4ZPWR

Structure of unbound mers-cov spike receptor-binding domain (england1 strain).
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
molecule keywords Spike glycoprotein
molecule tags Viral protein
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
total genus 57
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zpwR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zpwR01
3SCIE 4XAKA 4KR0B 2AJFE 4L3NA 3SCJE 3BGFA 4ZPWR 3D0IE 4ZPVR 3D0HE 4ZS6A 3SCLE 4KQZA 2GHWA 4QZVB 4ZPTR 2DD8S 3D0GE 5DO2A 2GHVC 3SCKE 4L72B
chains in the Genus database with same CATH superfamily
1B99A 1NZAA 4DN0A 1DARA 5IWAJ 2ZUGA 2HBYB 4MMOA 3C6UB 4EGLA 2ZH6A 5EX3A 1MN9A 2GW8A 1YX2A 2N82B 1F3FA 1RWXB 1AB8A 2GV1A 3I96A 5CCLA 5DM6Q 2KXNB 4AUKA 3N6NA 4DRKA 5KFUA 2NPFA 2F4VJ 4RNFA 3N9UC 3LA0A 1JLFB 4CQ1A 1TV6B 1HWUA 1XERA 1GMVA 3MMAB 4EWTA 1CSJA 1Q7YT 3WIUA 3V6DA 2PE8A 2OMLA 3OR1A 4NL5A 2CVIA 1SJRA 1V3SA 5RUBA 2QLWA 1FWLA 5HANA 4TN2A 2GJFA 3L09A 1W9PA 5HMWA 2CRLA 3JQMA 4HT5A 1QPLA 3NRBA 2BJ9A 4AT1B 5HW8A 5HO4A 3D54A 3CIMA 4P7VA 1JLGB 4NZ6A 2HQCA 3K5LA 2V8GA 1FRKA 1RSCA 2HHSA 3HHLC 1RADB 2HFOA 4NX9A 4FNHA 3NTPA 3I5BA 4FF4A 3CD6S 3EVMA 3SEOA 2DNPA 2JEGA 4DROA 4ZPCA 4MH8A 1FKOB 4Q2LA 3HI9A 3FFIB 3DOKA 2J0XA 2GMHA 1N56A 4B3MF 4DU7A 2WONA 3OXLA 1HQEB 2M4MA 2OPRA 3KJQB 3CHEA 3LGMA 4N41A 4F3MA 2HGNA 3RM4A 4I7FB 1PKUA 3OSNA 3KK2A 2LU2A 3U1LA 2N4DA 4J9MA 4LQ9A 2L2SA 2F4FA 4LR9A 4NLTA 3QIPB 3A8KA 2RRAA 1AUDA 4OZ3A 1RJJA 4P75A 2DGSA 3IBWA 1ZU8A 3MFHA 4JV5J 1JWWA 3KDNA 1SQGA 3GPAA 2A6MA 3NXZA 2Q1LA 3NAHA 1RT4A 4X84A 3AXKA 2EBEA 5G0RB 3RTVA 3IG1B 1FX4A 2OHDA 2QL5B 1IXKA 3MECA 3PACA 1W1VA 2DSVA 3FBBA 3FSXA 4L72B 3RFWA 2X1FA 4F04B 1LQ0A 3M8RA 2XMTA 4I2PB 3JXVA 5D0HA 4H4OB 4ZHRA 4P8WA 2C2ZB 3ARZA 4DWSD 4I64A 4PKDB 2DT9A 1EP4A 3FVYA 4KC5A 4PYAA 2LVWA 4AQYF 2HVZA 3ILIA 4OFZA 2XQCA 4ETZA 4CLFA 2BJ3A 5IC4B 3HJVA 4X65J 3Q89A 3KAIA 1DY3A 1NJYA 2HBQB 4F25A 3MDYB 3WD4A 1TAUA 3U7JA 1HPZA 3VR1A 2G2YA 2VKZG 4QIVA 2ZQTA 3J7ZT 3JTNA 1LWEA 4P2FA 3FRYA 3H25A 3NGSA 3P8BB 4G50A 3MEDB 5AXKA 4JFJA 1EX8A 2HWTA 3CD5A 1MU2B 2DD8S 4DL5A 4ZIWA 4USTA 2W01A 4LRCA 4MTPA 4DZ6A 2VOPA 4WU2A 1S1WA 2CZ4A 1JLBA 4BHQA 4NLRA 2Q66A 1KR4A 2XI3A 4YMEA 1O5JA 1CULA 3DXBA 1Q81T 1RAEB 1A9NB 2H54B 3ZFVA 5LXYA 2RQMA 4G1QB 5CYQA 1YIJS 3S01A 1RAJA 4C97A 2OSQA 4BC7A 4GMKA 4HYKA 3T19A 2DIVA 2XS5A 4F4ZA 2DRAA 2XY5A 2AIRB 1I3OB 3DRSB 1NPKA 4IFVA 1TELA 3EZOA 1CQMA 2MZSA 5K14B 3QOKA 4Q22A 3DGPB 4IG3B 4LSNA 1N5YB 3SV4A 3P5TL 2J0WA 3D0GE 4NCBA 4ID5B 3H40A 5KT7A 4QWBA 3EX7B 2LEBA 3OBIA 3Q2SC 2CAJA 4BWMA 2DPJA 2HVHA 2FY8A 1WG5A 4KHPJ 2ZZTA 1LG2A 2HVDA 3BR8A 4A4JA 2W24A 5DO2A 1REGX 4F50A 1RZMA 4PWDA 3X1LB 4OZJA 4R8UA 4V19J 2XO7A 4JI6J 4O44A 4LF9J 2VFVA 3N6LA 2Y8WA 2BABA 2W8KA 4J9PA 1I5OB 4X4QA 1S79A 4L3NA 1LWCA 3EGZA 3MFIA 3RMEA 4TYBA 3BBFA 4G6VB 2ZDPA 2PPNA 1TL1A 3CVKA 1HJXA 3TP2A 1J2VA 3QFWA 3HM9A 4YY3J 5HL7Q 2AJQA 4DCPB 4M95A 4J91A 4ELTA 5D78A 4B3OB 1Q6UA 4JFIA 1CTNA 1XBWA 2YPYA 4JI8J 1Y9OA 1FNOA 4JI0J 4L74A 5F8NA 3G96A 2DNMA 4C4WA 2RQKA 1P6TA 2YX4A 4OZ1A 3CCSS 2B4OA 1KOOA 2Y9HA 4F4WA 1HXVA 1L3TA 1FK9B 1X4FA 3ARVA 3WZ0A 1TFYA 4DX6A 2MLZA 4Y00A 1SC1B 1QJHA 1ZZNA 1HKIA 2DNQA 2EFPA 3G6YA 2FJVA 2VQEJ 3EYZA 1VQMS 2GJ2A 2AWZA 1X9WA 3KG0A 2N7CA 5LSLA 3QLHA 2YH1A 4H54A 4ECQA 3DHWC 1GK8A 3H59A 3U02A 3GE9A 2X1GA 2Q3PA 4ZMMA 3J80U 3CJ2A 4EK2A 2HGMA 2IA0A 1C0TB 4TNSA 4A8KA 2O67A 2ACYA 1IKWB 4CWBA 2M2AA 1R8CA 4KO0B 4RL1A 1VQSA 4RW9A 2E5IA 2YKNB 1XMBA 4F4XA 2OLHA 2CWXA 3PKYA 2WM0A 3ENVA 4DSLA 1E6YB 5E3AA 3Q24A 1FRXA 1SXLA 2QYCA 1JCHB 4OHZA 1RWUA 4A8YA 3LALA 2ZH8A 2W7PA 5DITA 1BQMB 4RW8A 3HXMA 5IWAF 3FCWA 5KFPA 2NXEA 2GIFA 1AYEA 1JIHA 4O3RA 3JYJA 5A2QU 5KOWA 1REVB 3A13A 3CD7A 3PO5A 3ARPA 1TCOC 3UNGC 1WC0A 1TKXA 4AXJA 1RT6A 2RQCA 4WKRA 1R8HA 1R6VA 5KFVA 2Q79A 2JX2A 4L6V3 4DLEA 5LM7E 2C2EA 2RKIA 1KVJA 4I2QB 2ZC3A 1G4CA 2W9CA 2F4VF 1EETB 4L3KA 1ZAVA 2UUAJ 3Q8UA 3T6JA 2VG6A 2EWHA 3JYMA 3WL0A 2PSZA 4ECVA 1PILA 3Q8YA 1NM2A 2LXIA 3FCVA 1WSRA 4DV6F 4Q44A 2AYGA 1QUVA 5F9NA 4IT4A 1RCXB 3B78A 5A8RA 4B9UA 4QU6A 4DR1F 2ZJRQ 2R2TA 4JYSA 4AD6A 3KAHA 5AXNA 1SI9A 1DAXA 3MDFA 3ZZZA 2HRYA 1JX4A 2FVSA 1IR0A 1RABB 4KHMA 1D3WA 2GQQA 4Y2AA 4GVBB 1D9AA 4ODQA 2WAQD 2C3OA 3NNHA 3KLGB 3IS9A 3VZIA 5KFSA 2E1AA 4HDHA 1FFSB 3WQWA 2EKNA 1ZTWA 3KLHA 3QPIA 3HHNB 3IP0A 1RWOB 5A6WA 4DWSC 1C4AA 1YWXA 1HHQA 5A76A 1LFWA 2V67A 2YNIA 1APSA 2MJUA 1RHQB 1ELOA 3ILOA 2L41A 1F2HA 1UVNA 2G2ZA 4YDDB 1CJVA 1LNQA 2V4QA 1DTTB 4JI2F 2LQBA 1O0PA 1F5AA 4K4SA 3PFOA 2NREA 3W7BA 3G87A 1Y0OA 3RBDA 5KFBA 5HW7A 1HR0J 4DR4F 3LP1B 3KAFA 3W66A 2AX1A 3UI6A 1KFSA 2R9LA 1J4HA 2B7BB 5CH7B 3FJ2A 4ZVPB 2FDNA 2VFUA 4USVA 2QJ3A 4OV6A 3PYGA 3M30A 3HK2A 3DYAA 4DR6J 2ZH3A 4UOFA 3GR0A 5HW6A 1KWMA 4CLSA 5LL6d 1Y5NB 1R0AA 2BJEA 4QWCA 2ITKA 2B8QA 2OD4A 3TX0A 3SCJE 2EXUA 1S9EB 3SDEA 4WE1B 2MB0B 2KFZA 2MDAA 1IR2A 1LL7A 1Q8KA 1CBKA 2ZBPA 3SSSA 1R89A 2G8ZA 5GQBA 5I3UA 3QGHA 3G86A 2AT1B 1N54B 3D1HA 2N87A 3TAMB 4CLKA 3CJKA 3UDEA 1GMWD 1Q95G 2RU9A 2F63A 4RW4B 2AU0A 4TW6A 1KT0A 1VRTB 4FF1A 3IC1A 1J27A 2J76E 3OT9A 4YHHJ 4OYZA 4RPFA 3D2WA 1S49A 4U95A 2JDJA 5HQLA 3C14B 1T3OA 1RAHB 1T8EA 4YEAA 5CQGA 2ZR4A 2DHAA 3GU0A 2FJEB 3L9ZA 3CD0A 1T03A 5FLXU 2OI2A 2MKCA 4ZCKA 3TZZA 2DHSA 4DV5J 4ILLA 2BANB 1N36J 1FKPB 1RBLA 1JKHB 2VBYA 4TU7A 2V4JB 5DG9A 4S3JA 3NGDA 3GONA 1HNIB 3MMCB 1FNXH 4K0KJ 5DZ7A 1QPFA 1U1OA 2WB1D 4J9QA 3MPWA 4JI3J 3RB4A 4Q8FA 2IC3A 3LO3A 2CDQA 1W1TA 1YJ7A 4KSEB 2XPAA 2GQ2A 2HFNA 2I2YA 1HNVB 2DISA 1OWXA 2OMOA 3H5SA 1AZSB 3AROA 2EKYA 3RAQA 3ENWA 2EULA 1NH8A 1KQGB 4ES1A 1Q82T 2O5DA 4Q7AA 1DJ0A 4UT4A 4R25A 2BJDA 3R5CA 2VDHA 3HT0A 3HPOA 1W1YA 2NUUG 4O2TA 4CH1A 2VFTA 5GAGU 1N33F 4B3TJ 4RKUC 2YPZA 5KG0A 1YBTA 3BO4A 3LP0B 4PR6A 1N34F 4RNMA 2OPPA 1FKDA 1HHSA 4ZJQA 2H3EB 3TA2A 4IOAQ 3JXOA 4C2MA 5CD4A 1XNQF 1T02A 4NI2B 4LVOP 2UVWA 4DR7J 1ZOTA 4ANCA 4M5JA 1HBMA 4F3QA 1I6JA 3OL6A 2F3JA 1TL3A 5FIIA 2PV1A 2BKNA 3FZ2A 5E3CA 1IKYB 4YY3F 1MN7A 3G8QA 4F0KA 2XMMA 4CLWA 4DSEA 2UXBF 3V6JA 1T7PA 1NBEB 5LOQA 1U0HB 2KJWA 2G0IA 4AFFA 3WDOA 5DS7A 4OHWA 1WC3A 2OSRA 3TO8A 2VHGA 1D7JA 1ZCNA 3BM7A 1NDLA 1SPBP 2XULA 4JFKA 4Y65A 1Y00A 2PFDA 2RHSB 3DKDA 2JRSA 1H0GA 2BE7D 1LXNA 3M05A 5SUHA 4PUOA 2GX8A 2YWFA 3JQKA 4FN5A 1H2UX 3DLGA 4JYAF 4H4KA 3ET6A 1NSPA 2EFOA 4ZVOB 4URIA 2W7OA 3I32A 3PRBA 3D5MA 4LFBF 2M5YA 3U27A 2VQEF 3R97A 2XP6A 2EG1A 3D66A 3F73A 2ZOFA 3G82A 1KEKA 4OZ0A 3T1HJ 3OFHA 4QT3A 2APOA 2VASA 1RWMB 3SCIE 5F8JA 4A8QA 1X0FA 3HP6A 3ARWA 1HWIA 3BV8A 5B0AA 3BN4A 5LXRA 3W5ZA 1Q1KA 5T14A 3MM6A 3M2VA 4W90B 4Z2XA 3OD2A 4QPTA 1X60A 1YJNS 1RA7A 5HJXA 5KFMA 3WBZA 1WF0A 5FDLA 4J90A 3UI4A 2QA4G 2AMCB 1JNSA 2PI5A 4EMDA 2V34A 1VQ6S 2BQRA 1VOMA 3CJSA 1UVLA 2BW2A 3FCHA 3BO2A 3FDSA 3H7HB 3LQVA 3ARUA 3TQEA 3G4SS 1HWJA 5HBMA 3UQAA 1UWBA 3W5XA 4ZPTR 2OPQA 3KJNB 3BJYA 2OEJA 1RAOA 2RF2B 1FERA 1YLXA 5BYRA 3I9ZA 2JFKA 3ZZRA 3DOKB 1YDLA 4G3IA 2VONA 4TX0A 2HNDA 2WONB 4NYOA 3IA0A 3OA5A 2OPRB 5LMNJ 1T9UA 2XMUA 4PAAA 1BL4A 2H65B 3ZZ0A 1KHWA 4RUCA 1RT2A 3KK2B 2CKWA 2BXJA 4L76A 1NPPA 1XK8A 2BQUA 4QT2A 2E66A 1Y5LB 4LRFA 3D6HB 1E9LA 3FBCA 4KTQA 4QU7A 2YNHA 3M2UB 1JNRB 2C2KB 2XG8A 2J6TA 3DHXA 3IGVA 4CCHA 4FYWB 4QJVA 3CCUS 4OYMA 1VRUA 2KE0A 1BWEA 2RUQA 1VQNS 3J81Y 1FKLA 3D1QA 2RRNA 2JFDA 2JVOA 3MECB 3VGTA 2ETNA 1ACMB 2M8DB 1RYSA 3CDBA 2CPYA 2DY1A 3O5PA 1F2GA 5H9FJ 1W9VA 4QIBA 4WP9A 4ZHRB 1VBZA 1XN9A 2MQNA 1UAWA 3C15A 2KT3A 4ECRA 4XDCA 3MF5A 2HLTA 1WOSA 2EFVA 4A46A 2RHQB 2RMLA 4JI4F 4LFCF 2RDJA 2F23A 1SH2A 4Y2IA 1RU2A 2GQCA 2R7TA 3G6ES 3PJ9A 1TFWA 1HPZB 4KRWA 2QRRA 3D6MB 2OLWA 2RT3A 5K8MA 1H98A 4CLTA 1U1RA 2J9DA 5CABA 2IJNA 4HLBA 4HL9A 2WRMA 2RS8A 2BACA 3A4TA 2VDIA 3HSJA 2Z56B 2ZITA 3Q86A 1SC3B 2GMLA 3TW0A 1JLBB 2XI2A 3QJJA 1GMUA 4W98A 3BZQA 1CULB 2P8IA 1RHUB 1HNXJ 4ECXA 2FLLA 2ZH9A 2XS2A 2W2PP 1FWKA 5CYQB 3JQJA 2DKOB 3HULA 5KFAA 3MI7X 5IFMA 3CTRA 3EJMA 3UCZP 2YNGB 4HTIA 3AB2B 4IFVB 4DFPA 3BGLA 1S0MA 3VTIA 2GO9A 1F3VA 2CJQA 1TMMA 1X0PA 1FKBA 2V94A 4DV5F 3NWRA 2W4DA 1B0TA 4DR2F 5D15A 3CH9A 1GMWA 3DLLQ 2QL7B 2VQFJ 4I67A 1X31C 2Z8QA 3ZNJ1 2RDIA 1WDDA 5KG6A 3AOAA 3M8ZA 1UEKA 4O3PA 4DUYF 2HVEA 4C8NA 2IYGA 4O44B 3I0SA 2E1RA 4DMZA 1U02A 3OTOF 3UQIA 3NAIA 1XIQA 1J4IA 1LWCB 1IQTA 1UFWA 2DEJA 4ZJOA 3FZBA 5E41A 2WVDA 3ZZPA 3D3CJ 1WI6A 2O01C 5B0FA 3IWNC 4P52A 4Z2IA 2E5HA 8RUCA 5DRKA 2XCAA 1WAWA 4KPCA 3UO0A 4B3TF 3MR7A 5F3TA 3L95X 2E29A 2LQ8A 3KLFA 5E3PA 1N5VA 1RBAA 2FJAB 4ILRA 1J5OA 2FQQB 4EBCA 2ATCB 4PQAA 4CM2A 2VICA 3KG1A 4PG6A 3CUNA 4ED8A 3C16A 4IQCA 4FNIA 4MK9A 4MKVA 4ZPDA 1TU0B 2PD1A 2EPIA 4DWIA 2ZNYA 1JNZB 3FAPA 1G2EA 4DV2F 1NMVA 4K4ZA 2NPIA 4UY85 5M2RA 4E98A 5DIUA 2WBRA 3TZYA 4UOCA 2J6UA 5JUMA 5HJYA 2YKAA 2F21A 1OY6A 1CG2A 2ADCA 2JZ5A 2OD6A 2R7VA 4TXSA 4LF8F 1S12A 1MSWD 2UV8A 5E5NA 1G6BA 4TU9A 4RUHA 2FTRA 2DPIA 2DNKA 3DXSX 3CCJS 1CS4A 3NOGA 1AXQA 3B4DA 2XMVA 2CQDA 4X64J 4J9OA 5EWFA 2IRYA 1I94F 1CVJA 3KJFB 4YN3B 2W4PA 3CCVS 2KU7A 5DETA 1FDAA 4OYPA 2MEWA 4QQBA 2AEMA 2UXCJ 2LGOA 4RW8B 4U6PA 2I8EA 1FKFA 3O5OA 4LMZA 3M32A 3MURP 2XYPB 4C7QA 3NGRA 1RDRA 1YGYA 4ELUA 4DR5F 3HD2A 2GVDA 1TKXB 1RT6B 3ENQA 3O5QA 4Z7YA 2XWYA 1YW5A 2FUG9 2DT0A 3RW6A 2RKIB 3CE8A 4EFAC 2W9CB 4IO1A 3TUZC 4ODPA 3QFHA 4HBEA 2VG6B 2DEIA 3DOMA 5D8HB 3DI6B 3NNCA 1OS5A 5J1EA 3MAQA 1YITS 1WD6A 5F8HA 3HVAA 5A8RB 2HQ3A 2EVZA 1EAYC 4HHJA 4I4BA 1BXNA 1MMNA 3R8YA 3EPGA 4A8SA 3MPDA 4LREA 3TNVA 1WC1A 2XZWA 3W64A 4B9NA 4OX7A 2VG5A 3PYDA 1B4SA 2XC9A 1JQGA 4CT8A 2LA4A 1RT7A 4LAYA 1JLEA 4MJKA 4KR0B 4V1Ak 3OFGA 3CULA 2E7WA 1MG7A 3IS9B 3QT6A 1RWPB 3DRRA 3VAJA 1S0NA 1NB7A 1H0HB 3O8WA 1HLWA 4A48A 3KLHB 2A10A 1RAIB 4KHRA 1VHIA 3T6BA 2D41A 2L9DA 2CQ4A 4L75A 2ZM6J 1UVIA 1PG5B 4GC7A 1NK4A 3EGWB 2VA2A 1ZPWX 3RR7A 1CJVB 4DQRA 3W3SA 1ROUA 1LWFB 1QY7A 3R5DA 3W9IA 1CJKB 3L7UA 1D1UA 2BEFA 3GMGA 1D9DA 3OV7A 4Y0FA 1S1XA 2ZE2A 4P7TA 4O3SA 2FZGB 3AJDA 2LKZA 1FKAF 4ZVRB 3M30B 1Q1CA 3DYAB 3NCRA 5KFZA 3SQOP 4WF9Q 1R0AB 3MM5A 3FKBA 1DBDA 4FP9A 4GO5X 1YBAA 4ANDA 4NMXA 3SDEB 2UU9J 1RHMB 1SL1A 1ZM3A 1SKRA 2J5AA 4IDKA 1FWPA 1K47A 3SIPB 3ILLA 4UW2A 4Q2MA 3B8SA 4WKHA 1JNEA 1U26A 4AYBD 1ZZFA 2I9SA 4W4MA 1FVSA 1T9YA 1XQIA 4DPTA 1E6RA 5L9XA 5I3UB 2XP9A 5A6PA 3CJKB 1QD1A 3M6WA 1ZAXA 3D1OA 2CXEA 2RUCA 2QGFB 4WKYA 2B5JA 5HMXA 1HNZF 1HKKA 3Q8RB 1FO1A 4W9PA 1I1GA 2LXFA 5C42A 4X4NA 5C5JA 3RZAA 2CADA 4X4VA 2UVUA 1E6PA 4ED0A 5C7PA 3UFCX 3CWJA 3ITHB 4LRAA 1JJ2R 1PIEA 5K20B 1VFJA 2BM0A 1MROA 1U48A 3PFEA 1JLQA 2E7XA 1HJVA 2J9DE 3KUGA 2IA6A 3UE2A 4UF4A 1F9FA 4YFUA 2QLJB 4BBYA 3UVJA 2DHHA 4C3LA 1WTFA 2OAUA 2YKMA 5D4LA 2W1BA 1XJWB 2BJ7A 2RNEA 5C24A 3KK3A 3LGHA 2VBWA 2KFYA 1IKVA 1NWSA 2UZAA 2IC3B 2UUBF 2IVMA 5KG1A 2M52A 2B5UB 3QGGA 2DSUA 5B0DA 3KAGA 1ZH5A 3CT9A 2CIMA 2LJ4A 4FZVA 4DRMA 2R4FA 3MOJB 2DY9A 1KBRA 3HFKA 1VCTA 1HFEL 3ARSA 3Q23A 3IRXA 3MM7A 1HNWJ 2BVZA 4ZVSB 1MWZA 3MD3A 4IRKA 2GIRA 3R9LA 4ZCIA 1DRZA 1Z2ZA 1OGGA 3I55S 1Y7PA 3PM9A 2KM8B 2OPPB 1OYEA 1DQ9A 1VQ8S 5B7WA 3VGUA 1NK5A 4P71A 4RWXA 2CFXA 1TUGB 1WG4A 2DXDA 1SUQA 1N6QA 3PIPQ 2VG7A 2F1FA 2HS4A 1HBMB 3GIRA 4M1KA 1TL3B 5DQIA 1FJCA 3OL9A 4M5DA 3PX4A 2BRKA 5IM0B 4CLYA 1E44A 1JLCB 2QO3A 1D7IA 2VUGA 2G1HA 4X4UA 1LK7A 2E5GA 3TCZA 4J4OA 2AOSA 4LFAJ 2HHWA 2OH2A 2E7VA 2CPEA 1NSQA 2KKHA 3B4MA 4A47A 5KT6A 2W9BA 2B9WA 1N88A 1ZBTA 2XY7A 5JH8A 3R3TA 2ZR6A 2D3OR 4Q0BA 2DPEA 1M0SA 4DEZA 3P5BP 3BR9A 3DLGB 2C3UA 3ET6B 2WOMA 1LEOA 1Q6IA 5M2PA 1H73A 1BHNA 1IBLJ 3MM9B 3UN3A 4WFNQ 4K2JA 3G82B 3BREA 5KFOA 2B8PA 2G0CA 4PG7A 4JV0A 5KFGA 1U1NA 4Y2MA 1SV5A 4OYWA 4TY9A 2XGPA 1K1QA 2FVPA 4LF7J 1TK5A 4ID8A 2EC0A 1SB6A 3MM6B 3M2VB 5CHCB 2CG8A 3M4XA 2MQ8A 5J2NB 7AT1B 3KJVB 1YZ7A 4IRDA 3W8PA 2QEXS 2E9RX 4X64F 2DXFA 2N7YA 5FDLB 2P9EA 3I5AA 1JLAB 1JJ4A 2ZHOA 5T41A 1N32J 1KQSR 1MMDA 2HNYA 3B9AA 4NZ0A 3TJ8A 1VQ5S 3OFEA 4MNJA 3O44A 1YG0A 2FLNA 1FKRA 5C25A 5ETMA 3TUJC 5HBMB 3EPIA 1UWBB 3ZNUA 1ZM9A 3OL8A 2OPQB 3VGVA 2VODA 2ROPA 3A3PB 1ROFA 1SH0A 3I87A 4N76A 4PG5A 2DXEA 1XNRF 2SXLA 2XZTB 1KQFB 3FEYB 2XO6A 3J7A1 2Z2LA 3GYNA 1OQ6A 1Q5VA 1M1GA 3MUMP 1KLNA 5L8RC 3V6KA 3MEEA 1FX2A 4KBIA 4ZPWR 2HNDB 3DNCA 1TUVA 1NZ8A 3A8JA 1RTDA 5CXTA 1F40A 4OX8A 1RT2B 4N47A 3JSYA 4KIAA 1FESA 4TYAA 1QUPA 3OXFA 3LH2S 5FD1A 5F8GA 2R3VA 4RNHA 4U8VA 2BYCA 4ZITA 2QYGA 2JL9A 1U79A 5D4NA 2CJYB 4I6YA 3IGNA 4P74A 2VKRA 5DZ6A 1R7IA 5HVGA 2YNHB 1FD2A 1IJFB 3BBCA 2CNOB 3BGFA 3ARQA 1DLOA 3PY8A 3CF5Q 1VRUB 2IRUA 2X1BA 4FBUA 4OZ5A 3VAIA 5KFRA 1U2FA 1VMBA 4B3MJ 3O3LA 3W9HA 4DPOA 3D3BJ 4EZ9A 2KYXA 2YH0A 4FXDA 4PCQA 4CO4A 3C46A 1YVFA 1HWLA 3IAM9 3C15B 3AHPA 1H2VZ 3QO9B 4CNZA 3ARYA 5L9NA 4YDXA 2PEBA 2IDEA 3GFYA 4XIUA 4DRJA 2P6SA 1U1PA 2QA2A 4B17A 1UJ5A 4NLWA 1DTQA 2AHOB 2Z2MA 5KFNA 1FKJA 4LF4F 1D2KA 4C6AA 1VQ9S 1OIAA 2FLPA 2R42A 1ZBCA 5JVGQ 3BDEA 1EIBA 3H20A 1BUXA 4K2XA 4U86A 4FDFA 1RA6A 3PEJA 2VIHA 2XSFA 2UU9F 2YX1A 4FF3A 4KFBA 4DF8A 3FMWA 1TMJA 4EU0A 2H5IB 4AQYJ 4F36A 3EICA 4MYUA 3HKZD 1U0SA 2RSQA 3EDQB 4QR1A 2P4VA 1PBUA 3TQ1A 4F4KA 3EVOA 1HYSB 2OJ3A 2A0FB 2CPFA 3CJQA 3QSYB 2DH7A 1VIXA 5GVQA 1QDUB 1XMQF 4HEA9 3I6PA 2B3TB 6FDRA 2L48A 4TLRA 1IBMJ 4OV1A 2XP8A 1F0XA 4Y3CA 3ILJA 4CYUA 2M8HA 2VOOA 1Q8IA 3H4DA 2FAPA 2MKYA 2DSZA 4CP5A 4J9NA 3QJLA 3M6UA 2AJ4A 3WIJA 2HS3A 4KYZA 4RWWA 3MEGA 3GFZA 4DUZF 4CLPA 1RT5A 1NKEA 2D74B 4PTMA 4LF2A 4WU3A 3I0RA 4NEYA 3DLBA 3W62A 1BGXT 5IT4A 2E5LF 1Z4UA 2ZVIA 1Y0HA 1S0VA 3GCWP 2O66A 2M7SA 3BGUA 4CM0A 2IBKA 3I0SB 2K8IA 3NS6A 1IBCB 1M1KT 3ETOA 5BYQA 4JI5F 2OTJS 2GGPA 4Q45A 2YWKA 3JS9A 3M9OB 5K8PA 3SQGA 2RRBA 4HACA 5AE1A 2CQGA 4DL0C 1NK6A 2W2QP 2KHDA 4K50A 5DDPC 4NLYA 3TJ9A 4EBEA 2FDMA 2FVCA 3D0HE 2YWGA 4FVMA 4J4NA 1FF2A 2KO1A 2KT2A 2O92A 1F9HA 3GQCA 1SC6A 4FYDA 3KLFB 4DS5A 2AJFE 3CGMA 1UETA 5CAAA 1J5OB 3HX9A 4E8UA 4DV4F 2OFHX 2F8MA 2U1AA 3PEHA 4PPZA 3C16B 1HBNA 5KAKA 1AFJA 5DJBA 3T5KA 2C3PA 1C1CA 4H4MA 4MFBA 3C8YA 4XAKA 2XNRA 1IKXA 1U1QA 1M5HA 4ODKA 4RO0A 4DZ3A 3WX8A 1FRHA 4O3OA 1FJEB 3KLIA 1K9TA 3LPYA 1WEXA 2HSEB 3IK8A 5THWA 5KG7A 3FBEA 1XTZA 4UUXA 5KFJA 4P72A 3KWMA 4UOHA 1JK9B 2UXDF 3MMBB 2DRDA 1IX5A 3SSRA 4P9SA 5ETSA 4ZPAA 4R5PB 3QGIA 1TZ0A 4RR5A 4BS2A 3JYTA 4QIGA 3UF8A 3IWLA 1CS4B 3RAXA 4PXDA 2WLYA 4GC6A 4U85A 2A3JA 4YB7A 2XCPA 5ETRA 3KABA 3KCEA 1XEZA 1ZPVA 4P6QA 2FPHX 4I69A 2EC2A 1ZA2B 2CYYA 1FDBA 2EFGA 3P3DA 5AT1B 5LSRA 3RAMA 4O4RA 1LJYA 2D3UA 1AT1B 2R8KA 3M32B 3MCSA 3ARRA 4K8RA 4DQIA 1P27B 1JXLA 1W2BR 4MIWA 2GVDB 4B3RF 1RAAB 1TKZB 2AGPA 3GJQB 1RKJA 2VB6A 5BXIA 5D6GA 3V81A 2RD5C 4OMFG 1C1BA 1S97A 4KKOB 4DV3F 2E5JA 3S1TA 3VAFA 5AJ3F 4KGKA 3R27A 2PIIA 4O0NA 3DOMB 5DDQC 5J1EB 3HZEA 1V6HA 4O23A 4LAWA 4WP3A 4OZLA 2HRTA 1EIYB 1YBUA 4PABA 1U6ZA 4X4PA 3FNNA 1D8ZA 2XP5A 3GG0A 2XLKA 1NWTA 2LEAA 2HMIA 1T95A 3W5YA 2GAGC 1RT7B 2YBTA 2FC9A 5IC6B 1JLEB 2MLYA 2R7UA 2ASYA 2Y1RI 3OPKA 2MMYA 2M1IA 3GWCA 2YXLA 3W4RA 4C3KA 4ZS6A 1FTRA 1X4EA 3OJUA 3EY6A 2B6AA 9ATCB 3O5FA 3DRRB 1TR0A 3K5NA 2VF3A 2JLFA 4DU8A 4DPWA 2DT3A 1T05A 4A8WA 1CQNA 2MKHA 2HGLA 4DV6J 2AYBA 4MIBA 3UDCA 2MLXA 3K7RA 3M9NB 1NJXA 4YB6A 5HUAA 1VK3A 3ZO7A 3CJ3A 2YVSA 1NB2A 1TV6A 2ZHAA 4DR1J 4ZLPA 3GP9A 1SC4B 3M8QA 3AD9C 1PO6A 3CMES 2L08A 3O5LA 4ZJLA 3Q0AA 2CQ2A 4MT1A 1NCLA 4L73A 1M1HA 3EXYA 3GSDA 1H72C 3PYEA 4MNKA 1GXLA 1CPZA 3NCPA 1S1XB 1W9UA 3T5JA 2GFFA 1FA0A 4USIA 5L1IA 4JV1A 4PPDA 2KI3A 1WELA 5D0RA 3IRWP 2BUNA 3T9NA 3CO9A 4QBUA 1QSSA 2QLFB 3NL0A 6FD1A 2IIHA 5DQHA 3OOBA 5GMDA 3MM5B 1FKOA 1RXOB 5I42A 4LIRA 2KZMA 4GIVA 1VC5A 1KQKA 4JI2J 4IDKB 3JAMY 4ECSA 2FB0A 2V63A 5CZXA 5IS2A 1DURA 2VC0A 2WVBA 4U7CA 1KFDA 1DHMA 5JJBA 4WIQA 4P2SA 2RAQA 4DR4J 3F0NA 1A6LA 1WNOA 5DDOC 2E1PA 5KFYA 2B4PA 2J0QD 3QIPA 1BC6A 2NLWA 2C2RA 4J9VA 1QE1A 2W25A 3HVRA 2ZH5A 1VK8A 2B5JB 1W1PA 4IOCQ 4W9QA 1S76D 2DR5A 4ES2A 5ETLA 1X6NA 1B7FA 5C42B 5EN1A 4F4AA 3MPYA 5A8WA 4AL7A 1OSCA 1VS3A 3CDEA 2UUCF 4N8NA 3IG1A 4ELVA 2YKQA 4K7QA 2ASLA 2XMJA 4IPXA 3GB0A 3TJAA 4DPUA 5HI7A 3DDNA 4KGMA 4USMA 1JLQB 1J6YA 2F4EA 1TVRA 2LP4A 4ED6A 2CJXB 3KNGA 3HHLA 3UVJB 4NCAA 2YKMB 4OYAA 3AH6A 2RDDA 4CZCA 5C24B 3K58A 5E0OA 2QE5A 4LUBA 3KK3B 5SZTA 3UR0A 3U1MA 1IBMF 2JNJA 5B0BA 4AY1A 2G1DA 4ED5A 3EIPA 1IKVB 3L7OA 4K4VA 4CO5A 1HI1A 1KLMA 4O3QA 1HW9A 3T1YJ 1NU4A 1S1VA 3BPDA 3BSOA 3K0JA 2QC3A 4OI3A 4N5SA 2WSCC 3K8VA 2F8EX 4ZVUB 2V2KA 3BMBA 1LG1A 1FKGA 1E6VB 1L1PA 1NWUA 1GH8A 3H0PA 1PBKA 3IRXB 3MM7B 3CDAA 4M5NA 3NP5A 3CSKA 2C2MB 4WFAQ 3LP2A 3BGRB 2B56A 2HQGA 1GT8A 4DSKA 4JFLA 4KJIA 5HLFA 2A18A 2KR7A 4F4YA 4ATNA 1N0UA 1HI0P 5KFTA 2HFUA 1SYTA 1HMVA 5I3PA 3VCDA 3GZ7A 4LSLA 3TYTA 4B08A 1YJWS 3O5KA 2DK2A 2RJZA 2C22A 2IM2A 5J2QA 3QT5A 1SUQB 3DRPB 1N6QB 2VG7B 2O1PA 3PG9A 4ENOA 5J2MA 1RCOB 4Z37A 1S6OA 2CPXA 5DLGA 4WPAA 2R7XA 2DNHA 2V8VA 4M5DB 2Y78A 2QMUB 1T9VA 4DL2A 3E8OA 2GHWA 4UQGA 2XMAA 1VI7A 4PYDA 1P5QA 4ID5A 1N33J 2VC1A 5IXUA 3E51A 3GYXB 5F41A 1CEZA 2EBGA 2MYFA 3HSDA 1ZM4A 1N34J 1UKUA 2OEMA 4R0XA 1IM4A 3GTYX 2W9BB 1P9YA 1FJ7A 5EWGA 4ZOSA 3GIKA 4QW9A 1NKBA 3IO1A 1XNQJ 2R7RA 4ZCMA 2Z57B 4J37A 4DV1F 3G6MA 3KKFA 2WOMB 4RU2A 3QRPA 4JI7J 1BQXA 1VQKS 1P8GA 2HURA 1U45A 3TUPA 1HD0A 2HHHJ 5GAEU 1KHVA 3RGIA 4C0BA 1Q6HA 3PV8A 4IR9A 1ITPA 2BKOA 3ZTPA 3HFZB 3GYGA 2KH9A 2UXBJ 3W65A 3I82A 2DYAA 3A12A 3QWUA 1YJRA 2IRXA 2DGVA 1JXVA 4EZ6A 1AFIA 2EK6A 4QIWD 3HD1A 2MF9A 1NDKA 2ASJA 2D69A 3DOLA 1KRPA 5IV4A 2X1AA 1UP1A 3H2VE 3R5JB 4M63A 4CRJA 1UMJA 4KT0C 4MSPA 1XR6A 3Q8PB 1PGZA 1SQEA 2QT7A 3BXWA 2DBBA 3J81U 1Q86T 5L46A 3AS2A 1EQ3A 5AE2A 2BR0A 4JYAJ 4EI2A 4UOGA 2HNYB 1UJ6A 1R0BG 2GCFA 2MJNA 4LFBJ 2VPXB 3UI3A 3FY1A 4ZVGA 3BPSP 2KDOA 1QAJA 1B0VA 4KGXB 1NUEA 4NXNJ 3DM2A 3IKDA 3K8WA 2YQ1A 1WG1A 3TC5A 5MLCV 2FJDB 4ED7A 3HLUA 4X4TA 2R8IA 2D9FA 5HMYA 1YQHA 2DGOA 2ZC4A 2D9PA 3TVKA 2GC8A 2G9OA 4BF8A 1GQEA 1SH3A 5L1LA 3PKMA 2XY6A 3MEEB 3K5MA 4XO0A 3K2YA 4TW8A 4RX6A 1WOOA 1C2PA 1K73T 4NOHA 1SJ4P 1CLFA 1PJ6A 2C3YA 4JBCA 2WB4A 3DCAA 1H2TZ 2V6AA 4WTOB 5EX0A 5IT9Y 5HROB 1BQMA 4HTJA 5B08A 2KFWA 2CQ3A 3H2UB 2RURA 4AL5A 3KZ7A 1F8AB 1P1LA 3RJMB 4YOEA 3THPA 3NI6A 4Z2KA 4NCGA 2P6TA 4RW6B 2EW9A 5E7OB 4ZLLA 4LBIA 2O9OA 1KSPA 3I4PA 1C4CA 4IG0A 4HDGA 2R2RA 4OIXA 4I2QA 2DG9A 1EETA 1MW7A 4IRCA 2ZJQQ 5KFKA 5L39A 3ALGA 2KB2A 2RE1A 4LT6A 1XWLA 5HK4A 5F8MA 5ETOA 3NMAA 3MPUB 3CCLS 3MOZA 1FVQA 1NMEB 3NY0A 3EDRB 2JZVA 4IH6A 2JJ4D 2DCUB 3KXDA 2D7SA 2CA9A 2D3O1 3MTJA 1SJQA 2H4YB 3VWSA 2HK2A 4UY8T 3FUYA 1AA1B 1DTQB 3VV2B 4G1PA 1FD9A 4HR2A 3PX0A 3DLKA 3DGVA 3FBFA 3QGPA 1S57A 3GR1A 2DTJA 3QJPA 2IMOA 3H4BA 1HJWA 2AW0A 2WVFA 1NWRA 2V2QA 1FD8A 1LKZA 1V3RA 1WSVA 4MTVA 4DV7F 2H51B 2WW4A 2PT0A 2G0JA 2LLZA 3R5AA 4NLSA 4WJBA 8AT1B 3AD8C 4KFBB 2JEIA 1FKIA 3LF0A 1UPPA 2NSCA 3HDSA 3L7PA 2C2OB 3ZXWA 3N28A 3SYZA 2DGTA 1NK8A 2U2FA 3QQCD 4JI4J 4HVZA 4MIAA 4LFCJ 1SKSA 1E6NA 3BEGB 1LW2A 3QIDA 2CPDA 2F7VA 4WJXA 4GKJF 3CHFA 2R2SA 2H1YA 6AT1B 2AD9A 2HAIA 3I9V9 1RGVA 4UTGA 3PW7A 1PYTA 2FZCB 4NLQA 4JV2A 4CYUB 1MNEA 4B3SF 4U7UD 3LGNA 2G2OA 3CC4S 4WZQA 5LSOA 5KFIA 3V2UC 2H9ZA 2VFRA 4KE5A 1HWKA 4WKAA 3MEGB 1C0UB 1WUUA 4YS2A 1RT5B 4ODLA 3NS5A 1ZM2A 4OHYA 2DH8A 1S9GB 4C0HA 4KGZB 4OJ1A 2MPHA 5DQGA 4PEOA 1GFWB 3PW2A 1VQLS 4OZ2A 4V19X 3ULHA 2D1CA 2V4RA 2C28A 4HKQA 1QM9A 4C11A 3QYYA 4GKKF 1LK5A 3UDLA 2YTCA 3UN2A 2K7JA 1S6QB 4QIEA 1FXLA 2PDAA 2ZWPA 3TAMA 1UTAA 2HHPA 4ML4A 2ZDOA 2W9AA 3GSIA 2RU3A 2XEXA 4CTAA 1D8YA 2ZVSA 4TQRA 3E01A 1FRMA 3WD1A 3T1YF 4DWSA 3Q83A 9RUBA 2GGPB 3HF5A 1VRTA 4OI1A 1BQNA 5FJ4A 3SQGB 1T9TA 5K5MA 5CYJA 1LV5A 3LUOA 1X7VA 3UW1A 3OSPA 2KRRA 4DR2J 1LOUA 3ENAA 1OQ3A 3AS1A 5DG7A 3C6TA 5AXLA 1XMOJ 1ITXA 1R8PA 3N6MA 3R7NB 3IR7B 2XBPA 4LAXA 1KTVA 2IM3A 4MK7A 2MZRA 4ZVQB 5B0CA 3EVWA 2WHOA 2XSJB 2LEPA 3ELHA 1JNDA 4DUYJ 2MTLA 4RUBA 4PG8A 3KHRA 1HBNB 4URSA 1C1CB 4H4MB 4MFBB 3OTOJ 2PV2A 2XP4A 2ALZA 2HHQA 2MQMA 1HNIA 1IKXB 5EUHA 2JC1A 2XMKA 4ICLB 3Q8SB 5BR8F 3MUVP 2GAHC 4FXWA 3KLIB 1U49A 3SCKE 3VVTA 1VF8A 2NQPA 4F3OA 1BWVA 2V9KA 2ZFHA 3NMRA 1U6BA 4QOTA 5ETPA 4C02B 2XM3A 5H9FK 3BBBA 3V6HA 3PNIA 4NA2A 4I1TA 2AYEA 4ODRA 3QATA 2Q5AA 2F5GA 1L5UA 4K4UA 4NMLA 3W2VB 3DC2A 2QL9B 2B9XA 2UUTA 1WHYA 4J9LA 4ZCLA 1FI4A 3LP0A 5KG5A 4Q5VA 1UR9A 3CEDA 1QAYA 3BSCA 4ZP7A 3QT7A 4JI7F 1FFRA 3G2XA 3U1NA 3O5IA 1RWNB 4DV2J 1K44A 1O8BA 2HHHF 4DS4A 3EUNA 2HBZB 4XPCA 3C3LA 2IMWP 1PINA 1X6LA 2IF4A 3BSNA 4NI2A 3J7YU 4TKTA 4DX5A 1R27B 2DGWA 5GAEI 3THTA 2XHCA 4DSIA 2CPHA 3QZ8A 4LF8J 3C19A 1IKYA 3N0VA 4QZVB 3B7XA 2AZ3A 4DN9A 3H5XA 2UP1A 4PQUA 1D6OA 5KOXA 2EK1A 1C1BB 2H5JB 3MAHA 2WSFC 4FVCA 4F02A 4TVAB 1RHKB 2QSFA 4WYWA 2PA8D 2QA4S 4RU9A 1P9QC 1YJUA 3R7BB 2QIFA 4JI1F 2PMHA 3HFVA 1I94J 4KH0B 3IMQJ 4IH7A 2C2NA 5E33A 3GFXA 3NGUA 4QW8A 2P9CA 3V5RA 1VISA 1Q5YA 1SIWB 2EFQA 5BYSA 4Z2LA 1FKKA 2RUDA 3HHDA 3S8SA 1NKCA 4NXNF 2HVIA 4FYVB 2HMIB 3L3CA 4DR5J 3KNAA 4C8YA 2C1EB 2HRUA 2A3CA 1RTIA 4OLPA 4MPKA 2N4CA 1VDHA 1M90T 3GJSB 1KKHA 2BQ3A 2P9GA 4BC9A 2FJXA 2GZOA 4IYQA 4PG4A 2Y1IA 1U8SA 2B6AB 1FHTA 1RU1A 1OWQA 1B6CA 1OGBA 4LR8A 1T05B 3CDUA 3AA9A 4EYHB 4ZPVR 3V6DB 5IQQA 3OR1B 3QBCA 4FF2A 2IM0A 5G4DA 1EDQA 3EGNA 2A2CA 1FKHA 1F9EB 2CJAA 1GEHA 3M8QB 4LF6F 2PMZD 3MMJA 3TRGA 2GHPA 4DOZA 2BA9A 2LYVA 5I98A 1VJWA 2QFIA 2I0XA 2Z30B 5ETNA 1Q78A 2VN1A 1S7IA 4YB5A 5HAOA 5IZHA 4X66J 1PSDA 2AKWB 2CJBA 2G13A 4DRHA 1DQ8A 4KB7A 4FYYB 2VZ9A 3D7SB 4NXMF 2RF2A 3IBFB 2EFNA 5KFDA 3T1AA 4C8LA 4X62J 2IUZA 5I3QA 2FIUA 4C8MA 4ANEA 2MKIA 4G1IA 3CCTA 5I42B 4G2PA 4PXCA 3RRKA 2HAFA 3P6YC 1TFVA 1WEYA 2DT1A 5J2PA 1CJUA 4AL6A 3K17A 2LDYA 3TR5A 1A7GE 3C66A 2RUGA 4XDDA 1OPZA 3PW0A 2I6WA 4OJ3A 3CCZA 2JOQA 4RBVA 1RT4B 4GRSA 4B9SA 3V4IA 2ZBIA 4W9OA 2R8HA 1QE1B 2JC0A 5KG2A 4OYBA 1FDDA 4Y2KA 3CXCR 2K3IA 3M2UA 4QR2A 5J6EA 1F1BB 3ZTRA 5HP1A 5A8WB 3A1YG 5D3GA 5D4PA 3VAGA 4DDFA 3IR5B 2LPVA 4F26A 2KG1A 1LXJA 3SMZA 2GS8A 3R5BA 1UVMA 2OEKA 2BJ8A 4CH0S 1EP4B 2VH7A 3DLHA 3NCQA 3M8WA 2FHJD 5KT5A 3FRZA 1TVRB 2K2PA 1FKTA 2ZBQA 3LWMA 3QZ7A 3DFEA 3HHLB 1PYSB 1LL6A 1N0VC 4DL4A 3HVTA 1S1UA 3N4WA 4ZP6A 2DNYA 1PAEX 1MLAA 4WKFA 4X2BA 4DRPA 2H48B 1HNZJ 1LWEB 3OLAA 5HSPA 2KTQA 2PFFB 1KLMB 5HT1A 1RLDA 5L1JA 2YQ3A 4NLDA 2NR0A 1IWAA 1S1VB 3RRGA 1HBOA 1OPIA 2KN4A 4ALZA 1KC8T 3KDOA 4UDMA 4J9KA 4ECYA 3O5RA 1RACB 4RNNA 2BOPA 1S1WB 2Q6CA 4ES3A 2WTFA 3BN7A 3IWXA 4O3NA 3RUBL 4S3KA 4KV8A 1LL4A 1VYAA 4ZLJA 1O6XA 1ZB5A 5HKGA 3LP2B 4UZBA 4Z2GA 3PIOQ 1QZ2A 2HYIB 2DHGA 1U1LA 1IN0A 1OYDA 5HLFB 1S4FA 1S0OA 3CGNA 1ZK6A 3EWGA 2KG0A 1N52B 2F9DA 3MTKA 2DNLA 2NXUA 1HMVB 4LSLB 1G3OA 1B70B 2KI2A 2ZHBA 3BS9A 5I4MA 4USKA 1U2CA 4B9TA 1LW0A 2W2MP 2UUBJ 4OX6A 5ETTA 2IJFA 1W25A 2F65A 2HK3A 3JTOA 5J2QB 4BLGA 5F9LA 4LSNB 4YQWA 1VBKA 3O6QA 3OQ2A 3ZC4A 5J2MB 3Q2TC 1HA1A 3AS3A 2DNZA 3HMJG 2YNGA 4N8OA 1ICEB 3TDBA 5KFCA 4HHHA 3FEXB 2QMXA 1NK0A 1SBRA 1TKDA 1FJGF 1XMOF 4QR0A 1VC6A 1W26A 2WVEA 2FY1A 1ZTTA 1V3ZA 2F8HA 2J0SD 4PWDB 3O5JA 3TAPA 1R3NA 4R8UB 1IVZA 4J7CA 4DRNA 4C8OA 2ZOMA 3F41A 1NLKL 3PCOB 3S7RA 4PXEA 4P2XA 1CC7A 1FRLA 2MPUA 4KPYA 2FYXA 4TU8A 1D0EA 2Y8YA 1TL4A 3RGCA 1FE4A 1FXRA 1T9WA 1TL1B 1U6FA 4J9RA 1Y3JA 1QSLA 1UPMB 4OI6A 3ARXA 3VZHA 2MHNA 4OX9F 3FXYA 1WB0A 1WDTA 4WK3A 3VHQA 5J1NA 2RH3A 5GAHU 2BE9B 3DOLB 3P4UB 2NS1B 2ACMA 3NG8A 2YX7A 3CCMS 3NWGA 2XNQA 3D0IE 4MAVA 4DG1A 4U84A 3VVUA 3T9ZA 1YJTA 4IT6A 1Z1ZA 2FVQA 2Z58B 3BKTA 2HFSA 2VJUA 2I1RA 5CYMA 2PPOA 2JVRA 4DI6A 1BE4A 2JH3A 3QLHB 1YHQS 2HHVA 2Z0GA 2FJBB 3OTCA 1TQLA 4TW7A 3DM2B 3DMJA 2DT2A 3PZPA 3J7YI 2CNNB 1S48A 1X8DA 3VGSA 3LPEA 1KVKA 1Q0NA 3M6VA 3PR9A 2MNTA 2IHR1 3MR2A 2KL8A 2Y3YA 3W1YC 3BQ0A 4RW9B 3KHGA 2JEFA 1Q8BA 3RU0A 3W2WA 1OO0B 2YBVA 4R0JA 3EZ5A 1FAPA 3S6EA 3K57A 3B8HA 2A6OA 1F5CA 3UI5A 2CZ9A 4K59A 1HBUA 4WTYA 2AJ1A 8ATCB 4F2SA 3R6LB 1XR5A 3OHAA 4HI2A 2V9WA 5KTQA 3ZTQA 3LWLA 4FS1A 2LCWA 3T5LA 5LMUJ 5HATA 2ROEA 3SFGA 3PX6A 4K4XA 2D9OA 1IBKJ 1S77D 4ITZA 4NCGB 2FVRA 1U09A 1SCJB 5HWBA 2LU1A 3MM8A 1XNRJ 3PR5B 4ZVHA 4CDIA 4USUA 4TY8A 2QSWA 3PW5A 1MWQA 5DDRC 4IG0B 2OPSA 1WHXA 4DCJB 2MQLA 3KG4A 2AYMA 3NNAA 1QTMA 2OKQA 3PDNA 4OL8A 3AODA 1PYOB 2WK2A 3DI6A 3GIIA 1QVFR 3AJ2A 1UJ4A 5B0GA 4RNOA 4JFMA 4D3GA 1UVKA 2OFGX 4C98A 4DRQA 2ZR5A 2YNFA 4X66F 4FKYA 2DNOA 4G65A 1WNEA 3OVSA 3TEHB 2X51A 1I51B 3DLKB 4LGXA 4PRFA 2HZCA 2V8HA 2ZJPQ 2ILYA 5DGBA 4X62F 3EXCX 3AA8A 2ABYA 2ZUAA 2VPZB 2YNIB 1JVWA 2QZ8A 2IAJA 1RWKB 2D3ZA 4IO9Q 4A8OA 4P8VA 4BWJA 2YWEA 3BO3A 2CQPA 2AF6A 2Q43A 3KMSA 3ADAC 1ZBWA 2AEJA 1FJDA 1GX6A 1RLCL 1KT1A 4WK1A 2P5VA 2FHMA 1LW2B 4DPYA 3MZIA 4ZK7M 2XP3A 1QAXA 1LWFA 2BM1A 4JV5F 4ZN3A 5KFLA 1F60B 2F40A 4LF4J 3O5EA 5IT0A 1CJKA 2UZ5A 1FFGB 2QFJA 3UN5A 3P96A 2CUYA 3M1VA 5DM7Q 4HH0A 3JSBA 2RUSA 3K5PA 1N5TA 1S6UA 1PC5A 4N56A 3BF4A 4DHVA 2Y1LB 4NRUA 1JJHA 4DSJA 2VA3A 1ZBKA 3ALFA 1NSKL 3OUYA 5KFFA 4GGQA 2QF8A 2W2NP 3CJ4A 4I6AA 2MGZA 1T9XA 1YRTA 2Y0BB 2DVIA 1ZL1A 3BB5A 1VQOS 4LF1A 2E44A 1WC5A 1NK7A 4DSFA 4C11B 4OQJA 4QIFA 3IKGA 2MSTA 2KRBA 2VD3A 1XMQJ 4HI1A 2ZQSA 2DJWA 4X65F 1UEUA 4Y6IA 2VV5A 4CTAB 2KM8C 1JJCB 3Q8QB 2Y1JA 3E01B 4OI4A 4DWSB 4TNOA 3UWTA 3GIJA 1T03B 3HZGA 1UZHA 1BQNB 3A3NB 3NLCA 2IVFB 2CDRB 1EKSA 2FHJA 3UQBA 3DRXA 2QLBB 1X5TA 4DQSA 1IM6A 2GO8A 3TVYA 2M88A 2DITA 4DUZJ 3WH0A 3FEZA 2HPUA 3MPVA 3A3OB 1GRJA 5GMKa 5KFEA 3I4HX 3OTEA 1S72S 3C6TB 1Z2LA 3ITHA 3FSYA 3FGVA 2E5LJ 3D68A 3HHEA 5HWCA 3TX8A 2ERRA 3H42A 1RTJA 4IQXA 1TL7A 2UV8G 3DLEA 3IHZA 4WYLA 1U24A 4LBHA 3BKFA 1VIOA 4XPEA 2N3LA 5DLFA 4NNRA 1LFPA 4DPXA 1PAUB 4JI5J 3JSMA 4IKAA 2RQ4A 3QMQA 4F7VA 5D0GA 1RD6A 4IUFA 4A8MP 1L3VA 4D3HA 2BOAA 1FFWB 1KTQA 1VLYA 4H4KC 4CO3A 4WCEQ 4ED4A 4NYPA 1S7HA 3QWPA 3KLVA 1IR1A 3G71S 3O5TB 1WC4A 3AQUA 4MNLA 4RW7A 5EDWA 2F9JA 2XLIA 5KT3A 1R43A 4B9VA 2ZNZA 1K9MT 4KHPF 1RYRA 1VC0A 4DV4J 3OJSA 3AQOA 5A0YA 1VLOA 5KFXA 2H5EA 4FPRA 3POTA 2YKPA 3CMQA 4IFYA 3KYLA 1VQPS 2BJ1A 1YJ9S 3CGIA 3FQKA 2E9ZA 2J8AA 5L38A 4WFBQ 1Q8LA 4JI6F 4LF9F 3LTOA 2ZBCA 2AGOA 4EYIB 2RQSA 4GO7X 4Z2JA 2IBOA 2HW3A 1QSYA 3UNYA 4YUDA 4OHVA 2AEFA 1U7LA 2UXDJ 1YRXA 2VPYB 5HQMA 5IM0A 3DU5A 4MK8A 1JLCA 4U96A 4PQUB 1FEEA 2FZKB 4FXVA 1IQZA 1NO8A 2B31A 2JLGA 5JVHQ 1AUSL 2DB1A 3JTPA 5GAHI 2HKEA 5ETQA 4PUOB 4JI8F 4KQZA 4M5LA 1UA0A 2DR9A 4DJBA 4JI0F 4ZPBA 1U4BA 3HJFA 1M5VC 3PO4A 5DF0A 1V5VA 5ITHA 2HHXA 1PJ7A 2QV6A 3B9EA 2ZH1A 5ETVA 1WHWA 3OVBA 5MAOA 2DGXA 2C42A 1RI7A 2DR8A 3CCQS 1SR0A 3JAMU 3WIVA 1SKWA 5K9FA 1TAQA 5HQ8A 1WKKA 1R8BA 1L3SA 3MM9A 1RTIB 4PWUA 4B3RJ 1VR6A 5D4OA 1IJEB 1UWAA 4M5GA 3PVXA 2NYHA 2FD2A 3AFGA 2VL1A 2DRBA 3G8SA 1RT1A 5CCMA 4DV3J 4LQ3A 4ZVEA 3MAAA 5AJ3J 1NXIA 3QAUA 2ESCA 1EYMA 1SQFA 1AROP 1FFQA 4USJC 4PZVA 4BCAA 1X4HA 5J2NA 1N8RT 3KJVA 3PHEA 3KOAA 2MKSA 3RBXA 4MYTA 1JLAA 4DX8H 4OJGA 2ZBRA 2CPJA 4K4TA 1KDNA 2L9NA 2E9TA 4CH7A 5LMUF 1S59A 3CIZA 2AZ1A 2UUWA 1WWHA 1CJTA 2VBZA 2BW7A 4UZCA 1IBKF 1KS2A 1TP7A 3M2RA 3KUHA 4Y34A 2HHTA 4I0WA 1RAGB 4MGVA 2K7KA 1W2IA 3NS7B 3KLEA 2A1BA 1IUJA 3J7Z5 1FXDA 1TKTA 4P8XA 3CNQP 2M70A 4NLUA 3V4MA 1Q79A 2X3GA 4WIIA 1NJIT 2RVJA 5KT2A 1DFDA 4JP8A 2YKOA 5B8IC 2LFVA 2HS0A 4OYIA 5D0EA 2DNRA 2KJVA 4ZVTB 4I56A 2DSWA 1QTNB 4YR3A 5JXSA 5GMEA 3TA0A 2UUAF 2J8SA 1WJ9A 3DLJA 1HD1A 3QRQA 1SL2A 2AP6A 1WTBA 4RBTA 1F5BA 3K5OA 1D7HA 4Q7NA 3ARTA 5J2PB 1LWXA 3IAS9 1CJUB 1KNZA 3G8TA 3KACA 1WOPA 2AJ2A 3VAHA 1YRUA 4ECWA 4X4SA 5F0UA 1S6PA 3RB3A 3ISZA 4YB1P 1X4GA 3GG1A 2WCXA 2PI6A 3PJXA 2C2DA 3EMTA 3V4IB 2MY7A 4ED2A 1NAQA 4WBFA 3WC0A 4JOUA 3EM1A 1DZ5A 2BE2A 2YY3A 1OMSA 4I68A 2M2BA 3CMAS 4PWWA 4NZ7A 5HP1B 2IPOB 1T94A 5D3GB 1EB0A 2PN0A 3FQLA 4NRTA 2XLJA 2DNNA 4DFMA 2IJRA 3JSRA 1EQ0A 4ZIVA 3WD2A 2HZAA 2ADBA 3J81j 2CQCA 2B9YA 3NRKA 1Y5IB 2I5JA 2VJVA 4IQ2A 4C8KA 1JXEA 2CNLB 5KG3A 3UQSA 4K5RA 2GA7A 3UCGA 2MQOA 3D4JA 4O4GA 3J7AN 5KFWA 3QO9A 3HVTB 3J80Y 2W2OP 1S1UB 2B7CB 2HNZA 1HR0F 4IR1A 2NUHA 1SVDA 1ZA1B 4Q8EA 4EEYA 3OVAA 2J9CA 2CQ1A 3WKZA 2RS2A 4A8FA 4WXWA 1GNKA 1TK0A 1T11A 2UUCJ 2CPZA 1HBOB 4RZRA 5GPRA 1L3UA 4U7UK 4LF5J 4DR6F 4U8YA 1UFKA 1GTHA 3OR2A 2CQ0A 2M9KA 3HSZA 1FTCA 4KV8B 4Y28C 4GVLA 3CZ8A 1RK8A 5A2QY 3G9CA 3H5YA 2ZQUA 1HQ2A 2V8DA 1ZS6A 2OELA 4RBUA 2OUGA 4ZDNA 4ERDA 1U1KA 2O3DA 2XP7A 5DGAA 3GILA 1N5QA 2K1RA 1RT3A 5T7LA 2GVZA 3F44A 2J7UA 1U8WA 2YWHA 3FC9A 1FDNA 1HYSA 7FD1A 1LW0B 2XTJP 1NMWA 3BH7B 3WHIA 1VQYA 2WSEC 4YHHF 2PC6A 2J7WA 3N01A 3CJRA 3BYRA 2MXYA 1U2RA 4ED3A 2CPIA 2XS7A 1BKFA 2ALYB 2I38A 1X4BA 3PRVA 3OLBA 1HW8A 3HVWA 1R8AA 3PYFA 2NXNA 4WFYA 4ED1A 4LRDA 4XK8C 3QSIA 1PJ5A 2HZVA 4QWEA 4NEZA 2NCKL 1N36F 5A8KA 2DH9A 3QRRA 2XYHB 5EHHA 3W61A 5BXJA 3N5FA 4OLOA 1VHFA 2OP5A 3BH6B 2MZQA 3CC2S 2J7KA 5K8OA 3NGTA 4CLLA 2V69A 3H8YA 4K0KF 2JWNA 1VBYA 1VGYA 3VF0B 3CO0P 4TLQA 5J1PA 2AWGA 1Y3KA 4JI3F 1PCAA 3RYLA 4LSZB 4ZP9A 4HBOA 2LDIA 2A3BA 3BQ1A 4DBQA 4ECTA 3H98A 1NH6A 4CLZA 4CO1A 4FKXA 5IT9U 1H7XA 2VFSA 1WEZA 2EG2A 3D28A 4DL6A 1RKIA 5KG4A 2GMJA 2V2ZA 3HSGA 4QCLA 1FE0A 1SJFA 4DG1B 4USWA 4DFJA 1T0TV 3THVA 3O5GA 1H6KX 2PV3A 1Y4ZB 4FYXB 5H9EK 4F2RA 1K8AT 1RTHA 3RM8A 5GAGI 2B9EA 3LW5C 3D67A 4DV1J 1WORA 1S1TA 2XGQA 3N5BA 5CYMB 3GIMA 2WVCA 4DR7F 1WKLA 4NASA 2ZH4A 3NBPA 3WX4A 4QWDA 1HQUA 3DMJB 3VAMA 3QAEA 4HHUA 3IM9A 1RHRB 2NYIA 7FDRA 3WC2A 5F3ZA 2Z4PA 3ISND 3MMBA 5LJ5Y 1FT8A 1KFWA 1WHVA 2BDPA 4DQPA 1X4CA 2WLZA 3M8YA 4ETXA 2UVRA 3O2IA 2AJ0A 4R5PA 4P10A 2L9WA 3W2WB 3CCRS 4QWAA 2HWHA 4ODOA 2ZD1A 5H1SV 1EARA 2F2DA 4URGA 3KUEA 4BDPA 1UA1A 3DU6A 2R7OA 2QA1A 1HBUB 3IM8A 4U67Q 1YSJA 2XWXA 5FLXY 2FGOA 4M94A 4B9MA 1EHWA 3TARA 3PHTA 4E0DA 1ZYQA 2MHEA 2BZ2A 2FHKA 3H5UA 1ULRA 4O0IA 1NHKL 3RG6A 3M7VA 2KZZA 5K8NA 1N1AA 3T1HF 1H0IA 1CC8A 1UFLA 1EHNA 3MM8B 1J5EJ 2KXFA 1RAFB 1FRJA 4TY8B 3I56S 1TKZA 2OO4A 2J6SA 2PI4A 2K3KA 3KADA 4ITSA 1M5KC 2OPSB 5E3RA 1GAOA 2RIJA 1RTZA 2DNGA 3A8EA 4KKOA 2YBUA 5ADZA 3MEKA 4NPOA 3M8PA 4C3MA 2IDLA 3KK1A 3NKYA 1W7WA 2LQJA 4HARA 2VG5B 4K4WA 1OJ4A 4JB8B 3T3FA 2Q6BA 4DX7A 2RILA 4MKYA 1UEVA 2WBMA 3C6UA 1M5SA 2BBEA 1Y11A 1PBAA 3CJTA 4P2MA 4HT7A 2V0NA 2YNFB 1HARA 1VRQC 2V5HG 4P73A 1URNA 4YR0A 1UZDA 1BD6A 1A0OB 3UDVA 3HHKA 2BX6A 3R2CJ 1P1TA 1C9HA 2XHWA 2DHXA 2JHEA 4DIPA 2AV5A 3O5DA 2ZOGA 3B82A 4JUZA 1JLFA 2IAJB 3D6TB 1WKJA 3O5MA 2LXUA 4NWBA 5HTGA 3MMAA 3UD3P 1BY9A 1EZZB 1GUVA 4TYOA 5BJRA 2HHUA 1M5PC 4DZ2A 1WACA 2OFNA 5LMNF 2W8LA 2FKEA 3TANA 1FCAA 3Q22A 2V8PA 4ODNA 2HFZA 2CJ9A 2IM1A 2KFNA 4CT9A 1X4DA 1V5IB 1TTHB 3Q8VA 3GV5B 2E1CA 1AW0A 2ZE2B 4LRBA 1RWVB 3CC7S 2CQBA 2XB2D 1JLGA 5IQ6A 3AD7C 3KTQA 1FKSA 3FK4A 5E3QA 2WZ1A 3CW2C 3MCOA 2CZVC 3R2DJ 1FEHA 4E2FB 3N79A 4NA1A 3M1VB 5GADU 4DV7J 4FN2A 4CI0B 4NYZA 1TL5A 2M3DA 5CA5A 4U9RA 3FFIA 2RSEA 5DIVA 1O6IA 4M5KA 1YJVA 3OUYB 3ZZYA 1Q4RA 1S4EA 4J5OA 1HQEA 4F8RA 4J9SA 3RBEA 1S10A 2MY8A 1X4AA 4I7FA 2MGZB 5F0WA 3PJWA 3GJRB 1JNTA 5H9EJ 3R7SB 2ATLA 3WD0A 3H2LA 4DV0J 1VQ7S 2YWWA 3CB4A 4FS2A 4GKJJ 1S9FA 4DT4A 1M5YA 4WP8A 1M5OC 2VCDA 1NH7A 1BLUA 3P45B 2AQ4A 5CZVA 2B43A 1RISA 3AT1B 3SBMA 2Z2ZA 2DG3A 3GJTB 1XHGA 1GXUA 1OY8A 3LAMA 3AQPA 2EEYA 4B3SJ 2KT5A 3R5GA 2PPPA 5G0RA 3RM9A 2AX0A 4DR3J 3UPFA 1E6ZA 3SFUA 3B9DA 5LT5A 4LF5F 4OYXA 1KONA 4EBDA 4DZDA 3RBZA 4QYZK 1MMLA 1KD1T 2HQFA 1N48A 2E1MC 1MROB 4NLVA 4ZA1A 3R1HA 1NSAA 1N4LA 1K0VA 1HL6A 4I2PA 5M2UA 3G6LA 4H4OA 5LJ3Y 3CHCA 1YI2S 3KHHA 3HKWA 3ZTOA 2CQHA 2QTWA 3G6XA 1RTJB 2DGQA 3OL7A 4M5IA 1NJWA 2Z2YB 1TL7B 2MSSA 4GKKJ 3BKUA 3DLEB 1HKMA 1QLNA 3DDIA 3ZZTA 2MKKA 1HNXF 3IXQA 2HIQA 1FNMA 3I5CA 3OHBA 3JSMB 3MD1A 4FPIA 1BMQB 2FJWA 3ZTSA 1HIYA 2B0GA 5AXMA 1X5SA 4Q43A 3TAQA 3ODKA 3G6VA 3TWZA 1HKJA 2ASDA 1ZETA 1B64A 1H7WA 3MEDA 1JMTA 4B02A 1MU2A 3QNWB 4FAPA 1Q16B 2DG4A 4MKBA 2RB7A 5DG8A 4OZNA 3HCXA 2ZZMA 2A3AA 3AS0A 2VU5A 4IOBA 4RW7B 2NXCA 4M8LA 2W7AA 2ZH7A 2Y0SD 1E6VA 3LAKA 2VQFF 1NK9A 4J9UE 4N77A 1IWGA 4EUVA 3OXGA 5A0YB 3HO1A 3POTB 3BGRA 2VBXA 4G1QA 3IFEA 5F8IA 3M8SA 3UCUP 2PN6A 4IFYB 3QT8A 5L1KA 5ETKA 3EGVA 4DRIA 1NHVA 3PRDA 5BR8J 2CQIA 1X5PA 1TK8A 5IOLA 3DRSA 1H38A 4WIWA 4LBPA 2JEJA 1U25A 2ZEJA 5K14A 5B09A 3DRPA 3DGPA 5KT4A 4IG3A 1N5YA 3ISNC 2K8GA 1SJ3P 4OYOA 4C9DA 3MCMA 3P49B 2PBCA 4K4YA 5EWEA 2V2VA 3PA7A 4KGVB 3MR5A 2CG4A 3IR6B 3DN9A 3VQTA 4DL3A 3R1LA 1K0TA 2MZTA 3SV3A 5DEZA 2PEHA 2BV3A 3MWBA 4Q0BB 3I31A 2HEKA 2XZDB 1RBOB 2PA3A 1VJQA 4EO6A 4YR2A 3AJ1A 3PW4A 2QX0A 2XMWA 4WK9A 2MKJA 1R0CB 2R8GA 3SCLE 1HHTP 2G41A 3PTWA 1OSDA 2G4BA 4MAKA 1G1XA 5IV3A 5HVFA 4WXOA 2L3MA 4X4RA 4MKAA 2N3OA 3PXGa 2ZKUA 4DH0A 1SV5B 2LA6A 1RWWB 3M6XA 1XC9A 2PMWA 4C8ZA 2KGJA 2B51A 1RT1B 1GOIA 2DO4A 4LJMA 4B3OA 1X9MA 4CLUA 4DUTA 3MAAB 4DLGA 1A7XA 4JI1J 3FSIA 1UL3A 1B3TA 1LQ9A 2V50A 4NLXA 3X3UA 1L3KA 2ZKTA 4DL7A 3C2PA 1V9OA 4NA3A 1T3NA 1QVGR 1FK9A 2DO0A 3GLJA 5C25B 1YKWA 4DXLA 2GJIA 1D09B 2GHVC 4RUAA 1R9HA 3ONQA 2UXCF 3AOCA 3HT3A 3BQ2A 1CJTB 4CNYA 3M2RB 3CCWA 2X3DA 1NDCA 1RHJB 3AOBA 2IVYA 3KLEB 1SJ1A 1J5EF 1TKTB 3EE3A 4QYZJ 2MZ1A 1SIZA 1XR7A 1B0PA 1C0TA 4ZP8A 4Z7CA 2A3EA 1N5SA 2K06A 1IKWA 2BRLA 2KXHA 4KO0A 3OFFA 3GFHA 2YKNA 1RTDB 4ECZA 1E6YA 3T5HA 5F8LA 1FRIA 3WQPA 2ZH2A 3WL1A 4B9LA 4LF6J 2HWIA 2XYGB 1YZ6A 3E2EA 3GV8B 4KY3A 1WC6A 2HBRB 2DCLA 4OI2A 2R7QA 5AE3A 1S6PB 1REVA 2P2CB 1PC4A 2R7WA 3TA1A 2LQ9A 5HROA 1DLOB 1R31A 2NSBA 2MQPA 3LOUA 3BGOP 1GX5A 2BKPA 4WWSA 4DFKA 3GPKA 2BE2B 2BMBA 4Z2HA 1U47A 4NXMJ 4RW6A 4CO2A 5HMZA 2ILZA 3IN5A 1K1SA 3DDKA 5HBFA 3DRYA 3K89A 3RW7A 1Q53A 2IFXA 1YTYA 2ZM6F 1YATA 3ICLA 3TZXA 4F0HA 2I5JB 2M0GB 1X9SA 3OTDA 2JLEA 1JB0C 4DF4A 2A2DA 3R6GB 1KVIA 3W60A 4URQU 1OY9A 2OIHA 1GPFA 1D9FA 4NLGA 4O4GB 1Y10A 4IH5A 3TI0A 2YQ0A 1VBXA 2M08A 2DGUA 1F6TA 2CVEA 2HNZB 1WI8A 1MWYA 4GVBA 4TQSA 3KLGA 3ETMA 1NRKA 3OTBA 2IYIA 4QYRA 3CJ8A 1O51A 1ZBVA 3FMBA 3CHDA 3HHLD 1KOHA 2QLXA 4NLOA 5GADI 1B7YB 1NHUA 4ZN1A 2KHCA 4LR7A 3OR2B 4IQMA 4M5HA 1ZAWA 3CJ0A 4CO0A 3M9MB 1DTTA 4DV0F 4C0OC 1SKUB 3TVZA 3SI8A 3PR4A 3L4BC 2LKNA 4HH1A 1J4RA 2HQDA 5D75A 3MGJA 1U1MA 3LP1A 2HLUA 2K1RB 3CCES 1RT3B 5T7LB 2GVZB 4A8XA 3RB6A 4ECUA 4ER8A 4NE9C 4Y2CA 4DR3F 3OW2R 1G7CB 1RUSA 1ROTA 1NSGA 4NSBA 4N19A 2FGCA 1EJ7L 2QN6B 4NZCA 4AXIA 3VQSA 1RE1B 3MXHP 1UCNA 4NLPA 4AE5A 4K5SA 2OGUA 3NEKA 3H9RB 5HN0A 3BSAA 5B0EA 3E3XA 1S9EA 3I0RB 2CNKB 2POKA 4WE1A 1KN6A 5KFQA 1NNDA 4DQQA 4CIOA 1C0UA 2NZCA 5A8KB 2LECA 1EKRA 4OHXA 1H74A 5C2GA 1S9GA 2V68A 3WD3A 2VPWB 3RRHA 2IY5B 4RW4A 3RB0A 3F56A 2LQ5A 2FC8A 1UW9A 2NXJA 1RP5A 3GV7B 5JMNA 3NOCA 4LAVA 3SSQA 1S6QA 4HACB 2KO7A 2DIUA 2WK4A 2NZ4A 5EGYA 3BDPA 3C14A 4W5UA 4OJHA 2FLOA 5CD4H 2KYZA 1SL0A 2COLA 2HIYA 2UVVA 3B6BA 2CWKA 1FJGJ 2EI5A 3W9JA 4QPXA 1E15A 3CDWA 3RR8A 3IBCB 4R0EA 4W92B 1R6YA 1TUWA 1Q7LB 1NPRA 2BANA 4I6WA 4WZMA 1FKPA 2ZZNA 4WFZA 2X7IA 1JKHA 1HNWF 2GNKA 4DCOB 2R7SA 4P8UA 1HKAA 3EZUA 1QAIA 4ZVFA 2V4JA 4X4OA 1X5OA 2HQIA 4C48A 3VAKA 2R2UA 3LUYA 1S5ZA 1NDPA 4FBTA 4ZKAA 1RTHB 4KAIA 3MMCA 1URRA 2XSJA 2KVQE 1NEEA 3MHYA 3BYPA 4USHA 2DR6A 1S1TB 4M5MA 1DQAA 3CPWR 4UQTA 2AGQA 3NGKA 3D6FB 3SXLA 1HNVA 1AZSA 3NBPB 4ICLA 4R5EA 4RJVA 2GIQA 1HQUB 4OX9J 3UD5A 3W8GA 3KHLA 3I6CA 4YP3A 1EQMA 3JB9k 3KFWX 1UW4A 3CJ5A 3GCXP 3O1LA 3AY0A 3JYTB 4UUWA 5GPGA 2FHOB 3AAWB 3TEGA 4F67A 3K59A 4LFAF 4OI0A 3LANA 4XTTA 3AB4B 2MZJA 2PO4A 4PXBA 1KP6A 2ZD1B 1WF2A 2JSXA 4ODMA 1RQ0A 2DR7A 4ILMA 3W2VA 3MR6A 3UD4P 2CJKA 4RLEA 5KFHA 3MUTP 3AXMA 5D77A 4LIWA 2ZQVA 3UR3C 1XRVA 2PGCA 2QG9B 3A8IA 5C2CA 3ZZOA 2R8JA 1IBLF 1H3DA 1YK9A 1S99A 3H90A 4F0MA 4N7TA 2ZWOA 2MQQA 3T41A 3V81B 3VAWA 1UVJA 5U47A 5HVHA 4ZLNA 1HI8A 1U0HA 2W4CA 2J9EA 1RB0A 2C3MA 2LMIA 1VQ4S 1GTEA 4EO8A 3MR3A 4LF7F 4WFXA 3D9BA 3ZZUA 1GXTA 2QMWA 3WQVA 3W63A 2H4WB 2XPBA 1WF1A 3US5A 2ROGA 1UR8A 3SZ2A 2WW8A 4S0MA 3PRAA 2B4VA 3TUIC 3B54A 3MCNA 3M8PB 2KVIA 3VALA 3TOQA 4LVNP 5E2QA 3KK1B 1N32F 4KH1B 1NJZA 2HG4A 2OTLS 4MNMA 3KMQA 2B4UA 3TZWA 2HFVA
chains in the Genus database with same CATH topology
2G9OA 4BF8A 1GQEA 1SH3A 3PHEA 3KJVA 1TKXB 3KOAA 1NZAA 1RT6B 4DN0A 3ENQA 1DARA 5L1LA 2MKSA 3O5QA 2XWYA 3PKMA 2XY6A 2ZUGA 4MMOA 1YW5A 2FUG9 2DT0A 3RW6A 3C6UB 4MYTA 3MEEB 4EGLA 3K5MA 2ZH6A 1JLAA 4XO0A 2RKIB 3CE8A 4DX8H 3K2YA 4OJGA 4TW8A 4RX6A 4EFAC 2CPJA 4K4TA 1C2PA 5EX3A 2W9CB 1K73T 4NOHA 2GW8A 1SJ4P 2L9NA 2E9TA 4CH7A 4IO1A 3TUZC 2N82B 4ODPA 5LMUF 1CLFA 3CIZA 4HBEA 2VG6B 2UUWA 2C3YA 1WWHA 2VBZA 4JBCA 2WB4A 1IBKF 1KS2A 1TP7A 3M2RA 2GV1A 3DOMA 3DI6B 3DCAA 3NNCA 1OS5A 5D8HB 1H2TZ 5J1EA 3I96A 4Y34A 2HHTA 5CCLA 4I0WA 4HKQA 4MGVA 2K7KA 5DM6Q 3MAQA 1W2IA 1YITS 2KXNB 1WD6A 3N6NA 4DRKA 5KFUA 2A1BA 4AUKA 5F8HA 3KLEA 2NPFA 1IUJA 5EX0A 3J7Z5 5IT9Y 1FXDA 1TKTA 4P8XA 4RNFA 5HROB 3HVAA 5A8RB 2HQ3A 2EVZA 1BQMA 2M70A 3N9UC 4NLUA 3V4MA 1Q79A 2X3GA 4HTJA 4HHJA 4WIIA 1JLFB 4I4BA 1NJIT 4CQ1A 2RVJA 5KT2A 1TV6B 1HWUA 1DFDA 5B08A 1MMNA 3EPGA 4A8SA 1XERA 2YKOA 5B8IC 3TNVA 2KFWA 2CQ3A 2HS0A 3H2UB 2RURA 3MMAB 4AL5A 3KZ7A 4EWTA 1F8AB 1CSJA 2DNRA 2KJVA 1P1LA 4I56A 2DSWA 1Q7YT 3THPA 4YOEA 2XZWA 3NI6A 4Z2KA 2PE8A 3V6DA 2OMLA 4NCGA 5JXSA 4YR3A 4B9NA 3OR1A 4OX7A 2VG5A 2P6TA 4NL5A 4RW6B 2CVIA 3TA0A 2UUAF 1SJRA 2EW9A 1V3SA 2XC9A 5E7OB 4CT8A 2LA4A 2QLWA 3DLJA 1RT7A 2O9OA 1KSPA 1HD1A 4TN2A 4LAYA 1SL2A 1JLEA 3I4PA 3L09A 2AP6A 1C4CA 1W9PA 4MJKA 4RBTA 1WTBA 4IG0A 1F5BA 4HDGA 4KR0B 2R2RA 3OFGA 3K5OA 3CULA 4OIXA 1D7HA 2E7WA 4I2QA 4Q7NA 3ARTA 5HMWA 2DG9A 5J2PB 2CRLA 3IS9B 3IAS9 1EETA 4HT5A 1KNZA 1QPLA 1MW7A 3G8TA 3NRBA 5HW8A 4IRCA 3KACA 5HO4A 3D54A 3DRRA 2ZJQQ 3CIMA 5KFKA 3VAJA 4P7VA 1JLGB 5L39A 1S0NA 1NB7A 4NZ6A 4ELUA 1H0HB 3O8WA 3VAHA 3K5LA 2V8GA 3ALGA 1FRKA 2HHSA 3HHLC 4A48A 3KLHB 1YRUA 2A10A 2KB2A 4ECWA 4X4SA 2HFOA 4KHRA 4NX9A 2RE1A 4FNHA 4LT6A 1XWLA 5F0UA 3NTPA 1S6PA 3I5BA 3T6BA 3ISZA 5F8MA 3RB3A 4FF4A 2D41A 3CD6S 2L9DA 4YB1P 2CQ4A 1X4GA 3GG1A 3SEOA 3NMAA 2WCXA 2PI6A 2DNPA 1UVIA 3PJXA 3CCLS 2C2DA 3MOZA 4GC7A 3V4IB 2MY7A 1FVQA 2JEGA 4DROA 4ZPCA 4ED2A 1NK4A 4MH8A 1FKOB 4Q2LA 1NAQA 3EGWB 4IH6A 2JZVA 2VA2A 3WC0A 2JJ4D 1ZPWX 2DCUB 3RR7A 4JOUA 3HI9A 3FFIB 2D7SA 3DOKA 1DZ5A 2BE2A 2J0XA 2GMHA 1N56A 3MTJA 4B3MF 2YY3A 4I68A 1SJQA 2WONA 3OXLA 3VWSA 4DQRA 4UY8T 2M2BA 1HQEB 2M4MA 3CMAS 2OPRA 3W3SA 3CHEA 4NZ7A 5HP1B 3LGMA 1DTQB 1ROUA 1LWFB 4N41A 1T94A 1QY7A 4G1PA 1FD9A 2HGNA 3RM4A 3R5DA 3DLKA 4I7FB 4F3MA 3PX0A 3QGPA 3FQLA 3GR1A 3OSNA 2DTJA 4NRTA 3KK2A 2LU2A 3QJPA 2XLJA 2IMOA 2DNNA 3H4BA 1HJWA 4DFMA 3JSRA 3U1LA 2AW0A 2N4DA 4J9MA 4LQ9A 2L2SA 1D1UA 3WD2A 3GMGA 1D9DA 4NLTA 1NWRA 2ADBA 1FD8A 1LKZA 1V3RA 3OV7A 4Y0FA 3QIPB 1S1XA 2CQCA 2ZE2A 2B9YA 2RRAA 1AUDA 4MTVA 4DV7F 3NRKA 2PT0A 1Y5IB 1RJJA 2I5JA 2DGSA 2LLZA 3IBWA 1ZU8A 3MFHA 4P7TA 1JWWA 3R5AA 4O3SA 4NLSA 4IQ2A 4WJBA 4C8KA 1JXEA 2LKZA 1FKAF 3M30B 5KG3A 1Q1CA 3UQSA 4KFBB 4K5RA 3DYAB 2JEIA 1FKIA 3NCRA 3LF0A 2NSCA 5KFZA 3HDSA 2GA7A 3UCGA 3L7PA 2MQOA 4O4GA 2Q1LA 3NAHA 5KFWA 1RT4A 4WF9Q 3QO9A 3HVTB 3N28A 4X84A 3J80Y 3SYZA 1R0AB 2EBEA 5G0RB 3MM5A 1S1UB 3IG1B 3RTVA 2DGTA 2B7CB 1DBDA 4FP9A 1NK8A 2U2FA 4GO5X 2HNZA 1YBAA 1HR0F 4IR1A 1U48A 2NUHA 4HVZA 4MIAA 1IXKA 1SKSA 3SDEB 1E6NA 3BEGB 4Q8EA 3MECA 3PACA 1W1VA 1ZM3A 3OVAA 4EEYA 1LW2A 1SL1A 1SKRA 2J9CA 2J5AA 3QIDA 4IDKA 2CPDA 2DSVA 2CQ1A 4UW2A 3WKZA 2RS2A 4A8FA 3FSXA 4Q2MA 2F7VA 3B8SA 4L72B 4WJXA 4GKJF 4WXWA 3RFWA 2X1FA 1GNKA 3CHFA 4WKHA 1JNEA 1U26A 1LQ0A 4AYBD 1ZZFA 3M8RA 2R2SA 1TK0A 1T11A 2I9SA 1FVSA 2XMTA 2AD9A 2HAIA 1E6RA 4I2PB 5L9XA 5I3UB 2CPZA 1HBOB 2XP9A 3JXVA 5A6PA 4RZRA 5GPRA 4H4OB 3I9V9 1RGVA 4ZHRA 1L3UA 3CJKB 3PW7A 4P8WA 4U7UK 3ARZA 4DWSD 4DR6F 3M6WA 4I64A 1GTHA 4NLQA 4JV2A 3OR2A 1ZAXA 4PKDB 2DT9A 1EP4A 1MNEA 3D1OA 3FVYA 4B3SF 2CQ0A 2M9KA 4KC5A 1FTCA 2RUCA 2LVWA 4AQYF 2HVZA 4OFZA 4WKYA 4KV8B 2B5JA 4Y28C 3CZ8A 5HMXA 3LGNA 1RK8A 4ETZA 5A2QY 1HNZF 3CC4S 5LSOA 3G9CA 4WZQA 5KFIA 1HKKA 3V2UC 2ZQUA 3Q8RB 3H5YA 1FO1A 4W9PA 2H9ZA 1I1GA 2VFRA 4KE5A 2LXFA 5C42A 1HWKA 3KAIA 4WKAA 3MEGB 1NJYA 1C0UB 4F25A 3MDYB 2V8DA 1RT5B 4X4NA 3WD4A 4ODLA 4RBUA 3NS5A 4ZDNA 1ZM2A 5C5JA 4ERDA 1TAUA 3U7JA 4OHYA 2DH8A 3RZAA 1U1KA 1HPZA 2O3DA 4X4VA 2XP7A 3VR1A 1S9GB 5DGAA 2VKZG 2UVUA 1E6PA 4QIVA 4ED0A 2ZQTA 3UFCX 3CWJA 3J7ZT 4C0HA 3ITHB 1JJ2R 3GILA 1N5QA 1LWEA 3JTNA 4OJ1A 2MPHA 5DQGA 2K1RA 1VQLS 3PW2A 1RT3A 3FRYA 1VFJA 5T7LA 4V19X 3F44A 3H25A 3ULHA 2D1CA 2BM0A 2J7UA 4G50A 1MROA 2YWHA 3MEDB 1FDNA 3PFEA 4JFJA 5AXKA 1LW0B 7FD1A 2V4RA 2C28A 1JLQA 1QM9A 1HYSA 2HWTA 3CD5A 1MU2B 4C11A 2E7XA 3QYYA 4GKKF 1NMWA 1LK5A 3UDLA 1VQYA 2DD8S 2WSEC 2YTCA 1HJVA 4DL5A 2K7JA 1S6QB 4QIEA 2J9DE 4YHHF 2IA6A 2PC6A 2J7WA 3N01A 3UE2A 1FXLA 2MXYA 2PDAA 1U2RA 3TAMA 4MTPA 2HHPA 1F9FA 4ED3A 4ML4A 2ZDOA 4YFUA 2W9AA 2CPIA 2VOPA 2RU3A 2XEXA 2XS7A 4WU2A 4BBYA 4CTAA 1BKFA 1S1WA 2CZ4A 2I38A 1X4BA 1D8YA 2ZVSA 1JLBA 3E01A 4TQRA 1HW8A 4C3LA 1WTFA 1FRMA 2OAUA 2YKMA 3WD1A 3OLBA 3HVWA 4DWSA 5D4LA 4BHQA 3T1YF 4NLRA 2Q66A 1R8AA 2RNEA 1KR4A 2GGPB 5C24A 3HF5A 2XI3A 4YMEA 1VRTA 3KK3A 4OI1A 2VBWA 1O5JA 4WFYA 1BQNA 5FJ4A 3SQGB 5K5MA 4ED1A 3DXBA 1Q81T 1A9NB 2KFYA 4XK8C 5CYJA 1LV5A 3ZFVA 4QWEA 3LUOA 1X7VA 5LXYA 1IKVA 3UW1A 1NWSA 2RQMA 2UZAA 1N36F 2IC3B 4G1QB 5CYQA 1YIJS 3OSPA 2KRRA 5A8KA 2UUBF 3S01A 1RAJA 2DH9A 1LOUA 2IVMA 2M52A 5KG1A 5EHHA 3QGGA 2DSUA 5BXJA 3N5FA 4C97A 2OSQA 4OLOA 1OQ3A 4BC7A 3AS1A 3KAGA 5B0DA 4GMKA 1VHFA 1ZH5A 2OP5A 5DG7A 3C6TA 4HYKA 3CT9A 2MZQA 3T19A 2DIVA 5AXLA 2CIMA 2XS5A 4F4ZA 1ITXA 1R8PA 2DRAA 3N6MA 2XY5A 3IR7B 2LJ4A 2XBPA 4FZVA 4DRMA 4LAXA 1KTVA 2R4FA 2IM3A 3CC2S 3DRSB 3MOJB 3HFKA 4IFVA 4MK7A 1HFEL 3ARSA 2J7KA 2MZRA 5K8OA