69A 2HHHJ 4C8LA 3IMQJ 2QTWA 2IA6A 3NMAA 4IR1A 4L3KA 1Z2ZA 2AGPA 1DLOB 2V8VA 2MZ1A 3ILLA 3H59A 3J81U 2FUG9 3H5UA 2LXUA 2PI5A 4JI7J 4JFMA 4DX7A 4U8YA 5IT4A 1CS4B 1FX4A 1PC4A 3FJ2A 2VUGA 1SJQA 5HK4A 3W62A 1W7WA 4JYSA 2E5LJ 1DQ8A 4NI2B 4U86A 1VRTA 1NHKL 4M5JA 1AT1B 1ELOA 2HFUA 4WE1A 3F0NA 2ADCA 3POTB 1VF8A 3ZZUA 3R9LA 4ECTA 4QU6A 3FK4A 3BN7A 1TFVA 3EE3A 3MM5A 1E15A 4DZ2A 3JSRA 1IR0A 1T03B 1MROA 3LPEA 1I1GA 2I5JA 5DITA 1RKIA 1S97A 2XMAA 3UCUP 2FVQA 4AXIA 2RUDA 1RISA 2W2MP 1EP4B 1FKPB 2MHEA 3WQPA 1J6YA 2OPQB 2BJ7A 1HBNA 2GVDA 1TFWA 4XAKA 1T8EA 1QVFR 4EUVA 3MM9B 2QV6A 2X3GA 3C46A 3ZZZA 5H9EK 5EWEA 3P5BP 1N33F 2FY8A 2FJWA 2CPFA 3HX9A 1KR4A 3TW0A 3NNAA 2ZH2A 2YNHB 4HT7A 2HVZA 3B9DA 3ELHA 1PGZA 2V8PA 2ILZA 3GIKA 2XPAA 2B31A 3QSYB 3LF0A 2EBEA 3DM2B 1RT4B 3V81A 3D6FB 1SQFA 3KUHA 1SYTA 4P8XA 4IO1A 4M5DA 1FKLA 5CYMA 4CTAB 4BCAA 3ILOA 3D66A 3W8PA 4Z2GA 4OX6A 3W3SA 2WM0A 4GO7X 4DSEA 2HS3A 4RW4B 1H72C 3ILJA 3KDNA 3MM6B 3CHDA 2ZVIA 9RUBA 3HFKA 4DZ6A 4DS4A 4XK8C 3MEGA 3GMGA 3WX8A 3DYAA 2YY3A 3EVMA 2LDIA 2HLTA 2UUAF 3Q23A 2K1RA 3F44A 2WOMA 1YJWS 5HWCA 2GFFA 2RAQA 3PR4A 3KK1B 2ZH5A 1R31A 4OZ1A 1X4EA 2I38A 4LBHA 2P8IA 2XO7A 2R7UA 5KG3A 1P9YA 5LSRA 5CD4A 3O8WA 5J1NA 2YX7A 4TNOA 4ECYA 3NS7B 4UOCA 2AZ3A 1GMWD 2RUCA 1YGYA 1KC8T 2WZ1A 3T6BA 2WONB 1APSA 5IT9Y 2R8KA 1YITS 4KB7A 1CPZA 4FF4A 1HNZJ 5KFNA 2ZH8A 4FKYA 4PXBA 1WD6A 2R8IA 3G9CA 3DCAA 1S6PB 1EJ7L 4RR5A 1RT6B 2H9ZA 1BC6A 3DKDA 2IVFB 1SV5B 5IM0B 1VQ5S 1EETA 3CXCR 5BYSA 1JLBA 1WG4A 4KPCA 5HL7Q 2JOQA 3AQUA 4I2PA 4LQ3A 1SKWA 3OV7A 2EW9A 1WOOA 1VQ4S 2XMMA 3FMWA 4LAWA 2KJWA 3UDLA 2BV3A 2C3YA 5ETOA 4UW2A 1QTNB 4GVLA 2ETNA 3QJJA 4OYXA 3HVAA 1VISA 1J5EJ 4FS1A 1S0NA 5DM7Q 1YJTA 2BJDA 2WHOA 4DSJA 2W4PA 4OX7A 4JI7F 1FNOA 1RP5A 5IQ6A 4MK9A 1ZYQA 1NMWA 3IGNA 3MM8A 3FRYA 2E5LF 4ECXA 2EWHA 4RW9B 1S4FA 3MAAB 4ZP9A 2UVUA 1M5YA 2ADBA 3GYXB 5DQHA 4R0XA 4GIVA 1LWXA 1JKHA 1RABB 2ZC4A 4DU8A 1IQZA 2H48B 4DT4A 3TA0A 2A3JA 1JLAA 3Q8UA 2GO8A 1E44A 3CJKB 2CJ9A 3C14B 4P71A 3KK3A 1T3OA 1E6ZA 3ET6A 1N5YB 2V34A 2NZCA 2Q79A 3L7OA 2ASDA 1RT3B 3TAQA 4NXNJ 1UCNA 2ABYA 4PWWA 4CM2A 2IF4A 1S5ZA 1SKUB 4JB8B 1VQSA 2WBMA 2Y9HA 2L9NA 5DDRC 1Y11A 1K73T 1NB2A 2W7AA 3JTOA 3RW6A 4RJVA 3G71S 4DU7A 1FKSA 3VALA 3F41A 3JYTB 3MFHA 2XULA 5DJBA 1MWQA 1X4CA 2FLPA 2DGVA 3ZC4A 1B3TA 3PJWA 3PRVA 3PHTA 6FD1A 2MZTA 4KY3A 3DRSA 4Z7YA 4CO2A 5DLFA 2IMWP 4F0MA 1JX4A 2FHJD 5HROB 4TVAB 1J2VA 2HW3A 4HBEA 4DN0A 3W61A 3O5PA 2H5JB 2RRNA 1YW5A 4MKYA 4HACB 1N5SA 2J5AA 1Q8IA 3N6NA 1FRIA 1MWZA 2JLGA 3FFIA 4USKA 2F9JA 4UF4A 4U67Q 1S6UA 3BV8A 2OD4A 2RJZA 2DG4A 1BMQB 4DPXA 1KOOA 4RWXA 2FJVA 2F4VJ 5LMUF 4X2BA 3ALFA 3PFOA 3HJVA 4X4TA 1T05A 1VI7A 4LAVA 1DRZA 3AY0A 2I8EA 1NJYA 4O4RA 1B7YB 1UMJA 3RG6A 4I56A 2EKYA 3KLGA 1LFWA 1HNZF 3FZ2A 2WK2A 1CJKA 1BKFA 5KFIA 3NOCA 4WJBA 2E5HA 4LBPA 2A2CA 1RT7B 5C42A 5KFQA 5M2RA 3FBBA 1S0MA 4Q8FA 4ZPVR 4KC5A 4KGZB 1N5VA 1R6VA 3IGVA 1FWKA 2RUQA 2MLXA 4RNHA 1S9EA 4J9KA 5J2MB 1WC3A 4ZKAA 3QWPA 3VQSA 1F3FA 2PV3A 4QIGA 1RTJB 3L3CA 4PTMA 1CLFA 2G0CA 3OL6A 1YQHA 2DT1A 1EAYC 2HZCA 2AEMA 3ALGA 2CNOB 2O01C 2BANB 5C24B 4BLGA 1VGYA 2XM3A 2XLIA 3AHPA 4ECWA 2IC3A 1C2PA 3ARQA 4H4MB 5ETQA 1ZZNA 1U2CA 3MCMA 1W1VA 4C4WA 3K5LA 4NCBA 4F36A 1S12A 3D1HA 1JJHA 1EDQA 4LFCJ 1Y3JA 1I51B 2BE9B 2HQFA 5EX0A 1UWAA 2Q5AA 2HIYA 1H0GA 4L76A 2V6AA 1U2RA 4MKAA 2PO4A 3J7ZT 4ZLLA 2YX4A 1RU2A 1OS5A 1FWLA 3KK2B 1CEZA 3T1AA 1NSKL 3A8JA 1OPIA 1MW7A 2CYYA 3DOLA 4L75A 3RW7A 1M5HA 4OHVA 5KT5A 3T1YF 4DRPA 1DTQA 2DY9A 1OQ6A 4ES3A 3M32B 1D9FA 4ZIVA 3O5QA 5G0RB 2HFOA 4NXNF 3OOBA 4PYAA 1WKJA 3BM7A 1RHQB 2MLZA 2GGPB 2ZDPA 3BKFA 1PAUB 3MR3A 1U6BA 1RT5A 3FSIA 3A3NB 1NK0A 4PWDB 5KG2A 2FDMA 1JJ4A 2XWYA 4S0MA 3R2CJ 2R7TA 2CQPA 2HPUA 2V4JA 3EUNA 5HUAA 4G6VB 3I32A 1V3ZA 2IAJB 3CDBA 1CVJA 4J9LA 3M9NB 3LP1A 3KNGA 2DCUB 2XMKA 2C42A 3GCWP 1GH8A 3RAXA 5D4NA 3PW0A 2W2NP 4FVCA 4TYBA 3VZHA 3MD3A 3Q2SC 1XTZA 3MCSA 1KD1T 4Q44A 2W4DA 4OV1A 2K3IA 2ZEJA 3JTPA 1JCHB 1PSDA 2N7CA 4KGMA 3O44A 3H90A 1LV5A 3KLIB 4ECUA 3OL9A 3X1LB 2F7VA 4QBUA 2F2DA 3H98A 3TI0A 4WFAQ 3MUMP 2NZ4A 3U7JA 2HAFA 3IS9A 4IG3A 3OUYA 2HNYA 3W9JA 2LYVA 3M8RA 2XG8A 2F4VF 3I82A 2VF3A 4F2SA 1TZ0A 1N56A 7FDRA 4DFJA 1IBMJ 1UZHA 5BXIA 2AWZA 3LWLA 1FKOA 1QZ2A 5D0RA 2W2PP 3EY6A 2FHKA 3KG1A 2ZWPA 1BGXT 5ADZA 3I6CA 1JLQB 4RW6A 4Y2KA 2BDPA 1YVFA 3UW1A 1RYRA 1DAXA 2CNNB 4W90B 2VFSA 3M8YA 1DHMA 3E01A 2DHSA 4IRCA 3BPDA 5DDQC 2OPPA 1E6VB 1HR0F 2XSJA 5HBMB 1TKXB 1RACB 2G0JA 4DSIA 3L4BC 1JNEA 2FC9A 2MPUA 4DV4J 2KFYA 1A9NB 4LUBA 3P49B 3RFWA 3K8VA 4ED7A 1MG7A 4ZPDA 2DG3A 1N1AA 1Q0NA 4I64A 4JFLA 7AT1B 4NWBA 1Q16B 3FGVA 1RAFB 3ENAA 1QJHA 3V81B 4ODQA 4C02B 2AJ0A 5T41A 5AXLA 2GZOA 4LVNP 1UVKA 2P4VA 3W1YC 2D3OR 2GHPA 1P8GA 3BR9A 2V63A 4GMKA 1U02A 4WK9A 2RS8A 3BQ0A 1JVWA 2V0NA 3QRPA 5CYQA 3EGZA 4K0KJ 3MPDA 1JJCB 4M5KA 9ATCB 4LFCF 2V4RA 3O5TB 4P72A 4TNSA 3QZ7A 1D8ZA 1P6TA 3PRAA 3DC2A 2E1CA 4EK2A 1J4HA 3A12A 1U0HB 1RTHA 4WZMA 1ZB5A 2QLJB 3TUIC 3G96A 3ONQA 2CQDA 2E7VA 1W9PA 5L38A 1V5VA 5E33A 1NKBA 2JEJA 1RWOB 3HSJA 3HT0A 2DCLA 3IBCB 2QA4S 3I5CA 2EBGA 5K20B 1KQFB 2CNLB 1S59A 4PKDB 3D5MA 1TUWA 4OQJA 3TVZA 1UFLA 1YLXA 2HQ3A 2DTJA 2LCWA 2R7SA 4OYMA 3BO3A 3KLEA 3TQ1A 2ZBPA 3D1QA 3DOKA 2DHAA 3H5XA 2ASJA 1JLBB 4RW8A 1MSWD 1WSRA 4KSEB 1FJEB 3MMCB 1GTEA 4DUTA 3ZTSA 1SBRA 3W2VA 1NPRA 1VC5A 4HI2A 2P9CA 3GLJA 4OMFG 2HKEA 1N0VC 2ZHBA 1K9TA 2XP5A 1FKGA 1GNKA 1HXVA 2DR6A 3B78A 2NUUG 3IRXA 2XSFA 4TU8A 3QFHA 1WC1A 2DH8A 1NSAA 4FF1A 3W4RA 4Z2LA 3O2IA 1WEYA 1EB0A 3T9ZA 2W1BA 5GAGI 1ZAXA 2DO0A 1F8AB 4DPOA 3HSDA 4JV2A 3AD8C 1IKXB 3J80Y 4LF6F 3BGRB 4X4NA 3OVAA 1I6JA 3CH9A 1Q7LB 4CH0S 2M8HA 3AA9A 5KFSA 5CCLA 3IC1A 2BJ1A 8RUCA 5DGBA 1WEZA 1M5PC 1JKHB 2W7PA 1IKYB 4J9QA 2AYMA 1VK3A 3WD4A 5EGYA 1VQYA 3R5BA 3C15A 2YNIB 3ARYA 2HNDA 1HLWA 1RU1A 3VAKA 2N4CA 3KACA 2Z57B 2XS7A 5FDLA 3GE9A 2VIHA 4C11A 4CQ1A 3ENWA 5EHHA 2NXCA 5HO4A 3TDBA 3C19A 1Q5VA 4PRFA 4QWCA 3K58A 3H8YA 4ZIWA 2Z2ZA 3JS9A 2HVHA 1VQ6S 2NUHA 5D77A 1TL3A 3MOZA 5D0HA 4TY8B 3H2VE 5ETNA 4ZDNA 4DCOB 2QX0A 4X4RA 4I7FB 5E3CA 1N54B 1O6XA 3NP5A 1RT1B 1FEEA 2HZVA 3AXMA 1VBZA 2W9CB 5KFXA 3N4WA 1F60B 3AFGA 3I87A 1ZBWA 3PV8A 1FKIA 2E5IA 1PJ6A 2YWFA 3ZTOA 5F0UA 2MKKA 4K4SA 2XYPB 2H54B 4EBCA 3AJ2A 4R8UA 3T19A 1KONA 4Z2HA 2IRUA 3RB3A 3I6PA 1RWUA 4U84A 2GVZA 4F0HA 3QT8A 1U09A 1HNWJ 4NLUA 3CCQS 3HO1A 4B3OA 2D74B 1HHSA 3VTIA 1RDRA 2PC6A 3CCJS 4CLFA 5F8GA 3SYZA 3CUNA 3ZZTA 4TN2A 4Q0BB 4PPZA 2DHHA 2IYGA 3OR2A 4RU9A 4X66F 2QZ8A 4XTTA 4J4NA 2PV2A 1U7LA 2KFNA 2ZJPQ 3QGHA 2C28A 1XHGA 2I1RA 1Q81T 3DOMB 4F2RA 4JYAF 2DNHA 2HYIB 2CJAA 1N32J 1NBEB 4ETZA 2RS2A 3GV8B 1ZZFA 1TL1A 1CJTB 3WZ0A 1UETA 3QIPB 2PMWA 2QF8A 4DHVA 3R1HA 2HBZB 2GC8A 3UI3A 5IWAJ 3KLGB 1ACMB 2HHQA 3CCVS 5F9LA 4ID5A 5HQLA 4R0JA 1WOSA 1K0TA 3B8SA 4Q7NA 1J5OA 1RLDA 3LGHA 3R5CA 2RQKA 2M8DB 1D9AA 3IN5A 3KG0A 4ENOA 2AIRB 3SBMA 5GAEI 2FTRA 1WC5A 1OMSA 4KH1B 2YNFB 3K5PA 2FVPA 4K7QA 2VZ9A 4IH6A 2APOA 1UWBA 1H38A 4M1KA 4J7CA 4O3QA 1T9YA 3CC4S 3DNCA 4DF4A 3GV5B 3C6UA 3MUVP 4U96A 5L39A 4ZPTR 4IDKA 2GQCA 3WH0A 2YNGB 1EHWA 1GXLA 2DNQA 2PGCA 2VFTA 3L09A 4MK7A 2MQQA 2RDDA 5BJRA 3HZGA 3L7UA 4ETXA 1CSJA 1JJ2R 1F3VA 1VIOA 3NAHA 4DQIA 1X4GA 4ODOA 4CO1A 3OVBA 1VR6A 1F2GA 4P8WA 1KT0A 4OYAA 4C97A 3VAFA 3CHCA 3LAKA 3E2EA 2BKPA 2H51B 4C0HA 3SEOA 1X4BA 4ZVGA 4NNRA 1UVIA 4KT0C 1JLCB 1RAOA 1KFSA 3T5KA 5J1PA 5CYJA 3SV4A 3NAIA 1FFQA 2FD2A 2EXUA 4F4XA 2DR8A 2HS4A 2Y1IA 4ED6A 1E6YA 1FE0A 3ZZOA 1D8YA 3KADA 1FWPA 3OXLA 3LP0B 3GZ7A 3KUGA 3KG4A 3G6ES 2CA9A 4P74A 2CQCA 1Y5IB 3U1MA 4O0NA 3AXKA 2CWXA 4DG1B 5GQBA 1EARA 1EQMA 4NZ0A 3J7Z5 3BB5A 1WTFA 2AF6A 2BA9A 5I98A 1DTTA 3OL8A 2XMTA 2FLOA 1HQUB 3QQCD 4MNJA 3IXQA 4NLYA 3CO0P 2ROGA 2POKA 3B9EA 1NNDA 4RW7B 2XQCA 2YQ1A 1Q86T 2MZSA 3CD6S 3TEGA 1HHTP 1EYMA 1F9EB 4W4MA 3FAPA 4L3NA 2DXFA
chains in the Genus database with same CATH topology
3O5MA 1U2FA 4NOHA 2M4MA 2VG5B 2CG4A 4I6AA 3ULHA 4Y2MA 4OJ3A 2OO4A 3U1NA 1HWLA 1LL7A 2C3PA 2OMOA 3KFWX 3THTA 3CPWR 4TY8A 1RYSA 4O3SA 4TW6A 1TL5A 4CT8A 2R7QA 4LMZA 3JB9k 5JJBA 3TVKA 2EFNA 3I5AA 1HWUA 1WTBA 2E29A 3M05A 3UE2A 3UFCX 3ZFVA 3HMJG 2DG9A 2DRBA 4YUDA 1L3TA 2P6SA 4DX8H 3P96A 1Q6HA 2EFQA 5HTGA 4I7FA 2EPIA 2B0GA 4YR3A 1TCOC 1SXLA 1NJWA 2CQ0A 3ARSA 1JNSA 3WD1A 3TNVA 4PUOB 1FO1A 2KT2A 1RT1A 1U1QA 2A3EA 4NRTA 2OSRA 3NI6A 2XGQA 4LSLA 2ZD1B 2UV8G 3TAPA 3CEDA 1W9UA 4PPDA 2BYCA 1NEEA 5I3UB 2G1DA 4AE5A 5DF0A 3PR5B 2W9CA 2ZJQQ 1HD1A 4ZP7A 3CCTA 2B9YA 3FNNA 4ZPBA 4A8OA 2G4BA 3ARWA 1N0UA 3DLJA 3M30B 1SUQA 3PHEA 5DM6Q 3RRHA 3H5YA 4ZS6A 3SCKE 4OHYA 3I0SA 2LVWA 1WWHA 3RM9A 1LK5A 1T95A 1ZM2A 3IR5B 3KLHA 1X7VA 5KFCA 4DL5A 4PXDA 3NNHA 4AL5A 4EEYA 4RNFA 3CIMA 5DS7A 4BDPA 1EETB 4Y2CA 2B9XA 4P8UA 5GADI 5L1LA 2UXBF 1SIWB 3KCEA 4MNLA 5MLCV 1HBOA 3EYZA 1TV6B 2VFUA 4ZA1A 2JVRA 1OPZA 4P7TA 1Q1KA 2EC0A 4JFJA 4I2PB 1FNXH 2WRMA 5F8IA 5A0YA 2QSFA 1WF2A 2QRRA 3NCRA 3AQOA 3MFIA 1S49A 2ZOGA 2AGOA 2IM2A 1AFJA 1FKOB 2V2KA 2FJEB 4TKTA 2KG1A 5DG7A 2DSWA 2UV8A 3FSXA 2DO4A 3M6VA 5HMXA 1B0TA 5KG6A 2MKIA 1TK8A 1LW2B 1LWFA 2A3BA 4R5EA 5DDOC 4DUYF 3MMBB 1NK5A 2DITA 4B9LA 4RUHA 4OI6A 2K8IA 2ZBCA 3K8WA 3PZPA 5D4LA 1NWSA 2J0SD 1FKTA 1CQNA 2CQ3A 2DNZA 5KFRA 2RKIB 3UQIA 1JK9B 5E0OA 3WC0A 3OVSA 3HP6A 1FK9B 3I0RA 4H4OB 2V8GA 1FTCA 1C0UA 3Q8PB 4Q0BA 4YB5A 4MNKA 1WAWA 2NLWA 2GGPA 4KE5A 4YEAA 2M5YA 3MEDA 4ZCIA 4IUFA 4HL9A 2B4PA 4A8QA 4X4PA 3PIPQ 3CSKA 4TLQA 2DNMA 2MKSA 1A7GE 2ZUGA 3I31A 4J9RA 3PY8A 4JI1F 1ZM3A 1D2KA 3NBPA 4HLBA 4K4XA 3GFYA 1UJ4A 3O5KA 3JSMA 3RB0A 2GNKA 5DLGA 3K57A 4CH1A 4MIAA 4B9VA 1PC5A 4U7UK 3AJ1A 1FRXA 2XPBA 4P8VA 3MMAA 1SH3A 3PX0A 3MM8B 1XMQF 3DOMA 1FD2A 3JTNA 4WIWA 3QGIA 5HLFA 4GGQA 1URNA 1M90T 3J7YU 4OZJA 1HBMB 2LGOA 1V6HA 3B4MA 3BDEA 3TAMB 3DMJA 3AH6A 2VBYA 2DT0A 3U27A 4B3RF 1S77D 4USHA 2VL1A 2BR0A 4K4VA 3JYJA 1QLNA 3QIPA 3DU6A 1FKBA 2FY1A 1JLFB 5KFPA 4N76A 1SQEA 1NU4A 2Z4PA 2JLEA 2XY6A 4ZOSA 4M94A 1S99A 1SKSA 2X1FA 1U47A 1R89A 4C8LA 2ZH9A 3PRBA 2AWGA 2MQPA 5B0CA 5D78A 1JLGB 2IA6A 2RILA 3VAIA 4OHZA 5F8HA 3NMAA 1JMTA 1H2VZ 1Z2ZA 4IR1A 3T1HF 4DR7F 2WSFC 2CPZA 4WFXA 3FQLA 2AGPA 1JLAB 1U1LA 1DLOB 1LWEA 2GIRA 4EFAC 2V8VA 2MZ1A 3TARA 1O6IA 3H59A 2KM8B 2HHXA 2FUG9 3ISNC 4PG8A 1B64A 3H5UA 1QAYA 2RT3A 2LXUA 2PI5A 2XLKA 1U24A 2OLWA 4JFMA 3MI7X 4IFYA 1FKHA 5KG1A 4ECZA 1IBMF 5F41A 5J6EA 2RB7A 3HVWA 2D7SA 5B08A 3CCRS 1F5CA 3KK3B 5IT4A 1GX5A 3QO9A 2DNGA 2UZ5A 1IKWB 1R27B 2NR0A 4I6WA 1OWQA 5B09A 1PC4A 4Y6IA 3CD5A 2GHWA 1TP7A 3FJ2A 2VUGA 1SJQA 1K9MT 1O5JA 2VOOA 4JYSA 2ZQSA 1PILA 1Q8BA 3A8EA 1FKDA 1TKTA 1D7HA 2F1FA 4B17A 2N87A 1N5QA 5KFZA 5L1IA 5KFOA 5E5NA 2DT3A 1DQ8A 5D3GB 1CTNA 3RR8A 4LJMA 2P9EA 3CHEA 2EG1A 3EGWB 2LQ5A 4X4SA 4ILRA 1U26A 4U86A 2VBZA 1OGGA 1C4CA 1FDAA 4DL3A 2YNFA 1VRTA 4A4JA 3UF8A 3PNIA 1DZ5A 2PT0A 2ZH3A 5EN1A 4HARA 5F8NA 5J1EA 3UQBA 4WK1A 1GTHA 3C8YA 2MMYA 1ELOA 1B0VA 4RX6A 4IQCA 3W2WA 4DL0C 3KAGA 2XS5A 3G6LA 4WE1A 2ADCA 3POTB 1HNVA 5C25B 2CQ4A 1QSYA 2ATLA 5KOWA 1VF8A 4WFYA 3ZZUA 4DV4F 2RSEA 4IT6A 4KIAA 3L7PA 1Y5NB 4ECTA 4QU6A 3J7YI 3BN7A 3Q0AA 2F4EA 1M1KT 2DGUA 1TFVA 4JFKA 2JEIA 3DRXA 3MM5A 1E15A 4DZ2A 1ZTTA 1K8AT 3GG0A 1X4AA 1L3UA 1IX5A 5A2QY 2JJ4D 3B4DA 2HIQA 3IR7B 3JSRA 3X3UA 1H2UX 1IR0A 1T03B 1S1TA 1MROA 2YNGA 1LW0A 2MGZB 1C1BA 4TYOA 1NJXA 3QOKA 3ENVA 4DV5F 1E6RA 1I1GA 2I5JA 5DITA 1RKIA 2LDYA 3RYLA 4FBTA 1S97A 2QMXA 1LK7A 3UCUP 2FVQA 3SCJE 4AXIA 3WDOA 1VC0A 1WB0A 2GA7A 1W9VA 3MF5A 2RUDA 1RISA 1EP4B 1FKPB 4WYLA 3S01A 2MHEA 1J6YA 2QSWA 4JI2F 2MXYA 2OPQB 1WF1A 4O23A 2O5DA 3DRSB 4G1PA 3K5MA 1HBNA 1WG5A 2WLYA 3KLEB 1TFWA 3GR1A 4XAKA 4DL2A 2JZ5A 1T8EA 3NKYA 2KTQA 3S8SA 1N6QA 3RR7A 1UAWA 4QQBA 1QVFR 1S76D 4EUVA 4X84A 3MM9B 3M8SA 3PKMA 3DOKB 2QV6A 2JLFA 2VG7B 3LP2A 4JV0A 1JNZB 2X3GA 3C46A 4GO5X 3ZZZA 3OJSA 3DLEA 5EWEA 1JLCA 3HVTA 2CQ1A 3I4PA 2RVJA 3MTKA 2H5EA 3PDNA 4FNHA 4K0KF 1N33F 3OTCA 4RBUA 2RIJA 2FJWA 1GQEA 4NLVA 1FRLA 2CPFA 3HX9A 2J0XA 4IOCQ 1KR4A 3CDEA 3FZBA 3TW0A 3FFIB 3NNAA 2ZH2A 2YNHB 1NAQA 4HT7A 3KJVA 2HVZA 5KAKA 4BBYA 3B9DA 3MAHA 1PGZA 3ARUA 4XDCA 5SZTA 2ILZA 3GIKA 2XPAA 3V6JA 2B31A 4KBIA 2UVWA 4QIFA 4FXVA 3M4XA 3M2RB 3MECB 3LF0A 4B3MF 2EBEA 3DM2B 1QAXA 1U79A 1RT4B 3V81A 4IOAQ 4K5SA 1M5SA 2CJQA 1SYTA 1FRMA 4P8XA 4IO1A 2A1BA 1IUJA 1QE1A 4O44A 4Q2LA 4M5DA 4EWTA 3LP0A 1S72S 1FKLA 1BL4A 5CYMA 2PPPA 4CTAB 3G6XA 3V6DB 2KJVA 4ILMA 4BCAA 5E3AA 5DEZA 4WU3A 1ZTWA 1R8BA 4Z2GA 4OX6A 2XMJA 3W3SA 1EIBA 1M0SA 1TR0A 3C66A 2WM0A 4GO7X 3WBZA 3HT3A 3G8QA 4DSEA 2HS3A 4ZP8A 2OFNA 4RW4B 2CPYA 3MEKA 4K4UA 2ILYA 1T05B 2L9WA 3CCZA 4DG1A 2J7KA 1Q6IA 2Z2LA 4PG5A 3MM6B 2BUNA 2KU7A 2EI5A 1Q53A 2I2YA 3CHDA 4L6V3 2DGXA 2X51A 4Q45A 2AYEA 3HFKA 1ZCNA 4HHJA 1P5QA 4OZLA 4QCLA 1JWWA 4QOTA 4KHPF 4MAVA 4DS4A 3QPIA 1TKZB 4J5OA 3ISND 5B0GA 5AE1A 4R5PB 4DL6A 3OR1B 4XK8C 4OI2A 4FS2A 2D1CA 3MEGA 5KFYA 2F40A 2FJBB 3GMGA 1OSDA 1CG2A 5KT6A 1SJRA 4ZP6A 2E1MC 3DYAA 2YY3A 3NMRA 4KJIA 4WK3A 2LDIA 1HQUA 4TQRA 2HLTA 3SV3A 1SH2A 2UUAF 1WI6A 2GQ2A 5F8JA 1BQNB 5HP1A 2GO9A 2E9ZA 2XMUA 4RW7A 2LEPA 1Y00A 5LJ3Y 3Q23A 4CT9A 2FDNA 3NLCA 2I9SA 2K1RA 2AYBA 1OGBA 3F44A 5K14A 1XNQF 2WOMA 2BZ2A 5HWCA 2GFFA 1YJWS 1SJ1A 4B9TA 2C3MA 5C42B 1ULRA 4FF2A 2A3AA 4HVZA 1YRTA 4M95A 3PR4A 1LL6A 4G3IA 3KK1B 1X0FA 2ZH5A 1R31A 3MWBA 4OZ1A 1X4EA 2I38A 3DLHA 2XO7A 2R7UA 5KG3A 5LSRA 1UR9A 3CHFA 5LSOA 3N9UC 2VG5A 3O8WA