4ZPWR

Structure of unbound mers-cov spike receptor-binding domain (england1 strain).
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein
molecule keywords Spike glycoprotein
total genus 57
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zpwR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zpwR01
4L3NA 3D0HE 3SCIE 3SCLE 4KQZA 4QZVB 4ZPWR 4KR0B 4ZPTR 4L72B 3SCJE 3D0GE 3D0IE 2DD8S 3BGFA 4ZPVR 3SCKE 4ZS6A 2AJFE 4XAKA 2GHWA 2GHVC 5DO2A
chains in the Genus database with same CATH superfamily
1EP4B 2MPUA 2P9CA 4I56A 2FHJA 5LSLA 4DL4A 3ZZ0A 2XY7A 2R8GA 3RGCA 3T1HJ 1ZM2A 4DRNA 3OVSA 1XMBA 4U95A 1YW5A 2IM2A 3MR3A 3QJLA 2KZMA 2R7TA 4KFBA 1JLCA 1SB6A 3BN4A 4W92B 4LF9F 4DWSB 1FKFA 3P8BB 1EB0A 3NL0A 2DKOB 2NUUG 4F0KA 2F5GA 1IQTA 3KDNA 1KLNA 2QMWA 3J81Y 3KK2B 3VVUA 2KXNB 2BQRA 3IKDA 2DD8S 3NS7B 2PEHA 4A8KA 4NRTA 2CPJA 4K59A 4IFVB 1KVIA 2LDIA 1KNZA 4A8QA 3GFHA 1JB0C 1FWLA 1VDHA 2LEBA 3TX0A 1TVRA 4E98A 1VRUA 3KLIB 4CLUA 4RJVA 4XTTA 2PPOA 1UFLA 5B0CA 4Z2GA 1IKYA 1TL7A 3O2IA 2AMCB 2F4VJ 1LWXA 3PHTA 3GJQB 5DETA 2XMWA 5IOLA 1A6LA 3UFCX 2A3BA 2OH2A 3MURP 3RR7A 2OP5A 2OEMA 2IBOA 3MTKA 3OA5A 3F73A 1NK5A 4DQIA 3THTA 1KTQA 4F2SA 2CQ0A 2B6AA 2ZOGA 1CVJA 4DR6F 3NOGA 3CCTA 3UVJA 5KFWA 1TKXA 3DLKB 3EPGA 4ECWA 4CTAB 1NH7A 2OLWA 1Y0HA 3EJMA 2HNDA 4I1TA 1JXVA 4MK9A 1HHTP 2DY9A 2BKPA 3T9NA 3W8PA 1U47A 1SJ4P 3UD3P 1KC8T 2HVIA 3LUOA 4DU8A 2R2RA 1FKGA 2N82B 1TK5A 2MKKA 3PRAA 2GHWA 1UVLA 1X0PA 3B4MA 1FTRA 2DNGA 2JFDA 1TL1A 4X4SA 4TU8A 2B9YA 4B02A 1W1VA 4BBYA 3UR0A 2HHQA 1W9UA 1FERA 3Q8PB 5I3QA 2ZR6A 5J2MA 4I2QA 2Y1RI 2OD4A 3U7JA 5HQ8A 4LIRA 3PY8A 3H7HB 3CCES 5AE1A 3H5YA 4NA1A 4QZVB 4ED6A 2QA2A 4FF1A 1E6NA 2DGUA 2XI2A 2DPJA 3NG8A 3QAEA 2QSWA 5A76A 2MHEA 4G1IA 4QOTA 1IBLF 2CVEA 4B3RJ 4X4UA 4I64A 1WACA 2UUCJ 1N88A 3FSYA 2ZZNA 1KWMA 4GGQA 4FXVA 3QIDA 3LGHA 4ANDA 4DI6A 4FS1A 3KAIA 4OYMA 1OY8A 2F4EA 1T9YA 4DDFA 3T41A 3CO0P 4PEOA 3RR8A 6FDRA 3KJVB 1Y5NB 2RUSA 3C15B 3PHEA 4QR1A 5GAEI 2WM0A 1RB0A 4G1QA 4KC5A 1M5YA 1S6OA 4P8XA 2KN4A 1GEHA 2ILZA 2OKQA 2X7IA 3IG1B 1FKHA 3TW0A 4IG0A 5AJ3F 3LWMA 2ZHAA 3BSCA 2AEJA 4ZJOA 3FSXA 2UXBJ 3R2DJ 2YNFB 1AROP 1IM4A 4IOAQ 4O4RA 4IPXA 1URNA 2AW0A 2KFYA 3BSOA 2UUWA 1PC5A 3HHLB 3KLVA 1QSYA 2HZVA 3G82A 1EARA 2HFVA 5IZHA 1J4IA 4IT4A 1X4BA 2GGPA 3PYGA 5KG0A 3BSNA 1RT7B 1KQKA 3ENWA 1LJYA 2J6TA 1CJUA 1GPFA 1PAEX 1EQMA 1IUJA 3UI3A 2BJEA 2ALYB 2W01A 2PA8D 3SQOP 4C8NA 2F63A 3IC1A 4L6V3 4Q7AA 1UP1A 1Q1KA 2CQ4A 4WWSA 2ITKA 2XG8A 4BS2A 1FKKA 3M32A 3NCQA 3FCWA 2LQ8A 1RT1B 3DRPB 1O6XA 5IT0A 3D28A 2DNRA 2HFUA 3SV4A 3UQBA 4HHHA 3ARYA 2HRTA 2XO7A 1NRKA 1D1UA 1CS4B 3W65A 5LOQA 4FNIA 2HBYB 5K8NA 4P2SA 4CWBA 3CJ4A 3PEJA 4YB5A 3S7RA 3DRSB 1VF8A 1VRUB 3KLIA 3S01A 2DH9A 4BC9A 3RMEA 3MPWA 4F04B 4JP8A 1LFWA 1D7HA 2XGPA 2OPPA 4ELVA 4DR7J 1SH3A 2AIRB 4YY3J 3R7NB 4R8UA 5KFQA 3L7OA 4GC7A 5HROA 3UN2A 1S6PA 3AJ2A 1FKDA 3M6WA 2CPFA 4QT3A 2M52A 1D9AA 3DYAA 2QA4G 2EFVA 2W2PP 3U1LA 1L3TA 1RQ0A 1KEKA 4O4GB 2MXYA 2VBZA 4JUZA 1XWLA 2BA9A 4R8UB 1Q0NA 2NSBA 2HK3A 4BCAA 3HVTB 3D5MA 1E6VB 1NMEB 4QIBA 4W4MA 3UD4P 3PXGa 2YWKA 5KFZA 4UZBA 1JJCB 3OD2A 1RTIA 1FDBA 1RADB 3UDCA 3GIIA 2ZWOA 5IXUA 4G1PA 3R5CA 5AXLA 4ANEA 1XBWA 3BGOP 2E1MC 4YFUA 3DKDA 2FB0A 3QQCD 3DLEA 4PYAA 2FLPA 5L46A 4YMEA 4K4SA 2CNKB 2IFXA 1F0XA 2Q66A 4DV3F 3G6XA 3FAPA 4DS5A 2HPUA 3M05A 1TV6A 2XZWA 5CH7B 4LRDA 1RACB 2J0WA 3ZZZA 5IV3A 2HZAA 2W7OA 1HKJA 4LRFA 4DV7J 1HA1A 2GVZA 1N8RT 4M95A 1KQGB 1FXDA 2V8HA 1R31A 4DN0A 1HJXA 2DSZA 5FJ4A 1I1GA 2FLOA 3D6TB 4ZOSA 4ZPBA 1JXEA 5KG3A 1KFSA 2A2DA 1HJVA 1FVSA 3SSQA 1S57A 3JQKA 3DDIA 3KABA 3OXLA 4LSNB 4NZ0A 1REVB 3JAMY 2XLIA 1Q5YA 3R6LB 1Q8IA 3QGPA 3RBXA 4ZCLA 4KBIA 3FQLA 2ZUGA 3DI6A 1XR6A 2QLWA 2XTJP 4C97A 1FEHA 3LH2S 5DG9A 5HP1A 1CULB 1VHFA 3H5SA 5I3UA 3FCVA 5SUHA 3V6KA 5K8MA 1RISA 3AQOA 4W9OA 4ZVSB 3WH0A 4PZVA 5IC6B 2RUCA 1B7YB 3CMQA 2W1BA 4GKJJ 4IH5A 4AT1B 3TVKA 5HQMA 5H9EJ 1BQNA 1T3NA 2A3AA 2ZWPA 2V67A 3RGIA 3M8QB 3SBMA 3H0PA 3GILA 2B3TB 2IAJA 4J9QA 3KMSA 2ZBIA 3MF5A 1IJEB 1OS5A 5GPGA 1J27A 4HR2A 2KO7A 3LGMA 2AJ1A 1T03A 1NK4A 2V4RA 1AFIA 4BHQA 2JJ4D 2M8HA 3PNIA 2FHOB 2KE0A 2MZ1A 2M4MA 2XMUA 4ZIVA 2UVUA 5HW8A 3SQGA 2ZBCA 2GFFA 2IPOB 5JJBA 4TU7A 5ETNA 2UXCF 1VC0A 1AUDA 3CH9A 2NXUA 3UCUP 2EEYA 2ROEA 5IT4A 1NSAA 4RPFA 2RQKA 4FZVA 3UW1A 1NBEB 4DQRA 1N5VA 1TKZB 3KG1A 4LFAJ 5LM7E 4U6PA 1JNRB 1Z1ZA 2OIHA 3ODKA 1WEZA 2VU5A 2MZTA 1NWRA 1BQXA 3OTOF 3R5JB 3DLLQ 3NMRA 1VRQC 3O5QA 1FNXH 1LXJA 1ACMB 1YX2A 4JI4F 2A1BA 1J6YA 2LGOA 5H9FK 1VK3A 2ZH9A 1S1TA 1PIEA 3IWXA 4CDIA 4CRJA 2IBKA 4QU6A 4URGA 3WD3A 3AHPA 1RWMB 3PW7A 3E3XA 3D9BA 1H7WA 1K73T 1BD6A 4P72A 3UDEA 1SQFA 1RCOB 4DL6A 4DQPA 3GV7B 3H2LA 1K9TA 2D9PA 1A0OB 2HNZA 4M5LA 2HHXA 3PRDA 2AGOA 1B6CA 1F1BB 1LWEA 2V68A 3HZEA 3BJYA 4KHPF 5C25B 1RKJA 4YOEA 2QJ3A 1CS4A 2KZZA 2OLHA 3C16A 2HQ3A 2RDIA 1FFRA 3CJQA 4KE5A 1TU0B 4USKA 4WP3A 5CCLA 5IWAJ 3OHAA 1C2PA 2VIHA 2C22A 1N6QB 2XNRA 4ECXA 1LW2B 1HQEA 4TW6A 1MU2A 3GIRA 1VIOA 4JV2A 4R0JA 4L72B 1WKKA 2YY3A 4F3MA 2YNGA 3H2UB 2IJRA 3M1VA 2FVRA 3UN3A 4H4KA 2NLWA 2DGQA 1UFWA 1Y5IB 2OO4A 3BV8A 2VG7B 2V2QA 5D4OA 2ZC3A 5F0WA 1XERA 3E8OA 2CKWA 3N9UC 6FD1A 1S0OA 4IQXA 4NNRA 1JLAB 1T05B 5F8JA 1ZU8A 3MAHA 1UPPA 1GX5A 2XMJA 4EMDA 5EWEA 4WU2A 1KTVA 1GOIA 1HPZA 2MEWA 2XMKA 3OUYB 5HP1B 2FJXA 1WKJA 1E6PA 2CQIA 4IR9A 3K5LA 4X65F 4RW6B 1QJHA 5B0AA 2GIRA 4QWDA 1ZBCA 3MR5A 3CCLS 4UDMA 1I94F 1EP4A 4U84A 3QLHA 1NDCA 2OMLA 4OLOA 2JEGA 5EGYA 1S10A 3FJ2A 2XWXA 1ZK6A 1N4LA 5KG6A 1T03B 3O1LA 4F36A 3SDEA 2RU3A 1WI6A 2GVZB 4BF8A 1D3WA 4OHYA 3DU5A 2IDEA 3ZO7A 3TCZA 4A48A 3CDAA 1UR8A 1CJVB 4FXDA 1C0UA 1EX8A 3OT9A 2D1CA 3DOMA 3NCPA 3TARA 1KONA 3AOBA 3GIMA 2PMWA 3G6YA 1YTYA 3KDOA 2R7VA 4X4PA 1VRTA 4Q8FA 3ETMA 5HQLA 4HH1A 3TQEA 1FRKA 4ECUA 2C2EA 3P6YC 4QCLA 1NWTA 1TFYA 3AS0A 2XB2D 5ETSA 3L7UA 3MM8A 3JQMA 3CD6S 2W7AA 3AD8C 2PPNA 3RBZA 1O0PA 4P6QA 3MFHA 5EWFA 1VYAA 5CYQA 2KM8C 5SZTA 4A8XA 1N33F 4KY3A 5J6EA 2RHQB 4QPTA 1UW4A 3M2UB 1JLQB 2K8GA 1UL3A 4CNYA 1TZ0A 4X4RA 4NLYA 2HFOA 3QT6A 5KFMA 2HWHA 3CB4A 3PR4A 3M1VB 2BABA 2HK2A 3QLHB 4MAKA 4P74A 2HVZA 2MSTA 4FBTA 3DOLA 3P5BP 4Y2IA 4Y2MA 3RAQA 4DRKA 4L76A 1K0VA 5L9NA 1BMQB 3OTBA 2MQ8A 3DMJA 4ES2A 2W8KA 2FVQA 3BDPA 3KG4A 1DLOA 2LEPA 2B51A 2RQ4A 3MPDA 4LF1A 4DRPA 2R8IA 3IR6B 1ZM4A 3MEEB 3BO4A 2MZQA 2DJWA 4KV8B 1Q8LA 3C66A 8AT1B 2A0FB 4FYDA 2E7XA 3A13A 4G6VB 5KFOA 3BH7B 1SJ1A 4E8UA 4JI3J 3NNHA 2BM1A 1JMTA 1HNVB 3HD2A 3IFEA 1PJ7A 5HW6A 3K7RA 4UQTA 4EWTA 4KJIA 3C6UA 3TANA 2B0GA 2ZD1B 2J6SA 4Y3CA 4K4XA 4ZPTR 3HJVA 4C02B 1H74A 2VFRA 4O23A 2JDJA 2CPIA 4NLWA 4EK2A 3DN9A 1S48A 2B8PA 4HBOA 3H59A 4IFYA 5M2RA 4RUAA 1IX5A 1BHNA 1OWXA 1W7WA 3MM9A 3O5FA 3QIPA 1RYRA 2MJUA 3CCVS 3ALGA 1EETB 3JAMU 2UXCJ 1D09B 1PBUA 2CDRB 2G2OA 2YNFA 1SBRA 1ZA2B 1TKDA 1XK8A 4KHRA 5F8MA 2B7BB 4CCHA 4OLPA 3CE8A 4JI5F 5LJ3Y 2RDDA 3C15A 2DSWA 1KS2A 2YNHA 3M2VB 1D7IA 1IKWB 1HQUA 4TLQA 4TNOA 4USTA 3B82A 2Y1LB 5KFAA 2L08A 3TOQA 4ILMA 1TL4A 3PACA 1JXLA 4RNHA 2GZOA 3I32A 4DQSA 4JI1J 1ZZNA 2Q5AA 1EHNA 3MR6A 3TYTA 4PUOB 1JX4A 1H6KX 4C8LA 4ZCKA 1FKOB 4MYTA 5KG4A 1Y00A 3MCOA 4ED0A 1HWJA 3M8QA 3QBCA 4P2XA 4JI5J 2VOOA 1Q16B 2DNLA 2OPSA 2MQMA 4LF5J 2G0JA 4H54A 2BOAA 2QSFA 4NMXA 3TVZA 3H8YA 2M8DB 2E5HA 3MMBA 3MR7A 1FI4A 1NSPA 1NXIA 2RRBA 2ZKTA 1QD1A 3IS9A 1XMQF 1HQ2A 3CF5Q 1P9QC 3NGKA 2MB0B 3OQ2A 3W9JA 2YH1A 1DRZA 1F9EB 2C28A 3QT8A 3IRXA 3MMCB 4I0WA 5T7LB 3G9CA 2Z2LA 2W2MP 4DV4F 1WTFA 4RBVA 1BUXA 2ESCA 4H4MB 3VCDA 1KLMB 3CHDA 2M0GB 3ARXA 3M6UA 5F3TA 4CLWA 3RB0A 3QT7A 2ACYA 4GIVA 3QPIA 5C24A 1FWKA 4YR2A 4TQRA 1N36F 3MR2A 1GTEA 2VCDA 2HLUA 2VBXA 3QWPA 1EDQA 4GKKF 1UEKA 4DSKA 4JI8J 1UZDA 1VFJA 2K1RA 3BM7A 4ED7A 1M5PC 4MFBB 3A12A 4GVLA 3MXHP 1IN0A 2YKQA 4CP5A 1BKFA 3I6PA 2UVRA 1FFQA 4DRIA 1CSJA 3J7AN 3KOAA 1U48A 5E3QA 3TR5A 1X60A 1PG5B 2V34A 3RRHA 2NCKL 3QJJA 4RNFA 3DXBA 1SKSA 4DG1A 1N36J 1U1NA 2JNJA 3QFWA 1NKCA 4ZLNA 2J8SA 4M8LA 5D3GA 3TJ8A 4IG3B 2BYCA 1TVRB 1QPLA 4KGZB 1EQ0A 1E6VA 1UJ6A 3FKBA 1DBDA 2O5DA 2Q1LA 4MMOA 4ES3A 4LR8A 2XQCA 3MUMP 3TA2A 2DT3A 3I96A 2UVVA 3M8RA 4IUFA 4C9DA 1SC4B 1D2KA 4U86A 5IS2A 1T11A 1I94J 1SCJB 5ETRA 2AYBA 2GIFA 1U2FA 1HWLA 2RIJA 2G4BA 1SL2A 2UXDF 1WKLA 3HLUA 4ZPDA 2HBRB 5HMXA 4ILRA 1NK8A 2GCFA 3NAIA 4FP9A 5D6GA 1ZCNA 2AF6A 5KFSA 1S9GA 2GNKA 4R5PB 3KZ7A 3G6ES 5J2PB 2KFWA 1SC1B 1S76D 2F8MA 2MQNA 5K8PA 4DPTA 1WC1A 3UQIA 1OYEA 3LWLA 3EYZA 2WVFA 2G1HA 3OV7A 2E1CA 3NRBA 1T0TV 2FJEB 4O4GA 4DSLA 1H0GA 1UWBB 3HHKA 1NB7A 1JLBA 1UJ5A 3IAS9 4NYOA 2FZCB 3KXDA 4PAAA 1AB8A 3O5IA 1F5CA 1S6PB 1B4SA 4MK7A 4ANCA 1N32F 5CQGA 3N79A 4HI1A 2Y0BB 2BOPA 5E3RA 3UPFA 4P9SA 2PV3A 2W25A 2MY7A 4NCAA 3IGNA 2GVDB 2F1FA 4UTGA 3L4BC 3V4IB 7FD1A 4DWIA 1RT5A 2HYIB 2NYIA 2AJ4A 2C2ZB 4P10A 3VQSA 4ZVHA 2KFZA 1WNEA 3HHLA 2XWYA 3BBBA 3ZZUA 3G4SS 2XNQA 3AH6A 1FD2A 2CA9A 3I0SA 1Q81T 3G2XA 1CJKA 4USIA 4GO7X 2YH0A 2L41A 4LF9J 1CLFA 1E6YB 5G4DA 1HBOA 1TUWA 2BV3A 4WPAA 2DR7A 2XS5A 1EKSA 2JLFA 3CPWR 4Y6IA 1TAUA 2FQQB 2AHOB 3N4WA 2DG4A 1U09A 4EFAC 3LP0B 1FKPA 1S9EA 1V3ZA 4CT8A 2W9CB 3OJUA 2HFSA 4RLEA 1U6FA 3PCOB 4GRSA 2ZVIA 2G8ZA 1H73A 1MLAA 2GMLA 3LP2B 4J9UE 1JKHA 4K5SA 5A8RA 3J7Z5 2IAJB 2BJ9A 2DY1A 4H4MA 3FZ2A 1RYSA 2BVZA 2HS3A 3S8SA 2ATCB 3KLEB 1QPFA 3JTNA 3GP9A 2XP4A 4LF2A 1RD6A 2HS4A 2V6AA 2RSQA 3CJSA 4GMKA 3EWGA 1CULA 2GMJA 4PQAA 5DDQC 4L3KA 4CO0A 4J9RA 4LF8J 1X4CA 1KFWA 1HARA 3AJ1A 1U1KA 1PYSB 3PX4A 2HWIA 2AWGA 4USUA 3M32B 4PYDA 3OVBA 1RWPB 4I2QB 1GAOA 3RZAA 3SXLA 2ZJQQ 1NJWA 1HBNB 2QIFA 4YDXA 1N6QA 1RA6A 2W9AA 3MGJA 3CHCA 2LVWA 2UP1A 1NPPA 1WI8A 1VC5A 2Z2YB 2JVOA 5D75A 2VB6A 4TY8B 4TN2A 3W5YA 3B4DA 4OYXA 3G82B 1W9PA 4Z2IA 3JQJA 4UW2A 4WTYA 1J5EF 1RT4B 4X84A 5K20B 3MMAB 5I42B 3W62A 5LXRA 4NLQA 2B5JB 1U1PA 5L39A 1XIQA 4FKXA 4RW9B 1C1BA 2IMOA 2DNKA 1FJGJ 1NZAA 4DWSC 5F9NA 2RQCA 5J2PA 4W9PA 2HNYA 4MNKA 1R0BG 1RAOA 3CW2C 2E5LJ 2DRAA 3FY1A 2B5UB 1R43A 3KNGA 3U1MA 1CBKA 1KP6A 1SC6A 3OTCA 1Y3KA 3AQPA 3O5RA 2QL9B 3K58A 1IKYB 4ZVRB 1HBMA 2ZH2A 2Q3PA 1IR0A 1V5IB 4EZ9A 5IWAF 1CG2A 4DR1J 4N41A 2EFPA 4WZMA 4M5KA 5C2GA 1N48A 1B3TA 4LGXA 1LL4A 1BGXT 2DNNA 2ZBRA 2M9KA 2RU9A 4ZLJA 3RAXA 1AZSB 1ZPWX 2KT3A 4PPDA 2IM3A 1U45A 3CJ2A 3ONQA 1TKXB 1WAWA 2DT2A 3DLKA 3MPVA 3CGMA 2RSEA 1NUEA 1SJQA 2DIVA 2X51A 3JXVA 1U26A 1UWBA 1WC3A 1FA0A 2OPPB 3PYDA 4QPXA 2CNNB 1YJ7A 1BQMB 4J4OA 4LREA 3T19A 3W9HA 4WFNQ 5A8WB 1PYTA 1RBAA 4F25A 4JI1F 1VR6A 2AV5A 3QO9B 4LVOP 5HJXA 3S1TA 2RT3A 3N6MA 1LK5A 3EVMA 3WD4A 4K7QA 2C3MA 3MM5A 2G2ZA 1KT0A 2H5IB 2VBWA 4IFYB 4NLRA 1NSQA 3HVTA 2AZ3A 2I1RA 4HACA 3RG6A 4DV0J 3ARWA 1VHIA 2N3LA 1S1XB 2V8PA 3WDOA 2V8VA 4MNLA 4ETZA 2QV6A 5HAOA 4V19J 1IKVA 1UW9A 1UTAA 2CNLB 2KI3A 1R0CB 2FGCA 2PT0A 1X4EA 3BKFA 3Q8UA 4NL5A 4C11A 4OX7A 1OYDA 3KAFA 2IM1A 4TQSA 4B3TF 3QNWB 1S4EA 4OHVA 3TJ9A 3IHZA 1N0VC 5D0HA 3OTDA 1WSRA 2MKHA 3FBFA 4AQYF 1S0NA 1B7FA 5E5NA 3DRRA 2IRUA 1U4BA 1OY6A 3B9DA 2KG0A 4USHA 5IT9U 1KVJA 1QAXA 1S9GB 4LAWA 4X65J 4DSIA 3QRRA 2XEXA 1PBAA 3K8WA 4PKDB 1VGYA 1RKIA 4ZLPA 1ZB5A 1FJDA 1RAAB 2YPYA 5KFHA 2H4WB 1J5OA 4WKRA 4K4YA 1X5TA 2CPZA 2OPSB 3MECB 2QL5B 2HVEA 5B0DA 3BXWA 4K50A 1UVJA 2PMHA 3FMWA 3FZBA 4YS2A 2OD6A 4WIQA 4J9NA 1WTBA 5J2NB 4LFCF 3RAMA 1R9HA 4M5HA 4YB7A 3NNAA 4DL2A 5K5MA 4DROA 3C14B 4DN9A 4CZCA 4LF8F 4GKJF 1A9NB 2OUGA 1SI9A 4WE1B 3C3LA 2RKIA 3SCLE 1PGZA 2HQDA 1HI8A 2OHDA 5GAGI 4DPYA 3PM9A 4X62J 4RZRA 1SQGA 1NJIT 1XJWB 4DR7F 2VICA 1NMWA 4AUKA 4HARA 2IM0A 2H5EA 2NXCA 4KFBB 3RB6A 2BJ7A 1DZ5A 3FBBA 3HF5A 3MM8B 5LXYA 1EAYC 4A8FA 4DFPA 3N01A 2J0XA 2ETNA 3MPUB 3TVYA 4CO1A 4CYUA 4M5JA 3CUNA 4ECRA 2YX4A 5IM0A 2ADCA 1B64A 4B9LA 3BGUA 2ZQSA 2NSCA 3PJXA 1ZETA 1LWCA 3FVYA 2CXEA 1VK8A 1P27B 2ZITA 5A8KB 2RRAA 3VAGA 1RI7A 1RT2A 1WG4A 2MQLA 4AD6A 2MQOA 3HT3A 2R7RA 4JV5J 4FYXB 2AU0A 1V5VA 3LA0A 1FE0A 3RRGA 2R8JA 4JI3F 1ZBTA 2XP6A 3UQAA 5A0YA 3FRYA 3JSYA 5K9FA 2COLA 5KFKA 4Q8EA 5GAHU 1REGX 9RUBA 3RTVA 4FVMA 4EBDA 2E44A 4UOCA 5FD1A 4DUTA 2E7WA 4DXLA 2JEIA 3LGNA 2QA1A 1V6HA 2MLZA 3R3TA 2HGLA 2VPYB 4I6YA 3V2UC 4JV5F 2R7OA 3CXCR 2A10A 3G8SA 5KFEA 3MTJA 3PW0A 4YDDB 2BX6A 3F41A 3JYJA 1C4AA 2JRSA 2G9OA 3IM8A 4TYAA 3QJPA 1UVIA 3WX4A 3PX0A 3E2EA 3TUJC 3LUYA 3O5EA 3ARPA 1IWGA 3HDSA 5LMUF 1O8BA 3DFEA 4KYZA 3ZFVA 3PR5B 1LWFA 1FX2A 2H65B 2VG7A 2HFNA 2DHSA 4U67Q 2F8EX 1RTJB 4HHUA 5F0UA 2CJ9A 1Q95G 1QAYA 3NCRA 4C11B 1HNIB 2G0IA 1LQ0A 2F65A 2PPPA 3AB4B 1IKXA 4K0KJ 1VQLS 3MM6A 1GX6A 1RGVA 3US5A 4AL7A 2C3PA 1E15A 4RNOA 4Q0BA 2RRNA 4IH6A 3T5LA 1JLCB 4EGLA 4RW4B 2WOMB 5KFYA 4NMLA 5MAOA 2DGSA 1OGBA 5D4LA 1NH6A 2ROPA 3GE9A 3QIPB 4MJKA 4NYZA 1UKUA 2KFNA 1FK9A 2CNOB 2E5IA 3C2PA 4WZQA 1X4HA 1YITS 1UA1A 1Q7YT 1QTNB 2AEMA 4CM2A 1DARA 2GVDA 2F23A 1Q5VA 2ZQVA 1F60B 3DHXA 3HD1A 3NLCA 2OAUA 3T6JA 5CZXA 4IR1A 1LG2A 3DOLB 3MMJA 2WZ1A 3Q2SC 5IT9Y 2VG6A 2YKMB 3RBEA 2LYVA 3AS1A 5A0YB 4XK8C 3CC7S 2XMVA 1RT6B 3DC2A 4YR0A 4ETXA 3PW2A 3I0RB 1HYSB 3HCXA 1T02A 3GTYX 1T9XA 2B56A 2Q43A 5KG1A 2MQPA 1JLGA 4HTJA 2CPDA 3MPYA 1SIWB 4KV8A 1SJFA 2F40A 3J7YI 2VDIA 2M2AA 4YN3B 1WHWA 3KLFA 4PRFA 4JI8F 1VISA 4LAYA 1VQPS 1RLDA 1UZHA 3FQKA 3GQCA 3CC2S 4DUYF 1UMJA 1HNWJ 3BBFA 1QE1A 5KFUA 2MLXA 3EY6A 3CTRA 3WC0A 3OUYA 4DR3J 1NPRA 4PXCA 2KYXA 2LXFA 4N47A 4F4ZA 2BR0A 3FK4A 2XHWA 2XHCA 4I69A 2Q79A 3G96A 2A6MA 4N7TA 4IKAA 3WL1A 3D7SB 2PBCA 3IWNC 4GKKJ 1YIJS 4Q2MA 1FE4A 1RHRB 2KDOA 5KT4A 1VQ8S 3GWCA 1KLMA 4C98A 3OSPA 2KGJA 4P7TA 4DV1J 5GMDA 3CDUA 1HD0A 2PI5A 4XIUA 4NXNF 3KLHB 4DR3F 1OQ6A 4ED5A 2YQ1A 3THVA 1G7CB 3CDEA 5HBMA 3OL7A 1VQ6S 3IM9A 2WSEC 3MAAB 4PG6A 4JFJA 4OI2A 4O3NA 1VI7A 1X4AA 4CLSA 3KLGB 3CJ8A 5CXTA 4DV3J 2R7SA 3ALFA 1Y9OA 1N34F 4OX6A 4DX8H 2LA6A 2Z2MA 3JTPA 2FDNA 3IR5B 1Y5LB 5JXSA 4ZCMA 4C8YA 1UCNA 3GCXP 4UUWA 2R3VA 5AXKA 1IM6A 1FXRA 2VKRA 3NBPB 4PABA 3AROA 5GQBA 1X4GA 2DNYA 4UOFA 2NZCA 2PD1A 4KB7A 2LKZA 4Z7YA 4OI1A 2J9DE 2OPRA 3K89A 3OR2B 1ICEB 4OFZA 2DSUA 2XY6A 1T05A 3AOCA 5KTQA 4OQJA 3K2YA 2DTJA 1DJ0A 5HKGA 1WORA 2DH7A 5IQQA 3WD2A 1VLOA 4QIEA 4K4WA 2LPVA 4ZN3A 1HNZF 1DTQA 4M5DB 4V19X 3QGHA 5DG7A 3OLBA 1FFWB 2E1AA 5AXMA 2BE2B 3T3FA 3GPKA 3IMQJ 1HQEB 4HACB 1EJ7L 4WYWA 4RO0A 4NLDA 2QMUB 4JI2F 1SVDA 3ENQA 4M5NA 1FKAF 2VODA 3A3PB 2GQQA 1LKZA 3QFHA 2VQFF 4EZ6A 4QYRA 4FVCA 4W90B 1FK9B 1UVKA 4FKYA 2H5JB 3PO5A 2BJ8A 3A3NB 1YJUA 1N0UA 2NZ4A 1PKUA 1MG7A 3MCMA 4F4AA 3JYMA 3KACA 1R7IA 1M5KC 2Y1IA 2MJNA 4F4YA 1RU1A 2POKA 3LO3A 3VZHA 4TVAB 3TJAA 4DLEA 1S1TB 1LW2A 1MU2B 5DO2A 2WB4A 4TW7A 3C6TA 3OFGA 3ETOA 4OZLA 4USWA 5F3ZA 4ODRA 2O92A 1B0VA 4X4VA 5HVGA 2DT0A 1YK9A 3AQUA 2JC0A 3G8QA 3POTA 3H98A 4ICLA 3K5OA 3J80U 4CO5A 3VAFA 3DRSA 4DUZJ 1LWEB 3SYZA 5T14A 1LWCB 3BYRA 2Z2ZA 2YWFA 1W25A 2J8AA 3O8WA 2DH8A 4ZN1A 4ZPAA 4ITZA 3FBEA 2AGPA 3CJ5A 3DGVA 1KT1A 5L1JA 2F3JA 1GK8A 4TYBA 1RT4A 4OZ5A 2PA3A 4DX5A 2RH3A 3BS9A 1VQMS 1QSLA 2QC3A 3TX8A 3KMQA 4QBUA 4F3QA 4X4QA 4MPKA 3CCJS 1U1LA 4EUVA 1FFGB 2EWHA 1OPIA 1EKRA 2KVQE 2R2TA 5M2UA 2K3KA 3MUTP 1M5VC 2FY1A 1WJ9A 2GGPB 2ZVSA 5J2NA 2G13A 4GO5X 1EYMA 2D9OA 1NPKA 2KB2A 3KFWX 3A8KA 3OFEA 4FYVB 4A8SA 2XM3A 1HNXJ 1K1SA 1P1TA 4O0NA 4N19A 5GMEA 1J5EJ 1U49A 1PCAA 4GC6A 2V63A 4G3IA 4NI2A 3ITHB 4IG0B 5B8IC 1TTHB 2MZSA 1OSCA 3H4DA 4FS2A 1XQIA 2CJYB 4MFBA 4DPOA 2CJXB 5THWA 3TAQA 3QRPA 3A8JA 1GXLA 1WEXA 4DG1B 4A8WA 4CLYA 4JI6F 3H5UA 3FFIB 4KO0A 1NU4A 4BC7A 4F8RA 1NEEA 2HBQB 3VGUA 3VQTA 4IH7A 4YHHJ 3HSDA 2PV1A 1WG1A 1QAJA 5KAKA 3UCZP 2FJDB 3HO1A 2JZ5A 3Q2TC 2BM0A 2OEKA 1HBUB 2GIQA 1E6ZA 2LMIA 4IQMA 4OMFG 3MEGA 3VAIA 3Q8YA 1HMVB 3MFIA 3UDVA 3O5OA 2OI2A 2L9WA 2CRLA 3HSGA 2XPBA 1WEYA 5LL6d 4WF9Q 3ILOA 4LRBA 1YATA 2Y0SD 1FRLA 4CO3A 1BXNA 2EXUA 4EBEA 2YKAA 3R8YA 3WD1A 3MD1A 1V3SA 4TLRA 2HQCA 5KOWA 1A7GE 4LFCJ 5A8WA 3D1QA 5L1IA 2DNMA 3D68A 2AX1A 2KT2A 1OO0B 3JXOA 4KIAA 4DSJA 4F50A 2ZNZA 3CULA 1IQZA 1VJQA 4JOUA 1ZAWA 1T3OA 3RB3A 1RT3A 4ODKA 2X1GA 1WF2A 2W4PA 4ZCIA 1X6LA 4RUBA 2YKNB 5HLFA 5EN1A 1AZSA 3U27A 4LF7J 3I6CA 4NXMJ 2C1EB 1YKWA 4P73A 2J9DA 4LF4F 3OW2R 4QYZK 3H4BA 2VASA 3OXGA 4RW6A 3VGSA 2ATLA 1XC9A 1N1AA 5DJBA 2GHPA 1M0SA 2MKCA 2ZR5A 3B6BA 3DLGA 3V6DB 2R7XA 3RRKA 3IWLA 1FKJA 1HHQA 1D0EA 4OYPA 4J9VA 3GJTB 1X9WA 3W61A 1FJEB 1WHYA 4KH1B 2PI6A 1TELA 1GRJA 2BQUA 3QO9A 4CLLA 1JLAA 2MKYA 3DXSX 1KVKA 3NGRA 1DQ8A 4OJHA 2MZJA 3TA0A 1RTZA 3ZNUA 4A4JA 4ATNA 4PG8A 2MLYA 1M90T 1F2HA 1X5PA 3H20A 3TZXA 4DUYJ 4C8KA 2WONB 2B9EA 3DYAB 4ILLA 3PKYA 3MM7B 4WXWA 2ZJRQ 5EX3A 2QG9B 4DFMA 4DR5F 4KTQA 1WC4A 2HAIA 2W7PA 1VS3A 1NKEA 1LWFB 3RYLA 3RW6A 2DR6A 2IDLA 2C3OA 1GMVA 2XP7A 1VBKA 3D1OA 2CJQA 2YBUA 2ZJPQ 5AT1B 4N5SA 2ZM6J 4X4NA 2FHKA 2N7YA 2H51B 3BR8A 3ZTPA 1JVWA 3Q23A 4BWMA 3DM2A 4NXNJ 1K0TA 3RM9A 5GAHI 4B3TJ 2J7WA 5LMUJ 3TEGA 4Q0BB 1L3UA 2Y9HA 2PSZA 1YWXA 3I5CA 2BJDA 3PW4A 4RUHA 4A8YA 3R6GB 1JLFB 8RUCA 3EZOA 5HJYA 5JVGQ 1X4FA 3KLHA 4OIXA 3IBCB 1S1UA 3EXYA 4ZP9A 2AP6A 3J81U 3KTQA 2AYMA 1DTQB 2JX2A 4M5DA 1FRXA 4J9KA 4MIAA 1RTJA 5KFDA 2ZH4A 2J0SD 3MEDA 4NLSA 1FEEA 3LANA 3WKZA 3AODA 4Q5VA 3P96A 2I0XA 4LAXA 2N3OA 4JV1A 4EO8A 4QIWD 1ZS6A 2J6UA 5DQHA 2EC2A 4ECVA 5C7PA 1HBNA 4OHZA 4L3NA 2FJAB 4YP3A 2CZVC 3T1YJ 4OI0A 2XPAA 1X31C 1GMUA 4I6WA 4FNHA 5CCMA 1HR0F 3B8HA 2DGWA 3TZWA 2DHGA 2CJKA 1SJRA 5CYMB 2C2MB 5CZVA 3VTIA 2UV8G 4NYPA 3W8GA 3T5KA 3CJKA 4DR4F 3W3SA 4MGVA 5U47A 1J5OB 2HHHJ 4Q2LA 4ENOA 1ZA1B 3MAAA 1EIBA 4ELUA 3JSBA 2YNIA 3O3LA 4U8YA 4CO4A 1XHGA 1RHJB 4RBUA 5KG5A 4DQQA 3EGZA 3I5BA 4YB1P 1XNQJ 2UV8A 1PILA 4W98A 4OJ3A 4U96A 1PBKA 3ET6B 3I87A 4KGXB 1HR0J 2O66A 3QATA 5G0RB 2LECA 2FUG9 3I5AA 4EEYA 1D9DA 4G50A 1RWNB 2M3DA 2K06A 5KG2A 2VPWB 3OTOJ 3OL8A 3FSIA 4Y65A 3GPAA 3MDYB 2DB1A 5AE3A 4Q44A 3BQ0A 3WD0A 4ECYA 1QSSA 3SSSA 4KPCA 1WC0A 1ZOTA 2WBRA 3EGNA 4J9OA 2ZBPA 1RAEB 3BR9A 2Y8YA 2RILA 1XN9A 3ILJA 2WSFC 4NLVA 4ZVPB 5DDOC 4LQ3A 3T1AA 1FAPA 2VH7A 2WRMA 3DM2B 1Y4ZB 3BN7A 3CNQP 3IGVA 5HVFA 2ZH6A 3NS6A 2FIUA 4DZ3A 3EX7B 4J37A 1KQSR 2FJWA 2FC8A 1VQNS 2EG1A 3OSNA 2J9EA 2KT5A 1GMWD 3KAHA 1IR2A 1S7HA 1NHVA 2RKIB 2WBMA 3L95X 3MM6B 1QTMA 2DNQA 2JEJA 2E9TA 3MEKA 1NDLA 3AAWB 1M1KT 2CQPA 3DDKA 2ZH5A 4LSZB 4JI6J 1G3OA 2HKEA 2UZAA 2KH9A 2HMIB 3FRZA 1RT3B 2VQEF 3SMZA 4DX6A 4ZVUB 2AJFE 2HZCA 5HROB 5J1EA 1NM2A 2EFOA 1RSCA 2DNHA 3TNVA 4O44B 5DS7A 3U1NA 1FTCA 5KFNA 5HK4A 1VBXA 2G2YA 3I55S 4CI0B 3EZ5A 4WKFA 2B4PA 2ZOMA 1F5AA 1W1TA 3LF0A 5KT7A 2IYIA 4DPUA 2JVRA 2QN6B 1T95A 5DRKA 3V4MA 1N32J 2MYFA 5BJRA 4K4UA 2WAQD 3ELHA 2YQ3A 4NLGA 1Z4UA 3U02A 2MKIA 4CH1A 1IBMF 2HVHA 3BF4A 2I5JA 2GW8A 1IVZA 1HI1A 1U25A 3HULA 4B9MA 2XLKA 5DEZA 4F0MA 2KHDA 4WFBQ 3TZZA 2DPIA 2B5JA 5E41A 4L75A 2H48B 3OL9A 1NLKL 2VUGA 5DZ7A 2ZDOA 4PG5A 1K47A 3EZUA 2Z58B 3OL6A 1H0HB 1S0MA 5HLFB 2K2PA 2CJBA 1TL3B 3LP1B 2O9OA 2J5AA 1I5OB 4NLOA 2Z30B 2QL7B 3O44A 4YUDA 3VAJA 4X64J 5I3UB 4JI2J 4NXMF 4B3OB 1G4CA 4LF4J 5HWBA 1FFSB 1PYOB 1TKZA 1YJRA 2ASYA 2KO1A 2M08A 1JJHA 2GO9A 3JSRA 2M7SA 2KRRA 5A8KA 4DV1F 5F9LA 2XP3A 2FAPA 3K5PA 4M5GA 4QIFA 1UJ4A 4UY85 1D8YA 2MF9A 2F7VA 4OX9J 3LAMA 4DPWA 1Q82T 2ZHOA 4HKQA 2Y8WA 1KKHA 4OV1A 1JJ2R 1C1CB 3O5GA 1IR1A 2Y3YA 3A1YG 3B8SA 3D54A 3FNNA 3IXQA 3M8PB 3Q0AA 1GNKA 3BO3A 1IWAA 1OJ4A 4TNSA 1RWUA 4WFXA 3ZXWA 4CNZA 1TFWA 2VOPA 3QGIA 1GMWA 4LSLB 3ZTQA 5IFMA 5G0RA 2UVWA 4KGMA 4PCQA 3HK2A 3DU6A 1NO8A 1FKLA 2DGTA 3ICLA 5I98A 3FEYB 2AEFA 1IBCB 1XR7A 1FDDA 4RKUC 2F8HA 4MKAA 2DISA 4XPEA 2X1AA 3CCUS 1UVMA 1Q8KA 2LU1A 2OTJS 2YNIB 3MEDB 1OPZA 5DIUA 2E1PA 4NLUA 1NZ8A 4XAKA 1LW0A 1DFDA 1B0PA 2JHEA 1R27B 2KYZA 3GYGA 4RU9A 2DPEA 1AFJA 3R97A 2XZDB 2LQ5A 1FKSA 1RHUB 2X3GA 1C4CA 3TO8A 5KT5A 3OVAA 2IF4A 3MAQA 4NSBA 1Q86T 1BWEA 2V69A 4RR5A 1MWZA 1TCOC 5C42A 4IQ2A 1YGYA 4RNNA 4AE5A 2H9ZA 4PQUB 5L8RC 1RWKB 4IDKA 4WKAA 2HIQA 3LP2A 2YTCA 1NSKL 3J7A1 1WSVA 3V4IA 1N52B 1CQMA 4A8OA 3NI6A 4FXWA 1FJGF 3FCHA 5F8HA 2C42A 3DOKA 1ROFA 5KFVA 3WIVA 2XS7A 1V3RA 4J5OA 2YX7A 1ULRA 2V4JB 3NXZA 2QX0A 2ZD1A 4W5UA 1M5SA 1HNXF 4E0DA 2B31A 2B6AB 1S1XA 1F5BA 4USJC 3I9ZA 3LW5C 4TX0A 4FYYB 1N5SA 2F21A 4ELTA 3T5HA 2EFQA 3AOAA 3EICA 3BGRB 4X66J 1U0SA 3QOKA 1F6TA 1JNZB 1RAGB 4TW8A 1WC5A 3BB5A 4LR7A 1RHQB 4KKOB 1W1PA 4ZPCA 5GADU 1NHKL 2ZOFA 3VWSA 1YG0A 1TL7B 1S49A 1TUVA 3EMTA 1NH8A 1UEUA 4G65A 3BO2A 1MWQA 2VL1A 1TL1B 3IO1A 2OFHX 3DRRB 5HATA 4C0HA 1PINA 1YLXA 3GFXA 3WL0A 2D3UA 4F0HA 2XBPA 4WYLA 2C2NA 4ZA1A 5HT1A 2N4DA 2V9KA 2W4DA 1VQSA 3R5BA 2CQHA 4LJMA 3W7BA 3H5XA 1WUUA 4HLBA 2WW8A 3HFVA 3TWZA 3WHIA 1IKVB 3CEDA 5HUAA 1P8GA 2XGQA 1QAIA 2CG4A 3BKTA 1LG1A 2AYEA 4ZVGA 2XO6A 1EZZB 3L09A 4MKBA 4DV0F 4WK9A 4DX7A 2JEFA 3LAKA 2KTQA 4K5RA 5LT5A 2DBBA 1RU2A 2EKNA 1Q8BA 1IBLJ 4ZVEA 2CQ3A 4IG3A 4U7CA 1OSDA 1S6QB 2HEKA 1U1MA 3PKMA 2K8IA 3CD7A 2DT9A 3S6EA 3FEXB 3D0HE 4UZCA 2QT7A 2QLJB 2A18A 3KHHA 2WSCC 3V6JA 2XSFA 1B99A 3UWTA 3SQGB 4KQZA 3BGRA 4ZDNA 3M2RA 3NP5A 4RL1A 2ZHBA 2WVEA 1MW7A 3I4PA 4YEAA 1C0UB 1TP7A 4DZDA 3G8TA 1X6NA 1WDTA 2FLLA 4MNJA 5LSRA 4FN5A 4JV0A 3BQ2A 2HHHF 2HMIA 1RTDA 2U1AA 2WVDA 2HRUA 4UUXA 1JLBB 2CPYA 3R5GA 3MZIA 4RW8A 3SDEB 2LQJA 3DOKB 4IQCA 3SEOA 4NLTA 2H1YA 4A46A 2ABYA 3W63A 3CVKA 3V5RA 4ZPVR 1K44A 1LFPA 3K17A 4M5MA 3HPOA 4DV2F 1N56A 3M7VA 2XSJB 4ZHRB 3D2WA 2QF8A 3O5LA 3DRXA 3SFGA 4CLKA 3R7SB 3EE3A 3H2VE 3ZZOA 4AXIA 3QZ7A 4DSFA 4F4KA 3HI9A 2DHXA 4O3OA 1VQYA 3NGTA 1FCAA 3PJ9A 3CJ0A 2FLNA 3IS9B 3PRVA 4LUBA 4RW7A 2HSEB 1FNOA 2IIHA 1FX4A 2CWKA 2RUGA 3N5FA 1A7XA 3DNCA 4NCGA 1RWWB 4OZ3A 3WX8A 1RLCL 1ZBVA 1U0HA 1H0IA 4DFKA 2RS2A 2C2DA 1LQ9A 1RHMB 1SUQA 1XEZA 1M5OC 2UUAJ 2DXDA 3M30A 1RHKB 2LA4A 1ZAXA 3O5DA 2BJ1A 4I2PA 5E3PA 5C2CA 3GONA 4KH0B 4UQGA 5F8LA 3KWMA 4ITSA 1FKPB 1S9EB 2W9CA 2VPXB 1VQOS 1RTDB 2AJ2A 1S1UB 2YVSA 4CH7A 3BBCA 3NEKA 3LQVA 2D7SA 4RNMA 5C5JA 4X64F 1HWIA 3D6MB 2VF3A 1H38A 1C0TA 1HBOB 4H4OB 4P52A 2HG4A 4DMZA 3UI5A 2H4YB 3LPYA 4NLPA 4H4KC 5D15A 2EBEA 3IBWA 5ETLA 5ETKA 2L3MA 1JJ4A 1VQ5S 4DJBA 3MOZA 2GA7A 4OX9F 5HL7Q 3MI7X 3D66A 4DV5F 4OZNA 4Y00A 2VBYA 4RW4A 4ZVFA 5J2MB 1NSGA 1FRHA 2VZ9A 4KT0C 3OHBA 4OL8A 3ISNC 3L7PA 1OGGA 3CZ8A 3TUZC 1T94A 2QE5A 2ZZTA 1VIXA 4P75A 3B9AA 2CVIA 4TY9A 1AW0A 5C24B 1FDAA 2EG2A 3D67A 3DGPA 4ZK7M 5CAAA 4O3QA 1Z2ZA 3EPIA 2MPHA 3OR1A 2RB7A 1SH0A 3PFEA 4MYUA 5DLGA 3C8YA 3E51A 2RF2B 5KT6A 3HXMA 4USMA 4LFBJ 4DCPB 3JB9k 3M9MB 2DYAA 2ILYA 4N8NA 1VJWA 3RFWA 3HX9A 2XC9A 1WWHA 2CIMA 3CC4S 4B3MF 3VGVA 3HKWA 4X4OA 2FVSA 4DL5A 4DR4J 1J4HA 3WIJA 5H9FJ 4M5IA 3CCQS 1SC3B 3A8EA 3ARUA 1QZ2A 3H25A 5DM7Q 2ZM6F 2CQ2A 4OZ1A 1E9LA 1Y3JA 3V6DA 2PIIA 2H3EB 2IRXA 4LVNP 3IK8A 2WVBA 2Q6CA 1U2RA 2YBVA 4I68A 4Y34A 3KK1A 1YRUA 2NR0A 1AYEA 3OFFA 4PG7A 5EWGA 3M6VA 3AS2A 3CHEA 4X2BA 1U24A 1NWUA 3MM7A 3MWBA 4ED3A 2HFZA 2NXJA 5HBMB 5KFPA 3SZ2A 1R3NA 3GFZA 2KJVA 2DCLA 3D1HA 5HMZA 2YX1A 4ECZA 1Q79A 4ZVOB 1JLEB 3D6FB 4B08A 4UY8T 2CDQA 2OPRB 2W24A 3QGGA 1RAJA 3PTWA 3MEEA 4DR5J 4RW7B 5KFFA 3HMJG 1W2IA 2UUBF 1SL0A 4URSA 1RABB 3AA9A 2C3YA 2JWNA 2ZC4A 3RU0A 1DQAA 3ADAC 3KJFB 5GAGU 3PW5A 2DRBA 2XP5A 2XP9A 3ARTA 1S12A 4KGVB 2C2KB 5KT3A 1SQEA 3MEGB 2K1RB 2X3DA 3NOCA 3QYYA 2KRBA 2OMOA 4DV6F 2PN6A 4A8MP 3Q8QB 1RDRA 2CPEA 4URIA 2XYHB 4KSEB 8ATCB 3TQ1A 1NK7A 4ED1A 4DOZA 3R1HA 1MMDA 4FPIA 5DGBA 1CTNA 1RT6A 2D9FA 5ETTA 2KXFA 5KFXA 4AFFA 1HNVA 2K7JA 1BLUA 5F41A 4AY1A 1UEVA 3UI6A 2BW2A 2G41A 1GT8A 2DNPA 3UD5A 1LOUA 2OFGX 2QZ8A 3D0IE 2DEIA 2P9GA 4J7CA 2DRDA 2QA4S 1RT2B 2E29A 3BGFA 5D3GB 4HL9A 4F26A 2C2RA 1VBYA 4LFAF 5GPRA 2ZH1A 1DHMA 1Q6IA 4AYBD 2D74B 4OV6A 1KD1T 3AD7C 3GB0A 3EVOA 4OYZA 3HJFA 2K7KA 2XI3A 3RW7A 4ZIWA 1HMVA 3GLJA 5DM6Q 3ISND 3ENVA 1CJTB 1H2VZ 3SIPB 1ITPA 3NWRA 3CSKA 4U85A 2PE8A 5KFRA 3Q8SB 2R2SA 4DIPA 2P2CB 1QY7A 5EUHA 1AA1B 1FKIA 3M2UA 4WTOB 4HBEA 5F8IA 3P5TL 3PR9A 2E9ZA 1XNRF 1VOMA 4WK1A 2KR7A 3C14A 4RW8B 4LF7F 4Z2KA 2FTRA 2GAGC 4PWWA 2I6WA 1GQEA 5B0BA 5DDRC 4ECTA 3EXCX 3M2VA 4WFYA 3UVJB 2NS1B 3NAHA 4DV4J 4DRMA 2RVJA 1S99A 2V94A 3IRXB 5T7LA 4DU7A 2AD9A 2X1FA 4PTMA 3F56A 4K4ZA 3HFZB 1YQHA 5B7WA 2J76E 3BKUA 4AL6A 2PC6A 3TAPA 1NJZA 4B9NA 3FC9A 4XO0A 1XNRJ 3F44A 5KFCA 3B9EA 1RTIB 1NB2A 3B78A 3NNCA 2RUQA 3AS3A 3ZZTA 3M9OB 4B9TA 2IY5B 1MMLA 3HZGA 2FGOA 2ZH8A 3VHQA 5HTGA 1WOPA 4NE9C 1K9MT 5J1EB 4NASA 5K14B 2A3CA 2MHNA 3KK3B 3NMAA 1C9HA 2E9RX 1UWAA 5GADI 4PR6A 2VD3A 4KGKA 4WIWA 3K57A 4DR2F 1H2UX 3AY0A 2R42A 3UE2A 3D3BJ 4JBCA 2ZFHA 4Q45A 1FESA 1T9TA 1XMOF 1N5YB 5J1PA 2ASJA 1E44A 2RHSB 3X3UA 2EBGA 4OI3A 4J9LA 3C16B 2W4CA 2XYGB 3UDLA 4URQU 2WVCA 3TRGA 1NJYA 1SL1A 3CCZA 1SXLA 2HNYB 3EGWB 2Z8QA 4NX9A 4ZS6A 4PPZA 4PXEA 2V50A 1EETA 2HNZB 5E2QA 3BDEA 2VQEJ 5C42B 4C8ZA 3CDWA 6AT1B 3N6NA 4B3RF 5BR8F 3HFKA 1S6UA 3CCRS 2EPIA 1RUSA 4G1QB 1WOOA 2IC3A 2WB1D 3BMBA 2J7UA 3E01B 1PSDA 3PYEA 1OIAA 4QIGA 4ED4A 4J9MA 3DLBA 2CPHA 2B8QA 3ZTSA 1WOSA 3OR1B 4B3MJ 4UOGA 2EI5A 2DGXA 4HDHA 3EVWA 5DIVA 1JLQA 4GVBA 2R7UA 4ECQA 4R5EA 2BW7A 3KK3A 1NAQA 2CADA 4OZ2A 5D0EA 2R7WA 2FDMA 2APOA 2B9XA 3D0GE 2DK2A 2MMYA 3KJQB 3NBPA 4NA2A 1HKIA 5IC4B 5KFIA 5B08A 5CYJA 5HN0A 3GJRB 1SUQB 3OOBA 2CQCA 2M2BA 2VKZG 1AT1B 3O5JA 3QAUA 2EVZA 2Z0GA 2EFNA 5DDPC 4IRKA 1GH8A 4ODNA 3DDNA 3PG9A 3UCGA 4I7FB 3K59A 1R0AB 2LJ4A 4I6AA 4CYUB 3P4UB 3DLHA 5A6PA 2P6TA 2IHR1 3GJSB 1Y0OA 1CQNA 5DF0A 3IG1A 1WF0A 1DURA 3MCSA 4NLXA 2PN0A 2ZR4A 1YBUA 1IJFB 3CCWA 3MMAA 4IOBA 2IMWP 5DLFA 4IRCA 4ED2A 4OJGA 2FVPA 3FUYA 3HHNB 2EC0A 1CC7A 1RAFB 4K2XA 1QLNA 3GIJA 2ZZMA 4ED8A 3VR1A 3OBIA 2OSRA 4CH0S 1IBKF 3HSJA 2AGQA 1FD8A 5HMWA 4DFJA 4M1KA 3I82A 4CLPA 2PGCA 4CTAA 1R89A 2RQSA 4A47A 3QSYB 3DCAA 2IJNA 3W2VB 4Q7NA 1R6VA 3W2WB 1T8EA 2BDPA 4C0OC 1PJ6A 2I2YA 5T41A 1F8AB 4S3JA 2CJAA 3GV8B 3I0SB 3ITHA 3JYTB 2LQ9A 5LMNJ 3B54A 4YHHF 2R4FA 1VRTB 3KHRA 2NUHA 4FBUA 1V9OA 1GUVA 2XSJA 1YJVA 4ZHRA 2YWHA 2E5JA 2IJFA 2DR8A 1VQKS 4JI0J 3Q83A 4QT2A 1JNTA 2KU7A 5LSOA 1CJVA 1BY9A 3R7BB 1HYSA 3WBZA 1BQMA 3FXYA 2F4FA 1RZMA 4O44A 3K5NA 4DS4A 3Q8RB 5J2QA 4N76A 4NCBA 2NQPA 4J4NA 1D7JA 3O5PA 2BACA 2Z56B 1SIZA 3EUNA 3K0JA 2NYHA 1RWOB 2BRKA 2DEJA 2WONA 5FLXY 2R7QA 4U7UD 2WLZA 2N87A 2QYCA 1BE4A 4C8MA 4JI0F 1R8BA 4HHJA 4KAIA 3ZC4A 2PMZD 4DRHA 3EM1A 3BYPA 5RUBA 3IA0A 4ZP6A 4DF8A 4LMZA 4LF5F 2P9EA 5FDLB 3K8VA 2PEBA 3HHEA 5C25A 2V2KA 4R5PA 2FC9A 3CD0A 3KNAA 4MK8A 5CA5A 1HHSA 2VDHA 3R5AA 4Y2CA 5F8GA 1JLGB 3TUPA 2OEJA 2CQGA 3A8IA 4DL7A 3EGVA 3ZZYA 2VJVA 1XNQF 5E3AA 2UUTA 4DT4A 4P8VA 3BEGB 2BE7D 4USVA 4EO6A 2BBEA 5BYSA 5I42A 1AXQA 2YKNA 2JFKA 3TUIC 2XCAA 1KN6A 5DITA 2AZ1A 3CT9A 3CHFA 4TY8A 3ILLA 3VAWA 2V4JA 3DLJA 3OPKA 4J9PA 5F8NA 1R8HA 2JZVA 3EIPA 3CJ3A 2XMMA 1S79A 2JOQA 4OYAA 2PO4A 3NTPA 2HRYA 5FIIA 5CD4H 4EYHB 1NCLA 2ALZA 4Z2LA 4WKHA 2EK6A 3WQPA 1QVGR 4DR6J 2E7VA 5GVQA 1E6RA 3P45B 2X1BA 1YRTA 4MH8A 1S6QA 3TZYA 2W9BB 4QYZJ 3JYTA 3VZIA 3GG0A 4J90A 2W9BA 4OYOA 4MIBA 2MDAA 4HYKA 1OY9A 2P5VA 4K8RA 1FNMA 4NWBA 4EBCA 1RK8A 3A3OB 3VVTA 4WJXA 1HLWA 1YZ7A 2WCXA 1HBUA 2MTLA 1T9WA 4QWBA 4O3RA 4L74A 1NK9A 4WP9A 3HVAA 5A6WA 2HURA 3J7YU 2WTFA 1FF2A 2OJ3A 2HHVA 2KJWA 3O5TB 1NK6A 4C0BA 3KUEA 2B43A 3WC2A 1Q7LB 3RUBL 5CD4A 2A6OA 2FZKB 3KADA 2XYPB 3KUHA 2GMHA 4HI2A 2M5YA 2GV1A 4FPRA 1FRJA 1Z2LA 3BREA 1HW8A 1B70B 4CT9A 3IRWP 1S0VA 1CEZA 3SCJE 1NDKA 5DQGA 1U6BA 4X4TA 4NCGB 1T9UA 4WBFA 2FJBB 3H42A 2BZ2A 1OWQA 1E6YA 2K3IA 3KYLA 1SJ3P 4RU2A 1X4DA 2I9SA 1CJKB 4JYAF 3T1HF 1TK0A 3R2CJ 3GMGA 3PRBA 3N5BA 3W4RA 3GSDA 1AUSL 1SH2A 2RS8A 3Q89A 4H4OA 2DITA 3CO9A 3D3CJ 4WK3A 3W2VA 2DXEA 4NPOA 4XDDA 3W2WA 2XY5A 2L9DA 3V81B 1D6OA 3W66A 1D9FA 4U8VA 1FKBA 1FXLA 1APSA 1J4RA 5GAEU 4GVBB 3TC5A 1CJUB 1RWXB 2QFJA 2HW3A 1F2GA 5ADZA 1YDLA 2XULA 1KSPA 1FT8A 1WB0A 1F40A 2KVIA 2QMXA 3M30B 3NGDA 2O01C 4KR0B 1ROUA 1TV6B 3KJNB 4OI4A 4P71A 2UUAF 1X0FA 4MKYA 5CHCB 1BWVA 2HLTA 1RAIB 5ETVA 1BL4A 2KKHA 4FN2A 1G6BA 1MWYA 2CPXA 4OI6A 4M63A 1NDPA 5CABA 4DV5J 2PI4A 3Q86A 1H98A 2R8HA 3ENAA 2DVIA 4I7FA 2OFNA 1R0AA 3HHLD 1L1PA 2HGMA 2GJIA 3BSAA 2DO4A 4UOHA 3PX6A 4HH0A 4NA3A 1U1QA 3NKYA 4OYBA 9ATCB 4C3LA 2UU9F 3R1LA 4X62F 3CJTA 1NWSA 3POTB 1REVA 4DRQA 4ICLB 1N5QA 1FKOA 3AFGA 3DLGB 4LBIA 4LBHA 1Q78A 1RT5B 3TEHB 4NZ7A 2JLGA 1N5YA 4ZVQB 4QWCA 3MCNA 3K5MA 2W2QP 4UF4A 1R8AA 2RJZA 5DQIA 5LJ5Y 1UR9A 1SPBP 1Y7PA 4FDFA 4LF6F 2JSXA 2ZUAA 4U7UK 2A2CA 1JNEA 4DH0A 5K14A 2P8IA 1PO6A 4S0MA 2DCUB 5B0EA 4JI7J 2DT1A 2HQGA 2HVDA 3NY0A 2LQBA 4U9RA 1S5ZA 4DHVA 2QLBB 2U2FA 4ZMMA 3CCSS 1NJXA 1FRIA 2DIUA 2JC1A 1TMJA 3GYXB 3F0NA 3DRYA 5ETMA 4LF6J 2QO3A 2B7CB 3CDBA 2AYGA 1X8DA 3CJKB 2WOMA 3Q24A 3ARVA 2BRLA 1MROA 3NS5A 4FF2A 3IAM9 4OZJA 1WNOA 3TDBA 3N6LA 4ECSA 2KG1A 2J7KA 2QLXA 2BANA 3W64A 2PV2A 1VC6A 4ODMA 4RWXA 2PFDA 3G6VA 1IKXB 1F9HA 2V8DA 1F3FA 2IVMA 2LEAA 4EYIB 4K0KF 2KL8A 3RM4A 2M70A 3SCIE 3UN5A 1KBRA 4PWDB 4LIWA 4CLFA 3SSRA 2CG8A 1YJ9S 2MKSA 3CIZA 3I9V9 4OX8A 5E3CA 2ERRA 2G0CA 4DWSA 2MY8A 3D6HB 4K2JA 2AWZA 4W9QA 4P2FA 5CYQB 5E33A 1RE1B 2CQBA 1F9FA 2FZGB 3AXMA 4WJBA 4O3PA 5KFGA 2R9LA 4B3SJ 2NXNA 4KPYA 3HSZA 2N4CA 5AE2A 3G6LA 1RBOB 4JFLA 2NXEA 1RWVB 5D77A 4UT4A 2QEXS 1RBLA 1NK0A 1MNEA 1C1BB 2Y78A 4F67A 1R8CA 1YHQS 3M6XA 2DGOA 2GX8A 3MMBB 3QSIA 1P5QA 2DSVA 2V0NA 3DMJB 4Z2HA 2I38A 4FYWB 2DG9A 5HBFA 2EK1A 3QWUA 4ID5A 1U1OA 2AJ0A 4DR2J 4TYOA 5HVHA 2MZRA 1JQGA 1S1VA 5HO4A 2E5GA 1EIYB 2UXDJ 4ZKAA 3UR3C 4Y0FA 3NRKA 3W9IA 3FFIA 4KO0B 2YWGA 1K1QA 2YPZA 3V81A 2E5LF 1Q1CA 4IDKB 4Q22A 5L1KA 4HVZA 4DLGA 1XTZA 2M1IA 2NPIA 3AT1B 1W9VA 4JYSA 1SV5A 1LK7A 3KHLA 1QE1B 4IT6A 2BEFA 2JL9A 3BGLA 3KG0A 5ETOA 5B0GA 5B09A 1L3VA 4OZ0A 2YWEA 5IM0B 3LALA 5MLCV 4F3OA 4TU9A 4RBTA 1MMNA 2YKPA 3FBCA 4JFIA 2VPZB 5JUMA 1XRVA 1SV5B 4EU0A 3ZTRA 3CMAS 1W2BR 3AB2B 3T9ZA 1TL5A 3JS9A 1HL6A 1RP5A 3KKFA 5D4PA 3M8ZA 3KJVA 1KOOA 1URRA 1SYTA 1QM9A 3M4XA 3J81j 1MSWD 3VAKA 2J0QD 1YSJA 4WE1A 2BMBA 3EDQB 4ZJQA 2DR5A 1HNWF 4DZ6A 3MHYA 3X1LB 3GG1A 3HT0A 1YZ6A 2BJ3A 4IO1A 5I3PA 1M5HA 5KFTA 5D78A 1UAWA 1P9YA 3C6UB 4P8WA 4DPXA 1HQUB 2P6SA 3KCEA 2E1RA 2SXLA 4MT1A 4V1Ak 4DV2J 3HP6A 1JCHB 2I5JB 2ZE2B 3E01A 5KOXA 2LXUA 2ZH7A 2BQ3A 1KRPA 5FLXU 4Q43A 1CC8A 1FWPA 3QRQA 1ZYQA 1B0TA 1S97A 1DAXA 5L1LA 2JLEA 2M88A 1M1HA 1HPZB 2DO0A 4QW8A 3CCMS 1U8WA 1FKTA 3KLEA 3VALA 2Y1JA 1JIHA 4PUOA 1S59A 3RBDA 3MM9B 4ERDA 2F4VF 1JLEA 1OMSA 4ZP8A 4BDPA 1UA0A 1HKAA 1WG5A 4B3OA 4QU7A 1LL7A 3RJMB 4G2PA 1KOHA 1Y10A 4IFVA 4X66F 4B9VA 4DCOB 1YJTA 1UFKA 1YBAA 2EW9A 2GJFA 3KLFB 2L48A 1ZM9A 2V8GA 5HSPA 4I67A 1KHWA 1TAQA 4LR9A 2B4OA 2C3UA 1DTTA 3DGPB 2L9NA 4IOCQ 1U7LA 4OHWA 3KK2A 4OJ1A 2BANB 2KXHA 3BZQA 4P2MA 2CAJA 2VFSA 2RQMA 5JH8A 3KK1B 4B9UA 3PYFA 1U2CA 5AXNA 5DZ6A 4AQYJ 2ZQTA 1KFDA 1MN7A 3MM5B 2IRYA 1FJ7A 2GS8A 1O5JA 4OYWA 3PEHA 5BR8J 5L38A 2UUBJ 1ZAVA 2BUNA 2LDYA 5BYRA 3ZNJ1 4QWAA 1S9FA 3O6QA 3A4TA 4Z7CA 4C3MA 4Z37A 1FDNA 4JB8B 3PV8A 2D3OR 1X5SA 2ZE2A 2BXJA 1HFEL 5KT2A 2O1PA 1ZL1A 2B4VA 3VF0B 3PIOQ 3HVRA 1DLOB 2XLJA 1P1LA 4F4XA 5B0FA 5A2QY 2CZ4A 3PO4A 3O5KA 1P6TA 2J9CA 2YKOA 5EHHA 2DHAA 3M8SA 3WQVA 4K4TA 2VQFJ 2C2OB 2H54B 4MNMA 2HHTA 2AJQA 1RA7A 2VG5A 2HS0A 1T9VA 3G71S 4MIWA 5J2QB 1WELA 4DF4A 1UVNA 2HIYA 2CYYA 4WFZA 1XMQJ 4ML4A 4I2PB 1J2VA 3KUGA 2XP8A 1N33J 1DQ9A 2LU2A 3ZZPA 1HBMB 1SKWA 2VFVA 4N77A 2ZEJA 4DEZA 2Z4PA 3P3DA 4NZ6A 2CWXA 3ARRA 4QIVA 4Z2XA 3TI0A 1RXOB 2VC0A 5FDLA 1TFVA 1X7VA 4RW9A 1G1XA 3KLGA 2XMTA 1LL6A 2HWTA 1C0TB 4LQ9A 1RTHB 4IYQA 2LFVA 2ZDPA 4LSNA 5K8OA 3SCKE 2QRRA 4P8UA 1EHWA 4N56A 1VQ9S 4ID8A 3I0RA 4ODOA 2GHVC 4TXSA 3UNGC 1HKKA 4MKVA 2HAFA 3ZTOA 2W8LA 2GAHC 3W5XA 3SI8A 1VQ7S 1YI2S 2YXLA 1WHVA 3ET6A 1NNDA 2UXBF 3GZ7A 3CGIA 2OGUA 2IA6A 1QVFR 4IRDA 2D69A 1ZBKA 4HDGA 2GQ2A 4JFMA 3MECA 2IA0A 1BQNB 1HXVA 5LMNF 1H3DA 1ZBWA 2DNZA 1U6ZA 2LKNA 1QUPA 3AD9C 3CD5A 3DHWC 2HHWA 4MSPA 2FYXA 1WHXA 2RMLA 5ITHA 5GMKa 2VV5A 5DGAA 3Q22A 2CFXA 4YB6A 2E66A 3GR0A 1I6JA 2HHUA 4WKYA 4L73A 1S7IA 1WDDA 2KI2A 1ZZFA 2I8EA 4JFKA 4R0EA 4WFAQ 5E0OA 3OTEA 4O0IA 1L3KA 3N0VA 5EX0A 1U79A 3BQ1A 1Q6UA 1U8SA 4QW9A 1IBMJ 3B7XA 2OPQA 1DTTB 3ZZRA 1I3OB 2MNTA 3HM9A 3TAMB 2VG6B 2YKMA 3JSMB 4ER8A 4DSEA 3C6TB 2YNHB 1N54B 4C7QA 2QLFB 4PG4A 4PXDA 4QR2A 4R25A 2DGVA 4Y2AA 3THPA 3FDSA 1FRMA 1TMMA 2VA2A 2XS2A 3OLAA 1VBZA 1JLFA 3MUVP 1S4FA 2LCWA 4F2RA 3H9RB 1NHUA 1R8PA 3ULHA 4WIIA 1S1WA 4YY3F 1PAUB 2MGZA 4O3SA 1Q4RA 3IKGA 5HWCA 2VA3A 2DHHA 2EULA 1UETA 1JWWA 2A3EA 2HHPA 4TKTA 3T1YF 4M94A 1GFWB 2EKYA 5KG7A 1SR0A 1ITXA 1ELOA 2FHMA 1S1WB 2D41A 2AKWB 3GCWP 2AX0A 2MGZB 2AQ4A 2LLZA 2QGFB 3ARSA 1KR4A 2YNGB 5KFBA 1N5TA 2XMAA 2IVYA 2OSQA 3BPSP 4IO9Q 1TKTB 3GV5B 3HVWA 2Z57B 5HANA 1H2TZ 3J7ZT 3MDFA 1R6YA 3BPDA 1O6IA 4DWSD 2IC3B 2EFGA 2RNEA 4HT5A 4QR0A 4F7VA 2ASLA 4K4VA 3CMES 1GTHA 4C3KA 4I4BA 4RUCA 4DRJA 5D4NA 1U0HB 2QTWA 7FDRA 2MQQA 4J9SA 2Q6BA 5ETPA 3NGSA 3PJWA 1PC4A 5JMNA 1N34J 2VN1A 1HD1A 2B9WA 2VJUA 4KKOA 4YQWA 1GXTA 1JK9B 1PJ5A 2VC1A 3M8WA 4D3GA 3LPEA 4RX6A 4YR3A 5JVHQ 5EDWA 2VHGA 2KHCA 1HKMA 2GJ2A 3PZPA 2CQDA 3VAHA 4JYAJ 3KHGA 2QFIA 2RF2A 1BC6A 4O2TA 4MTVA 4DZ2A 3UNYA 5A8RB 4LT6A 2ACMA 3L9ZA 1YJWS 4J91A 1HJWA 1YRXA 2FKEA 4HEA9 1FVQA 2OPQB 2RUDA 2VFUA 4NOHA 3TA1A 1U02A 5A2QU 2D3O1 1HNZJ 4C2MA 3VAMA 4MTPA 4FF4A 1EQ3A 3OXFA 2YBTA 1VQ4S 1XMOJ 4NEYA 1VCTA 2FPHX 2NPFA 4DV6J 3G87A 4ID5B 3CIMA 3HKZD 2P4VA 4HT7A 3WQWA 4F4WA 1LV5A 4HTIA 5IV4A 4ZLLA 2ROGA 2GQCA 3M2RB 4EI2A 2XZTB 4LAVA 2V5HG 1YVFA 2CZ9A 2HGNA 5L9XA 4WXOA 1VLYA 1K8AT 4B3SF 1OQ3A 4WU3A 2WLYA 1LNQA 5BXIA 5BYQA 3IN5A 2HQIA 2V2VA 2BE2A 4ZITA 1RCXB 2ZKUA 3DI6B 4CLTA 1H72C 2RD5C 4C6AA 2RE1A 4CO2A 3BH6B 1WD6A 2G1DA 4ZJLA 3UQSA 1F3VA 2BKOA 1FHTA 1LXNA 4Z2JA 1TL3A 3LP1A 3O5MA 4MAVA 2D3ZA 4QJVA 4D3HA 5E7OB 4C8OA 1TUGB 2GO8A 4PWDA 2V2ZA 2OELA 3G6MA 1HW9A 2HNDB 1S1VB 1SKUB 1TR0A 3I4HX 2UZ5A 4NRUA 5BXJA 3RB4A 1HIYA 2CQ1A 3ARQA 5H9EK 3NWGA 1LEOA 2IYGA 3UF8A 1C1CA 3IBFB 2RDJA 2WW4A 4NI2B 3WIUA 2ZNYA 3DLEB 1JNSA 3QT5A 4AXJA 4WP8A 3J80Y 4QWEA 2VONA 3N28A 3PDNA 4JI4J 2JH3A 2UUCF 3DOMB 1KDNA 1RJJA 3FGVA 3MOJB 4ODQA 1IXKA 2B4UA 2CUYA 2F9JA 1TK8A 2YWWA 4DCJB 2A3JA 1VMBA 1T7PA 2F2DA 2WHOA 3CJRA 3R27A 4WCEQ 1ZH5A 3SV3A 4FAPA 3GYNA 1RT1A 2HBZB 3DRPA 1KQFB 1NKBA 3FMBA 1W1YA 5HW7A 4LRCA 4NEZA 2DR9A 1TKTA 2MSSA 4ES1A 4JI7F 2UU9J 1HWKA 1IBKJ 1S77D 2AOSA 4Y28C 2W2OP 4CM0A 4DV7F 3VV2B 2DXFA 5AJ3J 1ZTWA 4AL5A 1ZM3A 3C19A 4PWUA 1H7XA 1MN9A 5D0RA 3CGNA 3H40A 3KAGA 1UPMB 3M8YA 2VFTA 3P49B 2OTLS 1MROB 4RWWA 3R9LA 5H1SV 3W1YC 3WZ0A 2DNOA 3JTOA 4QQBA 4DUZF 1ZTTA 2LXIA 2F9DA 3D4JA 4BLGA 1X5OA 2IUZA 4ZVTB 2R8KA 4KHPJ 3OJSA 1Y11A 2AT1B 3L3CA 1D8ZA 3GIKA 1WC6A 2ASDA 2FJVA 1FD9A 4N8OA 4LBPA 3HHDA 5I4MA 4S3KA 1RAHB 4NZCA 3AJDA 1HNIA 3H90A 1LW0B 2L2SA 2MKJA 3TAMA 2LP4A 3JSMA 2NREA 2YQ0A 1XR5A 4C4WA 4OYIA 4LRAA 4B17A 1FO1A 1QUVA 3I31A 1O51A 3OR2A 4DL0C 4DBQA 1S72S 1GXUA 2PDAA 3IR7B 3MD3A 3GR1A 4LSLA 2O67A 3M9NB 1Q53A 3ILIA 2FHJD 2ZH3A 3QMQA 1FJCA 4CQ1A 2V4QA 4C48A 4PQUA 3GU0A 5HI7A 1ROTA 3LOUA 4ZPWR 1FKRA 1U1RA 4E2FB 3PIPQ 1X9SA 4R0XA 5CYMA 2N7CA 3AXKA 5ETQA 1G2EA 1JNDA 2FVCA 1WF1A 4BWJA 3PA7A 3SFUA 1L3SA 3W60A 3PFOA 1W26A 3UO0A 5KFLA 2R2UA 4Y2KA 2BKNA 3GSIA 3AA8A 4PXBA 1HWUA 3T6BA 4ALZA 1JKHB 4ODLA 4CLZA 3W5ZA 4XPCA 3VGTA 1RT7A 4XDCA 5M2PA 4DL3A 4FF3A 3Q8VA 4OHXA 3I56S 5J1NA 2ZBQA 2WK2A 3G86A 2KM8B 2GC8A 4DR1F 3CWJA 1RTHA 3OFHA 3MMCA 2FD2A 1CJTA 2ZQUA 4ODPA 2WK4A 3V6HA 3ARZA 3R5DA 2V9WA 2DG3A 3GFYA 2FY8A 4B9SA 2RAQA 4CIOA 3PVXA 3T5JA 3NGUA 4KHMA 2PFFB 1HI0P 1CPZA 1I51B 5D0GA 1L5UA 2IVFB 2W2NP 3TP2A 5D8HB 1DY3A 2HHSA 2RURA 4P7VA 1NMVA 2QYGA 1KHVA 1TQLA 1ZPVA 2HQFA 1QDUB 3EDRB 3FEZA 3LTOA 5IQ6A 3QZ8A 5HMYA 5KFJA 2O3DA 1X9MA 1SKRA 4F02A 3RM8A 5DG8A 1YJNS 2VG5B 2ADBA 2BE9B 3IP0A 3ISZA 1Q6HA 3HHLC 2XCPA 3C46A 3LP0A 1M1GA 3UI4A 1IKWA 4ZP7A 4LFBF 1YBTA 4KRWA 3M8PA 7AT1B
chains in the Genus database with same CATH topology
1EP4B 2MPUA 2P9CA 4I56A 2FHJA 5LSLA 4DL4A 3ZZ0A 2XY7A 2R8GA 3RGCA 1ZM2A 4DRNA 3OVSA 1XMBA 3QJLA 1YW5A 2IM2A 3MR3A 2R7TA 4KFBA 1JLCA 1SB6A 3BN4A 4W92B 4LF9F 4DWSB 1FKFA 3NL0A 1IQTA 2NUUG 1KLNA 2QMWA 3J81Y 3KK2B 2KXNB 2BQRA 3IKDA 2DD8S 2PEHA 4A8KA 4NRTA 2CPJA 4K59A 4IFVB 1KVIA 2LDIA 1KNZA 4A8QA 3GFHA 1JB0C 2LEBA 3MUTP 1TVRA 4E98A 1VRUA 3KLIB 1N6QA 2PPOA 1UFLA 5B0CA 4Z2GA 1IKYA 3O2IA 5DETA 2XMWA 1A6LA 3UFCX 2A3BA 2OH2A 3MURP 3RR7A 2OP5A 2IBOA 3MTKA 3OA5A 3F73A 1NK5A 3THTA 1KTQA 4F2SA 2CQ0A 2B6AA 2ZOGA 1CVJA 4DR6F 3EPGA 3CCTA 5KFWA 4ECWA 1TKXA 3DLKB 4CTAB 1NH7A 2OLWA 1Y0HA 2HNDA 4I1TA 1HHTP 4MK9A 3T9NA 1KC8T 1U47A 1SJ4P 3UD3P 2HVIA 3LUOA 2R2RA 1FKGA 2N82B 1TK5A 2MKKA 3PRAA 2GHWA 1UVLA 1X0PA 3B4MA 1FTRA 2DNGA 2JFDA 1TL1A 4X4SA 4TU8A 2B9YA 4B02A 1W1VA 4BBYA 3UR0A 1W9UA 1FERA 3Q8PB 5I3QA 2ZR6A 5J2MA 4I2QA 2Y1RI 2OD4A 3U7JA 5HQ8A 4LIRA 3PY8A 3CCES 5AE1A 3H5YA 4NA1A 4QZVB 4ED6A 2QA2A 4FF1A 1E6NA 2DGUA 2XI2A 2DPJA 3NG8A 3QAEA 2QSWA 2MHEA 4G1IA 4QOTA 1IBLF 2CVEA 4X4UA 4I64A 1WACA 1N88A 3FSYA 2ZZNA 4FXVA 4GGQA 3QIDA 4FS1A 3KAIA 2F4EA 4DDFA 3RR8A 6FDRA 3KJVB 1Y5NB 3PHEA 4QR1A 2WM0A 4G1QA 4KC5A 1M5YA 1S6OA 4P8XA 2KN4A 2OKQA 2ILZA 3IG1B 4IO1A 3TW0A 1FKHA 5AJ3F 4IG0A 2ZHAA 3LWMA 3BSCA 3FSXA 2YNFB 1AROP 1IM4A 4O4RA 4IPXA 1URNA 2AW0A 2KFYA 3BSOA 2UUWA 1PC5A 3HHLB 3KLVA 1QSYA 5IZHA 1J4IA 4IT4A 1X4BA 2GGPA 5KG0A 3BSNA 2J6TA 1RT7B 1KQKA 3ENWA 1LJYA 1GPFA 3UI3A 1IUJA 2BJEA 2PA8D 4C8NA 3IC1A 4L6V3 4Q7AA 1UP1A 1Q1KA 2CQ4A 2ITKA 2XG8A 4BS2A 1FKKA 3M32A 3NCQA 1RT1B 3DRPB 5IT0A 3D28A 2DNRA 3SV4A 3UQBA 3ARYA 2XO7A 1NRKA 1D1UA 4FNIA 5K8NA 4P2SA 3CJ4A 3PEJA 4YB5A 3S7RA 3DRSB 1VF8A 1VRUB 3KLIA 3S01A 2DH9A 4BC9A 3RMEA 3MPWA 5KG5A 2XGPA 1LFWA 1D7HA 3M9MB 2OPPA 4ELVA 1SH3A 4R8UA 5KFQA 3L7OA 4GC7A 5HROA 1S6PA 3AJ2A 1FKDA 3M6WA 2CPFA 4QT3A 2M52A 1D9AA 3DYAA 2QA4G 2EFVA 3U1LA 1L3TA 1RQ0A 1KEKA 4O4GB 2MXYA 2VBZA 4JUZA 1XWLA 2BA9A 4R8UB 2NSBA 4BCAA 3HVTB 3D5MA 1E6VB 3UD4P 4QIBA 3PXGa 2YWKA 5KFZA 1RTIA 1FDBA 3UDCA 3GIIA 5IXUA 4G1PA 3R5CA 5AXLA 4YFUA 1XBWA 4K4VA 2E1MC 2FLPA 2FB0A 4K4SA 3DLEA 2KZMA 4YMEA 2IFXA 1F0XA 2Q66A 4DV3F 3G6XA 3FAPA 4DS5A 2HPUA 3M05A 1TV6A 2XZWA 5CH7B 2J0WA 3ZZZA 2W7OA 1HKJA 1HA1A 1N8RT 4M95A 1KQGB 1FXDA 2V8HA 1R31A 4DN0A 1HJXA 2DSZA 5FJ4A 1I1GA 2FLOA 4ZOSA 4ZPBA 1JXEA 5KG3A 1KFSA 2A2DA 1HJVA 1FVSA 3SSQA 4LSNB 3OXLA 4NZ0A 3KABA 3JAMY 4IRCA 1REVB 2XLIA 1Q8IA 3QGPA 4DG1B 4ZCLA 4KBIA 3FQLA 2ZUGA 3DI6A 1XR6A 2QLWA 4C97A 5DG9A 1FEHA 3LH2S 1TAUA 1VHFA 3H5SA 5SUHA 3V6KA 5K8MA 1RISA 3AQOA 4W9OA 3WH0A 2RUCA 4IH5A 3TVKA 5H9EJ 1BQNA 1T3NA 2A3AA 4F8RA 3M8QB 3GILA 2B3TB 2IAJA 4J9QA 3KMSA 2ZBIA 3MF5A 1IJEB 1OS5A 5GPGA 2KO7A 3LGMA 2AJ1A 1T03A 1NK4A 2V4RA 1AFIA 4BHQA 2JJ4D 2M8HA 3PNIA 2FHOB 2KE0A 2MZ1A 2M4MA 2XMUA 2UVUA 5HW8A 3SQGA 2ZBCA 2GFFA 5JJBA 4TU7A 2UXCF 1VC0A 1AUDA 3CH9A 2NXUA 3UCUP 2ROEA 5IT4A 2RQKA 4FZVA 3UW1A 4DQRA 1N5VA 1TKZB 3KG1A 4U6PA 2OIHA 2VOOA 1JNRB 1Z1ZA 3ODKA 1WEZA 3OTOF 2MZTA 1NWRA 1BQXA 3DLLQ 3NMRA 3O5QA 1FNXH 1LXJA 4JI4F 2A1BA 1J6YA 2LGOA 1VK3A 2ZH9A 1S1TA 3IWXA 2IBKA 4QU6A 4URGA 3WD3A 3AHPA 3PW7A 3E3XA 1K73T 1H7WA 1BD6A 4DQPA 4DL6A 2HHXA 3GV7B 3H2LA 2HNZA 1K9TA 2D9PA 2HHQA 3PRDA 2AGOA 1B6CA 1LWEA 4KHPF 3HZEA 3BJYA 5C25B 1RKJA 2KZZA 2OLHA 5CCLA 2HQ3A 2RDIA 1FFRA 4KE5A 2ZH4A 3OHAA 1C2PA 2C22A 1N6QB 2XNRA 4ECXA 1LW2B 1HQEA 4TW6A 1MU2A 1VIOA 4JV2A 4R0JA 4L72B 2YY3A 4F3MA 2YNGA 3H2UB 2FVRA 3M1VA 4H4KA 2NLWA 2DGQA 1UFWA 1Y5IB 2OO4A 2VG7B 5D4OA 5F0WA 2ZC3A 6FD1A 1XERA 3E8OA 2CKWA 3N9UC 4IQXA 5F8JA 4NNRA 1JLAB 1T05B 1ZU8A 3MAHA 1GX5A 2XMJA 5EWEA 4WU2A 1KTVA 1GOIA 1HPZA 5HP1B 3OUYB 2FJXA 1E6PA 2CQIA 4IR9A 3K5LA 4X65F 4RW6B 1QJHA 5B0AA 2GIRA 4QWDA 1ZBCA 3MR5A 3CCLS 1I94F 1EP4A 4U84A 3QLHA 2JEGA 2OMLA 4OLOA 5EGYA 1S10A 3FJ2A 2XWXA 1ZK6A 1N4LA 5KG6A 1T03B 3O1LA 3SDEA 2RU3A 1WI6A 4BF8A 1D3WA 4OHYA 3DU5A 3TCZA 4A48A 3CDAA 1UR8A 4FXDA 1C0UA 2D1CA 3DOMA 3NCPA 3TARA 1KONA 3GIMA 3G6YA 1YTYA 2R7VA 4X4PA 1VRTA 4Q8FA 4HH1A 1FRKA 3P6YC 2C2EA 4QCLA 1NWTA 1TFYA 3AS0A 2XB2D 3MM8A 3CD6S 2W7AA 2PPNA 1O0PA 4P6QA 3MFHA 5EWFA 2KM8C 5CYQA 1N33F 5SZTA 4A8XA 5J6EA 4QPTA 1UW4A 3M2UB 1JLQB 2K8GA 1UL3A 4CNYA 1TZ0A 4X4RA 4NLYA 2HFOA 5KFMA 3PR4A 2HWHA 3CB4A 4FBTA 3M1VB 2BABA 3QLHB 4MAKA 2HVZA 2MSTA 3DOLA 4Y2IA 4Y2MA 3RAQA 4DRKA 1K0VA 5L9NA 4ES2A 3OTBA 3BDPA 3DMJA 2W8KA 2FVQA 3KG4A 1DLOA 2LEPA 2B51A 2RQ4A 4DRPA 3IR6B 1ZM4A 3MEEB 3BO4A 2MZQA 2DJWA 4KV8B 1Q8LA 3C66A 2E7XA 5KFOA 4G6VB 1SJ1A 4E8UA 3NNHA 2BM1A 1JMTA 1HNVB 3IFEA 4UQTA 5HW6A 3K7RA 4EWTA 4KJIA 3C6UA 3TANA 2B0GA 2ZD1B 2J6SA 4Y3CA 4K4XA 4ZPTR 4C02B 2VFRA 4O23A 2JDJA 2CPIA 4NLWA 3DN9A 1S48A 3H59A 4HBOA 5M2RA 4IFYA 4RUAA 1IX5A 1OWXA 3QIPA 3MM9A 3O5FA 1RYRA 2MJUA 3CCVS 3ALGA 1EETB 2YNFA 1SBRA 1TKDA 1XK8A 4KHRA 5F8MA 2B7BB 4CCHA 4OLPA 3CE8A 4JI5F 5LJ3Y 4TLQA 2DSWA 1KS2A 2YNHA 3M2VB 1D7IA 1IKWB 1HQUA 4TNOA 5L9XA 3B82A 5KFAA 2L08A 3TOQA 1TL4A 3PACA 1JXLA 4RNHA 3I32A 4DQSA 1ZZNA 2Q5AA 1EHNA 3MR6A 3TYTA 4PUOB 1JX4A 1H6KX 4C8LA 4ZCKA 1FKOB 4MYTA 5KG4A 1Y00A 4ED0A 1HWJA 3M8QA 1Q16B 2DNLA 2OPSA 2MQMA 4H54A 2M8DB 2QSFA 3TVZA 3H8YA 2E5HA 3MMBA 2RRBA 2ZKTA 3IS9A 3RRGA 1XMQF 3PKMA 3CF5Q 1P9QC 3NGKA 2MB0B 3OQ2A 1DRZA 2YH1A 2C28A 4I0WA 3IRXA 3MMCB 5T7LB 3G9CA 2Z2LA 4DV4F 1WTFA 4RBVA 2ESCA 4H4MB 3VCDA 1KLMB 3CHDA 2M0GB 3ARXA 3M6UA 5F3TA 3RB0A 2ACYA 4GIVA 3QPIA 5C24A 4YR2A 4TQRA 1N36F 3MR2A 1GTEA 2VCDA 2HLUA 2VBXA 3QWPA 1EDQA 4GKKF 4DSKA 3BM7A 1VFJA 2K1RA 1M5PC 4ED7A 4MFBB 3MXHP 1IN0A 2YKQA 1BKFA 3I6PA 2UVRA 1FFQA