4ZPWR

Structure of unbound mers-cov spike receptor-binding domain (england1 strain).
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
208
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spike glycoprotein
publication title Evaluation of candidate vaccine approaches for MERS-CoV.
pubmed doi rcsb
source organism Human coronavirus emc (isolate united kingdom/h123990006/2012)
molecule tags Viral protein
total genus 57
structure length 208
sequence length 208
chains with identical sequence S
ec nomenclature
pdb deposition date 2015-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4zpwR02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zpwR01
4ZPWR 4KQZA 2GHWA 3SCKE 4ZS6A 3BGFA 4XAKA 3SCLE 4KR0B 4L72B 4L3NA 3D0GE 3SCIE 4QZVB 4ZPTR 5DO2A 2AJFE 3D0HE 4ZPVR 2DD8S 2GHVC 3D0IE 3SCJE
chains in the Genus database with same CATH superfamily
3O5MA 2PGCA 1DQAA 1SUQA 1JLEB 1EYMA 1OYDA 3CMQA 2IJRA 2BJDA 3DLHA 4PAAA 2CQPA 2W9BB 2FKEA 5F8MA 3EDRB 3NNCA 1GXTA 4M63A 2D41A 1Q8BA 4RNOA 2ZOFA 4RKUC 4Z2JA 3ZTQA 1WSVA 3OHBA 4OX6A 3M8ZA 1H2VZ 4J9LA 3KUEA 2OLHA 4TN2A 3UW1A 3CCJS 2D7SA 1Y0OA 3QPIA 4V19X 1HWLA 5KFZA 3O5OA 1S9EB 4RLEA 4LQ9A 1O51A 1NWTA 4F0MA 1QLNA 2GMHA 3KAGA 1RYRA 1KLMB 2OMLA 4ZPAA 2LU2A 5K14B 3N4WA 4Q2LA 2A10A 2HQCA 1DFDA 4L76A 1FT8A 2XMVA 1QZ2A 3OLAA 4WJBA 3OV7A 1N1AA 1F5CA 2DR7A 2WSEC 2XMMA 3PY8A 3QAEA 3AS0A 2IVMA 2CPYA 1WACA 2HWIA 2HBYB 4OIXA 4OYZA 3DGPA 3I32A 2MKJA 4NASA 3NOGA 3HSZA 2GVZB 4A4JA 1VGYA 1S9GB 1HBNB 1IUJA 4DV4F 1PGZA 4CNYA 2DNKA 5IOLA 4RWXA 4X4VA 4O3SA 2DITA 4LF8F 2YX4A 2PV3A 4Q5VA 1I6JA 5D3GB 3CCLS 4WFZA 3D5MA 1Q95G 3V4MA 4RBTA 2H54B 2DVIA 2GIFA 3EJMA 3KK1A 1HQ2A 3DRSB 2EK6A 4W9QA 2FLLA 2MKYA 2EW9A 3S6EA 1VQ9S 4O3PA 1U25A 3FXYA 4EZ6A 4P52A 1HBMA 1UVKA 1E6ZA 4OJ3A 4H4MA 3BGUA 4X64F 3UD3P 3J81j 3SCIE 2BQRA 5DQIA 3HMJG 5GMDA 1R27B 3PW2A 3BO4A 1RD6A 3OLBA 4WJXA 3SQGB 2AW0A 4PYAA 4AL6A 2LEBA 1Y3KA 2MHEA 1RAOA 4HH0A 2BA9A 3AQUA 2Q6CA 4XIUA 1VC6A 2A6MA 5HW6A 4FKYA 4NI2B 3DN9A 4P2SA 4JV0A 1FKRA 2B5JA 4UTGA 2JHEA 3MM8B 1X0PA 4UY85 5HL7Q 2G0IA 4KRWA 1GXUA 1T9XA 2CVIA 2AEJA 4DV1J 2L41A 4DWSB 4X4RA 4C8LA 3H0PA 2J9EA 4ZPVR 1PYSB 1M1KT 4EI2A 4LIRA 2B43A 1MW7A 4M8LA 2EFQA 4K7QA 3HT0A 3U1NA 1N4LA 1NWRA 2ZQSA 1Y9OA 1RYSA 4CT8A 4X4OA 2ZM6J 3KAFA 4DL2A 2R7VA 5C42B 2OGUA 3HJFA 2HBQB 3JB9k 5BR8F 2F4VJ 3H25A 2JOQA 1U6BA 5BXJA 4RW6B 5IT4A 1S1VA 3EIPA 3ARPA 1Y5LB 4PXDA 1NK8A 1N33F 2BJ8A 1SL2A 2QJ3A 2HFOA 4GC6A 3UDEA 5LXRA 1NK7A 2F9JA 1N0UA 1BQNB 3EXCX 5K8MA 5EWFA 3DLLQ 1TV6B 2DG9A 4Y2AA 3N9UC 3PJWA 4LFCF 3VCDA 1ZBWA 3G8QA 3GIRA 3CCES 2KZZA 2DR8A 4LRBA 2HS3A 1Q7LB 3R27A 3MMCA 1JLBB 2V9KA 3QAUA 3NCPA 4DX5A 2PMZD 2YTCA 4CDIA 4ZKAA 2HWHA 2AOSA 4O0NA 3MCMA 3K5LA 4JI8J 2YY3A 2RSQA 1NJXA 3O1LA 2BR0A 1RHKB 1MN7A 3HPOA 4LF5J 4WTOB 1WF1A 5LXYA 2QFIA 3IM9A 2XZDB 2C2ZB 2Z57B 4UOGA 2P9CA 2RH3A 1CC7A 4DPYA 1X4GA 3GG0A 3IHZA 1JLAA 4DV3F 1U1KA 2BE2B 3KTQA 4U7UD 1FFRA 3D6HB 3PW0A 2VPWB 5J2MB 2R7OA 1KHWA 2YKAA 1RAAB 3KK2B 2YH0A 1FE0A 4Y2CA 2CPXA 4YP3A 1J4HA 3DRPB 1HJWA 1N6QA 3PFOA 4KFBA 4M5KA 4NLOA 3TVYA 2HQIA 2MZRA 1RAJA 3AS3A 2HGLA 4JFMA 2CJXB 1UEUA 2ZVIA 2F2DA 2MTLA 5KFDA 1VLOA 2DGSA 3MMAB 3UN2A 2IRYA 4OX9J 2HZVA 1F8AB 1N5SA 3M8YA 4DRKA 2PI5A 4IQCA 3HHLB 3GR0A 4I2PB 2MKSA 1RT2B 4NA2A 1FFWB 2MJUA 4Z2GA 3H59A 2EFPA 4U7UK 2ACMA 3MAAA 4GGQA 2OAUA 3ITHA 1APSA 5KOWA 1KD1T 4R25A 1UVLA 3PYEA 4MKYA 3N0VA 4LIWA 2ZNYA 2DGXA 1EQ3A 3TWZA 2DB1A 5MAOA 3UCGA 4ITZA 3Q8PB 1C1CA 3E3XA 2MQOA 4LAVA 3D1QA 4OZJA 2JWNA 3I4PA 3K0JA 4CYUB 4QIWD 1PKUA 1F2HA 4TY8A 4USTA 3KXDA 1KVKA 2PBCA 2QIFA 4GVBA 2ZHBA 2YQ3A 1C4CA 2QA4G 4ANEA 1DBDA 1ZK6A 2VPXB 4TU9A 2YVSA 2XLIA 1KQFB 2RF2A 3O6QA 2KE0A 4RO0A 1OGGA 4Q43A 4ED7A 2YX1A 2F8EX 4C98A 2CUYA 2HVZA 3QJLA 1Y5IB 3BDPA 3CF5Q 1N5QA 3VVUA 3LF0A 1S1UB 4C8ZA 2AYGA 4ODMA 5AJ3J 4DR3J 4DSIA 1S7HA 3RBDA 3OR1A 4W92B 5H9EK 3M32B 3C14B 1LXNA 4W90B 5JJBA 4J9KA 3EDQB 4ECVA 5HK4A 2H3EB 1FXDA 1FK9B 2ETNA 4M5GA 5B0AA 1ZL1A 2NXNA 1C1BA 1S48A 2APOA 3BREA 2PO4A 4URGA 3V81B 3BEGB 4YY3F 1HNXJ 1WG1A 2DRDA 4X65J 4W9OA 4IT6A 2B9XA 1NSKL 2GVDA 2VASA 2BM0A 2DH8A 5L46A 3ETOA 3T9NA 5C2GA 1MSWD 2YBVA 1FWPA 4U6PA 2R7SA 1HBUA 3ZNJ1 2JEJA 3CEDA 4DQIA 3VAWA 1XR7A 3NTPA 1FRIA 5HBMA 1M90T 3QWUA 2OPQB 2XSJA 4MK8A 3PIOQ 2WK2A 4L72B 2Z30B 1KNZA 1KVJA 3MM5A 2XNRA 1DLOB 2KXNB 1EKSA 2DPEA 4M5NA 3G2XA 1M1GA 1LFPA 2G8ZA 3O5PA 1KQGB 4M95A 3W2VA 4RNFA 5GAGI 4NLXA 4ETXA 2XP3A 3DOMA 1OQ6A 1XMQJ 3B54A 1JQGA 2W7AA 3MCOA 5IWAF 1JXVA 3HHDA 2MB0B 2P6SA 3LH2S 3OXGA 3PW7A 4P2MA 2OI2A 3CJKB 3TZWA 4CLKA 2DRAA 2G0JA 3FFIA 4B3TJ 1BWVA 1G4CA 4UT4A 3UE2A 1MMLA 3QBCA 3CHFA 3JSMA 2X1BA 5J1EA 3I5CA 4IR9A 4DT4A 4G3IA 3BQ0A 1SR0A 2K7KA 3IK8A 4J9VA 1EJ7L 1KRPA 1ZETA 3GSIA 4QCLA 3WC2A 2FQQB 4DMZA 1P9QC 2VONA 2CJBA 1U1LA 5D0EA 3G96A 1KLNA 1F2GA 4M5DA 3OBIA 1TAUA 4U86A 3QO9A 2CQ1A 2W4PA 3E51A 2DGQA 3CJQA 5EX0A 2Z8QA 1RHJB 3MM7A 4ZJOA 2WVEA 4RPFA 3DC2A 4I7FA 3CD6S 5B0BA 2XMJA 3SZ2A 3WD2A 2HS0A 5T7LB 1YRTA 2YH1A 1L1PA 4KH0B 8RUCA 4IRCA 8AT1B 3VAJA 3KK1B 3UWTA 3IWNC 3R5GA 3U27A 3BH7B 3KMSA 3MEKA 4R5PA 1HFEL 1HBMB 5J1PA 3IR6B 1HJXA 2M5YA 3AQOA 1XHGA 3IFEA 3R2CJ 4QWEA 4I64A 2XHWA 3Q8YA 5DRKA 5KG0A 1QDUB 4QYRA 3PHEA 4EMDA 4DV0J 3K5MA 4KGKA 4XTTA 5IS2A 1CVJA 5KFGA 3SSRA 2OFNA 3NAIA 3UQSA 1FVSA 4DG1A 3BBBA 4P73A 4LAXA 4QR2A 5FD1A 4MGVA 3CHDA 2XP4A 2KHCA 1B7FA 1TFYA 2LECA 1X6LA 4KKOB 3IR7B 4WCEQ 1SCJB 1U45A 1T7PA 1FFSB 2FZCB 3WIVA 2PE8A 1NH6A 1K44A 4QPTA 5KFBA 4U7CA 3JXVA 4PR6A 1D6OA 3FK4A 4FS1A 3DLGA 5D4LA 4A8FA 3LA0A 1FKHA 4OZLA 1U6FA 2DHHA 2SXLA 2ZH1A 1ZBVA 1FKGA 1N5YA 4ZP7A 3WQVA 1S1VB 2FJWA 1LL7A 1ZM4A 2ZKUA 2QL5B 4DCPB 2I9SA 1JJHA 5DLGA 3IN5A 2VC0A 3G6XA 1LFWA 3CCSS 3MR7A 5D0GA 5I3PA 4J5OA 1NEEA 2CQ4A 3Q8SB 2QMWA 3SQOP 2B0GA 4ZVRB 1VC0A 3K2YA 4K2XA 1LOUA 1IR0A 3CTRA 4C3LA 5E3AA 4DRHA 2LQJA 5CH7B 3W66A 6FDRA 3DRRA 1U79A 2LKNA 3M8RA 3A3NB 5JMNA 1S79A 3TYTA 1RAFB 5IFMA 2OJ3A 2EVZA 2YQ1A 2GAGC 4ZITA 4DL3A 1T95A 5DITA 3BDEA 1SJFA 3F41A 3OR2A 1P1LA 3E8OA 2M0GB 4B9SA 3DFEA 5KFFA 1ZA1B 3KHLA 1NLKL 3LGHA 2HVEA 1P27B 2HNDA 2K2PA 2JVOA 3Q2TC 2XYPB 1SVDA 3EICA 4I69A 2YWFA 3RG6A 1RBLA 4NLTA 5IV4A 3WIUA 2Z0GA 3THVA 5D0RA 4IR1A 1AFJA 2MF9A 3KDNA 1V6HA 1OWXA 1UEKA 4KFBB 1PIEA 4F0HA 3UNGC 1UCNA 2UUCJ 1VJQA 4B3OA 3MEDA 5E3PA 2R2TA 4FPRA 2M08A 1DAXA 1J4RA 3CJRA 2R2RA 1Q4RA 4AQYJ 2FHKA 3ELHA 4URSA 3SIPB 2MKIA 2MLXA 2VU5A 2YWGA 2B6AA 2XY7A 2WVFA 4OJ1A 5G4DA 3KLGB 2PI6A 5KG7A 3WD1A 3JYMA 2HLUA 5KFOA 1RU1A 4DU7A 2YKNB 5IQQA 3K5OA 3V5RA 5GAHU 4LFAJ 4DV6F 3BZQA 1IWAA 2VCDA 5ETKA 4W9PA 5JVHQ 4M5MA 1UMJA 4JI3F 2VF3A 2BQUA 3MAAB 3C19A 1NCLA 2CPEA 1EDQA 4Y2IA 3ITHB 4NSBA 1RT3B 2B9WA 5CD4A 4MMOA 2O1PA 3CCVS 4DUZF 3SSSA 2ZJRQ 2FZKB 3HHNB 2HHPA 4IFVA 5DDOC 2NXJA 2M4MA 1C1CB 4ZIVA 3MTKA 2XPAA 2I5JA 1H0GA 3M1VA 3WQPA 2X1GA 1U0HA 2B8PA 2X3DA 4K4YA 2XC9A 1S4FA 2N4CA 4GO5X 4AUKA 2WM0A 1O6IA 4DH0A 4HI1A 4B9LA 1ITPA 4TY8B 2F1FA 1RT5B 3UFCX 1S1TA 3OFHA 4E98A 4ELUA 4DPOA 1W1PA 2PMHA 1FRHA 1T0TV 2ASDA 4TQSA 2VFTA 1REVA 1TAQA 3HSGA 4NCGA 9RUBA 3E2EA 1U8WA 4MNJA 1NPKA 2K7JA 3OTOJ 3IR5B 5E3QA 1X4AA 1SJRA 3SDEA 2ATCB 1ACMB 1PO6A 1R3NA 4I56A 1OQ3A 2CPIA 5L9XA 1YBTA 2J7UA 4JBCA 2B51A 1S49A 4G50A 2LGOA 2R8IA 4KR0B 3K57A 1K9MT 1HWUA 2HNZA 3GE9A 3MMJA 1VQYA 1C0UA 1UVMA 3JYTB 1XIQA 1D7HA 4Q8FA 5KFQA 2DG4A 1C1BB 3FEZA 1QAIA 1SJ1A 3W62A 4QIVA 4F4ZA 1FE4A 4DR7J 2K8IA 3CDAA 2JLEA 4USUA 3GSDA 3MGJA 1MU2A 1GX6A 2GVDB 2KI2A 5GADI 1U2CA 3QGHA 1QTNB 2BRLA 1HBUB 1VDHA 4N77A 1QAYA 3IXQA 1U1MA 2DO0A 4WK3A 4JI7F 5HBMB 1I51B 4OJGA 1EHNA 3EMTA 4F3QA 1SIZA 3L95X 1A6LA 4O4RA 4EU0A 2ZNZA 2XI3A 3VF0B 1NKBA 4MKVA 3LW5C 2KFNA 2Y1JA 3RRKA 2W9CB 2RKIA 2R4FA 3DOMB 2ZH6A 2ZKTA 3IG1A 5ETVA 2CXEA 3RFWA 1Q8KA 3DLEA 1S10A 1TVRA 1CLFA 1M5YA 1M0SA 1JJ2R 1PJ7A 2DCLA 1O8BA 4Y34A 1WC6A 2OPPA 3U7JA 1VBZA 4LREA 3SMZA 2Q79A 3RUBL 2C2DA 2JFKA 4IOCQ 2IVFB 3GYXB 2LEAA 2FVCA 1PJ6A 1UFLA 2ATLA 4MK7A 3JSMB 1R8BA 4FXWA 1G2EA 5J1EB 2RJZA 4P8VA 1TU0B 2Q3PA 3D1OA 5CABA 1RT6B 1ICEB 5AXLA 5E3CA 3QRRA 1ROFA 2PN0A 4ZVFA 2XPBA 1X4BA 1PINA 2WLYA 3V6DA 4M5DB 1M5OC 3PNIA 3KLFB 3QO9B 1DURA 1HNIA 1T3OA 2VFSA 1N48A 3MM7B 4RWWA 4X62F 4ODQA 2J0XA 3M2VA 3NI6A 4I7FB 4FBUA 1RACB 1R8CA 3O5DA 4I67A 1JXLA 3CCTA 5I3QA 1AROP 3PEJA 2WOMA 5IC4B 5A6PA 1ELOA 2ILZA 2ERRA 2NZ4A 1PG5B 1FEEA 4RW9A 3AS2A 5KT6A 3MR5A 3CCWA 3O5FA 4RX6A 1LXJA 2AKWB 2YNIA 1Y0HA 1S0OA 2CPFA 4C11B 7FD1A 1W1YA 1TKTA 2LXUA 2BJEA 3L7UA 4Z7CA 1AXQA 2HIYA 1EZZB 2DH7A 2NUUG 4NLVA 5KFPA 4AD6A 3QGGA 2DXFA 4DUYF 2BE9B 4ITSA 4ZVQB 4PRFA 4DG1B 3N6NA 3D68A 3BO2A 2VHGA 3IBFB 4NZ6A 4OL8A 1NJZA 2AGOA 1SH2A 1HQUB 1UP1A 3C15A 1JX4A 3MECA 2B31A 2AJ1A 5BYQA 4MFBB 4YMEA 3WD0A 4OZ2A 2NYIA 3W61A 2JSXA 4N8NA 1RWPB 1CG2A 1FERA 4FS2A 2AT1B 2ZD1A 1F9FA 1OY9A 2J9CA 3DLGB 3A12A 3TQ1A 1HHTP 4YB1P 2WVBA 3ICLA 3CH9A 3DDNA 3EGVA 4ZIWA 2A6OA 4PUOA 3H7HB 4ZVTB 2E1PA 2ZC4A 1SBRA 4QT3A 3VQTA 2DNHA 2HW3A 3CJSA 1CS4A 3TOQA 5EWEA 4UDMA 5K5MA 5ETLA 2RQMA 1NDLA 7AT1B 2QL9B 3EUNA 2JEIA 2W25A 5GAEI 2KL8A 2LXFA 1QVGR 3J7AN 3PX0A 2MQMA 2KRRA 5F0UA 2EEYA 1MWYA 3VVTA 4DJBA 3DRRB 4XK8C 2CJ9A 4J9RA 5L39A 3BSNA 2CQDA 2R7XA 5CHCB 2YKQA 5E41A 1WOSA 4Z7YA 3ALGA 3HF5A 1IWGA 3KG0A 1SB6A 4J9MA 4JI2F 4G6VB 5G0RA 3CD0A 4I2QB 4ODPA 3OR2B 2YXLA 3BXWA 5B8IC 3R5CA 1D7IA 3S1TA 1N8RT 1CEZA 1J27A 4ODRA 4TU8A 3ZTRA 3ZZUA 2HNDB 2XGPA 1J5EJ 3M8QA 2NLWA 1LK5A 2LYVA 2FVSA 4ECXA 1HW8A 1JKHA 1OS5A 1XR6A 2U2FA 1UR9A 4USIA 2E66A 4O4GA 4ECSA 3O44A 1RJJA 3H4DA 5L38A 4DX8H 3JQKA 3BH6B 3P5TL 3SBMA 1L3UA 1WG4A 3WX8A 3FBFA 2BV3A 5ETMA 3BN4A 2E5LJ 5LMUF 1N54B 4ZK7M 4B3OB 2VDHA 2HGNA 3MEDB 3FKBA 4WFNQ 4WZMA 3UQBA 4HEA9 2XZTB 4GVLA 3IBWA 1T9WA 4WIIA 1FKDA 1RK8A 5I42A 4DR5F 2RIJA 4J9UE 2EKYA 2B6AB 1P1TA 1FRMA 1VQKS 2IUZA 2GS8A 3I6CA 2ESCA 3VZIA 3CSKA 3IMQJ 4P75A 4PWWA 2N87A 3MPUB 2ASLA 1FO1A 1XR5A 4Q44A 4EYHB 2GZOA 2H5JB 5L9NA 3R1LA 1U2RA 3PX4A 2ZQVA 4DV2J 4FBTA 2ADCA 3KKFA 5LSLA 2FJAB 3W5YA 4Q0BA 2AGPA 3QATA 4JI5J 3GU0A 2YNHA 2IPOB 4WP3A 2NPIA 3G9CA 4OV1A 2V2KA 2WSCC 5DO2A 3ONQA 1AUSL 1R0AA 4F4XA 2YKMA 4DCJB 1N88A 2DTJA 3HP6A 3RR7A 1E6YB 2KH9A 4JYSA 4IFVB 4ZLPA 3EZ5A 2PPNA 5DDPC 3IRWP 2V63A 1BUXA 1E6NA 4J9PA 5HMYA 5FLXU 4OHYA 4NXMJ 2NXUA 3OSPA 2VBYA 3M1VB 2XMAA 3CJ8A 1U0HB 1EETA 3QT5A 1J2VA 3T5LA 2DHGA 5FJ4A 8ATCB 2HQGA 3DMJA 4KV8A 3JQJA 1X6NA 3MTJA 1YITS 1S6OA 1WEYA 1S1TB 4ED0A 3RW7A 4H4KA 4CCHA 4GKJF 2CNKB 5HBFA 5K8PA 4CP5A 3BPSP 1OWQA 2DD8S 4NCGB 1X7VA 2DPJA 5C24B 1WDTA 2XY6A 1RWKB 1ZTTA 1TP7A 4ES1A 3W5XA 2GQCA 2VJVA 2HPUA 3O3LA 3QYYA 4NLUA 4DR6J 4W4MA 2NCKL 2EKNA 3SSQA 3J7Z5 4PYDA 3SDEB 2DSUA 3BM7A 3B8SA 3HHEA 2VFRA 3AH6A 1LJYA 4DL4A 4NE9C 2RQ4A 5AT1B 2XP8A 5J2QA 3OW2R 2UUWA 4I6AA 4CO3A 1RB0A 3RGIA 1C0UB 3CCMS 2XG8A 2FGOA 4LF8J 3TVKA 4A48A 1HNWF 1YJ7A 2RUQA 2BANA 4DV5J 1TMMA 3I0RA 4X66F 4MT1A 2J8AA 3CCZA 5AE2A 2ZZNA 4ZA1A 1EB0A 3ZFVA 2W2PP 3BV8A 3CVKA 2WB4A 3JYJA 3OXLA 4NOHA 1NAQA 3IRXA 4I1TA 1ULRA 3M30A 3V4IA 3WD4A 2AX0A 3ZZRA 1KSPA 3CC7S 3NMAA 2PN6A 4ZJLA 2Q66A 1BC6A 2WW4A 4FNIA 4KHMA 4NA1A 1S5ZA 4WU2A 1WKJA 3DOKA 3TCZA 4NMXA 4KGVB 3FCHA 5KFYA 1HW9A 5D4PA 3ET6A 4QU7A 2KKHA 1GPFA 1VQMS 3H20A 2DSWA 4LFBJ 4EWTA 2C3OA 3DLEB 3K17A 4ZHRA 3K5PA 3OA5A 2AF6A 3R7SB 1VI7A 3GZ7A 2DNGA 4YR0A 5IM0A 2IF4A 4CQ1A 3LP1A 2BDPA 2OEMA 2OPPB 4PWDA 4N41A 3PKMA 1VBYA 2DHXA 4L3NA 2Q1LA 2RHQB 5B0CA 2GGPB 4C48A 5K8NA 2HK2A 2W24A 3G6MA 3MDFA 2N3OA 3VAMA 3NCRA 3GPKA 3DM2A 2Z2LA 1NZ8A 2EBEA 1VRTB 3QQCD 2AX1A 2WBMA 1YKWA 4NL5A 2ZWPA 1S6QA 2VQEF 3J7YU 4HDHA 2D9OA 3CMAS 3UCUP 2GHVC 4JI4J 1T05A 3O5QA 4DV7F 3V6DB 1RZMA 2XLKA 5B7WA 4X4NA 2A3AA 5HATA 4C8NA 2HYIB 4ZPCA 1HNIB 4LFCJ 3CC4S 2V68A 3DLKA 3M2VB 4NYPA 3J81U 2XO6A 4XPEA 1NK9A 3AODA 1V3ZA 3FRZA 2UXDF 1A7GE 1G7CB 3OJSA 2DT1A 2WOMB 3MEEA 1U24A 4B3MJ 4E0DA 4D3GA 2ZBIA 4HI2A 2YNIB 1D8YA 2B7BB 6AT1B 2E1MC 5I3UA 3IS9A 1XMOF 1WUUA 2QX0A 4ECYA 4DRJA 2LLZA 1REGX 1KN6A 1WTFA 3MAHA 4KJIA 4DRPA 2A3EA 3ZZZA 1S77D 1TKDA 4EFAC 2RDJA 4IDKA 1IBMF 3VGSA 3PKYA 3ZTOA 3A1YG 4DEZA 5F8GA 4OZ1A 1P9YA 3CJ3A 1ZM9A 2HVHA 2OEJA 2J6SA 1UVJA 1JLQA 5L1LA 4RU9A 4F4KA 3F44A 1YRXA 2Z2YB 4Y00A 3MXHP 2IAJA 4ZP9A 2ZD1B 5SUHA 2B56A 4UOHA 1H98A 1Q79A 2ZDPA 2DNRA 4ECTA 4K4ZA 4LRCA 1RWVB 3J80Y 2RURA 5DG8A 4PUOB 2G4BA 3D66A 1Q6HA 1UFWA 4YB5A 3FJ2A 3EGNA 4K2JA 2FJVA 4G1QB 1NB7A 2BXJA 2KJVA 1LEOA 2J9DE 3MURP 4GIVA 2QF8A 2OTJS 2QYCA 1TUGB 4AT1B 5IV3A 4ZPDA 2YX7A 1U1NA 1CJUA 2MPHA 1S1XA 3NLCA 1Y11A 4DQSA 5E33A 4U85A 4KIAA 1KHVA 1S57A 1MWQA 1VIXA 1LV5A 1UETA 2H5EA 2EBGA 1SPBP 3UVJA 1IKWA 5F8HA 1HA1A 4F2SA 1CSJA 3OL8A 1TL3A 1BY9A 2LXIA 2ALYB 5G0RB 2XNQA 5FDLA 5L1IA 2DY1A 2MNTA 5F41A 3MPWA 1LWCB 2IDLA 5C7PA 1N32F 2GA7A 4DSKA 4GC7A 3I6PA 4LVNP 2O66A 3TAQA 2L08A 1TKZA 1U1QA 1TZ0A 1JKHB 2OD4A 1HPZB 4IO1A 1PC4A 4O4GB 2A3JA 3HI9A 4ATNA 4K8RA 3VV2B 3GG1A 1O5JA 2GNKA 4IO9Q 3OL6A 3CHCA 1WI6A 5KFMA 2FDNA 3H2UB 2PD1A 2ZFHA 4FVCA 5LL6d 3SEOA 4QIFA 3J7YI 3PV8A 2ZQTA 2RU9A 1WEXA 3OTBA 4R8UA 5KFJA 2KG0A 4HT7A 2Y8YA 1F40A 3C16A 2XMUA 2OO4A 2JJ4D 2Y78A 2VL1A 3MHYA 2Y1LB 3DU6A 2AP6A 5I42B 1J5OA 4WWSA 2P5VA 2P9EA 2WVDA 2PFDA 4DHVA 1HKMA 1M5PC 3HD1A 1RA7A 3MM6B 3KJQB 5JVGQ 4LBHA 1YJUA 2XWXA 1NJIT 2H9ZA 4UW2A 3G8TA 3MOZA 1BL4A 4ICLA 2CQ0A 5BYSA 3HVRA 4B08A 3KLIA 4Y65A 1URNA 1NJYA 2KO1A 3NGDA 2AYBA 4C0BA 4FYYB 5KT3A 2F40A 1Q5VA 1F5AA 3NXZA 4ID8A 4ETZA 1E44A 2MHNA 3X3UA 2BVZA 4RW8A 4R0JA 2BMBA 1X60A 1R0AB 4DV1F 2I2YA 1R8AA 2YKMB 2VFUA 4M1KA 3C2PA 2A3BA 4YOEA 3KLHA 1HYSA 1CTNA 7FDRA 3H5XA 2NZCA 3UI4A 1ZOTA 5IC6B 4CNZA 2FIUA 3H2LA 2ZM6F 5GMEA 3I9V9 1RWOB 1EETB 1B6CA 2F4VF 3R8YA 1QY7A 1FD9A 3HKZD 5AE3A 2R3VA 3DMJB 3FGVA 4F4AA 3IM8A 5IWAJ 3TX8A 3AXKA 2ZJQQ 3V2UC 2AJQA 4DSFA 1LQ0A 3N5BA 1M5HA 3MR6A 1T03B 1RHRB 4OI6A 4YQWA 2RRNA 2G41A 1VCTA 3AXMA 3M05A 3MD3A 2OPSA 3EZUA 4USWA 4NLSA 3W63A 5ETNA 4OYWA 1SC1B 1TFVA 4QT2A 4FP9A 4BDPA 2G2OA 3R6GB 2C2MB 3RYLA 1FWKA 1IQTA 5HKGA 1RLCL 1D3WA 1XQIA 4PQUA 2H48B 4WK9A 2ZZTA 1VQ7S 3W60A 5J2QB 4LBIA 4XDDA 1VJWA 1ZZFA 4JI8F 3EPGA 4P9SA 2V6AA 3W8PA 4HHUA 4ED5A 2RE1A 1VQOS 3D9BA 4LF5F 4A8YA 1YIJS 1FKPB 2W7OA 3FAPA 3ADAC 2G0CA 5AXMA 1HI8A 1HQEA 3LQVA 1CJKA 2BANB 3CDBA 1RT1A 3PR9A 4HBOA 4P8XA 1RTJA 2HFUA 1I5OB 3CNQP 4D3HA 3CGNA 3EVMA 2QO3A 1YZ7A 4JV5J 4JYAJ 1NJWA 4AY1A 3MUVP 3M7VA 3IRXB 2XULA 4DWIA 2ZE2B 4LJMA 4CO5A 1FKFA 1UWBA 4FNHA 3V4IB 2EC0A 4CTAB 3PYFA 1IR1A 4O3RA 3LGNA 2F8MA 4LF4F 5FIIA 5ETOA 3N79A 1IR2A 1F9HA 4BF8A 1Y7PA 5DIVA 4FF1A 1YI2S 1UVIA 2QA1A 3DOKB 4LBPA 1FDAA 1VK3A 4OX9F 2A2CA 3ET6B 5LM7E 3VWSA 5M2PA 2R7QA 5IT9U 1EKRA 3JTPA 2LDYA 1UA0A 2GCFA 5IM0B 2RB7A 2EWHA 1YTYA 3MM9A 2EK1A 4O2TA 1AZSA 4PWDB 2ASJA 4DLGA 4K5SA 4Y2MA 5J2PA 3A13A 1ZBTA 2FHMA 4KQZA 3EVWA 3LUYA 5F8JA 1JVWA 3FNNA 4V1Ak 5F0WA 4F04B 1JCHB 2CKWA 3DM2B 1RBAA 4FXVA 1FF2A 3KG4A 1SKWA 4QJVA 4IRDA 1S6QB 2VG7A 4H4OA 1LG2A 3EYZA 2J9DA 2M3DA 1T05B 2FVQA 2BOAA 3O2IA 4ED6A 3FMWA 2JH3A 5C5JA 3JTNA 3PIPQ 3IP0A 2WSFC 1VHIA 3IBCB 1PSDA 1RWUA 1RBOB 2RS2A 1RHUB 4Y2KA 2P6TA 3C6TA 4ZCKA 1L3SA 1F1BB 4OMFG 3KJVA 3DLKB 1Y5NB 1FNXH 1VBKA 2M70A 1FEHA 4TYAA 5D78A 4WTYA 3A8IA 5CYMA 3M2RA 4HYKA 4ED2A 1QPLA 3MEEB 1B99A 3Q8QB 2CVEA 4CO0A 3BSAA 1UZDA 2LCWA 3GJSB 4WFXA 4EO8A 3T9ZA 5HQ8A 3LPEA 1XNRJ 5KFSA 3NP5A 3IS9B 5AJ3F 1X9SA 4DR3F 3CMES 3MUTP 3KUGA 4A8SA 5AXNA 2FVPA 1IJFB 3I5BA 3UI6A 2DNNA 3PACA 2Y3YA 2AJFE 1K1SA 2UXBJ 2F8HA 3A3PB 3G87A 5H1SV 1Z4UA 2OFHX 3UN3A 1TUWA 4WKAA 4RUCA 1F3FA 1RA6A 4P6QA 4Z2IA 4LF7J 4YR3A 1CC8A 1JLQB 4X65F 2WHOA 3M4XA 3K8VA 3FCWA 3NS5A 4MNLA 2DR5A 3OT9A 3ARSA 2DYAA 1UKUA 3UD5A 1D0EA 4NRTA 2HGMA 1F9EB 1RT7B 4J9QA 1O6XA 3S8SA 2MQLA 3FMBA 4G65A 4FYWB 2IM3A 4C6AA 1SKRA 2AEMA 3O5RA 3KNGA 2BKPA 2AQ4A 3M9NB 3T41A 2C3YA 3HSJA 2MY8A 4TLQA 2DNMA 4J9NA 1VQ8S 1FKOA 2IA0A 2YWWA 3MR2A 4QYZK 2XP6A 1KT1A 3MD1A 3VAGA 1CJUB 1XMQF 3PFEA 2X1FA 1S1XB 3IWLA 2X3GA 4OYXA 3AS1A 3Q83A 4R0XA 2MLZA 4PG5A 3A4TA 4BC9A 5HLFA 4OYIA 3ZTPA 2O67A 3DKDA 4A8MP 1CJTA 3E01B 2E1RA 2QSWA 2MKKA 2JC0A 3UVJB 4ZLNA 1NXIA 1OY8A 2CJQA 4B3TF 4ECRA 1X5TA 1X9MA 1FKJA 1VQLS 1ZBKA 5T14A 2VOOA 1X31C 4HHHA 4WPAA 1YGYA 4KH1B 3ALFA 2O3DA 1U2FA 2R7TA 1BQXA 1HWKA 4RW4A 1AW0A 4XDCA 2VKRA 2W8KA 2QA4S 1MWZA 2XYGB 2LPVA 1NHVA 1Y00A 4C0OC 1TKZB 3AFGA 5HMWA 1YRUA 5F3ZA 3QSYB 2LA4A 3B82A 3AD7C 3DDIA 4S3JA 4RR5A 3TJ9A 4NXNJ 3O5KA 3OD2A 2VG5A 1KTQA 3EGZA 3Q23A 3PYDA 1YX2A 4K50A 1K0TA 5HWCA 2BUNA 3PJ9A 4B3SJ 3H8YA 3RAQA 5HI7A 2B4UA 3BSCA 3DU5A 3DHWC 4WP8A 4Q8EA 3ARRA 3C16B 2CNLB 4WFYA 5A76A 4KPYA 2V4JA 4OYMA 4F3OA 1FKAF 4YB7A 2FJDB 4MH8A 5H9FK 3MFIA 2A18A 3MAQA 4C3MA 4LR9A 2B7CB 1TKXB 3AD8C 1RKJA 4CH0S 1S6UA 1RKIA 3MOJB 4CM2A 4DV0F 3NS7B 4EK2A 2C28A 4RBVA 4KC5A 4A8WA 4OHWA 2D3OR 1TL1A 2C1EB 2FHJD 5A8RA 1CPZA 3UPFA 1OSDA 1R43A 3R7BB 3AY0A 2YPZA 1N0VC 4I6YA 2Y0SD 2H1YA 5CD4H 4JI7J 1GH8A 3OUYB 4RW8B 2QFJA 3TANA 1FKLA 1YSJA 3UI3A 1Y10A 5JH8A 1WC1A 3NAHA 1VR6A 3LP0B 1TR0A 3BBFA 3KLHB 1HYSB 2CWKA 4IRKA 3TO8A 2L2SA 1CBKA 1WTBA 4RNMA 3HVWA 1FJGJ 1D7JA 4C0HA 2AZ3A 1T8EA 3I0SA 2IDEA 2A2DA 1VBXA 2VB6A 1F6TA 3TP2A 3OHAA 2J8SA 5HN0A 3W8GA 4TU7A 2E5JA 2LQ5A 2J76E 3KABA 1TFWA 2NXCA 4DL0C 2QRRA 1F0XA 2KT5A 3NGSA 2OELA 3VALA 2VKZG 4DWSD 3U02A 5J2NA 4TQRA 4P2FA 2OPSB 1JB0C 2FDMA 3F56A 4CLSA 2M52A 4ELTA 1WG5A 2C2RA 1MMDA 3ULHA 2ZJPQ 3FDSA 1N34J 4LF6J 4DIPA 2KFZA 3PHTA 5CQGA 4MSPA 2PA8D 2BQ3A 1N52B 2XCAA 5B0FA 1WKLA 1E6VA 1NNDA 3CIZA 1IJEB 4PQUB 2GHPA 1FKBA 3CJTA 4QIGA 1U1RA 2KO7A 3NG8A 2F4FA 2P4VA 1WHYA 2HURA 2IHR1 3C46A 4KPCA 2YQ0A 3B78A 3RAXA 3QWPA 1LWEA 1HNZJ 3P45B 3POTA 3R5AA 3WL1A 1FJEB 1QE1A 3CJ2A 1DZ5A 1DJ0A 1CJKB 3FRYA 4FN2A 3UDCA 1RT4B 2J7KA 2VUGA 1RWXB 2MY7A 3BKFA 4ECWA 2DEIA 2NPFA 5GAGU 2QMXA 3I96A 4CLTA 3DGVA 1ITXA 2XS5A 5GPGA 2VODA 2OHDA 2XMWA 1QM9A 4DDFA 1UWBB 4ZVEA 2F63A 5A8KA 2UUCF 1F5BA 2YPYA 1UR8A 4QWDA 4NNRA 3ARZA 1JLFA 1WC4A 1WC0A 3HULA 3PCOB 2EXUA 2XTJP 4OZ5A 3DOLA 3RBXA 4AQYF 3K89A 1S6PA 2K8GA 2XGQA 2C2EA 3D2WA 3D54A 1KFSA 1ZZNA 5BXIA 4KE5A 2L9DA 2OSRA 3BR8A 4ZCLA 5HVFA 3HO1A 2QSFA 3PRBA 1KWMA 4RL1A 2ZZMA 2DIUA 1JLCB 2HFNA 3VHQA 4MNKA 3L4BC 2HAIA 4LFAF 3MM9B 2HHQA 1AZSB 4CLZA 1ZA2B 1ZB5A 1RAEB 3NWRA 2MGZA 4B9TA 5J2PB 4RBUA 4GRSA 2UXCJ 1LW2A 4B17A 4HTIA 1DY3A 5ETTA 1FWLA 4OZ3A 2HHSA 1VF8A 4USMA 2VG7B 4H4OB 3GJQB 4WKFA 1NDPA 1B0PA 1WF0A 2V2ZA 3ZC4A 2QEXS 3GLJA 4YUDA 3JQMA 3QSIA 4B9UA 2QLJB 1IBCB 4YDXA 1BQMA 1TELA 2MMYA 3W7BA 4U8YA 5AXKA 3C6TB 3EXYA 4AFFA 4MKAA 3RM4A 3ARWA 4NRUA 4PG8A 1ZAXA 2D3UA 3DRYA 5DZ6A 4KGMA 4A8KA 4N5SA 5HTGA 1TL7B 3DHXA 1RTIA 2LKZA 2XB2D 2RT3A 1KLMA 1Q82T 2RS8A 2UUAJ 1FA0A 2VQFJ 1MMNA 2DIVA 1A7XA 2R7RA 1U49A 2HBRB 2WCXA 3GTYX 3OTOF 4TW8A 4NLRA 1S0MA 1DTQB 2Y1IA 1DRZA 2H5IB 2FGCA 3QT8A 1F60B 4JI1J 3D7SB 2N3LA 2QV6A 2PEBA 2WAQD 4ALZA 1H2TZ 2YKPA 4EBEA 1PCAA 3TVZA 4QZVB 5LT5A 4L3KA 3OTEA 3OFEA 2XSFA 4XO0A 5D6GA 4U84A 4DR7F 5D3GA 3EVOA 2V67A 4KSEB 2FHJA 3O5IA 2IC3A 1BWEA 2WK4A 2RMLA 4ED3A 3TR5A 1RAIB 3FZBA 2AGQA 2F23A 2E1CA 3NNHA 1ROTA 3ZXWA 1NDCA 1S59A 1OO0B 1Z1ZA 1RHMB 1U6ZA 3H40A 4O3QA 1IKYB 2A3CA 3BGOP 3CXCR 2F65A 1SUQB 3D6FB 3ZO7A 3US5A 4K59A 1FX2A 1M5KC 2VPZB 2EFOA 4IFYA 1X0FA 1RAHB 1X5PA 4V19J 2HLTA 4LRFA 3TI0A 2QLXA 3A8EA 3B4MA 2HVIA 3MM8A 1HMVA 1FDDA 5HVHA 3CO0P 2M7SA 4DWSA 1VFJA 2JRSA 1CJTB 4ZP8A 4USHA 2HQ3A 2FHOB 4A47A 2DNLA 1HKKA 4BWMA 1U0SA 4H54A 4OQJA 2N82B 1GUVA 1GNKA 1G3OA 4DPWA 1N36J 3IAS9 4WXOA 4RW6A 1KDNA 1QUVA 2BJ9A 3AHPA 2D9PA 3D4JA 2M8HA 3CDUA 1FAPA 2W2MP 2VG6A 3GFHA 3QT7A 3BQ1A 1HR0F 3DGPB 2QZ8A 3OFGA 4RW4B 2R2UA 4OI4A 4LGXA 3M8WA 3TA1A 4Z2LA 1SKSA 5B08A 1GTEA 1YDLA 4Z37A 3RR8A 2XO7A 2PPOA 4MJKA 3GIIA 4AXIA 2C3UA 4YFUA 3SFGA 4K0KJ 2VG5B 1NH8A 2LQ8A 5DLFA 3A8KA 2CWXA 2FVRA 4WP9A 5KFHA 4PCQA 2C3PA 5EHHA 1E9LA 1HWIA 3VGUA 2V4JB 3D67A 4P7VA 2R2SA 2LMIA 2GJIA 2B4PA 2P8IA 4H4MB 3TUZC 4OV6A 4KB7A 4NLWA 4QU6A 3T1YJ 3ILOA 3HX9A 4QR0A 1FJDA 3RGCA 3KLVA 1Q0NA 1QUPA 1RABB 3FQKA 4DR2J 5LSOA 4X66J 3RTVA 5J2MA 2DHAA 1TL1B 3LAKA 5KFXA 2KTQA 3WIJA 3DRPA 2NREA 1GMUA 4Y3CA 1IBLJ 1WD6A 2W8LA 2DGTA 1R7IA 2G2ZA 4XAKA 5HQMA 2B5JB 4BBYA 2HHHF 3I56S 2IJFA 1K8AT 1IBKJ 2ZVSA 5J6EA 3HFVA 4OYPA 2KDOA 2R8KA 4PXCA 3U1MA 3WC0A 3PW5A 1WOOA 5KG5A 3MPDA 2HFSA 3F0NA 3OFFA 2C42A 2X51A 2IBKA 1RCOB 2DH9A 3MMAA 3I0SB 3FSXA 1RCXB 4WFAQ 4CLUA 2W1BA 1FJCA 3D0IE 5U47A 3MCNA 1R9HA 3RB0A 1OY6A 2KJWA 4I2PA 1I94J 4ZOSA 1MROA 4Y28C 2F9DA 4ED4A 4WKRA 3R5BA 5J2NB 3SCKE 5KFTA 4ENOA 2W9AA 3DYAA 4B02A 3TDBA 1NSAA 4X4SA 2HSEB 4ZVGA 4C97A 3BSOA 5DQGA 2QTWA 1AB8A 3SCJE 2HQDA 1T9VA 3NEKA 2MZ1A 1P6TA 2VICA 1FKSA 1E6VB 1FVQA 3MMCB 4WIWA 1WHVA 1RHQB 2VOPA 1NWUA 3CGMA 1IVZA 5GADU 4MIBA 4DUTA 3D6TB 1DQ9A 3CWJA 3RW6A 3RRGA 3W4RA 2OP5A 4NZ0A 2H65B 1PBUA 3CT9A 4ZN1A 4EO6A 5D0HA 3B4DA 3CD7A 1J5EF 3KK3A 1JLAB 2DGVA 2IRXA 2VC1A 3DDKA 2WZ1A 2RQCA 4DRMA 5CAAA 3M8PA 5ETRA 2V8HA 1V9OA 4QPXA 2KI3A 2DKOB 1RU2A 5F9LA 4OZNA 3DLBA 2DT3A 2UVVA 2WBRA 4IQMA 1N6QB 4DRNA 3T1AA 4Q22A 2GO9A 4NMLA 4J4OA 3M6UA 5A8KB 3KHRA 2E5LF 2POKA 4OLPA 3TC5A 1WDDA 3C14A 1JLFB 1WOPA 3QNWB 1SC3B 1YG0A 5LMNF 3KHHA 3DOLB 3UCZP 3CCRS 3AJ1A 4DX6A 3FZ2A 2CNNB 2GIQA 4P10A 1OPIA 1UA1A 1W26A 2HWTA 2QL7B 4ZPBA 2UVUA 4DR1F 4E2FB 1HHQA 3ZZPA 4ILMA 1XEZA 1IKXA 3JSYA 1DHMA 4CLLA 3D1HA 3VGVA 1VQ4S 3LANA 2N7CA 4ZVHA 4MYTA 3RAMA 2FC8A 5KAKA 3G8SA 4DV2F 3HLUA 3AOCA 4LSZB 3H42A 4JI5F 4LT6A 4HT5A 1LW2B 2HZAA 2DNOA 4ES2A 2OPQA 2RVJA 3MZIA 4DS5A 2L48A 3EM1A 2AMCB 1DLOA 1JNRB 2MKHA 4NEYA 4LR8A 2COLA 1N5VA 3HCXA 4PG6A 2V2QA 3OQ2A 4DR4F 3CPWR 4DRIA 2UU9J 4HACA 4NXMF 4U95A 1NMVA 4AYBD 4Z2HA 3MEGA 1NSGA 4O23A 4Y0FA 3FC9A 1BQMB 2KYZA 3DLJA 2PT0A 3PRVA 1NUEA 2DXEA 3ARTA 2CQHA 4C3KA 1FD8A 4M5LA 1TL5A 2QE5A 4EGLA 3DI6A 2MZJA 1VIOA 3RM8A 1H3DA 3CJKA 5EUHA 4GVBB 1X5OA 5HMZA 5HW8A 4PXBA 1RTIB 1TK5A 3G6LA 2RF2B 3O5LA 3KJNB 2FJEB 4FPIA 4Q7NA 4DR6F 3UR3C 2BOPA 1PILA 4F50A 4J37A 4Q2MA 4WZQA 1XC9A 3I82A 2Q5AA 1N32J 5HW7A 3A3OB 3OR1B 2N7YA 1KS2A 1GRJA 1XN9A 2ZQUA 2R7UA 3AOAA 4RNHA 2EC2A 3FBEA 4OLOA 4CLYA 3NGRA 2DXDA 1R6YA 3ETMA 2ZITA 5D4NA 1XWLA 4JI6F 3ILJA 2P2CB 2A1BA 3CZ8A 2ZH8A 5M2RA 1L3KA 1KP6A 2GJFA 3BYRA 1YJ9S 1ZAVA 2M1IA 1RTDA 4DL6A 5T7LA 3VTIA 4DV5F 2XP5A 5CZXA 3OTDA 2IC3B 1ZH5A 1B0VA 1S99A 2VDIA 5DG7A 1EHWA 2D1CA 1U8SA 2ZDOA 2DGUA 1JNTA 1Q7YT 1PAUB 4OX8A 3WQWA 1X4DA 3UQAA 3T1HF 3H4BA 3TW0A 3UF8A 2HIQA 5GAEU 2F3JA 2XSJB 1QPFA 1CQNA 3GV7B 2M2BA 3V6HA 3MM5B 1NH7A 1W1TA 4KO0A 4YHHJ 2AEFA 4USJC 4P8WA 2D9FA 4HHJA 2AJ2A 4IFYB 4MTPA 5CA5A 4HL9A 3W2VB 4DN9A 3D0HE 3DRXA 4DS4A 4KKOA 2B8QA 4L75A 4LFBF 4NCBA 2FJXA 1VRUA 2DR9A 1HMVB 1WWHA 1BD6A 3WDOA 2VBWA 3D28A 1ZAWA 3EY6A 2M88A 3S01A 1EX8A 1HJVA 5DG9A 1U1PA 1YLXA 2MZQA 2L3MA 4KHPJ 3D6MB 3FFIB 1K73T 2PMWA 4GKKJ 1R89A 1TQLA 4ZVSB 2NXEA 2XWYA 1LKZA 1C0TA 3EZOA 1FNOA 1SL1A 5C25A 2ZUAA 4IH5A 2EPIA 2M9KA 2W4DA 2VG6B 2MSTA 3AROA 2GQQA 4N8OA 3KZ7A 4JI4F 4DWSC 2FAPA 1YATA 4LMZA 5THWA 1VK8A 4WYLA 4LF9F 1SH3A 4URIA 4HDGA 4A8QA 1T3NA 3L09A 4KHRA 2ZBPA 3PJXA 4IG3A 3PDNA 1JNSA 3G82A 3GIJA 2PEHA 3KJFB 1FKIA 2AWZA 3M9MB 3TJAA 2XM3A 1GXLA 2WRMA 1L5UA 3Q8RB 5HP1A 2IM2A 4UUWA 4YN3B 4B3MF 2EG1A 3N5FA 4KGZB 1OSCA 3Q89A 5HSPA 1Q1CA 1NZAA 3HM9A 2XP9A 4R5PB 3MR3A 3QRPA 1Q8LA 1H73A 5HWBA 4QWBA 2UV8A 4Z2KA 2NS1B 1B3TA 2DT2A 3DCAA 1NSQA 2QGFB 1Z2LA 2K1RA 1P8GA 1NHKL 1UFKA 4MNMA 4JP8A 1D9FA 4DFMA 1WELA 2GHWA 4ZDNA 3MPVA 1IN0A 1FD2A 2ILYA 4NYZA 3CUNA 3AA9A 4OI3A 4CLFA 1HWJA 1FRKA 4ODKA 2B9EA 4OZ0A 1IXKA 1UEVA 5A6WA 4LF4J 2VD3A 4O3OA 3QJPA 2IYIA 4F25A 4UOFA 4M5IA 3CO9A 1B70B 2BJ3A 4P74A 5GVQA 2L9NA 3LAMA 1ZCNA 4PEOA 2V5HG 4TW6A 1UZHA 5KFKA 3KLGA 2J7WA 3F73A 1T02A 1FDBA 1B64A 1N5YB 2YKNA 3ISNC 4JI0J 3Q22A 3OSNA 4UZCA 3BGRA 3KACA 3UD4P 1QSSA 1Q53A 2XZWA 1MROB 2IRUA 4DFPA 3CJ0A 3B7XA 1YJNS 3CW2C 3DYAB 1HLWA 5BYRA 1UVNA 1KKHA 3GYGA 1RT3A 4QIBA 4F7VA 2DGWA 2DNYA 3PO4A 4X2BA 3THPA 3L9ZA 1U7LA 2LEPA 2MDAA 3HHLC 4ED1A 3AD9C 1W2IA 3GV5B 1L3VA 2MQNA 3UDLA 3HFKA 1R8HA 2WONA 4OYAA 3HDSA 1CQMA 2HZCA 2KG1A 2VJUA 4FF2A 3IWXA 1JNZB 3OL9A 2XI2A 4F4WA 2ZOMA 4CO2A 1RT5A 2B5UB 2G1HA 2ITKA 1HKAA 4UZBA 1NPRA 2UUTA 3KNAA 5JUMA 3X1LB 2ROGA 4DSLA 4S0MA 3KK3B 3Q0AA 2FD2A 2BEFA 1TUVA 3P8BB 3H98A 2RUDA 2R42A 2DPIA 3M8PB 2B9YA 3VAFA 2CAJA 2FLPA 3L7OA 3I55S 1GK8A 4PTMA 2JLGA 5KFNA 4Q45A 1HI1A 1W9PA 2KM8B 3TRGA 3RBEA 4K4WA 2IFXA 3GIKA 4M5JA 2V50A 3RJMB 5A0YA 4DL7A 3TARA 4GO7X 2OKQA 2XLJA 3TA0A 4J9SA 4F0KA 4TXSA 2W2NP 3JYTA 3WKZA 2XHCA 2HHTA 1IKXB 2RUSA 2VIHA 3JXOA 3C3LA 2D3ZA 2V34A 1RP5A 1WI8A 1DTTA 1HD1A 2UUBJ 3VZHA 2KM8C 4NWBA 2VFVA 4MK9A 3D3CJ 4UQTA 4GMKA 2K3IA 3R97A 4TY9A 1E6PA 1RWWB 1LQ9A 5DDQC 1ZS6A 1X4EA 1VYAA 3CB4A 4B3RF 3TNVA 4DPXA 3T5HA 1X4HA 3JAMU 3IGVA 4IG0A 2DK2A 1GQEA 1AT1B 3MCSA 4MTVA 4ZMMA 3RB6A 5KFUA 4UQGA 4IUFA 1QSYA 1XJWB 4IKAA 5E0OA 4IH7A 1WSRA 5AE1A 3ISZA 3LGMA 3T5JA 2IA6A 4PG4A 1VC5A 2I5JB 3B9AA 4HACB 4KT0C 2XBPA 2W9CA 3MEGB 1FXRA 2EFGA 3R5DA 4X84A 1URRA 1SC6A 5KFCA 1VRQC 3KG1A 4LF1A 3DI6B 3DNCA 2MQQA 2FY8A 2E7WA 3RBZA 1NKCA 4RUHA 1BKFA 2MZTA 4TYOA 1REVB 4X4PA 4WIQA 3K59A 4CO1A 3JSBA 2AV5A 2YNGA 2CIMA 2GMLA 2MEWA 3T6BA 3PVXA 1GAOA 2CQ2A 4FKXA 2BJ1A 4YB6A 1OMSA 1WF2A 4QWAA 4F02A 1D9DA 2R9LA 1RT6A 4O44A 4ECQA 2IY5B 1U1OA 2NSBA 2XY5A 1NK4A 3SV4A 1Q16B 4TNSA 1KTVA 5BJRA 2CZ9A 5HUAA 4ZN3A 4CWBA 4DQRA 2E5HA 3LWLA 4DV4J 3KLFA 3QLHA 2HNZB 2Z2MA 2MQ8A 2XYHB 4TX0A 2KU7A 4ELVA 5GQBA 4F3MA 2E9TA 3VAHA 2DSVA 3FCVA 4ID5A 1RTDB 1NPPA 3JAMY 2RRAA 3NL0A 4IOBA 2C2OB 1MU2B 5HT1A 1ZBCA 3W5ZA 1KONA 9ATCB 4XPCA 1K47A 1FDNA 4JV5F 4JYAF 2HMIA 4EBCA 4X64J 4C11A 4DLEA 1HIYA 5FLXY 2G9OA 5LOQA 2JDJA 4KO0B 2GV1A 4NLPA 2RUCA 5A8WA 2ZOGA 5KFWA 4P72A 4RNNA 1M5VC 5K9FA 3GILA 5IZHA 2DCUB 1XNQF 3IKDA 3OVSA 1NK6A 3KLEA 2Z58B 1NB2A 5C2CA 3TQEA 4CM0A 2RKIB 2J6UA 1HQUA 1T9TA 2OD6A 5KG3A 3IG1B 2H51B 1VRUB 1TVRB 3BKUA 4MFBA 1WAWA 2Q43A 4NLQA 3L7PA 2MPUA 2L9WA 3HKWA 3QZ7A 2FY1A 1FRXA 1FFQA 1C9HA 3ODKA 2G1DA 4DZ6A 1K9TA 1A0OB 2HRTA 1Q5YA 3UDVA 4OYBA 3H5YA 1HD0A 2JEGA 1U09A 3KCEA 5BR8J 1SV5A 2CRLA 4BC7A 3NGTA 1N56A 1C0TB 5DGAA 2E5IA 4Z2XA 5HO4A 5C25B 1SKUB 2DEJA 4J91A 1LW0A 1N33J 5L8RC 3AQPA 4DQPA 1KT0A 1VQSA 2UV8G 3DXSX 2XP7A 4MAKA 1EP4A 3W9HA 5CCMA 1VQPS 2DGOA 1JJCB 2GMJA 5HVGA 1TTHB 3KUHA 2V8GA 1NMWA 1SQFA 2KVQE 1FHTA 5KT2A 3LWMA 4IG3B 1YJTA 3FBBA 3G82B 4FAPA 4QBUA 5KFRA 3WX4A 4ML4A 1NWSA 1WHWA 4NLYA 4CT9A 3BKTA 1FCAA 1LG1A 4BCAA 1UL3A 5HP1B 1NKEA 5K8OA 2LQ9A 2GC8A 3MI7X 4RW9B 5KG6A 3EX7B 4I2QA 4NYOA 3NRBA 5HROA 3J7ZT 3QMQA 2XEXA 3FEXB 1XNRF 3TUJC 3HSDA 3RMEA 4ZVPB 3MMBA 2MQPA 4IT4A 4C8MA 1TKTB 3W65A 5E2QA 1Q86T 4P8UA 3NOCA 4OYOA 4B9NA 2K1RB 2HBZB 2ROPA 4DV3J 3AAWB 2HKEA 1RISA 5MLCV 3NBPA 3GFYA 1QSLA 2KFYA 2CQCA 2RILA 2RUGA 2UXBF 4K4UA 1UW4A 3ZZ0A 4NX9A 1AYEA 4NA3A 4PG7A 4EYIB 2LVWA 3C15B 3MECB 2H4YB 1SI9A 2J6TA 3B6BA 3CULA 4LF7F 2W2OP 1WJ9A 4HVZA 1NDKA 3V6JA 3JTOA 1V3SA 3FEYB 2J0WA 3C6UA 3QFWA 1IM6A 1WORA 3R7NB 4LAYA 2QLBB 1FESA 5E5NA 4DRQA 3DXBA 3TAMA 1E6RA 2V2VA 4O0IA 1WEZA 3PXGa 3NWGA 4ZP6A 2E5GA 3TZYA 2PSZA 5M2UA 3B9EA 4WK1A 3BGRB 3OJUA 2O5DA 4JFKA 3WD3A 1CS4B 2EG2A 3J81Y 4YDDB 1IX5A 2V8VA 1VMBA 3H5SA 2CNOB 3GFZA 3AT1B 1EIBA 4ODLA 4I6WA 4OX7A 1L3TA 2I8EA 3ARVA 1N5TA 4DQQA 1W9UA 4TW7A 2QMUB 2V0NA 3B9DA 4PABA 2OPRA 3CE8A 2R8JA 5JXSA 3MF5A 1GFWB 2IMOA 3T3FA 1E6YA 4QR1A 3NS6A 5CYQA 1IKVA 4OI0A 2ZH4A 4MKBA 4FDFA 3SCLE 1F3VA 1P5QA 4BS2A 5B09A 4TNOA 2WONB 1HXVA 2I1RA 4M94A 3IO1A 3CDWA 1SQGA 2DNZA 2AJ4A 5J1NA 2QLFB 1R8PA 1WKKA 2FB0A 1DARA 3SXLA 2MLYA 3M8QB 3PA7A 3IC1A 3LP2A 5C24A 2UVRA 1FKKA 4FYVB 4OFZA 2MZSA 1M5SA 5KFIA 4USVA 5LJ5Y 4TVAB 5KFEA 4NXNF 1D1UA 3BO3A 2KXFA 3HD2A 1RQ0A 2GO8A 4Q7AA 4B3SF 4ILLA 3PM9A 4JOUA 1KOOA 5A0YB 2YWEA 3M6XA 4C4WA 5I98A 3LUOA 5IXUA 5SZTA 2HRYA 4K5RA 3LPYA 3ILLA 2XMTA 4A46A 5T41A 1DTTB 1WNEA 3BMBA 2LA6A 1NRKA 4CZCA 2DY9A 4YY3J 4ODNA 5B0GA 3HVTA 1WHXA 4MYUA 5KT4A 2R8GA 1S1WA 2GW8A 4Q0BB 4DSEA 4ZS6A 2WLZA 1RUSA 3BYPA 3VQSA 1BXNA 1PYTA 4F8RA 4CIOA 4OHVA 2HNYA 2YNHB 4IG0B 2ZBQA 4OHZA 3CHEA 2A0FB 1U02A 3AB4B 4USKA 2IM1A 4DU8A 1H7XA 1S4EA 1UTAA 2ZR5A 3HXMA 2PA3A 1LK7A 4OI1A 4R5EA 1S97A 1OPZA 2VH7A 2RD5C 3M2UA 1FJGF 3GWCA 2ZR6A 4RW7A 3R9LA 3AA8A 3Q8VA 1VISA 4X4QA 4QOTA 1W2BR 1ZYQA 2IVYA 1FXLA 4C02B 3QIPA 4OJHA 3IA0A 4I0WA 4KV8B 5EN1A 3G6VA 1V3RA 2KXHA 4IH6A 2DJWA 2OFGX 2XS7A 4PQAA 3PTWA 2FJBB 5DS7A 2JX2A 3M6WA 4RZRA 2GGPA 2RQKA 2YNGB 2R7WA 1JWWA 2AYEA 5F8NA 3OVBA 1N34F 4LF6F 1WC5A 2CJAA 1T9YA 1VRTA 2B3TB 4O44B 4DL5A 4MIWA 3NRKA 2OH2A 2OTLS 1LL4A 1HR0J 4ZCIA 2CPJA 5GAHI 2VA2A 4ZVOB 2V4QA 3LTOA 2HHUA 3A8JA 3CCUS 3QLHB 2RU3A 2JC1A 3Q8UA 2E7XA 3WBZA 4DZ3A 2KFWA 3KFWX 2ZR4A 4G1IA 1TCOC 2UP1A 1SC4B 2FUG9 5KOXA 3GP9A 1KFWA 2CQGA 1CJVA 3EPIA 3TAPA 1HNZF 4ID5B 1H6KX 5ADZA 5F3TA 1KQKA 5CCLA 4A8XA 3I0RB 1SYTA 2PFFB 2KT2A 3KAIA 1W9VA 2O9OA 1NK5A 5ETPA 1TK8A 2EFVA 2BABA 1UW9A 4DSJA 2HMIB 2JFDA 4U9RA 2PIIA 4UOCA 3P6YC 2V94A 3M30B 2C2KB 1J6YA 1SJQA 5HQLA 2X1AA 2W7PA 3R3TA 5A8WB 5K20B 3EE3A 2DNPA 2AHOB 1H0IA 2FLNA 1EQMA 3VAIA 3PG9A 2KGJA 1FTCA 1HHSA 2OEKA 3P5BP 3BS9A 3SI8A 3I31A 4BLGA 1NM2A 3P96A 3KLEB 2LJ4A 1KEKA 4KBIA 2DNQA 3D3BJ 3MWBA 4J7CA 2HHHJ 2QG9B 3U1LA 4ZHRB 3ENWA 4N47A 4C8KA 3N28A 4BWJA 1VLYA 3BQ2A 2R8HA 2V9WA 5CYJA 3TX0A 3CJ5A 3LP1B 4JB8B 2K3KA 4AXJA 2VPYB 1RADB 2RSEA 1BMQB 3ZNUA 2UXCF 1UPMB 1WB0A 4KTQA 1SV5B 1D09B 5DM7Q 3WL0A 5DM6Q 3ILIA 3T5KA 4WKHA 1FNMA 2J5AA 1RGVA 3KAHA 4LVOP 3PR4A 2BBEA 2JVRA 1LW0B 5DZ7A 4G1QA 4LAWA 3FSIA 1AUDA 3W2WA 1LL6A 2J0QD 1EP4B 2B4OA 2W4CA 2CDRB 2IBOA 3GONA 3PW4A 4CO4A 1UJ6A 2YBTA 2BACA 1JNEA 2LU1A 1RTZA 3SV3A 1A9NB 4ILRA 4IPXA 2CG8A 2IJNA 4J4NA 5EGYA 1QVFR 4J9OA 4DBQA 4MAVA 2C3MA 2UUAF 2DO4A 2VQFF 5E7OB 3C8YA 2JEFA 2PV2A 1BE4A 2CQIA 2BRKA 3CDEA 3UR0A 4YR2A 5HROB 3K8WA 3TEHB 3GJTB 3HK2A 3HZEA 4TKTA 1S0NA 1EAYC 1LWCA 2CADA 4L73A 1GMWD 5I3UB 3MMBB 1HARA 2Y8WA 4FXDA 2X7IA 2KR7A 5ETSA 4AL5A 5IQ6A 2MSSA 1ZU8A 1U47A 1JXEA 1SXLA 4WXWA 3RU0A 5D4OA 1HBOA 5EDWA 2DBBA 4ZVUB 3HVAA 5CXTA 4JI1F 3FQLA 3L3CA 3NBPB 2KN4A 5IT9Y 4B9MA 1HPZA 3BGLA 4ZLJA 4IDKB 1RAGB 1YWXA 2D74B 2OLWA 4E8UA 2Y0BB 2C22A 3O5EA 1QAJA 1B4SA 1RE1B 1X9WA 3HFZB 1IQZA 1HNXF 1M1HA 4C2MA 4LQ3A 3OPKA 3VGTA 2YBUA 3PX6A 2E29A 2IAJB 4HH1A 5LMNJ 2HFZA 4LRAA 3ZZOA 2V8DA 3C6UB 1UAWA 4DR1J 5L1KA 3NY0A 1YK9A 1JIHA 3LOUA 3P3DA 2AWGA 3TAMB 3MM6A 3QRQA 1LWFA 2E1AA 5F8LA 1R6VA 3QIDA 5GPRA 4DV6J 1FX4A 3H5UA 3PZPA 2I38A 3KOAA 1VQ6S 4JI3J 3FVYA 4JUZA 1GTHA 4J90A 4LUBA 1W25A 2FPHX 2KHDA 4LSNA 3ENVA 3NKYA 2V69A 2ZBCA 2OPRB 1NU4A 4DUZJ 1VQ5S 1I3OB 5D75A 4MPKA 5CYQB 4DR4J 1JNDA 4KAIA 1SJ4P 1IKVB 4K4SA 1IKWB 1RLDA 1EARA 2IMWP 3H9RB 4JFJA 3QZ8A 1TL3B 4FF3A 3W3SA 3TUPA 1XTZA 4WU3A 1N36F 5FDLB 5L1JA 4BHQA 4DI6A 2Y9HA 2DG3A 1RTHA 4FYXB 5E3RA 5D77A 2CQBA 3O8WA 1T03A 3QFHA 4CH1A 3LP2B 4ZCMA 4C8OA 1GX5A 2B4VA 3ZTSA 1FTRA 1W1VA 3THTA 3OXFA 2BW7A 4K0KF 4N56A 2V8PA 3BPDA 2O92A 3ZZYA 4R8UB 4NPOA 2CJYB 2HEKA 1XRVA 2Y1RI 5KG4A 3WH0A 4ZPWR 4JI6J 2RRBA 3Q86A 1J5OB 3EGWB 1FKPA 5HANA 3T1YF 2VN1A 1R0BG 1T11A 4WKYA 2XCPA 1FKTA 2HHWA 3O5JA 2BJ7A 2IIHA 5A2QU 4DR2F 3WZ0A 3RZAA 1D8ZA 4ICLB 4LF2A 3HVTB 1NK0A 3ENQA 3KLIB 1WC3A 1FFGB 2YNFA 1Q8IA 2BW2A 1LNQA 1S1WB 2YKOA 2XQCA 2PDAA 3TUIC 5F9NA 2RDIA 3GIMA 1FI4A 3CIMA 2CFXA 1IBLF 3T1HJ 2HNYB 2ZE2A 4DF4A 2E44A 2BZ2A 3K7RA 4N76A 4LSLA 2E9RX 3NGUA 4CLWA 4CTAA 1KVIA 1IBKF 4WF9Q 3HT3A 3AOBA 1KOHA 3ARUA 4RUAA 5ITHA 4F36A 5I4MA 4NZ7A 1X4CA 4OHXA 3M2UB 3LALA 4EUVA 3RB3A 4RW7B 3MFHA 1ZTWA 4RJVA 1BGXT 2W2QP 1YQHA 3T19A 2NR0A 3KDOA 3K5NA 4WE1A 2CPDA 1GMVA 2UZ5A 1VHFA 3QIPB 4UUXA 4ANDA 5F8IA 4U96A 3PRDA 1I94F 1VQNS 3BN7A 2ZH3A 4L74A 3BR9A 1RSCA 2ZH5A 5B0DA 2JZVA 2KT3A 3SYZA 2RNEA 2CJKA 1XMBA 4DX7A 3PR5B 2CPZA 5RUBA 3IGNA 2ALZA 5DJBA 2H4WB 2ADBA 2DT0A 2PV1A 1XK8A 4IOAQ 2ZEJA 2MKCA 3PYGA 1ZM3A 1E15A 4U67Q 3FUYA 1KBRA 2QA2A 2RAQA 1YVFA 3J80U 2AJ0A 4ZLLA 4YS2A 2JNJA 3M9OB 1U26A 2ZH9A 4LF9J 3NCQA 1ZM2A 4K4VA 4LR7A 5A2QY 1NMEB 1GMWA 4AL7A 5KFVA 3QGPA 3HJVA 4X62J 2QC3A 4DPTA 5LJ3Y 4URQU 3QT6A 4EEYA 3R6LB 1S0VA 2V4RA 1SH0A 2NUHA 1CJVB 1NHUA 3ARQA 3MPYA 1HQEB 4N7TA 1RT1B 4ECZA 4DOZA 1RTJB 1BHNA 1JLGA 1H72C 1ZPWX 3HHKA 2CZ4A 2AD9A 1QJHA 3Q24A 5HMXA 3BB5A 2HK3A 3OOBA 3P49B 4KY3A 3KHGA 3W9IA 5D8HB 5EWGA 4NCAA 1JK9B 3ARXA 2ZC3A 1S7IA 4DUYJ 3S7RA 1VOMA 1FRJA 1Q6IA 4HKQA 2OSQA 1OJ4A 3CCQS 4I68A 5DIUA 3IAM9 4NZCA 4S3KA 1HL6A 2IM0A 1YJRA 4HTJA 3O5TB 3R2DJ 3CJ4A 2DR6A 3I4HX 2EFNA 4QWCA 2MXYA 4AE5A 2PI4A 5GMKa 1XERA 4DPUA 4DCOB 2QN6B 4B9VA 1PYOB 4JFLA 3ISND 3W1YC 1ZPVA 2WB1D 3G4SS 3T6JA 1K1QA 1CULA 2VBZA 5DF0A 4QIEA 1RI7A 2GJ2A 3AB2B 3QJJA 4QW8A 4KYZA 1RT7A 4C7QA 1GT8A 1HNVA 4UY8T 2DHSA 5KT7A 2E9ZA 2E7VA 1RDRA 5KG1A 1JLEA 2LP4A 2LDIA 2FZGB 2PPPA 3BJYA 1MN9A 4CH7A 1NBEB 1NO8A 4QW9A 1HKJA 2W9BA 3HHLD 3PO5A 2UU9F 3W2WB 3GB0A 2LQBA 2BKOA 3TEGA 4TYBA 3UI5A 5DEZA 3CC2S 1OIAA 2ABYA 1QTMA 1SL0A 3KJVB 4PXEA 3BBCA 4LRDA 3O5GA 4QYZJ 2AU0A 4OI2A 4ANCA 1T94A 3E01A 2FTRA 1RWMB 4WYWA 2WTFA 1S9EA 3FBCA 2HVDA 5CYMB 2BM1A 3M2RB 1KC8T 2HFVA 4F67A 1TMJA 5K14A 4JI2J 3C66A 1FJ7A 1AA1B 2MJNA 5KFAA 1Q6UA 2F7VA 2UVWA 2ASYA 2GFFA 4O3NA 3MUMP 2MYFA 4ECUA 4CLPA 2LFVA 4EZ9A 2P9GA 2F5GA 2GVZA 1HBOB 2PC6A 1S9GA 2Z4PA 4ES3A 1U4BA 1HBNA 5KT5A 1YJVA 1GEHA 2DRBA 4W5UA 1S12A 5KG2A 3G6YA 3GR1A 2Q6BA 3ENAA 1JJ4A 2UZAA 4HR2A 5ETQA 2BYCA 3TZZA 4P71A 3OL7A 3G86A 3GFXA 1G6BA 2WW8A 4IYQA 2JL9A 5D15A 2DSZA 4C8YA 1S72S 4C9DA 3UQIA 5LMUJ 1SIWB 1TL4A 3R1HA 2F4EA 3DRSA 4IQXA 2FC9A 3KMQA 2VBXA 1W7WA 1H74A 1Z2ZA 2K06A 4DR5J 3H90A 1TKXA 4G2PA 1TK0A 5HJXA 1MLAA 2ROEA 5LSRA 3SQGA 4ED8A 3GQCA 2BKNA 2FLOA 4YHHF 5H9FJ 1LWFB 4F2RA 1YBUA 4ZJQA 1R0CB 3CGIA 2ZWOA 2OIHA 1YBAA 5HAOA 2ZBRA 2HHXA 3W9JA 4HLBA 4DXLA 1R31A 5B0EA 1X5SA 3I87A 3NGKA 4NI2A 1G1XA 4B3RJ 1FKOB 3K58A 5DGBA 4N19A 4LSNB 2ZH7A 3RM9A 2KZMA 3R5JB 1KQSR 2JLFA 3OUYA 2IYGA 5HLFB 3GPAA 1U48A 4DZDA 2XS2A 3BGFA 1MG7A 3LP0A 1UJ5A 3VR1A 1RXOB 2C2NA 4NLGA 4WFBQ 3GCXP 2VV5A 3AJ2A 4DFJA 1YW5A 1PC5A 1OGBA 4KHPF 5C42A 2KB2A 1X4FA 2CYYA 1YJWS 4GKKF 3FSYA 3GV8B 1V5VA 2KRBA 2VZ9A 5CZVA 3PRAA 1C4AA 3N6LA 5DDRC 2RQSA 4DF8A 3HZGA 1DQ8A 1MNEA 1RTHB 1WNOA 4PWUA 4GKJJ 2M8DB 2I6WA 2HRUA 1BQNA 3OTCA 3TA2A 3KWMA 2N4DA 1PBKA 1TV6A 3IKGA 4W98A 2NYHA 4IQ2A 2CPHA 4P2XA 1T9UA 3TZXA 4M5HA 1B7YB 3GJRB 1QAXA 2EULA 4F26A 1Q1KA 1JLBA 4JFIA 2Z2ZA 1AFIA 4H4KC 3EWGA 3V6KA 3FY1A 1EQ0A 3ARYA 4K4TA 3RB4A 1UJ4A 1JMTA 1D9AA 1S76D 4DN0A 2U1AA 1UPPA 1HI0P 2GAHC 2D69A 2WVCA 3GYNA 1H0HB 1H2UX 2ZH2A 5KTQA 1HNWJ 2RHSB 1O0PA 4FZVA 2BE2A 2ACYA 1RT4A 4FVMA 3M6VA 1SJ3P 4FYDA 5A8RB 3KK2A 1K0VA 2YNFB 2CA9A 2VA3A 2G2YA 3LO3A 2ZUGA 2OMOA 4LSLB 3G71S 4ER8A 1NSPA 2FYXA 2ZHAA 2W01A 2CZVC 4K4XA 1V5IB 4JV1A 4PKDB 3NMRA 3MDYB 2Z56B 4R0EA 1BLUA 1XNQJ 2RDDA 4DZ2A 3D0GE 1SQEA 3CD5A 1VS3A 3M8SA 4WE1B 4U8VA 4F4YA 1PBAA 4TLRA 1EIYB 4JI0F 4PZVA 1JLCA 3HHLA 5DQHA 4YEAA 2G13A 2CG4A 4HBEA 1X8DA 1RT2A 2CQ3A 2HAFA 2DISA 2AIRB 1YHQS 4DROA 3KADA 1S9FA 1Y4ZB 3H2VE 4JV2A 2I0XA 4NLDA 3ZZTA 4PPDA 1Q81T 3UNYA 4KGXB 4ERDA 2QT7A 2HHVA 4HARA 2HG4A 2GIRA 2YWKA 4A8OA 3P4UB 3GMGA 4CRJA 1PAEX 5EX3A 1H38A 3I5AA 4I4BA 2AZ1A 5IT0A 2VQEJ 3N6MA 1XBWA 1YZ6A 4L6V3 2O01C 2BX6A 2AYMA 4DV7J 2M2AA 4MIAA 1H7WA 2QYGA 2YWHA 3BF4A 4CYUA 4G1PA 1I1GA 1Y3JA 3J7A1 3G6ES 3GCWP 1B0TA 4RUBA 4Y6IA 1LWEB 4QQBA 2UXDJ 3POTB 1QE1B 2BE7D 3KYLA 1TL7A 3NNAA 3JSRA 1LWXA 1JLGB 2KYXA 1ROUA 1J4IA 2CDQA 2EI5A 3OVAA 4X4UA 1D2KA 3WHIA 2F21A 2JZ5A 1S1UA 5KFLA 1C2PA 2XMKA 1DTQA 3I9ZA 2HS4A 4UF4A 1XMOJ 3UN5A 1FRLA 3N01A 1PJ5A 2NSCA 1RWNB 2GQ2A 2HQFA 4RU2A 5DETA 3M32A 1Q78A 4FN5A 3W64A 1QD1A 2OUGA 3TJ8A 1KR4A 3VAKA 1S6PB 6FD1A 1HKIA 3Q2SC 2KVIA 1FK9A 5H9EJ 1IBMJ 3QOKA 3UO0A 3QGIA 2DT9A 2NQPA 4NEZA 2UUBF 4P7TA 2D3O1 3PEHA 3AJDA 1KFDA 3V81A 3SFUA 3JS9A 4ODOA 3B8HA 1CULB 5HJYA 1GOIA 4PPZA 1OYEA 2GX8A 4EBDA 4FF4A 2MGZB 3RRHA 1IM4A 4WBFA 1UWAA 4ZPTR 4X4TA 2J0SD 2ZHOA 2QLWA 4DFKA 1HNVB 4CI0B 1IKYA
chains in the Genus database with same CATH topology
4OI0A 3O5MA 4TW8A 2PGCA 4WZMA 3UQBA 1DQAA 4NLRA 4HEA9 1S0MA 3K0JA 1SUQA 3IBWA 2ZH4A 1DTQB 4MKBA 4WIIA 1FKDA 3SCLE 1JLEB 1EYMA 1P5QA 4BS2A 1RK8A 2Y1IA 5I42A 5B09A 1DRZA 4DR5F 2RIJA 2BJDA 2EKYA 2WONB 2B6AB 4TNOA 1P1TA 2FGCA 1HXVA 1FRMA 1VQKS 2I1RA 2IUZA 3DLHA 2CQPA 3IO1A 2W9BB 4M94A 2FKEA 3I6CA 2ESCA 3CDWA 1F60B 3VZIA 2DNZA 3CSKA 5F8MA 3NNCA 1GXTA 4M63A 2D41A 2N3LA 1Q8BA 2QV6A 4RNOA 2AJ4A 5J1NA 1R8PA 2ZOFA 2WAQD 4RKUC 2FB0A 4Z2JA 4ALZA 1H2TZ 2YKPA 1DARA 3OHBA 4OX6A 3SXLA 2N87A 2ASLA 1FO1A 4EBEA 1XR5A 2MLYA 4Q44A 3M8QB 3TVZA 4QZVB 5LT5A 4EYHB 1H2VZ 3OTEA 3PA7A 5L9NA 3OFEA 3IC1A 3R1LA 1U2RA 3LP2A 3PX4A 2ZQVA 5C24A 4J9LA 1FKKA 2ADCA 2UVRA 3KKFA 5LSLA 4FBTA 2FJAB 2XSFA 4XO0A 4Q0BA 4OFZA 5D6GA 2OLHA 4U84A 2MZSA 5D3GA 2AGPA 4DR7F 4TN2A 3UW1A 3CCJS 1M5SA 4KSEB 2FHJA 5KFIA 2D7SA 3O5IA 1Y0OA 5LJ5Y 3QPIA 4V19X 2YNHA 2IC3A 1HWLA 1BWEA 5KFZA 2WK4A 3O5OA 2RMLA 1S9EB 5KFEA 4RLEA 4NXNF 4LQ9A 2NPIA 1D1UA 1O51A 1NWTA 3G9CA 4OV1A 2V2KA 4ED3A 1QLNA 2GMHA 2WSCC 3TR5A 3BO3A 5DO2A 3KAGA 1RYRA 2KXFA 3FZBA 3ONQA 1KLMB 2AGQA 1RQ0A 2OMLA 1R0AA 4ZPAA 4F4XA 2LU2A 5K14B 3N4WA 2YKMA 4Q2LA 2A10A 2GO8A 2E1CA 1DFDA 1N88A 1FT8A 2DTJA 3NNHA 1ROTA 4Q7AA 2XMVA 3HP6A 3RR7A 1QZ2A 4B3SF 1E6YB 4ILLA 2KH9A 3OLAA 4JYSA 4IFVB 4WJBA 3PM9A 4JOUA 4ZLPA 3EZ5A 1KOOA 2PPNA 5A0YB 1OO0B 5DDPC 1Z1ZA 1N1AA 1F5CA 1U6ZA 2YWEA 3OV7A 3IRWP 2WSEC 2XMMA 4O3QA 3H40A 3PY8A 1IKYB 2A3CA 3QAEA 1E6NA 3AS0A 2IVMA 3M6XA 3CXCR 4J9PA 5HMYA 2CPYA 4C4WA 1WACA 4OHYA 2HWIA 5I98A 2NXUA 1SUQB 3LUOA 2VBYA 5IXUA 3OSPA 3M1VB 5SZTA 4OIXA 2HRYA 1EETA 3US5A 1J2VA 4K5RA 3LPYA 3DGPA 3I32A 2DHGA 3T5LA 2MKJA 4K59A 1M5KC 2XMTA 2VPZB 5FJ4A 4A4JA 1VGYA 2EFOA 4IFYA 3DMJA 4A46A 1S9GB 1X0FA 4KV8A 1HBNB 5T41A 1X6NA 1IUJA 1DTTB 3MTJA 4DV4F 1YITS 1PGZA 1WNEA 1S6OA 1WEYA 4CNYA 1X5PA 1NRKA 2LA6A 4CZCA 4V19J 1S1TB 2DNKA 3RW7A 2HLTA 4ED0A 4H4KA 3TI0A 4RWXA 4CCHA 4GKJF 2QLXA 4ODNA 3A8EA 3B4MA 5B0GA 5HBFA 5K8PA 3HVTA 1WHXA 3MM8A 2HVIA 1OWQA 4X4VA 4O3SA 2DD8S 4MYUA 1HMVA 2DITA 4NCGB 1X7VA 5KT4A 2DPJA 2R8GA 1FDDA 5C24B 4LF8F 2XY6A 2YX4A 2M7SA 1S1WA 2GW8A 4Q0BB 2PV3A 4Q5VA 4ZS6A 4DSEA 1ZTTA 1TP7A 1I6JA 2WLZA 3VQSA 4ES1A 5D3GB 3CCLS 4DWSA 2GQCA 4WFZA 1VFJA 3D5MA 4F8RA 2JRSA 4CIOA 4OHVA 4ZP8A 2HNYA 2YNHB 4IG0B 4USHA 2HQ3A 2FHOB 4RBTA 3V4MA 4A47A 2HPUA 2DVIA 2DNLA 1HKKA 4OHZA 3O3LA 3QYYA 3CHEA 4NLUA 4BWMA 3KK1A 3AB4B 3DRSB 2EK6A 4W9QA 2FLLA 2EW9A 3S6EA 2IM1A 3SSQA 1VQ9S 3J7Z5 4H54A 4OQJA 3SDEB 4O3PA 1U25A 2DSUA 3FXYA 1H7XA 3BM7A 2N82B 4EZ6A 3B8SA 3HHEA 1HBMA 1GUVA 2VFRA 2ZR5A 1UVKA 1E6ZA 1GNKA 1G3OA 4OJ3A 4H4MA 3HXMA 2PA3A 1LK7A 3AH6A 3BGUA 4X64F 3UD3P 3IAS9 4WXOA 1LJYA 4OI1A 4R5EA 4RW6A 3SCIE 4DL4A 2BQRA 1S97A 1OPZA 3HMJG 5DQIA 2VH7A 2RD5C 1QUVA 1R27B 2RQ4A 3BO4A 3PW2A 1RD6A 3AHPA 3M2UA 2D9PA 2XP8A 3GWCA 3OLBA 5J2QA 2M8HA 4WJXA 1FAPA 3CDUA 2UUWA 3OW2R 3SQGB 2ZR6A 4I6AA 4RW7A 2AW0A 4CO3A 2VG6A 3AA8A 4AL6A 3GFHA 2LEBA 3BQ1A 1HR0F 1Y3KA 2QZ8A 4X4QA 1C0UB 3OFGA 3CCMS 4RW4B 4QOTA 2R2UA 1W2BR 2XG8A 2MHEA 4OI4A 1ZYQA 2FGOA 2IVYA 4HH0A 1FXLA 4C02B 2BA9A 3QIPA 3AQUA 4LGXA 2Q6CA 4OJHA 3IA0A 4I0WA 4Z2LA 4KV8B 3TA1A 4XIUA 1VC6A 1SKSA 5B08A 3G6VA 5EN1A 3TVKA 4A48A 1V3RA 5HW6A 2KXHA 4IH6A 2DJWA 1GTEA 1HNWF 4Z37A 2RUQA 3RR8A 2OFGX 3DN9A 2BANA 2XO7A 2XS7A 2PPOA 4MJKA 4PQAA 4P2SA 3I0RA 4JV0A 1FKRA 2B5JA 4X66F 3GIIA 2JHEA 4AXIA 2C3UA 2J8AA 3CCZA 5AE2A 3MM8B 1X0PA 4ZA1A 4YFUA 2ZZNA 3SFGA 4UY85 2FJBB 3ZFVA 5HL7Q 5DS7A 4KRWA 2VG5B 1NH8A 2JX2A 5DLFA 3CVKA 2WB4A 1GXUA 3JYJA 2CVIA 3M6WA 3OXLA 4RZRA 2GGPA 2RQKA 2YNGB 2R7WA 4NOHA 2L41A 1NAQA 1JWWA 4DWSB 4X4RA 2AYEA 5F8NA 4C8LA 2FVRA 5KFHA 2J9EA 4PCQA 4F02A 3IRXA 4ZPVR 1M1KT 3OVBA 1N34F 4LF6F 4I1TA 1ULRA 4LIRA 2B43A 3M30A 3V4IA 2CJAA 1MW7A 2C3PA 2EFQA 1VRTA 4M8LA 3WD4A 3U1NA 5EHHA 1E9LA 2AX0A 1N4LA 1NWRA 2ZQSA 1HWIA 1Y9OA 3ZZRA 1RYSA 2B3TB 4O44B 4CT8A 4DL5A 1KSPA 4X4OA 3CC7S 3NMAA 2PN6A 2V4JB 3KAFA 4MIWA 4P7VA 2R2SA 4DL2A 3NRKA 5C42B 2Q66A 2OH2A 2OTLS 3HJFA 2R7VA 1BC6A 3JB9k 2LMIA 2GJIA 5BR8F 2B4PA 1LL4A 4FNIA 4ZCIA 4KHMA 4H4MB 2CPJA 4NA1A 5GAHI 3H25A 4WU2A 2JOQA 3TUZC 2VA2A 1U6BA 5BXJA 4KB7A 4NLWA 4QU6A 2V4QA 4RW6B 5IT4A 1S1VA 3HX9A 2HHUA 4QR0A 3DOKA 1FJDA 3RGCA 3ARPA 1Y5LB 4PXDA 3TCZA 3QLHB 2RU3A 3KLVA 3CCUS 1NK8A 1N33F 1QUPA 2JC1A 2E7XA 3FCHA 5KFYA 3WBZA 1HW9A 3FQKA 4DZ3A 5D4PA 2KFWA 1SL2A 5LSOA 4QU7A 2KKHA 1GPFA 2HFOA 2ZR4A 3KFWX 4GC6A 4G1IA 3H20A 3RTVA 2DSWA 5J2MA 2DHAA 4EWTA 5LXRA 1TL1B 2C3OA 1NK7A 3DLEB 2F9JA 1TCOC 1BQNB 1N0UA 4ZHRA 2UP1A 2FUG9 5KOXA 3EXCX 1KFWA 2CQGA 3LAKA 3K5PA 3OA5A 2AF6A 3EPIA 5KFXA 5K8MA 3TAPA 1HNZF 4ID5B 1H6KX 1VI7A 3GZ7A 5EWFA 2DNGA 3DLLQ 1TV6B 2KTQA 2DG9A 4YR0A 3WIJA 3DRPA 4Y2AA 2NREA 5ADZA 5IM0A 5F3TA 3N9UC 4Y3CA 2IF4A 3PJWA 1KQKA 4A8XA 1WD6A 5CCLA 2DGTA 3LP1A 1R7IA 4CQ1A 2W8LA 3I0RB 2BDPA 3VCDA 4XAKA 2OPPB 4N41A 2B5JB 4PWDA 1ZBWA 4BBYA 3PKMA 1VBYA 1SYTA 2DHXA 3G8QA 2HHHF 3I56S 3CCES 4L3NA 2IJFA 2PFFB 2KZZA 2Q1LA 1K8AT 2KT2A 3KAIA 2DR8A 2ZVSA 1W9VA 2O9OA 5B0CA 1NK5A 5J6EA 2GGPB 1TK8A 2EFVA 2HS3A 1Q7LB 2KDOA 2BABA 3R27A 4PXCA 3U1MA 3WC0A 2R8KA 5K8NA 3PW5A 2W24A 4DSJA 3MMCA 1JLBB 3G6MA 3MDFA 2V9KA 2JFDA 2HMIB 2N3OA 3VAMA 3QAUA 3NCPA 5KG5A 3NCRA 4U9RA 2PIIA 3GPKA 3DM2A 2Z2LA 4UOCA 2PMZD 3P6YC 2V94A 3M30B 2EBEA 2C42A 2X51A 2YTCA 3OFFA 1J6YA 1VRTB 2DH9A 2IBKA 1SJQA 4ZKAA 2HWHA 2AOSA 2AX1A 2WBMA 3MMAA 3K5LA 4NL5A 2X1AA 2W7PA 1S6QA 2VQEF 3I0SB 3J7YU 2YY3A 3FSXA 4HDHA 3R3TA 4WFAQ 5A8WB 2RSQA 1NJXA 2D9OA 2DNPA 3CMAS 3O1LA 2BR0A 3UCUP 2GHVC 1T05A 1H0IA 3D0IE 2FLNA