4ZPWR

Structure of unbound mers-cov spike receptor-binding domain (england1 strain).
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
208
Chain Sequence
b'VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spike glycoprotein
publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein
total genus 57
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zpwR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zpwR01
3SCJE 3SCKE 4QZVB 2GHWA 3SCLE 4XAKA 3SCIE 4L3NA 2GHVC 4ZPVR 5DO2A 4ZPTR 4ZS6A 4L72B 4KR0B 2AJFE 3D0IE 4ZPWR 3D0HE 3D0GE 2DD8S 4KQZA 3BGFA
chains in the Genus database with same CATH superfamily
3I9V9 5CCMA 5HVGA 5HANA 3DRYA 2LKZA 2OJ3A 5F3TA 3LGHA 3UQBA 4C11B 1FVSA 4RBUA 3WQPA 5GAHI 1QAJA 4H4KC 5CYJA 5ETKA 5HLFB 3CJ0A 1D6OA 2M70A 3TZWA 5JVHQ 1U7LA 1GXUA 1N5TA 1OY6A 3TDBA 1IVZA 4I6WA 3SBMA 1FKHA 5KFXA 2GVZA 5D3GA 3OFGA 1M1HA 3BEGB 2V63A 2BKOA 1XNRJ 1F9FA 3IHZA 5FJ4A 3TC5A 4YHHF 2DY9A 4ID5A 2UZAA 1YSJA 2LPVA 4NYPA 1B70B 4OV6A 1XN9A 2I5JA 4CZCA 1E6NA 4B9LA 1M5KC 2HNDB 2A3EA 5ETPA 1LWEA 1WI6A 1TFVA 3F0NA 1FFWB 1J4IA 5C42A 3LUOA 4M5MA 1QDUB 3KAFA 1VQSA 2P6SA 2DKOB 4J9NA 2DSZA 4QU7A 2B9XA 4URGA 3OL8A 3DLGA 1HI0P 3KFWX 1IKYB 1V5IB 4ILLA 4C3LA 3GIMA 2DGQA 4OI6A 3PW0A 3KK1A 5LT5A 4WFYA 4WWSA 4UOCA 3QFWA 3QRPA 2ERRA 1X9WA 1JX4A 3EIPA 3TEHB 4ZVOB 1UCNA 2RHSB 4Q45A 1X4AA 3T1YJ 2WONA 2XYPB 1VRTA 5EDWA 4DSKA 2YX4A 3N5BA 3BH7B 3QLHB 5LSOA 2R7RA 2F4VF 2DO4A 4ZIWA 3ET6A 3I0RB 2VOOA 1Q1KA 3R1LA 4FNHA 1UVLA 5DM7Q 1JLCA 1VR6A 3KHGA 2Z56B 5ETRA 1VQ8S 2QA4G 1VC5A 4NRTA 2Y1LB 2PPNA 2XS2A 3QGHA 1PJ6A 2RQKA 2DT1A 1X9SA 4DV1F 3V81A 3A1YG 1KFWA 1RUSA 4DV0J 1KR4A 2FDNA 1SQGA 3GG0A 4DFMA 2KT3A 3RM4A 4TW7A 4HHHA 4B3MF 5KFVA 4MFBA 3RTVA 3VCDA 2JL9A 3FRYA 2VJUA 4F4ZA 2CJYB 1AFJA 3QWUA 5KFUA 1Q8IA 2K06A 4GGQA 4C97A 3MAAA 4IRCA 2ZBPA 2R7XA 4QBUA 2ZWOA 3TRGA 2QE5A 3UDEA 4ZN3A 1YI2S 1N4LA 4KSEB 4UZBA 3KLFA 4RUBA 1HNIB 1Y00A 3FQKA 3OTEA 2EC0A 3I5BA 3TUZC 3LO3A 2FJEB 1QLNA 4ODLA 4PWDA 1RABB 1S1XB 4DR4J 1JLEB 2NCKL 2HQGA 4JYSA 2EKNA 3MR2A 3N5FA 3K5PA 5CHCB 1IBMF 1L3UA 1S4FA 2FHMA 5IWAJ 4F3OA 4H54A 1NCLA 2MZSA 3SZ2A 2PA8D 3QT8A 3C6TA 4YS2A 4QYZJ 2F5GA 4DU7A 1RAHB 2XGPA 2CQCA 3VGTA 2E9TA 4H4OA 4EGLA 4X4RA 3BGRB 3J7YU 3D1OA 5GPGA 2RE1A 1RT6B 2YH0A 2AHOB 2OLWA 1CQMA 1EB0A 5ADZA 2L2SA 2DTJA 4I4BA 3L9ZA 2PE8A 3M9OB 2XQCA 3PZPA 2R8JA 1K73T 5HMWA 2VFTA 1QE1B 4IFVA 4ZVUB 2XG8A 4Y00A 3UPFA 1X5TA 1KBRA 5EWGA 2D7SA 2NS1B 1T7PA 4B3RF 4LF6J 3C66A 4O0IA 4F4AA 2HZVA 4EBEA 3F56A 1HI8A 1KC8T 4C8OA 1XMQF 3JSBA 2ZBCA 1N1AA 2NR0A 4ECXA 4NEYA 5A8WA 4UF4A 4G2PA 3NGDA 4IH5A 3CMES 1XR6A 3G6VA 2OPRB 2C2EA 3RRKA 3W9IA 2OTJS 4CCHA 1IUJA 4X84A 3J7ZT 2BUNA 2FJWA 3QIPB 2JNJA 3EDRB 2E29A 2PN0A 4IG0A 2A3CA 4DUZJ 4I6AA 1VRUB 2KH9A 2G1HA 3KG0A 1L3SA 5HBFA 1Z2ZA 3HK2A 3VAWA 2DNGA 1KT0A 2A10A 5DDOC 1O51A 4L74A 1KOHA 3O5KA 1PO6A 4NZ7A 5BR8F 1RK8A 3I6CA 4K4VA 2B5UB 2FLOA 3PDNA 3ZZUA 2QG9B 4KO0B 5C5JA 3L09A 4JI5F 4ZPDA 2IIHA 3MCSA 5SZTA 1RTJA 5L46A 5DG9A 5LOQA 3CGMA 4ID8A 2OEKA 3DDNA 2ALZA 1TK0A 2HIYA 3KUEA 3HF5A 1GAOA 3US5A 1EP4B 2WK2A 4QT2A 2QTWA 3GV5B 3OXFA 3DCAA 1TL5A 3R5BA 2V69A 1UVIA 3UDCA 1WG4A 3PYGA 3K8WA 1S1UB 4BC7A 2IM3A 1FRJA 3G6LA 2PDAA 1RWKB 3KLHB 1JCHB 4JYAJ 5DEZA 3H5YA 4CYUB 1UVNA 4FP9A 2HVIA 1X4CA 3OLBA 1FKPB 3MF5A 1U1KA 2FGCA 3W3SA 2BZ2A 2F4FA 3EM1A 1Y5IB 1UWBB 3OA5A 5EGYA 2ASYA 2QA2A 1R6YA 3TI0A 2VZ9A 1XERA 3DLKA 4DH0A 3F73A 4G1IA 1Q16B 3NGSA 4KV8B 1C4CA 1S48A 5KFNA 2JVOA 3GSDA 3KJVA 2OGUA 2HNYB 4WE1A 2UXDF 5KFWA 2R7VA 2Y1RI 2YBVA 2IMOA 4GVBB 3PR9A 4ML4A 2KXFA 1TL3A 3AOAA 2CUYA 5B8IC 4ODNA 2C2MB 1SC6A 3BN4A 5K20B 1RBLA 1MWQA 2HBQB 5L9NA 2HHWA 1NJXA 1SPBP 4DUYJ 3ARYA 2HFNA 3B82A 5FLXU 3QMQA 1FX2A 1SI9A 3S7RA 3SV3A 3ONQA 5HAOA 3A3OB 2AJ4A 2QV6A 1C0TA 5K5MA 2KL8A 3MECA 2DR9A 1FDAA 5I42B 5D15A 2ZKUA 4F2SA 5HL7Q 4DV7J 4AL7A 4NCGA 3A8IA 1PJ7A 1X4HA 4E2FB 2MKHA 5K14A 1K9TA 3IWLA 2ZUGA 1RE1B 1NB2A 1GRJA 2CQDA 3HVTB 3C16B 2EFNA 5JVGQ 3JTPA 4AQYJ 3UI6A 1TVRA 3C14A 1UFKA 2DG4A 2A1BA 4X62J 2MKJA 5L1LA 3TA2A 4O2TA 3MCMA 1CS4A 4A8OA 1TUGB 1B6CA 4IKAA 1FK9B 3QQCD 1IBCB 3NG8A 1M5SA 4DR2F 2JJ4D 4OYAA 4OZ1A 4QU6A 5AE3A 2F63A 3H40A 3ZXWA 3TA0A 3D7SB 1NWSA 2RUSA 1LJYA 2Z8QA 3R2DJ 2I2YA 5LL6d 4QR1A 1HNVA 4CIOA 4F4XA 4DRPA 3HHEA 2LEBA 5CZVA 4CLYA 3LPEA 2W8KA 4LRAA 1W9VA 2BKPA 4HBOA 4KPCA 4LMZA 3UQAA 1HBNB 4WIIA 2DHGA 3M1VA 4B08A 1S0NA 1E6ZA 3NXZA 3F41A 3GCWP 2LGOA 3ARUA 2VFSA 4WYLA 1F8AB 3I87A 4UZCA 3ZZPA 4F0HA 5L8RC 3B7XA 4X64J 2W4CA 3EPIA 2FLLA 4UQGA 2QX0A 3Q24A 4K2XA 3MURP 4U9RA 4RL1A 3BSCA 3GR0A 3VVTA 1K1QA 4C6AA 1SJQA 5CD4A 1S49A 4MIAA 3WX4A 2KI2A 2MKIA 1U49A 1PCAA 4C8KA 2AQ4A 2W1BA 4LSNB 3B78A 2J9CA 2RU3A 3QIDA 1ZZNA 1RLCL 2XMJA 1OPIA 3SXLA 2HHHF 4Q43A 1RT4A 2Q6CA 4LR7A 3KNAA 3RAXA 3P5TL 2C22A 2YKMA 2OD4A 1NM2A 3NEKA 1S6QA 3PW7A 2M8DB 5M2UA 4L72B 2MLZA 4ZKAA 4C8NA 4OJGA 3JTNA 1YJRA 1V6HA 3A12A 2LDYA 4K4UA 4ZMMA 4O4RA 4F2RA 4WK1A 3TX8A 3O6QA 1YJTA 4USIA 4JI0J 1CJVA 3PIOQ 1LOUA 4PG7A 2NXJA 5J2PA 2C2NA 3LTOA 5I3PA 2ZE2A 2AV5A 2RD5C 2WZ1A 1U6BA 3MM5B 3M6UA 4A8KA 2K7JA 4P8VA 3RW6A 4N8NA 2MJNA 2DIUA 2ZQVA 1KOOA 2I38A 3CIMA 2CA9A 3VTIA 4DSIA 2XP5A 4WK3A 2F1FA 1RWNB 4KFBB 5HWCA 1XJWB 3OSPA 1R0CB 2OAUA 4ODRA 4P2SA 4AUKA 1RADB 5AE2A 2F2DA 5A6PA 2L9DA 3CCSS 1HHSA 1SQEA 3CCES 2B9EA 3BMBA 1Q7YT 2E5IA 2BANB 5E3RA 1XR7A 4M5JA 2XZDB 1YZ7A 4OX9F 1RT2B 4NLUA 1X4DA 2DGVA 1WTFA 3ZZOA 1Q6UA 1NWTA 1N54B 4UY8T 1WF0A 3NP5A 1BMQB 5D0GA 1UA0A 1TR0A 1ACMB 4CLWA 3QGGA 1DTTB 3M8ZA 1JIHA 1FHTA 2E7WA 4K0KJ 2NPIA 2WW4A 1FNOA 2V5HG 4LFAF 3EDQB 2VBYA 4HEA9 3Q2TC 1SC3B 4DROA 3QPIA 4O4GB 1ZETA 2ATCB 1TAQA 3PG9A 3MXHP 1PGZA 1SL2A 4NRUA 4DG1A 4WKFA 1HNXJ 1DHMA 1XC9A 3ARQA 3DMJB 2GZOA 4QYZK 1X4EA 1Z2LA 4HDHA 1WC0A 1UFWA 3TAPA 4RW8A 1RTIB 1LFPA 3PV8A 1SVDA 3HHLB 2CFXA 2QRRA 4OHVA 2HS3A 3HVAA 4DX7A 4JB8B 2QLXA 2VBXA 4DJBA 3T5JA 3RBXA 3OR2B 4OZNA 4WK9A 1AA1B 2W2NP 1ZK6A 2GMJA 1Q1CA 2M08A 2K1RA 3RBDA 1KRPA 1FE4A 3FEXB 2Z2ZA 4DV5F 3DFEA 2R7WA 4KRWA 2ZH8A 4MGVA 4LF9F 1YJ7A 3X1LB 1T05B 4ZJOA 2QGFB 1FXLA 1RU1A 5KG6A 3O5FA 4GKJF 1FKTA 3BGUA 1VQ4S 5HJXA 4ECSA 3UN3A 1N56A 3Q8RB 4N56A 2ZH3A 5IXUA 2M52A 2AF6A 5B0EA 5GAHU 3MR6A 2HSEB 4CLZA 3MMJA 1HNZF 2X1AA 3BF4A 5A2QY 1IR1A 5DM6Q 2GQCA 2YNFB 2IBKA 2BV3A 5DIUA 1KQGB 3MI7X 3AD8C 4L3KA 1GFWB 2DNYA 1L5UA 1NK7A 3MMBA 2L9NA 2WM0A 5CD4H 1KONA 4OYIA 1RGVA 5L1JA 2ZQTA 2VA2A 4RLEA 1WC1A 3HKWA 2BABA 5JJBA 1REVA 3LP2B 4YY3F 3KNGA 2XM3A 4UOFA 5EN1A 3G4SS 1VYAA 1DY3A 4DL0C 3ARSA 4MK9A 1VHFA 1BQNB 4O3RA 3PFEA 2W8LA 1CC7A 3NCPA 5RUBA 1NJZA 2YKQA 4E8UA 1FKLA 5B0GA 3OTCA 2VUGA 3LQVA 3KHLA 2ZH4A 3VAMA 3IP0A 3QNWB 4OYWA 3CGNA 3MM9A 3MR5A 4YHHJ 4QW8A 2CQBA 1J4HA 2XYGB 3N9UC 4LUBA 3VGSA 4OI0A 2LQ9A 1REGX 3CCMS 2N87A 3HZGA 1IBKF 2V50A 4MIBA 4IPXA 1N5YA 2ZDOA 2B4PA 1JXVA 4ECTA 4FN2A 4DL6A 4UOHA 1Y9OA 2BW7A 4DWSC 3FBCA 1X31C 2XY6A 3HI9A 2E9ZA 5GMKa 3R6LB 1PINA 3CMAS 2AGOA 3BREA 3GFZA 2V8PA 3M8RA 2R42A 2ASJA 2Z57B 1TCOC 4J5OA 2GGPA 3NBPA 3R7SB 4JUZA 4DU8A 3O5OA 3NS6A 2B3TB 2G0JA 4HTJA 4M5GA 3GILA 1WELA 2UU9F 1QPLA 4JFLA 2XP4A 1FJ7A 2ZQUA 5CABA 3O2IA 3J80Y 3QT7A 2R7OA 3DRRA 3CO9A 4TN2A 3VHQA 3TAMB 4OV1A 4RW4A 2PGCA 2ZJQQ 2W9AA 2CPJA 1XNQJ 1RLDA 3RJMB 1YLXA 2HWHA 2WW8A 1JLQA 3UNGC 2D3OR 2H4YB 2N4CA 3E01B 4RX6A 2FHOB 5KFZA 1E6YB 1RACB 4PYDA 3MCNA 3LWMA 2Z2LA 4EK2A 4JFKA 2BJ7A 4RR5A 3H8YA 2GVDB 5LXYA 2RRBA 3CD6S 1H2VZ 3BSAA 2M2BA 3SQOP 2MB0B 3N6LA 4LVNP 4B3TF 4DV1J 4U6PA 4I56A 1CC8A 3OTDA 2ZEJA 1NWRA 3GE9A 1U45A 3K89A 4AD6A 1SKUB 3M6XA 2EULA 1PAUB 4LAYA 4HH1A 5HVHA 2ACMA 1ZPWX 1H3DA 2ZH1A 3ARPA 4Q44A 1NK4A 4WJXA 4ECQA 3GIRA 4OZ0A 1OGBA 4NYOA 4NLPA 1TL7B 4DRNA 4RW7A 3CDBA 2LLZA 2KB2A 2P8IA 3QZ8A 2NREA 1AROP 3KDOA 4ZLNA 3CHCA 2F23A 3KACA 3WBZA 4WPAA 3UVJA 4N77A 2W2QP 2Z30B 1T03B 5HBMB 3HULA 2BE7D 2YKPA 1ZZFA 2VCDA 2L41A 1WACA 2OPQA 3JQJA 5IQ6A 1XBWA 4LF4F 2FY1A 1NH8A 2HK2A 2DNMA 2WLZA 3SIPB 2VDIA 4QWAA 1DQAA 1JK9B 2FJBB 4DPUA 3ULHA 3T3FA 4WFBQ 3G8TA 1C0UA 4RW6A 2C3UA 2EBEA 3T6JA 3U1LA 4Y0FA 3O1LA 4Y28C 1RHUB 4JFMA 1IJEB 4Z2IA 4EWTA 1FD8A 4YOEA 4GC6A 5DDRC 3HD2A 1WC3A 1CJTA 4RNFA 2XPBA 2A18A 2MGZA 3T19A 2U1AA 4QW9A 4IDKB 1A7XA 1S6UA 1FAPA 1FTCA 1RT5B 2EFOA 4DSFA 5KOWA 2WOMB 5C7PA 2HHUA 3B9AA 1U1OA 1TKTB 2L48A 4PEOA 2K8GA 4AL5A 4QWCA 1R43A 1NSKL 2IA0A 4P9SA 2ZJPQ 4OHXA 1N0VC 4FKYA 4ZPTR 5KFTA 3QT6A 4IO9Q 4NA2A 1XMQJ 4RNNA 1GMUA 3PIPQ 3KLGB 3KMQA 2VC0A 3O5JA 3M2UB 2ADBA 3TUPA 2ZR6A 4JFJA 3GIJA 1N48A 2VG7A 3EY6A 3P49B 5J1EA 1A7GE 1VBKA 2W4DA 2OFGX 1FF2A 4XTTA 6AT1B 4PYAA 2MQNA 2XP6A 5J1NA 1TKZB 3MEGA 2VKZG 2BDPA 4C8LA 4WYWA 2IRUA 4ATNA 3CCUS 3O8WA 2ATLA 1LWEB 3BDPA 1NDLA 4RUHA 2XZTB 5T7LA 1S4EA 5D77A 3QSYB 4K4ZA 3SSRA 1KWMA 2ROEA 3PRDA 1HWJA 1P1TA 4USUA 2J8SA 3BBBA 3KLIB 5E3PA 2KFYA 1K0TA 5DQHA 3DLGB 2RUQA 2DIVA 3I32A 2W9CA 4K2JA 2ZQSA 1X0FA 1RKIA 4JI5J 1LXNA 3VQTA 1NBEB 2OEMA 3WQWA 3AQUA 2FJXA 3P96A 1SL0A 4G1QB 1ULRA 3KDNA 4YFUA 4LAVA 2GQQA 4O3PA 1M5HA 2CPXA 4V19X 4J37A 2IDEA 2HAIA 1XR5A 2RU9A 2H54B 2CQ3A 1HA1A 3W62A 2G9OA 2IVYA 1JLGB 2KU7A 2YY3A 4FN5A 3PYEA 1NMEB 2VBZA 1Q78A 1CSJA 2XC9A 2WONB 4FBTA 3DI6B 3KWMA 1FJGJ 1VRTB 3NS5A 1X4BA 2POKA 1D0EA 1DBDA 4GKKF 1F3VA 2VU5A 5IZHA 1T11A 1TV6A 5D4LA 2WSCC 2PV3A 4USJC 1N5QA 1NPRA 3NNAA 2VKRA 1LWFB 4JV5F 3FAPA 1RWWB 2BBEA 1RKJA 3MPDA 4CLTA 1M5PC 3PRBA 1UEVA 4URIA 2ACYA 3MPVA 2RQSA 5EWEA 1N88A 2W25A 2KFNA 2V2ZA 1FRHA 2CQHA 3MM6B 2YKNB 3RM8A 4ERDA 3KZ7A 3VV2B 2CIMA 5LM7E 1W1PA 2AZ3A 1ICEB 2LCWA 1NMWA 4F25A 4PXBA 2DK2A 1HKMA 2V94A 4OLPA 5IC4B 4TQRA 3IS9B 1FXRA 3K5MA 1W1YA 3EE3A 4JI7J 3PEJA 4ITSA 3IGVA 2MQLA 4FYVB 4O0NA 2R2UA 2BOPA 2B9WA 4GO7X 2VICA 4PG5A 2CQPA 2HFUA 1LQ0A 4ED5A 4B3OA 1LW2A 1U6ZA 4C0BA 4Y2KA 5DLGA 2YBUA 1YJVA 3SI8A 4ZVHA 4LIRA 1TL4A 1N36F 1WWHA 5K8NA 1FWPA 3AB4B 2E7XA 4MYUA 2HBRB 1EZZB 2RNEA 3AOCA 3VAIA 3KXDA 4H4OB 3P3DA 3R5AA 2QFIA 3HP6A 3UQIA 3HCXA 1FRIA 2IJFA 4LF5F 3V6DA 4X4QA 1VGYA 1SIZA 4DFPA 4FPRA 3W1YC 4V1Ak 1MU2B 3H20A 4DR2J 1VQLS 3FRZA 2AYMA 3JYMA 1T3NA 4JI3F 4JI4F 1S1TA 2D3ZA 4FYWB 3PACA 3SQGB 3WQVA 2HLTA 3MD1A 4ZHRB 2DRDA 3M30B 3LP1A 4DIPA 4RNOA 3BXWA 2AX1A 2NZCA 4AY1A 2FVPA 4HI1A 1IBLF 2GMHA 3ENQA 4A4JA 4CI0B 4FYXB 4MNMA 1SJ1A 4CRJA 3O3LA 2JFKA 3PTWA 1RISA 2ZHOA 2XSFA 3FY1A 4MPKA 3PHTA 2V34A 3HVRA 2CPDA 2OPSB 5AXLA 2XMVA 4RUAA 4ODQA 2R8IA 3H7HB 1YRXA 3I0SA 2D9OA 2J9EA 1BLUA 2W7AA 4EFAC 3IKGA 2AJ1A 2VN1A 1VMBA 3DDKA 3TOQA 4DZDA 2KE0A 5HROB 2A3JA 3DKDA 4IT6A 4YB5A 2NSCA 4K4XA 4NZ6A 3B9EA 3QRRA 1FXDA 1IXKA 4HACB 5A8KB 2Q5AA 4AYBD 3U02A 2HPUA 2H3EB 5ETNA 3OL9A 1U0HA 2JEFA 3TAQA 3ENAA 5D8HB 3FK4A 3VAGA 3MR7A 3M32B 2CYYA 3RW7A 1K1SA 4ED6A 1F40A 2HKEA 5GMEA 3HO1A 3TUJC 5AXMA 3AXMA 1W26A 4FF3A 3BKUA 1FNMA 4NLXA 2FAPA 2N82B 4WFAQ 3RYLA 5KTQA 4FXDA 1S77D 3DXSX 3IC1A 1SIWB 3M8PB 3GJQB 5KFAA 2ZZMA 2XP7A 3V4IA 4M5DB 3ILIA 1WG1A 2V0NA 3PX4A 4ANCA 4O44B 4Q2MA 4KIAA 1S1VA 4JI1F 5CYQB 3BH6B 5CZXA 1MNEA 4DR5F 1LWCA 2FUG9 4IG3B 3Q22A 3C15B 3D1HA 3FCVA 5IFMA 5G0RB 4QPTA 1JLBA 1H98A 4ZN1A 2JEGA 3CUNA 3D54A 3UW1A 1PJ5A 2KT5A 1WEYA 4P8WA 1T9XA 3UCGA 2R8GA 1NB7A 2F21A 5BYRA 4NOHA 4Z2KA 3N6NA 2IRYA 1HFEL 1F5CA 1LW0A 1RT1B 4H4MB 5KFEA 1OS5A 1HQEA 4PTMA 1BE4A 3LOUA 3MUVP 1MSWD 2XNRA 5GVQA 2B6AB 2FJAB 1ZU8A 3KJFB 4RO0A 4KQZA 4WE1B 1B3TA 2APOA 1NU4A 3MZIA 3ILLA 3V6KA 3W64A 2V4JA 1TL3B 3GQCA 2MZJA 4K4SA 1BL4A 4PXEA 3R5JB 3ZZZA 2V4RA 1HNWF 3FKBA 4C02B 3SCJE 1RHKB 2XMTA 3IRWP 3S01A 4IQ2A 1UR8A 2C3PA 3DOKB 1F5BA 1A9NB 1SH0A 3UCUP 1RI7A 3V6JA 3MECB 3BBCA 4OX6A 4NEZA 3KK2A 2DXDA 1YATA 2VG6A 4TY8A 3C19A 2XWXA 2GX8A 1RB0A 3WZ0A 1BQXA 1R6VA 4Q7NA 2CKWA 3C2PA 1RTHB 1N32F 3KHHA 4LF7F 4PUOB 2LKNA 3RB3A 4P7VA 3DLLQ 2XY5A 1TVRB 3C14B 2ZWPA 1RT3A 4P72A 4P8XA 5MAOA 3RBEA 4D3GA 1FD9A 2BVZA 3NCRA 3JSRA 2EVZA 3EICA 2NYIA 1GNKA 3KJNB 3KTQA 2K7KA 3TW0A 4NE9C 3HKZD 1F9HA 3T9NA 4W92B 2B4OA 3BR8A 3Q8QB 2HAFA 2CADA 3DRPA 2WAQD 4HT7A 2ZD1A 4KKOB 4F04B 2WVFA 4ES2A 1O5JA 2DNQA 1KLMA 2O3DA 1S9GA 3UD5A 4W90B 4C3MA 1PILA 3OT9A 4FXWA 2BJ1A 4LF9J 3W66A 3H2VE 5FDLB 1FD2A 1W9PA 3QATA 1UJ5A 2YNHA 2JEIA 3EUNA 1IQTA 2FVSA 3DYAA 4BWMA 3CJKB 1J4RA 4CTAA 4P8UA 1W7WA 3OBIA 4DCJB 1KSPA 1HNZJ 3FVYA 4OHYA 1ZL1A 5FIIA 2FPHX 3TUIC 3O5MA 3UCZP 4YUDA 5ETOA 2YBTA 1UVJA 3AS0A 1KTVA 4ZPVR 5HO4A 4QR0A 4IYQA 5KG7A 4K5RA 2DRAA 2W2OP 2NXUA 4TU9A 1W1VA 2FJDB 2XP8A 2MKYA 2LDIA 2MQMA 4Q0BB 2QLBB 4NLOA 2ZOMA 4KT0C 3OQ2A 2HIQA 1RXOB 3FBBA 2RUGA 3NAHA 2ESCA 2ETNA 4YY3J 3WIUA 5IM0B 1LKZA 3TVKA 1T9TA 3P45B 1HKKA 1HQUA 3G82A 4OI2A 2DNOA 4WIWA 4KHRA 1VI7A 2DR5A 2FQQB 5J2NA 3ZZRA 3ITHB 2V8VA 4TW6A 3QRQA 1MLAA 2QZ8A 3KK3B 2JVRA 2PO4A 1JLFA 4WKHA 2ZR5A 2IC3A 3C46A 2HRTA 3CT9A 2E1AA 1U47A 1D7HA 3ARRA 2HZAA 3IM9A 1ZPVA 3PA7A 4R25A 1HJVA 2MKCA 2VC1A 1R7IA 1S79A 3LAMA 4MH8A 4KGXB 2DNPA 4J9MA 1YIJS 5J2PB 4MTPA 4CLKA 2YPYA 1NSGA 1Y3KA 5F8GA 2W9BA 3TR5A 4QJVA 1MN7A 1EYMA 5KFIA 3UN2A 1E6VA 3AS3A 4LRBA 3WD2A 4ELUA 1RT7A 2JLFA 1VQ6S 4LBHA 2JDJA 3CD7A 2MPHA 2XWYA 3OVBA 1D8YA 1RHQB 3JYTB 3OFFA 2KXHA 1BWVA 4P6QA 1UKUA 2EK1A 3W8PA 2IAJA 4KGZB 2FC9A 2G2ZA 4FYYB 2GJIA 6FDRA 2XMMA 4YP3A 3UQSA 4IFYA 4WFZA 1JWWA 3M05A 1NHUA 4RW9B 3BR9A 3DU5A 2PT0A 3M2RA 3AA8A 1SH3A 4TNOA 1GTEA 5HW8A 3WH0A 1J5OA 3W2WB 2CRLA 2KN4A 1X6NA 4W4MA 3MGJA 3LAKA 3OSNA 1B0TA 4DFKA 4QZVB 2LXIA 5LMNF 4YQWA 5CCLA 2P6TA 3UDLA 1N52B 3VGUA 1A0OB 1Q8LA 4B3TJ 8AT1B 1N5VA 4MNKA 5GAGU 4I7FA 1VJQA 2OPPA 2UUAJ 2HVDA 3BB5A 2HS0A 1PBKA 5E33A 1RP5A 2F4EA 3W60A 1P9YA 4RW8B 2ZVSA 2ZITA 1BQMA 3DLBA 2UUWA 3EVOA 3TX0A 4F67A 3Q0AA 4IOBA 2VF3A 2QMWA 3QWPA 4C11A 1RAAB 1H72C 2MTLA 2QIFA 3LW5C 2VOPA 2DXFA 1LL7A 3G86A 1HMVB 4AXJA 3J81Y 1WAWA 5FD1A 5HLFA 2Y0BB 3IM8A 2YXLA 5K9FA 2KO1A 4U7UD 2IFXA 2WVBA 2RDJA 2PMZD 3O5EA 2W2PP 3B6BA 1KDNA 3NGRA 4J9UE 4IH6A 1YQHA 4HT5A 1HL6A 1E44A 8ATCB 5C24B 1KQSR 4O3SA 4YEAA 4Y2MA 5EX0A 3ZTSA 1JJ4A 5HKGA 3QYYA 2RDIA 3CH9A 2G13A 2HNDA 3BQ0A 4IUFA 1HWUA 4TKTA 5J1PA 2GIRA 4X4VA 3G6ES 2DH8A 2IDLA 4IO1A 4TY9A 1DRZA 4YDDB 2CJAA 2B0GA 4CO1A 3PJ9A 1L3KA 4NXMF 5AXKA 3QGPA 3T1HF 4QIBA 3GFYA 1ZM2A 3CCJS 1WB0A 1IKYA 3JTOA 4WFXA 4CP5A 3L7UA 1QSSA 1TUWA 4X66F 3BGOP 1L1PA 4DT4A 3DOLB 1WOPA 1REVB 4MTVA 4DR1F 3CJ8A 1HD1A 1FKJA 1IKVB 3L4BC 2B31A 3BGFA 2KJVA 1D9DA 7FD1A 3O5DA 2VODA 7AT1B 2DGUA 1H0HB 4URSA 4YR3A 4LR9A 1FEHA 2RHQB 1X8DA 3HJVA 2Z2YB 3QLHA 4HARA 1UJ6A 2NQPA 4ICLB 3LP0B 2ZOFA 1HBOB 3I0RA 2AEJA 4Q7AA 4LF8F 2YPZA 3N01A 2FVCA 4DV4F 3NTPA 3T5HA 1HR0F 2ROGA 3NWRA 1N6QA 3DRSA 3BPSP 5L9XA 1FFGB 2KVQE 3MEEA 4M5NA 1GQEA 1EX8A 3PW5A 3NGUA 3OHBA 1FCAA 4DMZA 1V3SA 3HLUA 3J80U 2F8HA 4DRMA 2AOSA 4KGVB 2AMCB 1U1MA 2Q1LA 1VCTA 4I2QB 2DPJA 1UA1A 3CD0A 2J7WA 5D78A 1NPPA 3HT3A 1S6OA 4BBYA 3R8YA 2ZZNA 2AP6A 4DQPA 2WTFA 1QUVA 2DGWA 2YNGB 3M8SA 3Q89A 1I94J 1JXEA 2W24A 1XRVA 1HXVA 5CAAA 2CJ9A 2EFPA 1HNIA 3CCLS 3DHWC 3EGNA 4HLBA 4ETXA 1WKJA 3N4WA 4MKVA 1Q95G 1S1XA 2BEFA 2HQ3A 4ELTA 1XQIA 5ETLA 4OFZA 1S97A 2A6MA 2DO0A 2MQ8A 3DRXA 4O3QA 1Q79A 2DNZA 1M5VC 5F0UA 1SYTA 1ZA1B 3BSNA 1JLQB 3KYLA 1S9FA 4UW2A 2G4BA 1YG0A 2F65A 2V9KA 3OLAA 2GO9A 1PYTA 2AYBA 4WBFA 4I64A 2HHSA 1OY9A 4ODKA 2R3VA 3BGRA 1YTYA 5F8NA 1JNSA 2B43A 4E98A 2JX2A 1RT6A 4IR9A 3POTA 3GB0A 2IRXA 4USKA 1S7HA 4XIUA 3CJQA 1QE1A 4QIFA 3TQEA 2LQ5A 3K8VA 5SUHA 2YWKA 5K8MA 2XI3A 3OV7A 3KJQB 2PSZA 2HVEA 1NMVA 1H0GA 2O92A 3OJSA 5H9FJ 3R1HA 1IR2A 2XS5A 4ZPAA 2BW2A 1S59A 4A8WA 2MDAA 2AKWB 1WOOA 5J2QB 5H9EJ 3HHKA 3SSQA 2N7YA 2CVEA 1VQOS 2KZZA 2QEXS 2RUCA 1OWXA 2A2DA 2OPRA 3BYRA 4F0MA 4Y6IA 4LF2A 1CEZA 1LNQA 4FVMA 4ED1A 4FXVA 1XNRF 2ZM6F 3K5LA 4J9QA 2BRKA 1B4SA 4G65A 4TNSA 4FF1A 2MMYA 2PFFB 1BXNA 3AQOA 4UQTA 4WP8A 3M2VA 1YRTA 1G7CB 4L76A 1WTBA 1IR0A 4RW6B 2RRNA 4RWWA 4DRIA 4DR3F 1PKUA 2E5HA 2QLFB 2DD8S 2BA9A 2J8AA 4B9UA 1GH8A 4C98A 1ZAWA 3IO1A 3UDVA 3FBFA 2C3MA 1T3OA 2HEKA 1WKLA 3ENWA 4HTIA 4KO0A 4M94A 2DSUA 1TMMA 2DB1A 5K8PA 5BJRA 1UFLA 1RAFB 1VOMA 4F3MA 1AFIA 5U47A 1VBXA 3H98A 2DITA 1EP4A 1Q6IA 1B0PA 1QTNB 2UXBJ 1T9UA 2HFSA 2MKKA 1L3TA 1IBLJ 2LQBA 4TW8A 1S1UA 3PJXA 1PYSB 3KLHA 4Z7YA 3T1YF 2PPPA 4L3NA 4CYUA 1R3NA 1XHGA 3GYGA 1TP7A 4ZCIA 4TLRA 4C0OC 4DPTA 1HI1A 3AD9C 3E51A 4C0HA 4WP9A 1FKPA 5K8OA 3ETOA 1NO8A 1YBAA 3JQKA 1BHNA 4J7CA 3LANA 1FRKA 3CEDA 1SV5A 2KI3A 1JLAB 1RYSA 4DS5A 1UWBA 1E15A 3H4DA 2MZRA 2EXUA 1OGGA 2PI4A 5IC6B 2OUGA 2W01A 3M8QA 4DV0F 1FVQA 1NJYA 1OQ6A 4KV8A 1AUSL 4C4WA 3Q8UA 1U2CA 4QPXA 2HNYA 1J6YA 3AFGA 4TYAA 4DLEA 2J7KA 1GX6A 4GVBA 1X6LA 2IVMA 2R8KA 4DSJA 3RRGA 5CXTA 5C2CA 4MAKA 1O8BA 5B09A 2CJQA 2LYVA 3WD4A 1E6RA 2BM0A 1IWGA 3O5QA 1D2KA 4D3HA 3CCRS 4DRJA 1I1GA 2DEJA 4ENOA 3CJ4A 3A4TA 5J2MB 1EQ0A 3TJ8A 1DQ9A 1RTDB 4CM2A 5I42A 4JI1J 3Q8SB 2CQ0A 1VIXA 2QSFA 4DR5J 4ZP9A 5A8RB 4DR4F 1FKSA 1OO0B 4Y65A 1PAEX 3AJ1A 3N0VA 2MZQA 2Y1IA 1YBTA 1P8GA 3RMEA 1G4CA 5IWAF 5GADI 5F9LA 1X4GA 2MLXA 3ZTPA 3HVTA 4WZMA 3C16A 4ED7A 2KR7A 3GCXP 2KHCA 3HDSA 5KT7A 1D9AA 3B4DA 1CJUB 1WD6A 4I0WA 3OR1B 3W2VB 2HFZA 1FK9A 2EW9A 2KYXA 3CCWA 3BM7A 3L7PA 3I9ZA 3WIJA 2ZHBA 2CPIA 1F9EB 2LJ4A 2X7IA 2AGPA 2DY1A 2UUBF 2BR0A 5ETMA 1TK8A 4O3NA 3ZNUA 2F9JA 3ILOA 2AGQA 2N7CA 3BV8A 1T9VA 1S57A 1QVGR 1G6BA 1JKHA 5D75A 3PR4A 2CPZA 4OI4A 3LPYA 4OZ5A 2IA6A 4CLSA 3BPDA 2KDOA 3UWTA 1W2IA 1HBNA 2UUTA 3TARA 4IOCQ 5CYMB 1F2HA 2JC1A 3RBZA 3H5SA 2B51A 1HBMB 2HWIA 1UL3A 4OYMA 3LGMA 1MG7A 1IKXB 3G6XA 4J4NA 4ZCMA 2ZBQA 1MMLA 4CWBA 2RQCA 5KG5A 4K4WA 1FDDA 3SMZA 2P9GA 4MKBA 5LMUJ 2HZCA 3H59A 5DLFA 1N32J 1ROFA 3HFZB 4DX6A 4LF7J 1VHIA 1Y4ZB 4KHPJ 4L6V3 1DTQB 3PYFA 4DV2F 2FTRA 3UR3C 4RBVA 3A8JA 4A8MP 1U09A 2KM8B 4F50A 4LSNA 2OMOA 4M5KA 1Q5VA 3MAHA 2VPYB 2BJ8A 4NA1A 3CHEA 2B5JB 4CLPA 3IRXB 5ETVA 2RDDA 4ED2A 2QL7B 1S1TB 3OUYB 3QAEA 3V5RA 2PI5A 2O67A 1QSLA 3ZTOA 1VQKS 3RAQA 3IK8A 1FA0A 4F4WA 1GX5A 5B0CA 3N28A 3V4MA 4K8RA 1RAJA 2AEFA 2WVDA 5A0YB 3K57A 4DX8H 3AY0A 2X3GA 4OLOA 2QL5B 4ZP6A 3RRHA 2YWWA 5L1IA 1FKOB 2C2OB 4ED3A 1L3VA 4J9LA 4QQBA 2OTLS 3LALA 1MWZA 5DZ6A 4M95A 4ELVA 2E7VA 3RZAA 1RA7A 1HW8A 4DL7A 2GW8A 1F5AA 1P1LA 2Y3YA 3PKMA 1J5EJ 4DOZA 5B0FA 5E3AA 2AJ2A 3PFOA 3CWJA 4NXNF 2M88A 1M1KT 4ILMA 2GIFA 2E66A 3FSYA 3G8SA 3JQMA 1NZ8A 2Q6BA 5DDQC 4KFBA 3HHLD 5F8HA 1C1CA 2W7PA 4I2PB 4QWBA 2R4FA 3FGVA 4J4OA 5I98A 2HGNA 3IR5B 1P27B 2BANA 1NK6A 4HH0A 4Z37A 2DRBA 3G71S 1EETB 1RT2A 5KFPA 4KTQA 2J5AA 3BQ2A 2C3YA 4DI6A 3QT5A 4X4PA 2AZ1A 2H9ZA 1YBUA 1YKWA 4DUYF 1NK5A 1DTTA 4JOUA 1VC6A 3VQSA 4ED8A 2GS8A 2YNIB 2IM1A 2XI2A 4WU3A 2DBBA 2B4UA 4LREA 4O4GA 2OFHX 3S8SA 1UZHA 3ARVA 2MJUA 2GQ2A 4FF2A 3TJ9A 3OFHA 4DV7F 1KNZA 5KFQA 4PKDB 4DR7F 1Y0HA 2XMUA 1GPFA 3Q83A 4YDXA 1ZBKA 2P2CB 2VFRA 3DMJA 4UDMA 5I3UB 4DWSD 1LEOA 5E5NA 3QAUA 5HP1B 2P4VA 2BX6A 1RTIA 3GJRB 3ZZYA 1URRA 4AQYF 3ILJA 5D6GA 1PIEA 3HHLA 2M3DA 1IKWA 2KT2A 3CC4S 3B8SA 1GMWD 4X62F 3D5MA 5DJBA 4BDPA 3FMBA 1XIQA 2WVCA 4WF9Q 2OEJA 3EVWA 3NLCA 1HQEB 5AT1B 2FLPA 3O5LA 2KHDA 9RUBA 4WU2A 3W65A 1GEHA 2UZ5A 2LMIA 1T0TV 2BMBA 1KP6A 2D3O1 1U48A 1U1PA 1VQMS 2WBMA 4A47A 2OFNA 2XSJB 4DL4A 2XNQA 1HPZA 1V5VA 1WSVA 2FKEA 1HWLA 2FB0A 2V4JB 3B9DA 1NSQA 5H9FK 3MFHA 1SH2A 2EC2A 3R5GA 1RWXB 1T05A 4ALZA 2CZ9A 1QM9A 2VG5A 3D0IE 1HHTP 3UI3A 2LFVA 4DPWA 2C2KB 3D2WA 3IAS9 4DWSA 4DV3F 1JNEA 1RHRB 3FXYA 5ETTA 3TVZA 4ZDNA 3FJ2A 4OIXA 1YJUA 2KVIA 1UW4A 2JLEA 2CG8A 5LMNJ 1GMWA 2B7CB 2YNFA 4RJVA 2VG6B 3DOMB 5HSPA 3NNHA 4XPEA 2RSEA 2YWGA 4F26A 3JS9A 4ZVQB 1ZYQA 4U95A 4S0MA 3C6UA 2QT7A 3PX0A 3DNCA 2FVQA 3TJAA 2GFFA 2GC8A 3LP2A 1T8EA 2XMAA 3RGCA 2LA4A 2WCXA 1ZH5A 4DR6F 2D41A 5IQQA 2HHQA 2P9EA 3HPOA 2GJFA 2E1PA 2GHPA 1UEUA 1BQNA 4DV6J 2HQIA 1KEKA 3KOAA 1HIYA 2G1DA 3N79A 1KHVA 3R3TA 1C2PA 4NYZA 3Q23A 1KFSA 3BKFA 4OYXA 1OSDA 2LU1A 2Q66A 3RFWA 3QOKA 1KLMB 4S3JA 2DR7A 1U24A 4NWBA 1S6PA 3W8GA 4Y2IA 1RAOA 2CNKB 4NASA 4PWUA 3MHYA 1HLWA 4K5SA 4PPZA 2XPAA 5IT9Y 3W5ZA 3ZZ0A 2L9WA 3FZBA 2UUCF 1OWQA 5HN0A 4ZP7A 3P5BP 1LV5A 2J0QD 3GIKA 1D9FA 4R8UB 2O9OA 3UNYA 1NDCA 1U0SA 1Q5YA 3VAFA 1FKFA 1SQFA 1ZBVA 1F60B 4IR1A 1LG2A 2CG4A 1KTQA 3CDUA 2DGSA 3DM2B 5KFOA 2LP4A 2M7SA 4TYBA 4K7QA 2ZKTA 2AX0A 5BYSA 3C3LA 3QO9B 1FJCA 3EYZA 1QSYA 1TQLA 1QD1A 4NLRA 3M8YA 1GXTA 1KFDA 2M8HA 2YVSA 3AS1A 3UO0A 4B3SJ 4X66J 3K58A 2CJXB 5L38A 2M5YA 5G4DA 1WF1A 4PCQA 3CO0P 1WC6A 3D68A 2UV8A 3MFIA 1H73A 4ZLLA 4LAXA 4L73A 1Y5NB 3PR5B 3KABA 2ZNYA 2KFWA 4BC9A 2ZHAA 3TAMA 2OELA 1YHQS 2WK4A 5AE1A 3IBFB 1NWUA 4U7UK 1WOSA 4LIWA 3G87A 1QY7A 3G6MA 1ZA2B 5JH8A 1DJ0A 4CLFA 4KGMA 4PQUB 1FX4A 2HNZB 1S9EB 3E01A 4P2XA 2AJ0A 1E6YA 4K0KF 2VV5A 4LF8J 2HMIB 2ASLA 4ITZA 2RF2B 3MEDB 2Y78A 1KVIA 1AZSA 5HATA 2HURA 3MM7B 1H6KX 2GVDA 4OX7A 1YX2A 1T95A 1URNA 5DG8A 4A8YA 2C42A 2X51A 1UVMA 4Y3CA 2QA4S 3MDYB 4EUVA 2RIJA 1R8HA 3ETMA 4LSZB 3DHXA 2XHWA 3T41A 1EKRA 1C1BA 3DU6A 2OLHA 1RZMA 2ILYA 4HR2A 1F1BB 1RAEB 1U02A 4OZJA 1VDHA 3FSXA 2H5IB 1TL7A 2XLKA 2Z4PA 2J0XA 2DHXA 1DFDA 5HQMA 4GO5X 3CJTA 3U27A 2H5JB 4ZJQA 1LQ9A 5I4MA 4DSEA 1NAQA 4ES1A 2BJ3A 2LQJA 3KLEA 2JOQA 4TU7A 3R2CJ 1T03A 5HBMA 3MUMP 3E2EA 4R5PB 2NSBA 3EX7B 2UVRA 1NLKL 4C7QA 3MMCA 1ZB5A 4NZCA 2RKIB 2DNNA 2ZFHA 2KZMA 3W7BA 1WHYA 2HHPA 3GSIA 3G2XA 4LT6A 3SYZA 2V6AA 4HHJA 2ZH7A 4QIWD 5DGAA 3BGLA 1SR0A 4DLGA 4USVA 3FCWA 3J81U 2JC0A 2J9DE 2PA3A 2MQPA 2PMHA 3FQLA 4IDKA 3EPGA 3I4PA 1NEEA 3OL6A 1C9HA 2O1PA 4G1PA 2J6UA 1FTRA 3EJMA 4LJMA 1RT5A 1FKDA 2M9KA 2WOMA 2XMWA 1TKTA 3K0JA 2YKAA 4DHVA 1S1WB 4MSPA 2KKHA 2I1RA 4LF1A 1FWLA 4M1KA 2R2SA 1UR9A 2PMWA 1SKWA 2ADCA 5B0BA 2RUDA 3TZZA 3TANA 4TVAB 1D7JA 5HMZA 4NLVA 2UXCF 1TKXA 1NKBA 3GFXA 2C2DA 3IAM9 3K59A 4PABA 3DLEB 1MROB 5GMDA 2IBOA 2Q3PA 1YRUA 1FKIA 3HHLC 3KLGA 2RMLA 3M2UA 3PNIA 2DSWA 3DXBA 4A46A 3GYXB 1UVKA 2YH1A 4QWEA 4OJ1A 2XGQA 5A6WA 3OW2R 2CWXA 2DISA 2IJNA 1TL1B 4NNRA 2KXNB 1FKRA 5KFDA 2ZM6J 1NNDA 4RKUC 3SCIE 2ZJRQ 2HVHA 2FJVA 1KLNA 3NMAA 1TKZA 5D0RA 4MMOA 1G2EA 4M5LA 1IM4A 3DGPB 5EWFA 2JSXA 3BQ1A 3SSSA 2VBWA 3AJ2A 1N34F 3IKDA 2VDHA 3UD3P 1YDLA 2H65B 2F8MA 2K2PA 2A3BA 1SUQB 1IWAA 4DR3J 5KFFA 1DLOB 4OL8A 4DPOA 2F7VA 4WFNQ 1VRQC 3KLIA 2CNNB 4DEZA 1EQMA 4IOAQ 3T5LA 4USTA 4DWIA 3WKZA 4X4OA 5HUAA 1MW7A 4A8QA 2L3MA 4U84A 5D0EA 1N33F 1O6IA 1Y7PA 1TFWA 2HQCA 2Q43A 4F7VA 4DRKA 3EGWB 1YJ9S 2GIQA 4G1QA 1IX5A 2D1CA 1OJ4A 9ATCB 5CA5A 2CQIA 1VQPS 1CQNA 1RAGB 2KRRA 2EFQA 3IGNA 3HMJG 2ZVIA 4BS2A 5HW7A 1D09B 1JLGA 1R0AB 3Q86A 4M5IA 4C8MA 3HJFA 1XNQF 4RUCA 2NXNA 4F8RA 4AE5A 3DI6A 2HHXA 1EJ7L 3GMGA 3GIIA 3HHDA 3GV7B 3RB0A 2F4VJ 2CPEA 1LWFA 1AUDA 1N6QB 2ZNZA 2XZWA 2X1GA 3CW2C 2BOAA 3DRSB 4PWWA 1O0PA 1VK8A 4OQJA 2E44A 3TP2A 4QCLA 3JAMU 3P8BB 2RB7A 4ECVA 1WHWA 3TA1A 3MEEB 4CQ1A 3GZ7A 1EHNA 5E3QA 2JEJA 3DDIA 3G6YA 2E1MC 1B7YB 3CPWR 4WZQA 1HBUB 5C25B 1GUVA 5GADU 4B3MJ 4X2BA 5HMXA 3MM6A 3UI5A 2YKNA 3H4BA 3OVSA 2BXJA 3FSIA 2JH3A 3Q2SC 4HI2A 2ABYA 1T9WA 1U1RA 2CPFA 3HX9A 1D8ZA 1VK3A 1VC0A 3X3UA 5F8IA 2ALYB 2O01C 4DZ2A 3IS9A 1ITXA 4MNLA 2ZZTA 4PG8A 4QR2A 2DH7A 4EYHB 2CZ4A 1YITS 1QAXA 2V2VA 2V8DA 3GYNA 4EBDA 1RWPB 3MMAB 2N3LA 3NOGA 4WP3A 1CULB 5CQGA 1VBYA 3D1QA 1KN6A 3BS9A 1S76D 2BYCA 3PRVA 3LGNA 1IBMJ 2WLYA 2KRBA 1PSDA 1FNXH 4OYZA 4PG6A 1W2BR 2MY8A 1CJKB 3NI6A 5JXSA 1R8BA 2WSEC 5KT6A 4LSLB 4CDIA 2AYEA 1GT8A 5D4NA 4NI2A 1MU2A 4MNJA 1JJCB 3POTB 1AXQA 1EARA 3CGIA 5LJ3Y 1VLOA 1RTZA 4MAVA 2J76E 3I96A 3J7Z5 4LFBF 4OZLA 2ZOGA 3SQGA 1FKAF 1SKRA 4ZHRA 2BE2B 2UUBJ 2VIHA 3MPYA 3M30A 1ZM9A 2RS8A 3MTKA 3SDEB 3I55S 3RB4A 4XK8C 1HYSB 1FRLA 3ALFA 3W9JA 3HVWA 3K2YA 1HWKA 5DG7A 4Q22A 1R8AA 4X65F 4B3RJ 2DHHA 5DQGA 4KB7A 3JB9k 2OPSA 3CDEA 4QIGA 3KKFA 3J7A1 2GCFA 3PHEA 3EWGA 2HGMA 3UN5A 4CO3A 4PAAA 4OHWA 3MAQA 2X1BA 5HROA 2FHJD 3MEKA 2GVZB 5D3GB 4KE5A 1FJDA 2CDRB 1OQ3A 1FRXA 3SV4A 3BO2A 2CJBA 2F3JA 4HACA 5A8KA 3M2VB 2K3IA 4OYPA 4ID5B 3MOJB 2G41A 2OD6A 4MKYA 2I5JB 4X4SA 3M32A 4WJBA 2MKSA 4WKYA 4DV2J 3T5KA 3NRBA 2CNOB 3ARZA 2DNLA 3M7VA 5B0DA 3ARXA 3R97A 1FJEB 3H5XA 2HLUA 2IM0A 4N76A 3V2UC 5C42B 2RVJA 3WC2A 1DURA 5BR8J 4N47A 2EI5A 2J6TA 3CE8A 3PEHA 1GK8A 1R31A 3M8PA 4DN9A 3GTYX 4NLWA 2CAJA 1NRKA 5T41A 4ZITA 1VS3A 4M5DA 4EZ9A 2HK3A 5F8JA 4O44A 3KK1B 3CJ3A 2VPWB 2FIUA 5CYQA 4B9SA 1S7IA 3FNNA 4J91A 4J9KA 2FHJA 4IG3A 1MN9A 3D3BJ 3C15A 4CO5A 1FJGF 5G0RA 3BN7A 3R27A 4PQAA 2FZCB 4LBIA 1Q86T 1RSCA 1NDPA 4HYKA 1PBAA 5JMNA 4Q8FA 4OZ2A 2RRAA 2P5VA 1QPFA 1SV5B 3U1MA 2XB2D 3ET6B 2OO4A 2NUUG 1RT1A 4H4MA 4NXNJ 1JLCB 2HWTA 3FZ2A 3TCZA 1GTHA 4WTYA 3O5RA 4MYTA 4RPFA 2AJFE 1X60A 1OY8A 3M9MB 3M8QB 3R6GB 2B6AA 4YMEA 3SCKE 3T6BA 2M2AA 1BWEA 3V81B 1ZTWA 4PXCA 2C2ZB 4ED4A 2BQRA 5AXNA 5KFSA 3TZYA 5KFKA 1FRMA 2JZ5A 2UXDJ 3THPA 4MFBB 4Y2CA 1H2UX 3W5YA 2DNRA 7FDRA 2QA1A 3OTBA 1SJ3P 3BDEA 2Z0GA 3MAAB 4DQIA 4NCAA 3DOKA 4Q2LA 3AS2A 4CH1A 5L1KA 4JI7F 1IN0A 2QFJA 1Q4RA 4IT4A 3KLFB 1EKSA 5DO2A 5B0AA 1SC1B 4DR7J 3MM8A 2R8HA 3O5PA 2BACA 4U8YA 3VZHA 4PWDB 1RTHA 3UD4P 4PUOA 2MLYA 3D66A 1NXIA 1WEXA 1BUXA 1WG5A 1YJWS 2YTCA 4P73A 2MQOA 4DZ6A 4OYBA 5KOXA 3A3NB 4TU8A 2BM1A 4J9SA 3C6TB 3M8WA 4URQU 2FC8A 2RILA 2BQ3A 4PZVA 5JUMA 1JQGA 1C4AA 4DFJA 5KFCA 3OFEA 4B02A 4TQSA 4I1TA 4QYRA 4ECWA 1FE0A 2KTQA 1APSA 1VISA 3AODA 4KKOA 3MPUB 3RU0A 4P2FA 2CXEA 3IFEA 2Y8YA 1UMJA 2DT9A 3CJ2A 1N8RT 4W9PA 1MMNA 3DLHA 3LWLA 1RU2A 3BKTA 2QMXA 4IFVB 1K0VA 1U79A 2D69A 4J9PA 4KC5A 1JMTA 2AW0A 3CVKA 5FDLA 1JKHB 4PRFA 3I5CA 1M90T 5HVFA 5IT4A 2DGOA 3EGZA 1SCJB 2V2KA 4YN3B 3K5NA 3CJKA 1RCOB 1QAIA 4WCEQ 4DV3J 3JSMA 1NKEA 5A8WB 4HBEA 4Z2LA 3HM9A 1RWOB 2XO6A 3H25A 2GV1A 4EU0A 5AJ3F 3CCTA 1GXLA 2KYZA 3MTJA 1V3RA 4FS1A 2Z2MA 4C9DA 3GV8B 2GAGC 1QZ2A 2IM2A 4IG0B 4DL2A 3NY0A 3ZZTA 4Q0BA 4P71A 2Y1JA 2FY8A 3GP9A 1AW0A 4DQSA 2HBYB 3UE2A 4DR6J 4FNIA 5IS2A 1EIBA 1WORA 4ECZA 5IM0A 3TVYA 2MXYA 1OYDA 2MYFA 4F36A 5LXRA 4NLDA 1TMJA 1S99A 3PXGa 3ITHA 3ODKA 2HHHJ 4W98A 4CLUA 1RTJB 1YK9A 3KK3A 1ZM3A 3NKYA 3FFIA 2DSVA 1RHJB 3B8HA 3HSGA 4UTGA 1WHVA 2HS4A 3MOZA 1J27A 3S6EA 4EO8A 3M9NB 1O6XA 3JXOA 2UUCJ 1FFSB 4NMLA 1VQ7S 3S1TA 2B4VA 3QZ7A 1CG2A 5HJYA 3VALA 5GQBA 4U96A 2EWHA 5E7OB 4J9RA 1ZCNA 3V6HA 2Y8WA 4UY85 3VAKA 1Y10A 4FKXA 4LR8A 3VAJA 1S12A 2XLIA 3UI4A 3UF8A 1OPZA 3NGTA 1UAWA 3PJWA 2JFDA 3CJSA 4ZA1A 3AH6A 3QBCA 5E2QA 4OI1A 2LEPA 4ILRA 1GOIA 4NL5A 4P2MA 3I4HX 1JXLA 2N4DA 4CM0A 5KT3A 3JYTA 2DGTA 3L3CA 3MWBA 3DLKB 1Q53A 1C1CB 4JI6F 1U6FA 1NKCA 3KJVB 4DRQA 2LA6A 1EAYC 2IYIA 3IWNC 5T14A 2MHNA 1SBRA 1WSRA 1U8WA 2P9CA 1MMDA 3EGVA 4RW9A 4OX9J 5EHHA 3R7BB 2IJRA 2MNTA 1SJRA 4ZPWR 1WHXA 2M1IA 2NUHA 5ETQA 4CH7A 2QLJB 3W2WA 4RU2A 1AB8A 4HL9A 3RAMA 2J9DA 2DEIA 2D9PA 4GRSA 3IA0A 3DGVA 2YWHA 4UT4A 3CULA 4LFAJ 3W9HA 2WBRA 2WHOA 1C0TB 3ADAC 1EIYB 3D67A 4ETZA 4ZIVA 3AOBA 2HRYA 1PC4A 1XEZA 4O3OA 5GAEI 4NLYA 3CXCR 2CQGA 4NCGB 2E5LF 2RS2A 3I82A 2AIRB 1TK5A 4NX9A 5K14B 4CNYA 2O66A 3H2LA 2DT2A 1IKWB 3MD3A 5KT5A 4TX0A 2VFVA 5KG3A 2DXEA 2FYXA 1HMVA 4LFCF 4WKAA 3ZTQA 4KYZA 4OZ3A 3RGIA 3AHPA 3CIZA 1CS4B 3FEYB 3A8KA 4ZCLA 1HKIA 4YB7A 4RWXA 1NUEA 4ZVGA 2G2OA 3HHNB 1HPZB 1LL4A 5C24A 3GU0A 1RHMB 2R7QA 3EZUA 1WJ9A 1I5OB 3GJTB 1E6PA 4N19A 4DV5J 1YZ6A 1H74A 3ELHA 3L7OA 2VG5B 3HZEA 4KGKA 4UUWA 2CQ2A 3I31A 1HNVB 2H5EA 4ZLJA 4OX8A 4KH0B 2KG1A 4GKJJ 3E3XA 1U2FA 3KAHA 4DWSB 3NRKA 4FS2A 3WX8A 5IV3A 2XBPA 1NK0A 1TUVA 2RSQA 3M1VB 2DPIA 5KFGA 2ZR4A 5M2RA 2Q79A 3GLJA 3KUHA 3G96A 4KY3A 4A8SA 3C6UB 1R89A 4ODMA 1ZTTA 6FD1A 3LF0A 3A13A 4JI8F 2I8EA 5LSLA 1U8SA 4ECUA 3CTRA 4ED0A 2C28A 3QJJA 5IT9U 1HQ2A 3DOLA 4GIVA 2Z58B 1FERA 4DN0A 2UXCJ 2PIIA 1IKVA 1SL1A 2KGJA 3AB2B 3NL0A 2ZBRA 1NZAA 1X0PA 3QFHA 3CD5A 2ILZA 4LGXA 2PV2A 2XLJA 4HKQA 4ICLA 3LP0A 4I6YA 1HBOA 4IRDA 1RT4B 4N7TA 4DSLA 5HW6A 1H7XA 4DCOB 1X7VA 4J9OA 1S6PB 3WHIA 3GFHA 4P52A 1NHKL 5L39A 1HW9A 2YKMB 2YQ3A 4R0XA 1ZOTA 2WVEA 4U86A 1S6QB 4RNHA 5THWA 3AA9A 1JJ2R 2VFUA 1N34J 1D7IA 3C8YA 1QUPA 1D3WA 2IPOB 3AROA 3IBCB 2BJ9A 1SB6A 4GC7A 2QSWA 3NCQA 1CJVB 1XMBA 1IBKJ 4I2QA 4M5HA 3THVA 3CCZA 2ZE2B 4WKRA 1UZDA 2E9RX 4X4TA 2PBCA 3H9RB 1N33J 2YNGA 2IYGA 1F3FA 1BD6A 3CC2S 3PYDA 4AXIA 3U1NA 1YWXA 4C8YA 4RU9A 1R27B 2UU9J 1Q8BA 3SCLE 4LRFA 2CDQA 2F9DA 2VPZB 4BWJA 3WD1A 1S72S 2F8EX 2YWFA 2JLGA 4IRKA 3BYPA 3ISZA 4CLLA 2CNLB 4XPCA 2HHTA 2EG1A 3UR0A 3CJ5A 1AZSB 1RWUA 4ANEA 4CO4A 2IMWP 5LJ5Y 4F4KA 2E1RA 2COLA 5C2GA 3B4MA 4DPYA 5E0OA 2XMKA 3GPAA 4NLSA 4DG1B 3IG1A 2UUAF 5IV4A 2DNHA 2K8IA 3WL1A 5DRKA 1JNZB 2R7SA 1CPZA 4BF8A 4PR6A 3T1AA 1C1BB 1SJ4P 2ROPA 2HRUA 4EO6A 2MZTA 4Z2HA 2OSRA 3EMTA 2QO3A 4R0JA 2LXUA 3IN5A 2MY7A 5F9NA 2IY5B 3KHRA 1H0IA 2J0SD 3CDAA 3VZIA 4A8XA 3OJUA 3QSIA 5J2QA 3NWGA 4CT9A 2GA7A 2OKQA 3KLEB 4K50A 3PO4A 1J2VA 5GAGI 1BGXT 3HFKA 2XO7A 4KAIA 1Y3JA 3MMCB 2V9WA 2K1RB 4QWDA 1Q81T 4DF8A 5A2QU 2D3UA 3GWCA 2QYCA 3U7JA 4LF4J 3PX6A 2WB1D 1WF2A 3EVMA 1UPPA 5KFBA 2XULA 4ZCKA 2FZGB 4U67Q 2DH9A 5MLCV 2PD1A 3PCOB 2OP5A 2GJ2A 1RJJA 4N5SA 3CJRA 1XTZA 1U25A 3B54A 1T94A 4LRDA 4YR0A 4DL5A 1NK9A 3FEZA 3I5AA 5HQ8A 3VWSA 4R5EA 1FT8A 2LVWA 5HK4A 4FAPA 3OTOF 4RBTA 4LFBJ 2OSQA 2OI2A 3LH2S 3PKYA 3MMBB 4JI2F 2YX1A 4LBPA 4YB1P 1I51B 4B9MA 2M0GB 4HHUA 1FDNA 1KKHA 4P74A 1TKXB 3FDSA 2AWGA 2VQFF 1SKSA 2VB6A 2PEHA 2EKYA 4IQXA 1F0XA 2KFZA 4X65J 2C3OA 2DPEA 3WIVA 2K3KA 1KVJA 1TTHB 4JV1A 2IHR1 3Q8YA 1H7WA 2CWKA 1X5PA 4USHA 3JYJA 2H48B 5KFRA 4DXLA 4EEYA 3GR1A 2HVZA 1B99A 4X4UA 5KFMA 1PC5A 2G0CA 2C1EB 1G3OA 1JLAA 1VBZA 1X5SA 3PRAA 1WKKA 4GVLA 4DX5A 3OPKA 3W4RA 5DETA 4OI3A 3MM9B 3TNVA 2LECA 4EMDA 3G9CA 3NAIA 1VIOA 3R9LA 4EBCA 2J7UA 3FMWA 2HW3A 3HFVA 2MHEA 3OVAA 3CMQA 4C3KA 1QTMA 3IXQA 2VQEF 4J90A 2GHVC 2GAHC 1N5YB 3GG1A 2J0WA 4FZVA 4EZ6A 1NK8A 5IOLA 4DBQA 1R9HA 1ROUA 1FFRA 1JNRB 3SEOA 4DUTA 2O5DA 4EI2A 2ZUAA 4ES3A 1NH6A 2NXCA 2CPHA 2AT1B 5J2MA 4JFIA 3H90A 2MPUA 4J9VA 1I94F 3RUBL 2DHAA 2XY7A 1RTDA 2GGPB 2JRSA 3NBPB 3PO5A 2R2TA 1CBKA 3H0PA 2HQFA 2EG2A 1D1UA 4MT1A 5A8RA 1RDRA 4I67A 4B9VA 5BYQA 2J6SA 3DRRB 2PC6A 4RW4B 1JLEA 3CDWA 1AT1B 1HHQA 4M63A 2B9YA 4R0EA 4E0DA 3FUYA 1Q7LB 5F8LA 1OSCA 1I3OB 1FFQA 1CJUA 3FBEA 4GKKJ 4PXDA 4C8ZA 4DQQA 4DL3A 1U26A 1TAUA 4IQMA 3TZXA 3W63A 3OR1A 3I56S 2FGOA 3W2VA 2XP9A 2I6WA 3DN9A 1M0SA 3H5UA 1XMOF 4JV5J 1Q82T 3GJSB 2YX7A 1ZBTA 3JSYA 1Z1ZA 1K8AT 1P5QA 4CT8A 2RAQA 3BZQA 4UOGA 4Z2GA 1ZAVA 2HFOA 3ARTA 3ICLA 3MCOA 4ZP8A 4OJHA 1FKBA 2UVUA 1ELOA 3WD0A 2DR8A 5KFLA 3BBFA 4F4YA 1I6JA 1Q8KA 3FCHA 4LVOP 5HI7A 3HT0A 1XWLA 4BHQA 3CHDA 4NLTA 1ITPA 4JV2A 3BSOA 4RW7B 5CYMA 1BY9A 1HBMA 3JXVA 3BO4A 2WB4A 3A8EA 1IKXA 3UVJB 2OHDA 1LK5A 2NXEA 1F6TA 4QOTA 4JP8A 2OPQB 4BCAA 1HKJA 4ECRA 1OIAA 4ZVRB 1SXLA 2GO8A 3HSZA 2RQMA 1DQ8A 3QIPA 2VONA 2VPXB 4XDDA 3E8OA 5E41A 1VRUA 5KFJA 5IT0A 4B9TA 1DTQA 4WXOA 2CZVC 3OL7A 4TLQA 3AT1B 1MWYA 1C0UB 1VFJA 2XS7A 3PY8A 2C2RA 1N36J 1UP1A 4KR0B 2OMLA 3D0HE 2RURA 4P75A 1CJTB 1T9YA 2DGXA 2B5JA 2LU2A 3KUGA 2MGZB 4NI2B 1EDQA 4CO0A 5KT2A 3KG1A 4LF5J 3IRXA 1TKDA 4NMXA 2UVVA 1S5ZA 5LSRA 3OUYA 4U7CA 3HXMA 2EEYA 3IR7B 3A3PB 4I69A 5EX3A 4EYIB 1B0VA 4JI3J 4JI4J 2V8HA 1NHVA 3D6MB 3AAWB 2UXBF 2PN6A 2XEXA 5A0YA 3RR7A 1KD1T 3PM9A 2Y0SD 1V9OA 1FKOA 2HFVA 3ZC4A 2B8QA 2ZBIA 3K17A 3M6VA 1VF8A 1JB0C 4KBIA 3MR3A 2I9SA 4ZPBA 1N5SA 2PEBA 2E1CA 3HSJA 4P7TA 5DIVA 1X4FA 2VG7B 1R8PA 5J1EB 1YGYA 1PYOB 5AJ3J 1T02A 1JNTA 3KAIA 4ZLPA 1UW9A 3CZ8A 3BJYA 1S0VA 3GPKA 3R5DA 3TQ1A 3MEGB 5ETSA 1K9MT 2MEWA 4JV0A 1X9MA 4Z7CA 4PPDA 4NA3A 2ITKA 4YB6A 4I2PA 3OD2A 4OJ3A 4LAWA 1WC5A 2RH3A 1EETA 5T7LB 2QYGA 3OXGA 1YVFA 2BJEA 2W2MP 2W9CB 1JNDA 2X3DA 1SC4B 1JVWA 4KJIA 1S10A 4MKAA 2YNIA 2H51B 1IQZA 1Y0OA 2EK6A 3VR1A 1M1GA 4U85A 4TXSA 1NSAA 2EFGA 3EXYA 5D0HA 5DQIA 1OMSA 4GMKA 4XDCA 4ER8A 1TFYA 2JHEA 2B56A 1TZ0A 1VJWA 3VGVA 4WIQA 4ANDA 5I3UA 2H1YA 2XCAA 5HP1A 1SJFA 2FZKB 5KG0A 2IF4A 2AYGA 4NLGA 1Y11A 1KHWA 4RNMA 3KAGA 3O44A 2V68A 1TV6B 2CVIA 2VHGA 2U2FA 5FLXY 3NMRA 4NCBA 2R2RA 3QJLA 2FD2A 1RA6A 2WRMA 2I0XA 4QIVA 3UFCX 4ZS6A 1VQ9S 3W61A 2AJQA 2BRLA 3G8QA 4ZVEA 2LQ8A 1M5YA 1QAYA 2XSJA 4JI6J 3IMQJ 1FKKA 1ROTA 1FWKA 4DRHA 1KQKA 5GAEU 1FKGA 3KG4A 2HQDA 2ZH2A 2VASA 1Q6HA 3D6TB 3AJDA 1WNEA 4LF6F 5D4OA 5KG4A 4ODOA 1HNWJ 2BE9B 4MIWA 3J7YI 4AFFA 2ASDA 3D0GE 2KJWA 4HDGA 1RQ0A 3MM8B 3DOMA 4NLQA 1DARA 3GONA 1DZ5A 5LMUF 3NGKA 2DG9A 2E5LJ 1OYEA 2AD9A 2OIHA 2R7UA 4DUZF 3TWZA 1K44A 1UPMB 2NPFA 5EUHA 4XAKA 1GMVA 1H2TZ 4KHPF 1KS2A 4B3OB 3J7AN 1LW2B 2FHKA 1IM6A 3AQPA 1LK7A 1E9LA 1V3ZA 1YJNS 2DNKA 2AWZA 3TO8A 5DGBA 1ZM4A 2KO7A 1LFWA 2LXFA 3DC2A 4LFCJ 4YR2A 3VF0B 5B08A 1NSPA 2AEMA 3Q8VA 1TELA 3V6DB 4LRCA 2V67A 2AU0A 2H4WB 1AYEA 3FC9A 1S0MA 4CH0S 3H42A 3NNCA 5B7WA 1HJXA 4WTOB 3EZOA 2E5GA 2G8ZA 3ISND 3LP1B 2CJKA 3I6PA 2DCLA 4ZPCA 1RBOB 2A3AA 4Y34A 4R8UA 3D3CJ 2A6OA 3IWXA 4RZRA 3CC7S 3CNQP 3ENVA 4JYAF 3D6FB 2MSSA 1BKFA 2MZ1A 3JSMB 4LQ3A 3DM2A 5CH7B 1J5EF 1NDKA 2UV8G 3I0SB 2HGLA 1KT1A 3KMSA 3QO9A 2ZC4A 1UETA 3M6WA 1VQ5S 4ZVSB 3MM5A 3CSKA 3W5XA 4ZK7M 4ECYA 2DJWA 3QGIA 5GPRA 3ZO7A 2FVRA 4JI8J 3HSDA 2DT0A 4MK7A 2B8PA 1U0HB 1KQFB 4G50A 5M2PA 1WDDA 1X5OA 5F3ZA 2PPOA 1P6TA 3OXLA 5HWBA 4PQUA 2HNZA 3PVXA 2VJVA 1S9EA 4DZ3A 5HTGA 2DG3A 2VA3A 2KM8C 1XK8A 4KH1B 2XHCA 1HD0A 2HMIA 4ODPA 4ZVPB 4ZJLA 4OYOA 3TYTA 2RF2A 3MEDA 4ZVFA 2N3OA 2YKOA 3FFIB 4AT1B 1NJIT 2D9FA 3V4IB 2PV1A 3MM7A 1B7FA 3RB6A 1S1VB 5J6EA 4C48A 2ZH5A 8RUCA 2QN6B 1EHWA 1KVKA 1LWCB 3MDFA 5KAKA 5KG2A 1HWIA 2RJZA 4PG4A 2CQ4A 4Q8EA 4G3IA 5DF0A 4X4NA 3F44A 1JLBB 1YW5A 5F41A 1U4BA 1WI8A 4H4KA 3WC0A 4UUXA 1HKAA 1U1NA 4IH7A 2F40A 1DAXA 1QJHA 1PBUA 1RBAA 1CLFA 2HG4A 3ZTRA 1WEZA 1LW0B 5F0WA 2SXLA 1RAIB 3OR2A 3T9ZA 4IQCA 4R5PA 3K5OA 1ZAXA 3J81j 1VQYA 2W4PA 2V8GA 4G6VB 2RKIA 2PFDA 2LEAA 1VLYA 2CPYA 4MK8A 3Q8PB 3WDOA 2UP1A 4V19J 1W1TA 3NS7B 4OHZA 2VD3A 2QF8A 1HJWA 3AD7C 2EBGA 1RWMB 4QT3A 2DHSA 3SFUA 2W7OA 3SFGA 1NJWA 1U1LA 3RM9A 2DVIA 5H9EK 3P4UB 2R7TA 1CVJA 3CCVS 4FPIA 1FI4A 5HT1A 2G0IA 4DPXA 2G2YA 2UVWA 1WC4A 5DS7A 1UTAA 1FESA 3KK2B 2QLWA 4DQRA 3N6MA 4K4YA 1N0UA 3K7RA 3O5TB 2NLWA 3M4XA 4TY8B 3IBWA 1S1WA 4DF4A 4X64F 5BXIA 2EPIA 1RYRA 2PI6A 4FBUA 1F2GA 2X1FA 2KG0A 4MJKA 4O23A 4FVCA 1RT3B 3DLEA 4KHMA 2FDMA 1MROA 1P9QC 2QMUB 2DCUB 2OH2A 4S3KA 2DYAA 1FEEA 2E5JA 4ZOSA 4DV6F 2BJDA 2B7BB 1UEKA 2BKNA 3LUYA 4K4TA 2MSTA 5F8MA 3DRPB 2FLNA 5KFHA 4W5UA 2ZD1B 2QJ3A 1TL1A 3P6YC 3R5CA 4USMA 4I68A 2A0FB 1WNOA 2HBZB 1S9GB 3DGPA 4BLGA 5KFYA 2GNKA 2GHWA 1H38A 1M5OC 4F02A 1SUQA 4KPYA 5I3QA 1DLOA 1NH7A 4JI0F 2YNHB 4F0KA 3ZFVA 3DYAB 4ZVTB 2YQ1A 4CTAB 3CCQS 4DS4A 1U2RA 3R7NB 1W25A 1U1QA 3D4JA 1LWXA 3LA0A 2QL9B 3OHAA 3VVUA 4NXMJ 2YQ0A 3T1HJ 3OTOJ 3EZ5A 2M4MA 1RCXB 4B3SF 4FDFA 2A2CA 3PW2A 4W9QA 4A48A 1Y5LB 2MQQA 1FDBA 1K47A 2XTJP 4FF4A 3O5GA 5KT4A 3WL0A 4USWA 4JI2J 2V2QA 1UJ4A 2HYIB 4Z2XA 3OOBA 4TYOA 2VQFJ 4QIEA 3VAHA 4DR1J 1R0BG 4CNZA 1R0AA 4P10A 3PW4A 4Q5VA 4Y2AA 1Q0NA 4JBCA 3HD1A 3KLVA 5ITHA 1HQUB 3G82B 3MPWA 2RT3A 1HARA 5DZ7A 5J2NB 2GMLA 1S0OA 4OMFG 3CB4A 3D9BA 1ZBWA 2JWNA 1JJHA 4XO0A 3L95X 4DV4J 4NSBA 4DCPB 1JLFB 1LL6A 1HR0J 2Y9HA 2IC3B 4B9NA 5BXJA 2NZ4A 4L75A 1CTNA 4N41A 2IVFB 1VQNS 2ZDPA 4LQ9A 3O5IA 5DITA 1IJFB 5DDPC 1HNXF 5D4PA 3IR6B 3QJPA 3THTA 1LXJA 2VQEJ 2MF9A 1HBUA 5KG1A 5C25A 3D28A 3TEGA 4Z2JA 2IUZA 4M8LA 2ZC3A 4FYDA 3ARWA 3D6HB 1TU0B 3ALGA 2VH7A 2W9BB 5H1SV 3CHFA 3JAMY 1E6VB 5A76A 4CO2A 1RWVB 4AL6A 1RT7B 2YWEA 2RQ4A 1ZS6A 3NOCA 4HVZA 4DDFA 4A8FA 4F3QA 1B64A 2QC3A 3ZNJ1 3RR8A 1PG5B 1W9UA 1ZBCA 2IAJB 1EQ3A 2HHVA 1Z4UA 3MMAA 4B17A 2L08A 3H2UB 5HMYA 2D74B 2V4QA 1CULA 2XP3A 4IFYB 4C2MA 1QVFR 4K59A 1RD6A 2DT3A 1R8CA 3MUTP 1WDTA 2R9LA 3RG6A 2NYHA 4NPOA 3M2RB 3KCEA 3AXKA 2WSFC 1CJKA 1WUUA 4NZ0A 1NPKA 4W9OA 3ISNC 3CF5Q 1J5OB 2ZH6A 2VL1A 4LSLA 5E3CA 2BQUA 1XMOJ 3DLJA 1G1XA 2EFVA 1LG1A 4U8VA 3WD3A 3IG1B 2DR6A 2XCPA 2JZVA 1A6LA 4WXWA 3KADA 3BO3A 5HQLA 2ZH9A 2BE2A 4I7FB 1BC6A 2OPPB 3EXCX 2XYHB 3SDEA 4N8OA 1UWAA 1FO1A 2CQ1A 1HYSA 1BQMB
chains in the Genus database with same CATH topology
4URIA 3I9V9 4DN0A 2ACYA 3MPVA 2PIIA 2RQSA 5CCMA 1NK6A 1IKVA 4HH0A 4Z37A 3DRYA 5EWEA 2LKZA 2KGJA 1N88A 2W25A 1EETB 3AB2B 3G71S 1SL1A 1RT2A 2DRBA 3NL0A 1NZAA 5F3TA 5KFPA 2KFNA 3UQBA 4KTQA 1FRHA 1X0PA 1FVSA 4RBUA 4C11B 2J5AA 2CQHA 3BQ2A 3MM6B 5GAHI 2YKNB 3RM8A 2C3YA 4ERDA 3CD5A 4X4PA 2ILZA 4LGXA 2H9ZA 2PV2A 3KZ7A 2CIMA 2XLJA 4HKQA 1QAJA 1W1PA 4H4KC 4DUYF 5CYJA 4ICLA 3LP0A 5HLFB 1NK5A 2LCWA 1NMWA 4F25A 1DTTA 4I6YA 1HBOA 4JOUA 3CJ0A 1D6OA 1VC6A 4IRDA 2M70A 5JVHQ 1U7LA 1GXUA 1N5TA 1RT4B 4PXBA 3VQSA 4ED8A 4DSLA 2DK2A 1HKMA 2YNIB 3TDBA 5HW6A 2IM1A 1H7XA 2V94A 1X7VA 2XI2A 4OLPA 4I6WA 4WU3A 2DBBA 2B4UA 4TQRA 3IS9B 1FKHA 4J9OA 1S6PB 1FXRA 4O4GA 3K5MA 5KFXA 1W1YA 2OFHX 3S8SA 5D3GA 3ARVA 3OFGA 2MJUA 2GQ2A 3GFHA 3PEJA 5L39A 3BEGB 4FF2A 4ITSA 3OFHA 1HW9A 4DV7F 2YKMB 3IGVA 5KFQA 4PKDB 1KNZA 1Y0HA 4R0XA 1ZOTA 2YQ3A 4DR7F 4U86A 2XMUA 1GPFA 1S6QB 2MQLA 4RNHA 1F9FA 5THWA 2R2UA 3IHZA 4YDXA 2BOPA 5FJ4A 3TC5A 4YHHF 1ZBKA 4ID5A 2UZAA 2B9WA 3AA9A 4GO7X 1JJ2R 1YSJA 2VFUA 4PG5A 2CQPA 2VFRA 3DMJA 2LPVA 1LQ0A 4NYPA 1D7IA 3C8YA 4ED5A 1QUPA 4B3OA 1D3WA 1LW2A 1U6ZA 4C0BA 5I3UB 4Y2KA 1XN9A 2I5JA 4CZCA 4DWSD 5E5NA 5DLGA 1E6NA 2YBUA 3AROA 1YJVA 4B9LA 3QAUA 3SI8A 1M5KC 5HP1B 4ZVHA 1RTIA 1SB6A 2HNDB 3ZZYA 1URRA 2A3EA 2QSWA 4GC7A 3NCQA 4AQYF 4LIRA 1LWEA 1TL4A 1WI6A 1XMBA 3HHLA 5D6GA 1N36F 1WWHA 2M3DA 1IKWA 2KT2A 5K8NA 3CC4S 1TFVA 3B8SA 4I2QA 3AB4B 2E7XA 4MYUA 4X62F 3D5MA 2RNEA 5DJBA 1J4IA 4BDPA 3VAIA 3FMBA 4H4OB 3THVA 3P3DA 3R5AA 3HP6A 5C42A 4WF9Q 3LUOA 3UQIA 1FRIA 2IJFA 3CCZA 2ZE2B 3KAFA 1VQSA 2P6SA 4WKRA 4LF5F 3V6DA 3NLCA 1HQEB 4X4QA 2E9RX 1VGYA 4J9NA 2DSZA 1SIZA 2B9XA 4X4TA 2PBCA 4URGA 3O5LA 2FLPA 2KHDA 4QU7A 4WU2A 3H9RB 3OL8A 3DLGA 4DFPA 1HI0P 3KFWX 4FPRA 2UZ5A 2LMIA 2YNGA 1MU2B 1IKYB 2IYGA 3H20A 4C3LA 1U48A 4ILLA 3GIMA 1U1PA 1VQMS 1VQLS 3FRZA 2AYMA 2DGQA 3JYMA 4OI6A 3PW0A 1T3NA 2WBMA 4JI3F 4A47A 1S1TA 2D3ZA 4JI4F 2OFNA 3KK1A 3PACA 5LT5A 3SQGB 1BD6A 3WQVA 2HLTA 2XSJB 4WFYA 2XNQA 4AXIA 3CC2S 4DL4A 3U1NA 3MD1A 4UOCA 4ZHRB 1YWXA 1HPZA 4C8YA 4RU9A 3M30B 1R27B 2FKEA 3LP1A 1HWLA 2FB0A 2ERRA 1Q8BA 4DIPA 2V4JB 3SCLE 4RNOA 3B9DA 3BXWA 2AX1A 3MFHA 1X9WA 1SH2A 4AY1A 2CDQA 1JX4A 2FVPA 4HI1A 1IBLF 2F9DA 2VPZB 1NK0A 1T05A 2GMHA 3ENQA 4A4JA 4BWJA 4CI0B 4MNMA 3WD1A 1SJ1A 4ALZA 1QM9A 3O3LA 1S72S 2VG5A 2JFKA 2F8EX 1RISA 2YWFA 2ZHOA 3D0IE 4Q45A 2XSFA 2JLGA 1X4AA 1HHTP 4IRKA 3FY1A 3UI3A 3ISZA 4MPKA 2WONA 1VRTA 3HVRA 5EDWA 4DSKA 2CPDA 2YX4A 2OPSB 4XPCA 3N5BA 2HHTA 5AXLA 3D2WA 3QLHB 3IAS9 5LSOA 2R7RA 2F4VF 2XMVA 4DWSA 2DO4A 4RUAA 4ODQA 4DV3F 1JNEA 2R8IA 3FXYA 2EG1A 1YRXA 3I0SA 4ZDNA 3TVZA 3UR0A 2D9OA 3CJ5A 3I0RB 2VOOA 2J9EA 1Q1KA 3FJ2A 1BLUA 1YJUA 2W7AA 3IKGA 4OIXA 4EFAC 3R1LA 4FNHA 2KVIA 1UW4A 1UVLA 2JLEA 2AJ1A 1JLCA 5DM7Q 2VN1A 1RWUA 1VMBA 3DDKA 3TOQA 2KE0A 5HROB 2A3JA 3KHGA 4IT6A 4CO4A 2B7CB 4YB5A 2NSCA 2YNFA 2IMWP 2VG6B 1VQ8S 2QA4G 5LJ5Y 4F4KA 4K4XA 1VC5A 4NRTA 2E1RA 3NNHA 2PPNA 4NZ6A 4XPEA 2COLA 3B9EA 2RSEA 3B4MA 2XS2A 3QGHA 5E0OA 1FXDA 1IXKA 2YWGA 2XMKA 4F26A 2RQKA 4NLSA 2DT1A 1ZYQA 5A8KB 1X9SA 2Q5AA 4DG1B 3IG1A 2UUAF 4DV1F 3C6UA 3V81A 2QT7A 4AYBD 3A1YG 3U02A 2DNHA 3PX0A 1KFWA 2HPUA 2K8IA 3WL1A 3OL9A 2JEFA 3TAQA 1KR4A 5D8HB 5DRKA 2FDNA 3DNCA 1JNZB 2R7SA 3GG0A 1CPZA 4BF8A 3VAGA 2FVQA 4DFMA 2KT3A 4PR6A 3M32B 2CYYA 2GFFA 3RW7A 3T1AA 1K1SA 1C1BB 2GC8A 3LP2A 3RM4A 4TW7A 2ROPA 2HRUA 1SJ4P 4EO6A 1T8EA 3RGCA 2MZTA 4ED6A 4Z2HA 4B3MF 2LA4A 2WCXA 1ZH5A 4DR6F 2D41A 5KFVA 1F40A 4MFBA 3RTVA 3VCDA 2OSRA 3HO1A 2JL9A 5IQQA 3FRYA 3TUJC 2HHQA 5AXMA 2QO3A 1W26A 4R0JA 4F4ZA 1AFJA 4FF3A 2LXUA 2P9EA 3QWUA 3HPOA 5KFUA 3IN5A 2MY7A 1Q8IA 5F9NA 4GGQA 1FNMA 3KHRA 4NLXA 2FAPA 4C97A 2N82B 2GHPA 1H0IA 4WFAQ 2J0SD 3CDAA 4IRCA 3RYLA 3VZIA 4A8XA 5KTQA 1UEUA 1BQNA 4FXDA 3OJUA 1S77D 3DXSX 2R7XA 2HQIA 5J2QA 3NWGA 4CT9A 1KEKA 3KOAA 2GA7A 2OKQA 2G1DA 4QBUA 3N79A 3TRGA 1KHVA 3IC1A 1SIWB 2QE5A 3KLEB 3M8PB 4K50A 3PO4A 5KFAA 3R3TA 1C2PA 4NYZA 2XP7A 3Q23A 2ZZMA 1J2VA 1KFSA 1YI2S 5GAGI 3V4IA 1N4LA 1BGXT 4M5DB 4KSEB 1WG1A 2V0NA 3HFKA 1OSDA 2LU1A 1Y3JA 3MMCB 4KAIA 2K1RB 3KLFA 2XO7A 3RFWA 3QOKA 1KLMB 4QWDA 3PX4A 2V9WA 4S3JA 2DR7A 1U24A 4NWBA 1Q81T 4O44B 1S6PA 4DF8A 4Y2IA 1HNIB 1Y00A 4KIAA 4Q2MA 2D3UA 3FQKA 3OTEA 3GWCA 4PWUA 1S1VA 3MHYA 3I5BA 3TUZC 3LO3A 4JI1F 4K5SA 2EC0A 4PPZA 2FJEB 2XPAA 5CYQB 5CZXA 1QLNA 5IT9Y 1MNEA 2QYCA 3U7JA 4DR5F 4ODLA 3PX6A 4PWDA 2WB1D 1WF2A 3ZZ0A 1LWCA 1S1XB 2L9WA 3FZBA 2UUCF 1OWQA 2FUG9 4ZP7A 4IG3B 5HN0A 5KFBA 1JLEB 2XULA 1LV5A 2J0QD 3GIKA 4ZCKA 3Q22A 4JYSA 3MR2A 1D9FA 3N5FA 3K5PA 4U67Q 4R8UB 2O9OA 3D1HA 5CHCB 2DH9A 5IFMA 1IBMF 5G0RB 5MLCV 1L3UA 1S4FA 2PD1A 4QPTA 1JLBA 3VAFA 1H98A 2FHMA 1FKFA 4F3OA 4H54A 2JEGA 3CUNA 3D54A 2MZSA 3SZ2A 3UW1A 2PA8D 1ZBVA 2KT5A 1F60B 2OP5A 4IR1A 1LG2A 1WEYA 2GJ2A 3C6TA 4P8WA 2CG4A 3UCGA 4QYZJ 1KTQA 1RJJA 3CDUA 2DGSA 3DM2B 1NB7A 4N5SA 2R8GA 1XTZA 5KFOA 2F21A 1U25A 2M7SA 4TYBA 5BYRA 2XGPA 2CQCA 4NOHA 4Z2KA 3N6NA 2IRYA 1HFEL 4H4OA 2ZKTA 2E9TA 2AX0A 5BYSA 4EGLA 1F5CA 3C3LA 3QO9B 4X4RA 1T94A 1LW0A 1FJCA 1RT1B 4H4MB 4YR0A 4DL5A 5KFEA 3EYZA 1NK9A 3BGRB 3FEZA 3J7YU 3D1OA 1OS5A 3I5AA 1HQEA 5HQ8A 1QSYA 4PTMA 1TQLA 4R5EA 5GPGA 3LOUA 3VWSA 1FT8A 4NLRA 3MUVP 2LVWA 1MSWD 4FAPA 2RE1A 1GXTA 1KFDA 1RT6B 2M8HA 2YH0A 3OTOF 2YVSA 2OLWA 2XNRA 3AS1A 5GVQA 1CQMA 4RBTA 5ADZA 2L2SA 2DTJA 2OSQA 4I4BA 3K58A 3LH2S 5L38A 2B6AB 2M5YA 2PE8A 1WF1A 5G4DA 3M9OB 2FJAB 4PCQA 3PZPA 1ZU8A 2R8JA 3PKYA 1K73T 3MMBB 4JI2F 4KQZA 2YX1A 2VFTA 1QE1B 5HMWA 4WE1B 4IFVA 4YB1P 2XG8A 4B9MA 2UV8A