4ZQKA

Structure of the complex of human programmed death-1 (pd-1) and its ligand pd-l1.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
publication title Structure of the Complex of Human Programmed Death 1, PD-1, and Its Ligand PD-L1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zqkA00
4CL7A 1N64L 5F6IC 3D85D 5DQDH 5SWZD 4YUEH 1X7QA 1G0DA 1UWGL 2CUMA 5TDNB 1TVBA 1Z9SA 3O3AB 4D0BB 4XMLH 3RZWA 1VGEL 2IADB 2IBGA 2VC2L 3DHJA 2E7LA 5BRZB 5H35A 4N5EC 1G7HB 3QIUB 1KXVC 4MD0A 4ISVA 1J10A 2OR9L 3BIBX 1LK3H 2IEPA 4F7CB 1H3XA 1OGAE 4IOIA 3PWJB 3AROA 5E6ID 1MY7A 2DQEH 3BUYB 4XVTL 1HYSC 1CFVL 3O4LE 5I1GH 4L5FH 4QXWA 3VXUB 4PRDA 1AGBB 4NRZB 3AAZA 2I60H 4JFQB 1EBPA 1IMHC 1IJ9A 1T0PB 4DN3L 3C6LC 1K8DA 1AJ7L 2DI7A 2FR4B 2EDKA 3HAEH 3HAEG 4G8IA 1F3JB 1FZOB 4PP2B 2FIRT 2D3VA 5K33A 4EQ3A 3B43A 1G7MA 2JJTC 1V3LA 3VWKB 1OD7A 4WRLA 2P44B 3AS1A 4OV5B 4QLRA 4RBPH 2BVUA 2IQAB 3HR5B 3C8HA 3LEXB 2QQNL 5F7EL 3NTCL 5EU7E 5B21A 5KTEH 1U0QA 5EZIH 2C4FU 1LO3L 1JIBA 4JPIB 4ZXBC 3BPNC 2VXTL 2VXQL 4RQQA 4N0RA 1IT9H 1WICA 1KULA 4X6EB 4RAVB 4F7EA 4I2XB 3LKNA 1HQ4A 3MXWH 5DD1H 5CBAB 2OZ4H 1FJ1A 4PTTA 1J0YA 2WWMD 4LNRA 2CDGA 1J0IA 2F8VA 1BD2B 2E7HA 4Z95L 2VDRL 1BIHA 1DQMH 2R15A 3SOBH 5DJDB 5J06A 5KSUB 1KLGB 4D9QE 4XP9H 3CFKA 5T1KB 5T3ZE 1MQKL 2W91A 3WNKA 3S9DB 3GGWA 2BJML 1PG7X 5DVOA 4JM2C 4XC3L 5I17A 3BEVB 4YHLL 2HTKC 1K9TA 3EYOA 3SE8L 1LP9E 2IANE 4M5YH 3S34L 2C3GA 3TBYA 4XMPH 4KKBD 3HZYB 3EOTH 3DRTB 1HDMB 3FRUB 4MVBD 3KXFA 2I24N 3VXRA 1S9YA 3BKML 3O6MH 3PJSA 5FV2A 2DS4A 3P0GB 4X7DC 3SGKC 1SJVA 4BSVA 4C55A 2W92A 1XF4A 3P4LA 4PG2C 4GH7B 2Y4SA 5FK9B 2R23A 2A6IB 2D4FA 3BGMB 5GSRB 1AGDA 2X4TB 4QRPA 4NPYA 1QBLH 4R26L 2BNQB 5IKCA 4U6HB 1IEAA 5D7JB 4FOMA 1WIOA 4NM4H 1ZVHA 4WUUA 3DYPA 4ZPVA 5E8PB 3UTSE 1ZHLB 5TE4H 1NPUA 1TJIH 1SEBA 3VGAB 4OI7A 4GKNB 3L95B 3QEGH 1HI6B 5I1EH 3JWDC 1FG2A 4LLDB 3WLBB 5HYQA 4E41B 5JZ7D 1H3UA 5ISZE 5HHVL 3F7YA 4C59B 2AABH 2ZCKL 3GSNL 3BT2H 4OBRA 1RZKL 4PRHB 4LIQH 3NCMA 4GUPB 1G6RA 4KMQA 4D9RE 2HVKB 2F54A 1AR1D 1F13A 3EDDA 3GHBL 2B1AL 4UTAL 2GT9B 2UZIH 3ZE0E 4P48A 1KEMH 4EUPH 3RWJB 4EUPG 3BVNA 1HXYB 3KPSB 4YDIL 4PV8A 4Q0XH 3WNLA 5ABDE 1OAKL 3V6ZB 5DLMH 1BIIB 2EH7H 1JGVL 3U2SA 1CFTA 4ZG1A 2YA2A 1ZLSL 3OKNB 2F5BH 4X9BA 1XF2A 3HR6A 4CNIA 3X11A 1A6UH 5CUSL 5FXCH 1AO7E 4P2OA 1OT1A 1HINL 1E4WL 2ESVB 2Z31D 5KSAD 1FNGB 2DM3A 4HIIA 1FE8H 3CSYB 4KY1H 5L9DL 3BZFB 2X4RB 5MI0C 1NCAL 4QF1B 3FOLB 4ZOCA 4QRQB 5T1DL 3R0NA 2DLFH 3TGXA 3HUJF 5SWSD 4PGBA 1ED3B 2DQHH 4V1DE 3DVFA 3HAEA 4MA3B 2IFFH 2MJWA 1JP5A 4GMSL 3WFZA 2HT4D 2BRRL 5IVXB 4HH9B 4NC1C 2GSIA 4LFHD 4M5ZL 5FKAB 5CGYC 4AK1A 1OD9A 5HHNA 2FO1A 4O9HL 4NQXB 4HT1L 2DQTL 1VEPA 1L7TL 3MV8E 3LQZB 2GAZA 1DJSA 3MJ9H 2KDGA 5TDNA 4LSRL 5CD5D 3O3AA 4D0BA 3OG6B 2IADA 5LJYH 3RVWD 4RBPK 5BRZA 2OZ4A 1TCMA 5F7MC 1G7HA 1QBMH 3QIUA 5C0CD 2DQCH 2XKUA 4W4OA 4KHTL 5T3ZL 2YD7A 4F7CA 5BVPL 3BP6B 1RIUL 2CKBL 3PWJA 2VITA 4M4PA 1PSKH 5GHWH 3JWOC 1J11A 4OZGE 1RZ7L 3VXUA 2XI9A 2HYMA 4JFED 4NRZA 1E6OL 3TP4A 5KZCD 4JFQA 3CFCL 4AEIL 2EDTA 2BVEA 1OM3L 1U41A 3EJJX 2FR4A 4YDKH 4OCWH 4X6BB 4BH7B 1F3JA 1FZOA 2NMSA 2ZKHH 4PP2A 3V5KB 3PWPE 1MEXL 3KGRA 4IDLA 4LLQB 2MSPA 2H2PC 3VWKA 4I8DA 3T2NL 4Z7UE 3GMOB 4OV5A 4Y4FC 3MYZA 32C2B 2IQAA 3O6KH 3HR5A 3LEXA 1BREA 3DO3A 2J5LB 3TNNB 1V5JA 4JPIA 4QEGA 5LCVL 4UNTA 5HDBE 1CLZH 1W0VA 4OZHB 1ZKAA 4I2XA 3BDBA 3EFFB 4M62L 2PYFB 2LV4A 1UM6L 3PIQB 3HMXH 1LEIA 3T4AB 1AIFB 1I7ZB 3LHPL 4FTVE 4XCCL 5KSUA 4KU1A 2GJ6E 1PAMA 2R56L 1KLGA 5DJDA 2VO5A 5JW3L 3P40A 4HC1H 5T1KA 1RIHH 5DO2D 4EIGB 2YS4A 3L1OH 4KJQC 1BFVL 3IKKA 1MH5B 4UT9H 3BEVA 2NTFB 2QQLH 4PRPB 5DUPH 1V05A 1A3LL 4K23H 1XEDA 5D6CB 1IQWL 3HZYA 4TRPL 4DGYH 3DRTA 3NZHH 1HDMA 3FRUA 2UZYB 4Z5RB 5FGCE 1INEL 3RUGF 4OFYA 3DO7A 5GRUH 3RUGA 1BJ1J 2F53B 2GQHA 3M45A 4NQEE 1RUPL 3VA2C 4MLIA 1CS6A 4F58H 4P2RE 5FK9A 3BGMA 4FQJH 2D31A 5GSRA 2X4TA 3KYNB 4YR6B 5CBEB 4KZEL 1CWVA 2BNQA 4U6HA 2ITCB 2VZ1A 3H3PH 5D7JA 1I9EA 5HYJB 1IGTA 3OXRB 1NANH 3HZVB 2HMID 1ZGLB 5E8PA 1IC5L 1V7NL 2NR6D 1ZHLA 2O5YL 1T03H 3G5VA 5KW9L 3R06B 4GKNA 3L95A 3RI5F 1HI6A 3K1DA 3FCTB 3DYMA 3ZYIA 1KENH 4LLDA 3WLBA 1T0NB 4JQXA 5J11B 4E41A 3SKJH 1HHGB 2F5AH 4KK9D 5E24E 1DSFH 2VQUA 4IMKC 3SE9H 1KPRB 4PFEA 4PRHA 1MAJA 4GUPA 1YEJH 1U91B 3KXFD 3VXRD 1INQB 4FZ8H 4XTRC 5C0FB 2HVKA 3OAZH 5FYLH 2NY6B 1KB5B 1ITBB 1A64A 4EBQL 1CQYA 5HPOA 1I4FB 4JGMA 3KG5A 2AKRB 2GT9A 4UILH 3MJ9A 4DTGH 1CLYL 2C26A 3IGAB 4M43L 2APVA 3F6LA 3RWJA 4QRPD 1WIUA 3V6ZA 1VHPA 4JM4L 2P5WB 3OKNA 5F96L 3U9UB 2CK0H 4WUUD 3HNTL 4KI5F 3GI8H 4CN1A 3UBXG 1SY6H 3E8UL 1XGTB 4M1GL 2CSPA 3I75B 4WY7H 2CIKB 2ESVA 5IMLB 4J23A 1UWXH 2CH8A 1FGVH 3EYQC 5IB3B 4PP1D 1QSFA 3CSYA 3OL2A 3BZFA 3VXOB 2X4RA 2CRIA 4B7IA 4QRQA 3S7GA 5FYKE 3RDTB 3IRPX 4OF6A 1ED3A 4F9PC 1FRGH 3VWJC 3U36B 2A9ML 4H0IA 4MA3A 4OM1H 3BOVA 1TZGL 4AM0B 4HH9A 5FKAA 5FUCE 1RULL 3MGOB 2GIYA 5CJOL 1HYRC 1FVEB 5KSBB 4PR5B 2DD8H 2NY2B 3W0WB 5JW4N 4MB5A 3V4VL 1B2WH 4W6YB 2JIXA 4NQXA 1MFBL 3SGEH 3VFNA 2VOTA 4Q9QH 3KNBB 4K7PY 1OAQL 2AXHA 4N0YH 5AG9A 2Z0BA 4KRPC 3LQZA 5JDSA 4YWGL 1R0AH 1DBKL 1Z0MA 4WWKC 1HIML 2FATH 4MJ2A 1N7MH 1NBYB 3RX7A 5GRVK 4P2OD 3TFKD 5IM7B 5F7LB 3HMXA 2D7OA 2LFGA 4LAQH 1W2KT 1B88A 4MXQD 4YZFE 4HC1A 4KKNA 4L3AA 1LDPH 4JFXB 4YHOH 1IM3B 3DWTA 4O02H 4M48H 1HXMB 4Z7WB 3FTGB 3JVGC 5IWLA 3QBTB 1YJDL 1NUGA 5EA0L 1MIEH 3VFRB 2DJUA 5HTSA 4QGTA 1OOAA 4X6BA 4BH7A 3V5KA 1B0WA 3ARFC 2Y72A 3T77B 3SDDB 3PG2A 4LLQA 3QEHB 1CGVA 4P3CH 2EXYC 3GMOA 1EA9C 32C2A 5D8JL 3TN0D 3GSWB 2J88L 3TPKA 3D39E 3TNNA 2IH1A 2ZUVA 4IS6A 3LS5H 3HC0B 3IAPA 1RHFA 3QZWG 3ISWA 4ZFFB 2H6PB 5E8DH 4OZHF 3QIUD 3GRWL 4OZHA 4GG6B 4PLKD 2ZUSA 1I9JH 3EFFA 1YN6B 1YYMH 2PYFA 1U8IB 3PIQA 4JKPH 3T4AA 1AIFA 3U9PH 4ZTOL 2OL3L 1I7ZA 3VE0B 3VXUD 3SE4C 5JW4R 5BW7C 2QHRL 4OF5A 1MH5A 5K9JH 2NZ9C 1MPAL 2DICA 3CVHB 3MUJA 2W65B 2NTFA 4MA1C 3QRFM 4NJ9H 4PRPA 4R90H 3EDEA 2ZSWB 2BVTA 5ANME 4GS7C 3VWKD 4G80B 1JHLH 5D6CA 3MACH 4Z5RA 4JO1L 4OCLC 4TVSa 4MS8C 5FV1L 4PJCB 3EDKA 2F53A 1ADQL 2AEQL 3LAFA 2PYEB 2VZOA 1UC6A 5F9OH 2GUOB 3N06B 4U1NB 3UBXA 1B4RA 1SY6A 4JHWL 1EMTH 3KYNA 4YR6A 2V6HA 1YEHL 5CBEA 1HH9B 2ITCA 3TT1L 3QUKB 5HYJA 4PS4L 2J4WL 1EZVX 4GW1B 1RZKC 4LU5H 1NAML 1ZGLA 1RUQL 3CAFA 1QFHA 3CNKA 3O41B 5C0DB 5LGHL 5ACMA 5SWZE 1X5YA 4KVNL 4IDJH 3FCTA 1BQHB 2DTMH 3RRQA 4LLAA 1KV3A 4QGYA 4LVNC 4ZAKD 3I3DA 1FHGA 1HHGA 4HK0B 3WFEL 2FLBT 4XVUD 1UWXK 4KTEL 1IKFL 1MRDH 3ZKQD 4S1DD 3T2PA 2AJVH 5D1XC 2J8OA 1KPRA 3CVHH 1BJ8A 4CKVX 1U91A 2BY0A 5CINL 1INQA 5C0FA 4OFYD 5ALBH 4E42B 1AD0B 1I4FA 4YHKH 1PJ9A 2AKRA 3V6OE 4XPGH 3ZO0A 2X4SB 4JZNB 2VDNH 1NGPL 2BNQD 2P5WA 1IGIH 3CC5B 5D7JD 3GDBA 3U9UA 3H9YA 1ZEAL 2E9IA 3K0WA 1XGTA 3IFNL 3I75A 2CIKA 3PHOB 1IC1A 5J1AB 2UZXB 5IMLA 1HSAB 5EU7C 1O7VA 1TJHL 5IB3A 5J57B 3LMJH 4LSQL 3ALWA 2VRAA 4OT1L 4XAWH 1AE6L 1XCQB 3VFOB 3VXOA 4E41D 1BAFL 3LKQB 4NWUH 4O4YH 3RDTA 3S37H 2NXYB 2DIBA 3VDAA 1KN2L 2A6KB 1CU4H 3EOBB 3U36A 3OKMA 2H26B 1N5AB 3NN8B 4AM0A 5KSBF 4PJ7F 2VDKH 5DYOB 1NGXB 1JHKH 1FVEA 5KSBA 4WFGD 4PR5A 3W0WA 5IBLD 4EI6B 2Y07L 2MTPA 3MODL 2FBJH 4XCNB 1TIUA 3KNBA 4O58H 2P49B 2ZCLH 1A7RL 3HFMH 3R1GH 1WUNT 2HVJB 4LMQI 3AGVA 1NBYA 5EZOL 3NH7L 4KI5D 4FXGB 2HKHL 3QDJB 1QNZH 2ESVD 3NCBB 4QHNB 1J5OH 3LEVL 3A67H 5JXAH 4RX4A 3G6DH 4S2SB 1QSFD 4ZO7A 3HNVL 4NP4L 4JFXA 1IM3A 4XB8A 3TZVC 3QCTH 4Z7WF 4I4WB 4HXAL 1HXMA 2VZUA 1D6EB 4Z7WA 2A1WL 5SV4A 2BSED 3A6BL 3ZE1E 2HFGH 3T0XA 2VXVH 2XKSA 2AVGA 4ONFH 2DWDA 3BQUC 1UYWH 1L6XA 2QV2A 5D2LE 2R8SH 3T77A 3SDDA 2EZ0D 2JIXD 1GOGA 3QEHA 4G8EA 1FL3B 1DCLA 2OQJB 5IFJB 3VXPB 3T3PF 4XCEB 4ZS6D 4UTBH 1AQDB 2OK0H 4XPHL 5DMIH 1JZ5A 4X0KB 1FNAA 1GGBL 1H3GA 4JG0H 1U3HD 5EO1B 1KCUH 2H6PA 2FH8A 4ZFFA 1CGSL 5J8OA 5IG7B 4U7SA 1X5ZA 1CZ8H 1BWWA 1NUNB 3IJYA 4GG6A 2O5XH 1Q9LB 1YN6A 5E4EB 2AGJH 2IALB 3S36H 1U8IA 2XXMB 2G2RB 1FCGA 3VE0A 1OP3H 5I76B 4MD5B 4PGCB 4XNYL 4HCRH 4JE4B 2NY0D 2YMXH 1J7VR 3EW3B 3CVHA 2W65A 4I18C 4P5KB 4MDIB 2ZSWA 5IFHL 4FNLL 1IQDB 3HI5H 4G80A 2ZJSL 1HHIB 4RWHA 2FEDD 1NANI 4PJCF 2Y06H 4PJCA 4ENED 1F90H 4KKAD 1BVKA 4Z7OE 5GS2H 1IM9B 1ETZB 4OLXH 4Z7VB 2PYEA 5DMJB 4DCQB 1G7PB 2GUOA 4U1NA 1A14L 1WBZA 3KPPB 2YBRB 2ZNXA 5I15L 5ILTH 4MX7B 2F58L 3U4BH 2AJXL 1HH9A 5KAQF 1E4XL 4XPAH 3PWNB 3S5LB 1A7QH 4X5WB 4JLRB 4BFIA 1OCWH 3MGAA 1NJ9B 1MRCL 3O41A 1N4XL 3V2AR 5AZEL 1C1EH 5C0DA 1NLBH 3K2MC 4ZSOB 3ZMRA 1BQHA 2IPTH 4X7SH 3F7VA 4FFZL 2HKFL 4LLYB 2BCKB 4HK0A 1CD9B 4PRPD 4U1LB 5GGVH 5C0CE 4G6KL 1NCBH 5FYLD 4YFLF 4KQ3H 2B2XL 4WFHD 3KAAA 5F1KC 3BN3B 3FQTB 4X6DF 3QQNA 3UBXI 4GBXB 4MQXC 2YWYA 1LE5B 2CXGA 4E42A 1QRNB 1AD0A 1FCCA 1VFUA 2F53D 5F7UA 3QFDB 5JW4Q 1BVLB 4JFEE 3ECBB 1EEYB 2WQ8A 4FQIH 2X4SA 1KSRA 1QPXA 3A6CH 4YFEA 4D9LL 4TNWF 3CC5A 4PGJA 1A7PH 4FFWD 4N1HB 5HYJD 4JN1L 3KLHC 5F1OB 2NYYC 4QXUL 5DD0H 2HT3D 4XP4H 4LK4A 4AEFA 1ZGLM 1RPQA 3PHOA 4GRLC 5J1AA 3ZKMC 3S5LG 2ICWB 2ZZUT 4BQ8A 3ARBC 1A4KB 1FGNL 4IMLB 4L3EB 3VFOA 1XCQA 3SDYL 3LKQA 4RDQG 4TNWK 2F74B 3SGEI 4CDGC 3NACL 1OWRM 2BY3A 1SMOA 2A6KA 3IU3B 3EOBA 2C3HA 1DVFC 2H26A 1N5AA 3RWEB 1F3DJ 5BMFH 5HI5C 4FA8A 1WZLA 1MQ8A 3UTTD 5DYOA 1NGXA 3V6BR 2NY6D 2FEEI 5DRWA 2C3VB 2ENYA 3PL6B 3BP7B 5F70A 2BVOB 1OGTB 1ZLWH 5EPMB 4EI6A 1P5VA 2QSCH 3IDYC 1F5WA 4LASL 4MAUL 4S10A 4XCNA 3WUZA 5EOTB 3I02B 2Q1EA 4O2CA 4XNXL 1JNLL 2P5WD 2HVJA 4M1CD 2P43B 4QTIH 2V17L 5C0IB 4MA7H 3RIFK 4FXGA 2PO6C 1YJDC 3QDJA 4HWZB 4HUUB 1L4IA 3D69B 2BC4B 4U3XA 2IMNA 4QHNA 3W2DL 1E27B 1T0MA 4HCRA 3VW3H 4S2SA 2DDQH 4DW2H 4HLJA 2ZP0T 3LDBC 1B4JH 1MHCB 3V95A 3R8BB 3RDTD 4I4WA 1YC7A 1D6EA 1NC4B 4GSDL 5HD8C 1JYWA 4GAYB 4MB3A 1OP3K 3TM6A 1AKJB 2DQUL 5F7KC 3FOMB 4I1NB 1I8LC 1IAKB 5FYJL 3W0WD 2RFXB 5A16B 1H3VA 4LEXH 4XVJL 2Q8AL 1NBZA 3BKJH 5EBMA 1YNKL 1OTSC 1BFSA 2DLIA 4O5LH 4TVPH 3FRPA 2HP4A 1FL3A 5H37G 5SWQA 4CADB 1A9BB 1MJ8H 3B9KB 2OQJA 5MP6L 5IFJA 3VXPA 3SE3C 1A5FL 4LCIL 1AQDA 2C3WA 4X0KA 3PP3H 5FUZL 1H3PH 5EO1A 1CICB 5F44A 5IG7A 5C6TL 1ZA3B 3BRDA 3KXFE 4KKCD 3VXRE 3S6CA 3K7UA 4RX4D 1MCNA 1Q9LA 2X09A 2IALA 1CK0L 3GM0A 1HKLH 3P9LB 4OZIB 4X9FA 2G2RA 4LOUD 4JFZL 1JVKA 5TFSH 5I76A 4MD5A 4PGCA 4QRPE 1CL7L 2DI8A 5HVFB 3ARSA 4WUUE 5E2UL 3EJYC 1GRWA 1JL8A 3ME0A 3FQXB 3VXSB 1BF8A 4P5KA 4Y16C 4EN3B 4Z76B 3SDDD 1IQDA 4HBCL 3K8MA 2WAHA 1HHIA 4NSKB 4TSBH 3W9EA 4PJEF 4ODHL 4G6MH 4EI5C 1TXKA 3CIQA 4M6OH 5C7XL 3TESA 5T5FL 5K59F 1IM9A 1ETZA 4Z7VA 2OMBA 4DCQA 1DBMH 4O2EB 1G7PA 4F57H 5FUCC 3KPPA 2YBRA 4IOFC 5L88L 1OW0C 4MX7A 3ULVH 3PWNA 3DTXB 3S5LA 3B3IA 5J1TC 4DKEL 1WZMA 4X5WA 5JR1H 4JLRA 2LE9A 1FORH 4WJ5B 4RDQF 4WHTB 3S3PA 2X9WA 1NJ9A 5GZNC 2EIZB 2N7AA 3EO9L 3ORJA 2UV3A 2M1KA 3F62A 4ZSOA 1QG3A 2FX9H 4NT6B 3N1FC 3PWLB 1T1XB 3AU1B 4OFKA 4P9HL 2ZG3A 2CIIB 4LLYA 2BCKA 3MMEB 4QXGL 1IC7H 4U1LA 1QLFA 1KNOA 3SDCB 3WE6B 2AJYH 1L0XA 1LO0L 5ALCL 5F88A 1U6AL 3CPLA 3PABB 1ACYL 4LQ1A 3FQTA 3HG1A 1CD0A 4GBXA 5E9DB 1Z6JT 1LE5A 1QRNA 4PJ9B 3ALPA 2JCCB 3HUJE 3QFDA 4ONGL 4YAQB 2PYED 1F97A 3VG9C 1EEYA 3WLWD 3OZ9H 4NQSB 4WU5B 3FO9B 3RL1B 4K3EL 3T2OA 3SCMA 2BSSB 2ZCHH 1ZLWK 2AXGB 1HN1A 2X10A 5ADOL 1UKTA 3JWNC 4LDOB 4M61A 5KSVB 3BRGC 2XICA 3Q6FB 3QJHB 4G5ZH 1GC1H 2CQVA 2D7TL 2WIIB 4R97C 2ICWA 4YFLI 1A4KA 4L3EA 4IMLA 4NRYB 1AXSB 2QADC 4XZUB 1PKOA 3HCVB 2EEBA 2F74A 1B0RB 4ZUSB 4CMHB 4WO4C 5DTFB 1DFBL 3PDDA 3OBAA 1U9KA 5JIKA 3RWEA 4M93B 3L3JA 4LSPL 4IRSC 5KVDH 2AK4B 1DQDL 4Y7MA 3ARUA 4OF7A 3VXUE 4ZS7L 1Z3GL 2BVOA 5IHBA 1MCQA 1OGTA 1C08B 1F58L 4NN6C 3FT2B 4W6WB 5I2IB 5EOTA 1XGQB 5IVZB 3I02A 1C5BH 3IDIB 4JR9H 3IU4H 4Y4HD 3U79A 3LEYH 4P4RB 3MBEC 4Y5XC 1UJTA 5CILL 3ZZ1A 1TZIB 5C0IA 1E4KA 3FAXA 1UH3A 3E3QE 1DBBL 4HWZA 2QHLA 3D69A 4W6XB 2BC4A 1EJOH 4WW2F 2VDLH 4NZRH 4WW2A 1TNMA 2Z8WC 5D1QC 5L2KB 1UACH 1MHCA 4LSDA 1CI5A 2NXYD 1UCBL 1F4YH 2J3SA 3L5IA 2YRPA 1NC4A 2O5ZL 4JG1L 5LWYH 1D7FA 1UXWB 4X7EC 3AREC 1ZLVH 4GAYA 5DMGC 3SJVB 5T1LB 1N5YH 1AKJA 3QXWA 5GS1C 4OFVA 1EHNA 3RNKB 1IAKA 2EIBA 2RFXA 4D2NA 3KJ6L 4OLZH 3TLRA 3ZTNH 1J8KA 1G6RL 2IH3A 4J3UA 1A9BA 3B9KA 2DQGH 4HMDA 4LIQE 3ZL4H 2AS5M 4PV9B 3ULVF 5HGHB 4YUEL 4TTDD 1I9IH 3V5DA 3NAAH 1PLGH 2Q8BH 3BKYH 4K94C 4UNVA 5SV3A 5JORB 3QDJD 1CICA 4XMLL 2ITDB 1KYOK 5E6IC 4C83B 1JPFB 3U7AA 3KR3H 4QXTB 2VQTA 3RUGE 3P9LA 1LK3L 4OZIA 4KHXH 5D5MB 3KS0J 3VH8B 1AHWB 5JHLH 5B8CC 3PXJA 2EXWD 4PUBH 2I60L 4WIQA 4YX2H 4OF3A 5F93C 2VUOA 2C3XA 3BN9D 4NN7C 3OR7B 5CJQH 3VXSA 4UOW0 4EN3A 4Z76A 2XTJD 5A1AA 1P4IH 5LQBL 5EFIB 4NSKA 5GS2D 3H3KA 1OPGH 4OFDA 2KQMA 5BXFB 4ZNEE 2XFXB 5C08E 5KTEL 5EZIL 1Q9WA 4O2EA 3O8XB 4PTUB 2WWMC 5F9DC 1IT9L 4WFGE 3P77B 2DWEB 2GHWB 3DTXA 2YN5A 3MXWL 1B6UA 5DD1L 4DKDC 2ED9A 4R4FH 3MLVH 4WJ5A 3RY5A 5ESQB 3GEWB 1RZIB 3FO2B 1NL0H 2EIZA 1A7NL 1EEUA 2EDJA 3SOBL 3QNYB 5IW6B 1DLHB 1UGNA 1QBAA 4RCAA 5MENE 3VH8G 3IFOB 1A4JB 3PWLA 1T1XA 3AU1A 3HA0A 5L6YH 2CIIA 4KI5E 4KKBC 5C2UB 1JTPA 4MVBC 1LNUB 1KBGH 1W72B 4YC2B 2PXYB 2ESVE 3SDCA 3WE6A 4MQTB 4LMQE 5D1ZB 2GY5A 3PABA 3QHZH 1T5WB 1QSFE 4M5YL 4XMPL 5ICYB 3OMZA 4JDZB 5E9DA 3EOTL 1EIBA 4PJ9A 4CUCA 1K85A 2JCCF 3VMNA 2JCCA 3O6ML 3VI4F 4YAQA 1IM9D 4X4MA 4N8VG 1A6ZB 4NQSA 4WU5A 3FO9A 3BZ4B 3RL1A 4O51A 1AGEB 4QOKB 4RFNB 2BSSA 2AXGA 3L3DB 1QBLL 1QZ1A 3C8DA 5KSVA 4HH8A 3W5NA 1MCCA 3U83A 4NM4L 4DQOH 4LSTH 5EWIL 4U3CA 5GGRB 3QJHA 5JZ7C 2WIIA 1MUJB 5TE4L 4MXWH 4ZO8A 1TJIL 5JA8B 2D03H 3QEGL 5I1EL 4NRYA 3D2UA 1AXSA 4XZUA 3HCVA 2JTDA 5IB5B 1B0RA 4ZUSA 4L8SA 3V0WH 4ZOAA 2BOBA 5DTFA 5DSCB 2AABL 1AR1C 4HKBB 1VERA 3HG1D 3RNQB 2R1WB 1W72H 4QRTB 4LIQL 1QRND 5I1LB 1ZLVK 3EJZD 4ZTPL 1N0XH 3BZEB 3FT2A 2Q3ZA 5I2IA 5J6HA 5IVZA 2UZIL 3SCMD 5GIRB 3IDIA 1ZVSA 1KEML 1NCWH 3MR9A 3MFGB 4P4RA 2Y23A 4Q0XL 2ICWI 1NFKA 5EULV 2Z31C 2EH7L 5KSAC 1TZIA 5AZ2L 2F5BL 2M26A 3MJ7B 1G9ML 5JW5B 1A6UL 3MA7B 2E9JA 1CVRA 1VPOH 4YDLC 4A2LA 4N8CL 4L3ED 5L2KA 4DVBB 3H42L 3QPQD 1FE8L 3DUSB 3JTTB 4JQIH 4KY1L 4OTXH 3V52L 4F9LC 2HT4C 3T0DA 1DQTA 4OZHE 2DLFL 5GRYA 1PYWB 3L9RB 4M6MH 1FNLA 2DQHL 1A7OL 4LGPB 1MCDA 5IBTH 5T1LA 3VJ6B 2IFFL 3HE6B 3ZHLA 5DJYA 1T4KB 4TVPD 2DLHA 3RNKA 3MLWH 4FQ2H 2FSEB 5CEXA 3E6HB 1C12B 5D7LB 5IBUG 4NKOB 4R4BB 5CD5C 5SX5H 3RVWC 5A3ID 2VSDA 4DK3A 4PV9A 4PRPE 5HGHA 1HK6A 1VACB 5FYLE 2DKUA 2NY1B 3MJ9L 4JGJA 2NY3B 1BBDL 2BNRB 2ITDA 1IC4H 4C83A 1QBML 4UUJB 2DQCL 4EOWH 1PX4A 3ARDD 4QXTA 2RBLA 5D5MF 1G6VK 2F53E 5D5MA 5I1HH 3NZ8B 1M1SA 2VAAA 3VH8A 1PSKL 3P9MB 3X17A 1NC4D 1KCKA 5GHWL 5E0QA 1A02N 3AS3A 3QEQB 3QT2A 4UDUB 5HYJE 2V5YA 1AKJD 4Z8FH 4TUOB 4X4YB 2OTUB 3OR7A 5E5UB 3I6LD 4YDKL 4OCWL 2VLMD 2ZKHL 3LOWA 5EFIA 3RWCB 5JQHC 4ZMAT 5F1SA 3B9KD 4GRMB 3UC0H 4N8VA 3TIDB 2E7LC 5BXFA 2D7QA 3OKDB 5GRVL 2C1OB 3RTQD 1ZT4A 4BZ1L 2VR4A 3ULVD 2XFXA 2PR4H 5HHXH 1CICD 3LCYA 1RJZB 3O8XA 4PTUA 2D7NA 4U1IB 3UTTE 4P9HC 2ICEB 2X42A 2YHGA 4JHZA 5E8OB 3NCFB 2DWEA 2XV6B 1Y6MR 3NCEB 4MJIB 3O2DH 2JLLA 5DO2C 1FFQA 5ESQA 3IDUA 1RZIA 3DECA 3FO2A 5HY9B 3Q1SH 3MRQB 2DQFB 3QNYA 2HLFD 2P5WE 1P69B 4WI2A 5IW6A 4HC1L 1RIHL 3LN9A 4NZDA 3IFOA 1A4JA 3L1OL 4K7FB 5BJTB 2ZG1A 1G7QB 3VXSD 3TNMB 5TE7H 1LNUA 1W72A 1Q1JL 4JFDA 4UQ3B 1UENA 4IHOB 2QQLL 5LAXB 5CHNB 5D1ZA 3Q3GB 5DUPL 1T5WA 1UWGH 3CXHK 5ICYA 2AJUH 4JDZA 3NZHL 1KF9B 4YHML 1A3QA 3QI9B 4NC2B 4PG9B 5GRUL 2XN9B 2V2TB 1A6ZA 2WANA 2DAVA 4WI7A 1VKXB 4HKJB 4QOKA 1EUUA 1FBIL 4FQJL 1CE1H 5KSBE 4PJ7E 2HMIC 1XMWA 2I26N 3C5ZB 1DEEA 2NR6C 4WENB 2HRPL 3EYUH 3L3DA 3PDGA 4P5MB 3H3PL 3QFJB 1EDQA 1K4CB 4DN3H 4U0RC 5BV7B 1MUJA 1FDLH 4RA3A 3PDOB 1T03L 1AJ7H 1S7SA 1EUTA 2W9LA 4KK9C 5IVOA 5ACLA 5IB5A 1KENL 3SDCD 3U6RA 5D7IB 2DRUA 1O0VA 3SKJL 5DSCA 2C5DC 2F5AL 4B53A 5JIPA 5F7EH 2VH5H 4HKBA 4AYFA 3RNQA 1DSFL 2R1WA 4QRTA 1QFPA 5E9DD 1ONQA 4IM8A 1NCNA 4L1HA 4PJ9D 5I1LA 1YEJL 1JWMB 5BVJB 2VXQH 3T0WA 4NCDA 4FZ8L 5FYLL 5C07E 3BWAA 4PJBF 5E70A 3QNZB 4UILL 4DTGL 4PJBA 2IFGA 5GIRA 4YEFA 5LBSH 4FFYH 4RMQA 4U6TA 1FL6B 1P53A 1JGDB 4QRSB 5SX5K 4HWEH 3MJ7A 2CK0L 4PP1C 5JW5A 1SY6L 3MCG1 4FQXD 4DEPB 3MA7A 1OLZA 4WY7L 3T3PE 3B6SB 4XC3H 1Q9KA 4YHLH 4PJIB 4DVBA 3TVMB 1IZJA 1FGVL 3D2UD 5BV7H 3DUSA 3JTTA 2A6JB 5IT2L 1PYWA 3G6JF 3L9RA 1FV1B 4PJGB 1RVFH 4OGXH 3C8KA 1FRGL 5TQ0H 3D0VA 4M8VA 3BKMH 3VJ6A 4YHIA 2RQ8A 4OM1L 2RHEA 4BUGA 1T4KA 2VYRE 5GGUB 2V9RA 3VU2A 1AD9B 5DJ2B 2FSEA 4MB4A 3E6HA 4HZLA 1C12A 5D7LA 4L9DA 4R4BA 3V8CA 1B2WL 1B0GB 4YE4H 4Q9QL 4P2OC 3HI6H 3TFKC 3AMKA 1VACA 4DUXA 1R0AL 1BQUA 4MJ4A 2H1PH 4MXQC 2BNRA 2FATL 3MOQA 3O2DA 1YMMB 5DGQA 1RU9H 3IXTB 1PBYA 3REVB 3WJJA 1CR9H 4UUJA 3OGOE 2W0KA 5L0QB 4PJCE 5L2KD 5HHVH 2ZCKH 3RY6A 2PYEE 3NZ8A 5LKNA 5DC9B 4YHOL 5EZLA 4Y8DC 2X9YA 3P9MA 4RMWA 4XH2B 4JKLA 3SDAD 4O02L 4M48L 4X4XB 1U95B 3QEQA 4UDUA 5DK3A 3FB8B 5T1LD 3GHBH 3ZDYF 2WLZA 4RZCB 2B1AH 3MTRA 4TUOA 4X4YA 1MIEL 4F7TB 2OTUA 2EDBA 4TULH 3JXAA 3TN0C 1MELA 4MNGB 3QULB 1XIWB 2NY4B 1OAKH 1ZANL 4K7PX 3RWCA 3I6GB 5EOCJ 4GRMA 2DIAA 4M7KH 4F7PB 3QIUC 2C1OA 5CUSH 1UA6L 4PLKC 4W4OC 1FLTX 3ARZA 5DFTA 4EVNA 2K3TA 1RJZA 3T04D 4FQQB 2R0ZH 4FQ1H 3UYOD 1OY3B 4U1IA 5E8DL 2ICEA 4X6DE 5LG1A 5E8OA 5T1DH 2W0FB 4MJIA 2APWA 2MCPH 4XI5D 2AW2A 2P24A 2Q7YB 1YYML 1VFBB 1IFHH 2VERN 4NZTH 4JKPL 5FO8B 5HY9A 4LP5A 4LSVH 3MRQA 3HRZB 5DJ6B 4LPXA 3VI3F 3E3QC 4KK6D 3VWKC 4K7FA 1P6AB 5BJTA 4JFPB 1J1XH 1G7QA 3TNMA 4O9HH 5HGBB 2R29L 1TITA 4IHOA 5LAXA 4NJ9L 4R90L 5CHNA 1L7TH 3NIFF 3DI3B 3Q3GA 1EERB 1FAKT 3LD8B 1XCTB 1JHLL 4LSRH 4N0FB 3O2WH 1KEGL 3QI9A 3CUPB 2LTQB 1Y0LB 4PG9A 2HAZA 2XN9A 2R4SL 3EFDH 1EXUB 4KHTH 3O8XD 5BVPH 1VKXA 1A1NB 4HKJA 1RIUH 4JVPA 5F9OL 2F9BT 1EMTL 3C5ZA 1RZ7H 4NQCA 2YD5A 4P5MA 3QFJA 3P0VL 4R6UA 1K4CA 4OZFB 3WUWB 3MROB 5DVKA 3CGTA 5INCB 4ZAKC 4LU5L 3STBA 5IHUL 1A9EB 3RIAF 4XVUC 1F2QA 5I9QB 4S1DC 2EIEA 2CD0A 1MEXH 2DTML 5CZKA 3QDJE 4MJ6B 4JFDD 5D7IA 3B2UD 3S4SG 4NKMB 1WT5A 3V4PH 1V3KA 1S7RB 4NFDA 4QYOB 5D1ZD 3MLZH 4Q9BA 4XNUH 4LCYB 5I66B 4UB0H 4POZD 3CVHL 4WFFD 1MCWW 4WHCA 1G9MC 15C8L 4X4ZA 1JWMA 5LCVH 3RIAK 4NOBA 1R3KA 2KH2B 1DUZB 5ALBL 5DUBB 4Z9KB 1QLEL 5D7JC 4YHKL 3QNZA 1BMGA 2R0LH 4XPGL 4QOKD 3P4NB 4M62H 4OUOA 5E56A 2VKXA 4MAYB 1KJVB 1UM6H 3PNWB 1T20A 3WEXB 5HSFA 3HRPA 1FL6A 3LHPH 1JGDA 1J1PL 2XTJE 4QRSA 4XCCH 3VGAC 3M8OH 4JFHD 5I71B 1YY9D 5DWUL 1BFVH 3C6SB 4JQXC 1FNFA 1K5NB 5EU4B 4PJIF 3B6SA 2YZ1A 3Q5TA 2XZCH 4PJIA 2Z93B 1F8TH 4OZFH 4Y5YB 3TVMA 1R3IL 3DURB 3S96B 1Q0YL 1TZHB 2A6JA 4XAWL 4MMXC 3QCUH 4PJGF 4O4YL 3S37L 1CD1B 1FV1A 4PJGA 3W82A 4PJ8B 1RSFA 2WQRA 1QR1B 1MLCB 3DX8B 5IBLC 5MERB 5I19H 1FNSH 5GGUA 1AD9A 5FM5M 5DJ2A 3B5GA 1JHKL 1BZ7B 4JO2H 1JNNH 4J1UB 3DGGB 1PQZB 3U30B 3ROLB 3MV11 4KZEH 1B0GA 1CDBA 1I8IB 2BX5A 4KI5C 2FBJL 1J1OH 1MJUL 4O58L 4RGMB 4AH2B 4AIXA 5I6XB 4QHMB 3HFML 1IC5H 3RJQB 3R1GL 3U7YH 3WDIA 5EN2B 3HHRB 5KW9H 1UJ3C 1JZ4A 1G7IB 1YMMA 4JDTL 3IXTA 1U3YA 3REVA 5FAAA 4OCMC 4PJEE 1QNZL 1MI5A 3EYSH 5E03A 4IBLT 4BQ9A 5JXAL 5K59E 4OLUH 1UFUA 3UJJH 4XPFH 1CFQB 3AC0A 2FJGB 4XH2A 3OJDB 3QCTL 4U6VH 4X4XA 1U95A 4OI9A 3FB8A 4JRXA 2A83B 4EBQH 2EZ0C 4RZCA 1CLOL 2HFGL 5E00A 4F7TA 2WP3T 5F6HJ 1UYWL 4MNGA 5D7LD 3QULA 1XIWA 2H45A 4ZS6C 5B3JF 4ZSOE 1N8ZB 3I6GA 2WZPD 1U3HC 3NA9H 3HNTH 5GISL 4F7PA 1A3RL 1ZWIA 2P48B 5FEBA 2FIKB 2DQJH 4R7DB 2NY1D 4UTBL 3UX9B 4HDIB 4YXKH 4L9LC 5DQJB 4XNZC 3CH1B 4JPKL 2OK0L 5DMIL 1X44A 4G6AD 2P1YA 3SDXF 4FQQA 1GJIA 1KCUL 3HG1E 3SDXA 2E7MA 1CZ8L 1QRNE 2NY0C 2W0FA 4B5EA 4BZ2H 2O5XL 5IWLC 1CT8B 3P11H 4QHLB 5I74B 1VFBA 2A9MH 4ZOEA 1XGRA 3MUY1 3IB4A 5FO8A 4HGWB 1LEGB 3DVGB 2FB4H 1TZGH 4M3KB 2ZWLT 4HCRL 3HRZA 5DJ6A 5HDOA 2J8UB 3QEQD 3MLUL 4U33A 2YMXL 3TBWB 3BI9X 5HDQH 4PLNC 4JFPA 3BPOB 3EZJB 3UPAA 5HGBA 2VR5A 1I3GH 4LQFL 2FEDC 5DJ0B 4LVHB 4ENEC 4YWGH 4KKAC 1XCTA 5F3BB 5J13B 1HIMH 3LV3B 4N0FA 4G8GB 2BXZA 3CUPA 5DS8B 4G42B 3UEZA 3PQYB 1Y0LA 2LAGB 2Y06L 1CTOA 4Y5VB 3WFHB 4JRYB 3RWHB 2JK5A 4H25A 2KL6A 4RISH 1A1NA 3SBWA 4I3RH 4P4KD 4YBQD 4MJID 4XBEH 3THMH 4XPAL 2YPLB 3VFUB 4XWGH 4OZFA 3WUWA 4FQLL 1A7QL 5DRXA 5HYFA 3MROA 5INCA 4HHAB 1A9EA 3NIGF 1OCWL 5E7BA 1F6LL 1C1EL 3OSKA 4POUB 3V7AE 5C0JB 1NLBL 4LPCA 4QRRB 5SX4H 4LEOB 5TPWH 3PGDB 1U8JB 3LKRB 1PDKA 5T1MB 4LLMB 1EV2E 4X7SL 4MJ6A 2EO9A 4NKMA 2CKNA 3GSUB 5GGVL 1S7RA 4QYOA 5ITBL 2PW1B 3GI9H 1NCBL 1GHFH 4LCYA 3L7FA 4KQ3L 5I66A 4XCFL 3QI9D 4MNQB 4F33B 3CMOL 5F9JB 2VE6B 2ORBH 1DUZA 2XN9D 5DUBA 1FL5B 4FFWC 4P5TB 3KPMB 3H7BB 4M6AA 3NA4A 3P4NA 4XPBH 4FQIL 3K1KC 1YEFH 1KJVA 2EDNA 2HT3C 4XHJD 3WEXA 4D94A 3C5ZD 1UXSB 4ZTOH 2G75B 4NQCD 4MLSA 2VXSH 1A7PL 2AEPL 3QFJD 2QHRH 3KLSA 2VLME 4M7ZB 1FSKB 25C8H 2ENSA 1EGJH 1QLRB 3C6SA 5J11C 5DD0L 3DVNA 4XP4L 4JY5L 3EO0A 1K5NA 1MPAH 5EU4A 3QAZC 3LRGA 4ELMB 2Z93A 3MCKB 1IVLA 3S96A 2RJMA 4X6FB 4G6JL 1CD1A 2NY6C 4OLVL 4PJ8A 1FZKB 1QR1A 1MLCA 3GSRB 1CDIA 3DX8A 5C2BH 5MERA 3P9WB 2D4DA 3KDMB 5ID0B 3N1PC 1KIPB 2FNBA 5BMFL 5IJVB 1WJ3A 5F6IB 2FZ3B 3L3IB 3QIBB 4J1UA 4ODUB 2AJSH 1PQZA 3DGGA 4JHWH 3ROLA 1EVTC 4M1CC 3R0MA 1RZFL 1DZBA 3MRPA 4AG4H 2X7LB 2H32H 3ZT5A 2QSCL 1I8IA 3L5JA 2FHCA 2V9QA 3HZKB 4AH2A 4U6YB 4MZ3A 4QHMA 4GXUM 5EN2A 1I3RA 2XZAH 1CDHA 1X5AA 4QTIL 4MA7L 1G7IA 2E5EA 2V5RA 4YIQB 2BFVH 4ODVH 1PG7H 3RDTC 1FVCB 1H0DB 2YKLH 3KPRB 3EKCA 3OPZL 4JREB 5E2WL 3TVMD 3VW3L 1JZ2A 4WCYL 2DDQL 4DW2L 3RBSA 2DI9A 4NN5B 1B4JL 3C6LB 2FJGA 4Y88A 3V5HB 1RI8A 3OJDA 4GKZB 3QB7C 3BFOA 3QUXB 4YQXL 1QO3B 1FG9C 4LEXL 1N8ZA 4KMTL 3BKJL 5DURB 3ZSTA 2VZ3A 4O5LL 4TVPL 2FIKA 5A43C 1KCVH 4KKCC 4R7DA 3IFNH 3WO3B 2NXZB 4HDIA 3L3GB 5DQJA 3CH1A 2DQIH 3CD4A 1H3PL 1YMMD 2YPKB 1G0XA 4LOUC 5E9DE 1MI5D 1BAFH 5EG6C 4NGHH 5CD3B 2JCCE 2H9GB 1CT8A 1D5IH 4KROB 4YEEA 3ZKSD 4X4ME 2BMKB 3VI4E 1HKLL 1MFCH 2XY2A 1LEGA 3DVGA 4K07A 1F4HA 2J8UF 2YD1A 3PP4L 1KB9K 4QHKI 2J8UA 1T83A 5I8KH 1H8OA 1T22B 4JRXD 5KVFH 3SDDC 3TBWA 4L4TB 4LCCB 1T21B 3H7LA 2WNGA 3OGCB 4NKDB 4CJ1A 4DFHA 3MODH 2XA3A 5INDA 4RAHA 3INUL 3T08A 1XIWD 4G9FE 2KBGA 4J8RB 3M1BB 2PN5A 3U0PB 4GKOA 3LV3A 4I0PD 4G8GA 7FABH 3NH7H 5DD5H 5DS8A 4G42A 3PQYA 2FJHB 4LCUA 3WFHA 2OTPA 1SYSB 1PFCA 4WI9A 4JRYA 4N8PA 3HNVH 4F57L 4NP4H 1A6WH 3UZQA 1EGJA 3ULVL 2YPLA 2A1WH 3VFUA 2YC1B 5JR1L 1FORL 3U0WH 1BZ9B 1FZJB 2X4QB 4HHAA 4F2MA 5FA4B 4ZFGH 5HDLA 2VQ1B 1QPPA 5C0JA 4LEOA 3PGDA 4LHJB 3LKRA 2EDYA 5T1MA 3TIEB 4Z77A 1JTTA 5D9SB 4LLMA 3RVXD 2WM0A 5I8OL 4K3HA 2G5BB 3GSUA 2PW1A 3VD7A 2AJYL 1T2QL 1RY7B 3LRSB 5L2KE 4BJLA 5JOPD 1AC6A 4JQVA 3WLWC 1GGBH 1NSNH 4HSQA 1DE4B 4MNQA 2WUCL 4F33A 1CGSH 5F9JA 2VE6A 4ALAH 2PTUA 4WW1A 1FL5A 4P5TA 2R1XA 3KPMA 4L4VB 3IAGC 3ZDZF 2VUYA 3VD3A 4R96A 3OZ9L 4ZYKB 1FNEB 1XAUA 3SKNB 1UXSA 3ULSB 1L7IH 2G75A 4LSSL 1G84A 4NKIH 1WZ1H 1OF2B 1N6QL 3TO4B 4HPOH 2H8PB 4I3SL 5B22A 1A0QH 4ELMA 4G5ZL 2FECI 1GC1L 4TUKH 3MCKA 1P6FA 4DFIA 4X6FA 4MXVF 4OZ4B 3BJ91 4ZDHB 2ZJSH 1X5GA 4OJFH 1SBBA 1FZKA 3GSRA 1NFDB 4B50A 5ID0A 3T09A 3WBDA 1KIPA 4N5UA 5D5ME 5CSGA 3GM8A 5IJVA 1MCRA 4C54A 3DRQB 2EC9U 2HWZH 3PWUB 3L3IA 3QIBA 1A14H 3H9SB 4HS8H 4ODUA 2B5IB 2F58H 2AJXH 5HVHB 1E4XH 2X7LA 1IZKA 1CGTA 5TDOB 1VADB 2H41A 1JGLH 1BF2A 1KJ2B 1C5BL 3B5HA 1ZHBB 3HZKA 4JR9L 1CFNB 1NH6A 2VZVA 3IU4L 4U6YA 2CUIA 1QHOA 3I50H 3LEYL 4NC1E 2UWEF 1N4XH 1QVOA 5AZEH 1K2DB 1YQVH 1MNUL 4HUKB 3SQOH 1GGCH 4YIQA 1P7KB 3G08B 1FVCA 2NXYC 1EJOL 1H0DA 1OAUH 2VXUH 2AI0H 4NZRL 4NKQB 4G6KH 1UACL 4MJ5B 1QSEB 1TPXB 3C6LA 4D3CH 3VRIB 1MSPA 2YA0A 3KPLB 3V5HA 1F11B 4JO3H 4PJ8D 1F4YL 3DV6B 2QEJA 4GKZA 4DKAA 2YD4A 4ETQB 5LWYL 3BHBB 4GAGH 5DJCB 2JB5L 4HF5H 1N5YL 3MREB 1KIUA 3QUXA 3IVKB 1QO3A 1NLDH 5IVNA 2BOCA 4OLZL 5L2JA 5F8RC 3REWB 4TTDC 1DQJB 1S78D 3ZTNL 4TNVF 3MFFB 1FH5H 2DQGL 1MVUB 4QXUH 4JFDE 1Y6NR 4J3TA 4HUVB 1Q38A 1WQVT 1IGJB 3K3QA 1JBJA 1I9IL 2YPKA 2G60H 3D0LB 1PLGL 2Q8BL 1KIRB 4HJJL 1J8HB 4WFFE 3BKCH 1FFOB 4ZUWB 4LKCB 4HEPG 5CD3A 5HHOB 4HQQH 2H9GA 3KR3L 3NACH 4KJYB 2IAMB 4TNVK 4HUWB 4DZ8B 2BMKA 4PJXF 2EXWC 3ES6B 3SY0A 4KHXL 3B5TA 4PJXA 1UKQA 2XA8H 1TNNA 2R9HD 3BN9C 4Q7DA 1T22A 2XTJC 5JHLL 5GGSB 4L4TA 5MEOB 1EFQA 1T21A 4LCCA 5H94B 3OGCA 4JFHE 4NKDA 4PUBL 3QRGL 4NBYB 4YX2L 3QIWB 5AD0B 2AXFB 2YWZA 3I6KB 2WUBH 3FQWB 4NFBA 4PY8I 1P4IL 4J8RA 4XNXH 1JNLH 1YPZB 3WFDH 3SKOB 2EEDA 1WZKA 3U0PA 3T3MF 3ZKND 2ZUYA 4QRUB 3OJVC 1OPGL 2FJHA 5K9KB 3PHSA 5DJXB 1SYSA 1CF8H 5E4EC 5EDXA 3OKEB 3GSVB 5SX4I 2FL5B 4AZ8A 4HGMA 4XCYB 5EBWB 1DR9A 2Z91B 3WV0A 1X5XA 2FJFB 4JJ5B 4ONOA 3SKUD 1F6AB 3VXNB 1Z5LB 2YC1A 3LKSB 1N59A 1YNLL 4HG4K 3RZCD 3ELAT 4PJBE 3MLVL 1BZ9A 1FZJA 2X4QA 4GXVH 5FA4A 1I1YB 2VQ1A 1NL0L 4PJFB 3QNXA 5FYJH 3H2WA 1HILA 4GQ9H 2P8PA 3TIEA 1KPUB 1O5DT 4XP5H 5D9SA 2ATKA 3VD5A 4HAGA 3QUZB 5E99H 1OVZA 5CGMA 2G5BA 3UMTA 3BISA 4APQB 4LFHG 5DUMH 3TCLA 3WS3B 3QDGB 1A5FH 3LRSA 4LCIH 1MCPL 3QHZL 4G8GD 1KT2A 4YBHA 3GB7B 3PQYD 5JHDA 1DEDA 3G6JE 4L4VA 3T0AA 2FH6A 1ZA6B 1GOFA 1TCRB 4ZYKA 1F3RB 1FNEA 3SKNA 3ULSA 4DOHE 3S36X 3OKKA 1CL7H 1YEDB 5D7LE 3CLFH 1IGFH 1KLFA 1OF2A 2HH0L 3TO4A 2NW2B 1FC2D 2H8PA 3G9VA 1YZZA 5DFWH 3V79C 4DQOL 3IFLL 4LSTL 2VLKB 2XZQH 3PF2A 4OGYH 2A9NH 4MXWL 1MHEB 4OZ4A 5J4MA 2D03L 2YZ8A 4I9WD 4ZDHA 4H26B 1J18A 3CX5K 2CO6B 2PTVA 1NFDF 1E28B 4UINH 4A6YB 1NFDA 1U8KB 4XXCA 3A6OA 3EJZC 1D9KD 1X4XA 3RWGB 4NZUH 1XGUB 4QKXB 1I7TA 3DRQA 2ICCA 1W72L 3SCMC 3PWUA 4EZMA 5I1DB 4ODSH 3H9SA 2O93L 5L88H 4DJMA 4P5TD 3QEQE 4GRWB 2OJEB 2EYTB 3TBSB 1VADA 3O9WA 3ZDYE 1C5DB 1KJ2A 2GCYB 1ZHBA 3QUMB 1HKFA 1CFNA 5JA9A 1NCWL 5DR5L 1MFAH 4M4RA 3F58L 1K2DA 1ZE3C 5DGRA 3QPQC 1P7KA 3G08A 2YPVL 4XAKE 5D96B 4ODXB 4AQ1B 5CGTA 35C8H 2DN7A 5F7DB 1VPOL 2FLRT 3VDCA 1D5XB 4MJ5A 1QSEA 1TVHB 1IKNA 3MZTA 3S35X 4JQIL 3VRIA 1PZUB 3KPLA 1BQSA 1F11A 3U7WH 1JNJA 3DV6A 4P49A 2Q6WB 4P59L 4M6ML 1TETH 4YHNA 3WD5H 4MJIE 5KANG 1EX0A 5DJCA 3AM8A 3MREA 4JY4B 3IVKA 2VIRB 4A6YH 3QIBD 3HC3H 4N90D 4RMTA 4K3EH 5I30H 3CDGB 5A3IC 4FQ2L 4U7MA 3RQ3A 3TH4T 5JO5B 3T2QA 1DQJA 1E4KC 3ARGB 1PX3A 4Y2DB 4Y1AE 3VI3E 3MFFA 2J1KA 1Z2KA 1MVUA 5J12C 5HBBA 2AV1A 4WW2C 4GRWH 1IGJA 3ARDC 2D7TH 3NIFE 3D0LA 2OSLB 3QUMH 5DZOA 1FIGH 1OP9A 1EK3A 1J8HA 1T80A 1FFOA 2Q76B 4ZUWA 4LKCA 2MOVA 2JJWA 3GBML 1QFUL 2B0SH 5HHOA 4EOWL 4KJYA 2IAMA 5CMAB 4HUWA 3P4OB 4DZ8A 4S11A 3ES6A 2VDMH 4D0DB 5I1HL 4E0RB 2X4OB 4N1EA 1T6WA 5HPMB 3RWDB 3BDYH 4ZS7H 1RHHB 1Z3GH 4NQCE 5CJXA 2DYPB 2YSSB 1YEGL 4WO4D 5MEOA 3QFJE 4GS7B 2YN3A 3GIZH 1YUHA 3QIWA 3QUXD 2AXFA 2C4XA 3B9KC 3I6KA 4KGLA 4NCC1 5AD0A 4RRPG 4Z8FL 3FT3B 3RU8H 3FQWA 3TJHD 4FRWA 3RTQC 1YPZA 1JYXA 2YUXA 3SKOA 3ULVC 3TWCH 2Q7NA 5CILH 1CICC 2ERJC 4S0TD 3D25B 4QRUA 2CO7B 3UC0L 1DBBH 3CFBB 5K9KA 2NXZD 5DJXA 5KJRL 2IBZY 3OKEA 5HHXL 4CVXB 2FL5A 3C09B 3CFEB 4XCYA 5EBWA 1QTYT 2FJFA 4JJ5A 4MCZB 3VFSB 2A2QT 4KROD 2HLFC 3LKSA 1RUAH 3O2DL 5MEPB 1NCCL 4XC1L 4LVNB 1MJJB 1I1YA 4PJFF 3MNZB 1AQKH 4PJFA 3UP1A 5I1IH 5EU3B 4L4TD 3R8QA 4NYLB 3KJ6H 4UAOB 1KPUA 1OGAB 2ZUQB 1IAIH 4LHUB 4DN4H 1BGXL 3QUZA 4JVWA 1ZSDB 5KOVC 4KRLB 3VCLB 4APQA 3QYCA 4KTDH 5TQ2L 3WS3A 3QDGA 4NCC2 4PJIE 3IDJA 4P23D 3WKMH 1VSCA 1HWHB 2AJUL 3GB7A 3PGCB 3VRJB 3MZGB 2FGZA 4PJGE 1OLLA 1YQ2A 5FGRA 5I0DA 1GC1C 3H8NA 4IEFB 1QEWB 1ZA6A 1T2XA 1TCRA 3DOSA 3L3OB 1VGKB 1JZ8A 3OAUL 3IF1B 2D0FA 2RAMA 1CE1L 2Y9RT 4G9DB 1YEDA 5F71A 3EYUL 1WITA 2NW2A 4HKXB 4PJHB 4HKZB 4ZODA 2VLKA 1BBJB 3E6FB 3SDCC 1AP2B 1FDLL 3KPOA 3ZYOA 1MHEA 4FABH 5LQBH 3LN5A 1E4XI 3UO1H 3FO0H 4H26A 2X4UB 3WDHA 4PJ9C 3MC0A 3KPNB 1E28A 4A6YA 1MI5E 2LVEA 4LHUG 2EDFA 2VH5L 5BZWB 1XGUA 5CIPB 3MXVL 5DVMA 5I1DA 5JHDD 1OT2A 4IJ3C 2FX7H 2O26U 4GRWF 1LP9B 4JRXE 2YXFA 2IANB 2OJEA 3FB7B 2N1KA 1W0WB 1C5DA 3GK8H 4MD4B 3QUMA 1C8PA 4FQXC 5I1CH 5LBSL 4FFYL 4MNGE 1P84J 3T1FB 1A7NH 3IETB 5B3JE 2X05A 1YC8A 4RGNB 3TO4D 2I5YH 4HWEL 4KDVA 2IQ9H 1YY8B 3HLAB 4ODXA 4NUGH 4L8SC 4CMHC 1MLBB 1F4XL 3O0RL 5F7DA 4F8TA 3H3BC 1TVHA 3LS4H 4M93C 5BV7L 3GJFB 5KVGH 2PF6A 3SDXE 1X5JA 3JUZA 1LO2H 3BQUB 4RRPA 3UTSB 2EYRA 2Q6WA 5CS7A 5DK2B 1RVFL 4MQSB 4OGXL 4H0HB 5TQ0L 3GMQA 3V4UH 4KH2A 1WISA 1V3MA 3H9HB 2YA1A 4JY4A 2VIRA 4QHUB 4TQEH 4XT1C 3H9SD 4CW1B 5IUSA 1GIGH 3HMWH 3OKYA 5ISZB 3CDGA 4JZJB 2EE9A 3GUTB 5JO5A 5CIPH 3ARGA 2QTEA 4Y2DA 1ND0A 2P46B 3O9WD 4YE4L 3HI6L 5EWIH 3PUCA 1EFXA 2E8YA 1HHJB 5JPMB 1KTDA 3BRFA 2OSLA 2H1PL 4HLZH 2C9AA 4HLZG 5IHZB 5JOPE 1T1WB 2Q76A 3F7QA 1RU9L 4UQ2B 3AS2A 1CR9L 3SDAC 5DA0B 5CMAA 2AV7B 3VFWB 3P4OA 4D0DA 1KIQB 5JIIA 4E0RA 2NPLX 2X4OA 5FHBH 4EXPX 1NUDA 4AIZB 5D93B 3OKLB 5HPMA 3RWDA 4WUKL 1MCOL 1UG9A 2DYPA 1REIA 4ZTPH 3UAJD 3FT3A 5CJ8A 1MCIA 2JB6B 4TULL 4JKMA 5L8JB 3NIGE 5M94B 1N26A 5FHAH 5A2KH 5AZ2H 1WAAF 3D25A 1WAAA 4EIZC 1G9MH 3CFBA 4M7KL 3RY4A 2ARJQ 2MKLC 3EOYG 3RPKA 4NHCH 3N1GC 1J05B 1CVSC 3EBAA 4Y2OA 2V5TA 4XI5C 4CVXA 4N8CH 3CFEA 4X8JB 1J8HD 2ADIB 3H42H 1S7XB 2R0ZL 4FQ1L 5DMYA 3V52H 1FC1A 4MCZA 5HHOD 3VFSA 3ET9F 5GS3A 2IAMD 3MV8B 4LKXB 5MEPA 2MCPL 1A7OH 5FYJD 2W1NA 2M2DA 5EIVA 4N9OB 1IFHL 5C86A 4KK6C 1MJJA 3MNVB 4NZTL 5CKAA 1MHHB 3FJTA 1DANT 4LSVL 4MSWB 5EU3A 4NYLA 2Y36H 4XP6H 5DA4A 4QWWD 4MDJB 2YEZB 1OGAA 3QIWD 4H20H 3BWUC 4LHUA 1R5WB 1TDQA 4BK4A 2VTFA 2JJSA 1ZSDA 1J1XL 2BHZA 3VCLA 3EOAA 5F7FA 2ADJB 2QSTA 3C5JB 1P9MA 4AQOA 4BQBA 3L6FB 1CL7I 1KJ3H 4PRIE 3O8XC 3RA7H 3PGCA 3VRJA 1BBDH 3O2WL 4OFPA 1MCHA 3Q0HA 3PWPB 1QEWA 3EFDL 3MRKB 4FQPA 1TTUA 4D0CB 3L3OA 1VGKA 3FQUB 4OD3H 1WVZA 8FABB 2P45B 3KPTA 4GRLB 4G9DA 4KUZH 4Z7NF 3BUYA 1BLNB 3DX9B 3A0OA 3KWWB 3ARBB 4PJHF 1FFPB 1AGBA 2WMPA 3H0TB 4HKXA 4PJHA 4P2CG 4HKZA 2I9TB 1VEMA 1BBJA 3E6FA 1JV5B 4NUJB 1AP2A 2Z92B 3GHEH 3B2UC 4PB9H 1DVFB 5D1ZC 1KJMB 3WL9B 1FN4B 1NUFA 1FPTL 4P46B 3QUZD 4POZC 2AXJA 3S88H 4APQD 3KLDA 3KPNA 4FTVB 4LRIA 3QDGD 2GJ6B 3F5WB 4OQ1A 3V4PL 2KZWA 4L8BB 3WXVL 3MLSH 3MLZL 1RZJH 4BZ1H 4XNUL 5CIPA 4PJAB 4UB0L 4RFNC 3JV4B 3QPXH 2ADGB 3VGBA 1UH2A 5J7CC 5F1IB 2PCPB 2APBA 5IROA 4CU8A 3FB7A 4RAVA 4X6EA 4RWYH 1W0WA 2R0LL 2PO6B 4LPTA 4OBSA 5CBAA 4MD4A 1YY9C 4EQ2A 1GZPB 4XB7A 2AK1H 3RBGA 5FGCB 4HWNA 5IMKB 3FZUD 3O3DB 3T1FA 1BD2A 3PHQB 3IETA 3BE1H 4M00A 5ERWB 3TYGH 3M8OL 4NQEB 3JSSA 5KANI 1YY8A 2VLKD 3HLAA 5EBLB 2ZG2A 5L7XL 4UI2A 5IHLB 1MLBA 1M05B 1NCUA 2IPKB 1Q1JH 1G0YR 3EDFA 2XZCL 5IOPB 1F8TL 3JV6B 2PKDA 4KMLB 3Q48A 1GSMA 4ORZC 4W81A 3QCUL 4IIQB 4S0SD 1A7BA 3UTSA 2A77L 4YHMH 3MYJB 4FG6D 5DK2A 2FCBA 4Q58C 2OI9C 2FBOJ 3BH8B 5I19L 3MJGX 1FNSL 3H9HA 3UTPD 4KPHH 2VL5B 4URTB 1RMFL 4CW1A 5ISZA 2FECL 3QDHA 3ROOB 2PETA 4JZJA 1FBIH 2A6IA 4JO2L 1M7XA 2J8UE 1BFTA 3GUTA 1JNNL 4K9EH 2HRPH 4U1GB 1LHZA 4GQPH 1J1OL 1RD6A 3BUTA 1AXTH 4KUCF 4GMTH 1CDCA 1HHJA 5JPMA 1WCQA 1F45A 1R3HB 3QJFB 4I77H 3U7YL 4JN2B 5ADPL 1T1WA 3I9GL 4UQ2A 4HG4J 4F15B 3PQYE 3CJJA 2VR9A 3NGBC 5D6DA 2AV7A 3VFWA 3EYSL 5GGQH 2MQ3A 3S35L 3LKPB 1F00I 3SO3C 4OLUL 4S1SH 2OYPA 2YD6A 5ICXB 5F89B 3UJJL 1MIMH 4XPFL 3IRZA 4AIZA 3OKLA 2VSCA 4U6VL 2KUTA 3MRMB 1S9VB 4JANB 3BESR 3RI5K 3B8SA 3V8OA 1HSBB 2CR6A 3DXAB 5F1NB 2P42B 2JB6A 5E1AB 4EI5B 1MOEA 3KJ4B 4TSAH 4PJDB 2BSTB 3NCJH 1BEYH 1HXYA 3KPSA 3BD5A 2NY1C 3ARGD 4Y2DD 1S7VB 1XR8B 5T5NG 1BIIA 3K4DA 4G6AC 4NIKB 1U93B 4XVSH 3WJJC 4I9WE 3NA9L 3IFPB 4GLRH 1BFOB 1EFXD 3HZMB 3L7EB 1EZVY 2DQJL 3B2VL 5FCUL 1DL7H 4YXKL 2BVPB 3RY6C 4S1QL 1FNGA 2R2BB 4X8JA 2ADIA 3QXTA 2E3VA 1S7XA 3IYLW 4QF1A 3FOLA 5IT2H 4LKXA 4BZ2L 4R9HA 1EO8L 4DGIL 3FONB 3UXFA 4YXHH 2WBJB 4QO1A 5IR1B 4BM7A 3P11L 4LL9A 2D0HA 1MCBA 2R0KH 3ZDZE 2XXCB 5CLTA 3MNVA 5TJWK 5IVXF 1MHHA 1ODAA 2YXMA 4AL8H 5IVXA 2FB4L 1IAIM 4MSWA 4XWOD 3CX5J 4CDHA 2DYPD 2F54D 4MDJA 2YEZA 3C9NB 1R5WA 5HDQL 1QD0A 5E08H 2FDBP 1I3GL 1BECA 1KB5H 3SO5A 2ADJA 4NQDB 3UPRB 3C5JA 3IXAB 3L6FA 3EDJA 1WBYB 3VG9B 1IGMH 4R2GD 5GJTH 4OIIL 5DT1L 4MXVE 4KJPD 2LU7A 4P4KC 4YBQC 3PWPA 1DUYB 2VDOH 3MRKA 2W9EH 4RFEB 4D0CA 3ZTJH 3TF7C 4HIXH 3ARWA 3FQUA 3BP6A 4RISL 3ZTJG 4I3RL 8FABA 4N90E 1BLNA 3D39B 1JI1A 3DX9A 3KWWA 4ETYA 3ARBA 4XBEL 1FFPA 3THML 5JPNB 1KC5H 3H0TA 5IQ7L 3DSNA 1AI1L 4YNYB 1EO5A 2I9TA 4XWGL 1DBAH 5ETUB 4NUJA 4EKXA 2Z92A 3T0BA 2R0WL 5A40E 2CRMA 3VA6A 3CXDH 4U1KB 2Z8RA 1KJMA 3WL9A 2C1PB 1FN4A 2UWEE 4XBGB 4LHUD 5HYEA 5TPWL 5JDJA 2W9DH 1ZANH 3GBNH 4P46A 2C7UB 3KYKH 3QI9C 4FTVA 4LARL 5IB2B 3SQBA 2GJ6A 3F5WA 2DTSA 2RCSH 2VL4A 3VXTB 4L8BA 4XP1H 1UA6H 2NY7H 4Y4KB 3GI9L 1EEQA 1GHFL 4PJAF 2QQQA 1LILA 4PJAA 5E6ZA 2GW5A 3JV4A 2ADGA 4PJ5B 5BRZD 1CDJA 1Q9OB 4XHJC 2OBGA 2UUDH 2PCPA 3C5ZC 2ORBL 2X1WL 1IGCH 1IBGH 1SYVB 1TJGH 5B39B 4XPBL 3UCRA 1GZPA 1YEFL 4RA0C 5BV7C 2GITB 5IMKA 4Q9CA 1YEEL 3O3DA 5D71H 2QJDA 3PHQA 2X1XR 5ERWA 2VXSL 3DIFB 4NQEA 5A2LH 3GKZA 5KBNC 5GZOD 5CJBA 5EBLA 25C8L 1EGJL 4FQHB 1WT5C 3QHTC 1M05A 1ERNA 5BOPA 2IPKA 1VENA 3QG7L 2R29H 5H8DA 1FYHB 3AREB 5IOPA 1RURH 2EC9T 3JV6A 5IW1B 3CVIH 1XR9B 5FYKU 2WBWB 4IIQA 3OB8A 3MYJA 4D9QD 1KEGH 3D85B 3V6FB 1S3KH 2YK1L 5C2BL 3BH8A 5T5NF 2R4SH 1UVQB 4PJXE 4DUWA 2VL5A 3ZE2F 4UOW1 3ROOA 5ITFB 3OAZK 2AJSL 3RWFB 3QXAB 3SHSA 4L4TE 5JXEA 3FFCB 4AG4L 4PIRF 4G7YL 5E8EB 3P0VH 4DEPC 4PBVC 3EGSB 5IHUH 3OXRA 3HZVA 1BD2D 4UOJA 1R3HA 3QJFA 4RGND 1GL4B 5B39G 3TVMC 3V9FA 3WO4B 3GKWH 2XZAL 5T1KD 4ORGB 1HNFA 1JPST 3R06A 4NZJA 4GO6B 1NKOA 4M7JH 4U1JB 3T3ME 4F3FB 2BFVL 4ODVL 1PG7L 1T0NA 2ARWA 3MRGB 3RKPA 1BJ1H 2YKLL 4AIOA 3LKPA 1U8QB 4AEHH 5ICXA 5F89A 1U58B 4BKLB 5JQ6H 3UTSD 1WK0A 2WP3O 3QXDB 15C8H 4NBXB 3OHXB 1GPOH 3MRMA 1S9VA 4JANA 3WHE0 1KB5A 4HFUH 1S7QB 3B9EA 1QLEH 5ESAB 1HSBA 5F1NA 3DXAA 4PJDF 5E1AA 4ZUVB 2B8OT 5TF1H 4PJDA 3IGAA 1RK0B 2BSTA 3NIDF 1DLFH 1K4DB 1QYGH 5B4MD 1S7VA 3QCVL 1J1PH 3TH2T 2J6EL 1CXFA 4YHPB 1U93A 2XNAB 5GGTH 1BFOA 1PD6A 5DWUH 3HZMA 1KCVL 4KUCD 4WTWA 5L0QC 2XYCA 3B9DA 4TSCL 3AFLA 2BVPA 4Q9RH 5EO9B 2DQIL 2R2BA 4JB9H 4KJWD 1R3IH 5CEYB 1Q0YH 3IDXH 3TBTB 3NBNA 5JHDE 3PV7A 4NM8H 4NGHL 1D3CA 2WBKA 3FONA 3SGJA 2WBJA 1D5IL 1S9KC 2NLJB 1BQHG 1MFCL 4PRHD 1QUNA 4ACPA 3MGOA 1XIWC 4P2QB 5I8KL 1X5IA 3C9NA 1F4AA 5KVFL 2WWKO 4Z0XB 3BZDA 3BPLB 2VZTA 4I0PC 4U3HA 4G6FB 1MJUH 3KPSD 4NQDA 5F72S 3UPRA 3IXAA 1MREL 1H3WM 1WBYA 4RMVA 4J2XA 1NGQH 1OAZL 2YOCA 7FABL 5DD5L 4JDTH 5E8NB 3F12B 5KN5B 2XACC 2FD6H 5IM7A 5D2LB 1NFDE 2A0LD 1YDPB 2BY1A 4K55A 4RNRB 4RFEA 1EAJA 1UH4A 1A6WL 1QFOA 3GMRB 5D72H 4BH8B 3H9SE 5GQBA 3D39A 3RJDA 2XWTB 5JPNA 1GGUA 3FTGA 4QNPF 4YNYA 3RX5A 1OSPH 2APXA 4WEBL 3QQ3B 1CLOH 1TTGA 5ETUA 3RVXC 1EHXA 2EDWA 3U0WL 4L29B 5JUEH 3VFRA 4ZFGL 3W5MA 4U1KA 2C1PA 5I75B 4XBGA 3UDWA 3X3GL 3ILPB 5IB2A 2LTQC 5GISH 1A3RH 1JF5A 3VXTA 3BGFC 3GSWA 4Y4KA 2VDQH 4NNXB 1S5HB 4JPKH 2GKIA 3SBWC 3HC0A 3WNNA 1NSNL 5FA3B 1JPSL 4PJ5A 4FP8L 1Q9OA 4GG6F 4ALAL 3PWPD 2FX8H 1T66D 3H6JA 1SYVA 5B39A 4PRBB 4TYUA 3MX0A 3QDAA 4OGZA 4WDIB 1U2HA 2E9BA 1AGFB 2GITA 5GS0H 5IEHB 1L7IL 1L0QA 3DHMA 1WFTA 3QH3B 3DIFA 4NKIL 5EU6B 1WZ1L 5GXBB 4JO4H 3MLUH 1CQKA 4HPOL 4H8WH 4FQHA 2OR7A 4WGVB 1A0QL 3CCHB 3GJEB 1SM3H 4LQFH 43C9B 4TUKL 4CJ0A 5IW1A 5HI3D 5DZLA 4P46D 2HJKB 1XR9A 4ONHB 1J8HE 1QRKA 4FTVD 5HHOE 4E5XB 3D85A 4OJFL 3WKNA 1RFDH 3V6FA 1KGCD 1WEJL 5SWSE 1UVQA 3MOBH 3BPCB 5FYJE 3FRPG 4HFWB 3AXLB 5I18L 2XT1B 5ITFA 2UY6A 2HWZL 5GGTA 1H8NA 4BQ6A 4HS8L 4HWUA 1Z9LA 4PBWD 2AQ3A 1YN7B 3FFCA 1XGYH 3ARYA 1DN0B 5I71C 3MV7B 3FMGH 5E8EA 1SJEB 3OJ2C 3QUKA 3EGSA 1JGLL 2F19H 4FQLH 5DMKB 2Y25A 3CSPA 4GW1A 3WIIH 3WFCH 3X3FH 2I27N 2I9LB 3I50L 1TQBB 4OCSH 3V6OA 3HS0B 4ORGA 1YQVL 3SQOL 1U92B 1YYLH 1GGCL 4F3FA 2ZUWA 5BQ7B 4ZOBA 4PJ8C 3MRGA 1OAUL 2VXUL 1HCFX 4KTYA 2AI0L 1KXTB 4YHYB 5ITBH 3RP1A 1F42A 2OMNA 4C56B 1N2RB 4BKLA 4XCFH 4D3CL 1QFWM 1Q94B 3QQ4B 4HD9A 1MFNA 3OHXA 4JO3L 4GLRI 3CMOH 3U30C 1EHLH 3CZFB 1AY1H 4OIBA 1BQLH 1S7QA 2DF3A 4GAGL 1S78C 5ESAA 1KN4L 4LAJH 4HF5L 3CDFA 4ZUVA 2GY7B 4RGMC 1RK0A 5I6XC 4PJFE 1K4DA 4JZNA 4MD0B 4B41A 1NLDL 1JGUH 5JXED 3UYPA 3O3UN 2AEPH 4YHPA 2CJUH 1CXLA 3KYAA 4KAQL 1FH5L 4JY5H 3RHWF 1LEKB 5FKPB 5EO9A 1HSAA 1KJ2L 2G60L 3WSQH 2LU4A 3TBTA 3I3EA 3BKCL 2R9HC 4G6JH 4KK8D 1RJYB 4BZYA 4HQQL 1CGWA 4OLVH 5DJZB 1ZHKB 2NLJA 5FM4A 2DM2A 3JWOL 2HJLB 4OAWB 4QT5B 5C0ND 3NN8A 3RHWK 3MRBB 3GNMH 2XA8L 4K2UL 5IFAH 4PGZA 4P2QA 3EYFB 3QO1B 3D87B 1M71B 5I1JL 2WSKA 4Z0XA 3RWIB 1RZFH 5C0RH 3DXAD 3ZKNC 1BOYA 4RQQB 5F9WB 2WUBL 3MRHB 4W68A 3WFDL 2ZUXA 3PWVB 5CWSB 1JPGB 5IMMB 1CIUA 2R2HB 5E8NA 3HC4H 3F12A 4CAGA 5KN5A 5D2LA 5FYJU 1YDPA 1CF8L 3JTSB 4RNRA 5E2WH 3OPZH 5I74C 4X5XB 2E6JA 4I5BB 4WCYH 3RZCC 3UTPE 1GXEA 2R39A 2NY5H 3GMRA 1FZMB 4HPYL 4U0RB 4BH8A 4XHQA 1EAPB 5T3XH 1T83C 2WBJD 2XWTA 3MRRB 4GRWE 1OTTD 1DDHB 3QQ3A 3BPOC 5D2NB 3K81A 1U2CA 5MHSD 5HXMA 3ZHKA 4GXVL 1T04B 4LVHC 3VXRB 4YQXH 2NY2D 4GQ9L 1FQ9C 3TJEL 3ZSSA 4BSVB 1H5BB 2X4NB 4XP5L 3TC9A 4KMTH 3ILPA 1E4JA 2B1HH 2E7BA 5E99L 5BS0B 2EDRA 4NQDD 5DUML 3I2CL 4J4PA 2NX5B 3W39B 4XCEA 4OI8A 4NOFA 1PGRB 3O6FB 1IEAB 4NBZB 4NNXA 1S5HA 5E2TL 1IRAY 3OV6A 5FA3A 4N0CD 3ZHDA 4OD2B 4LPYA 1KTLB 4PRBA 4KI1A 1HOCB 1I8MB 1A1OB 4WDIA 3C60B 5KVEH 1AGFA 5HYQB 5IEHA 5HHPB 3D39D 1PY4A 4Z7OF 3QH3A 3PP4H 4O00A 3VDBA 2EIDA 5EU6A 3CLFL 1IGFL 2LVCA 4J3XA 2H2SD 1ORQB 4LHQB 3MLYH 3CCHA 1OAXH 3GJEA 43C9A 2XZQL 2WINB 3DMMB 4OGYL 2A9NL 3INUH 2Z8VC 2C4FT 4MDIA 4K7PH 1D9KC 1SVZA 2HJKA 3AB0B 1S5IH 4JQVC 1DBJL 1F4WH 4ONHA 5FOJA 4KXZH 4PV8B 4E5XA 4Y4KD 2YR3A 2R1YB 4UINL 4P5TC 1EPFA 1XF2B 3BPCA 4Z7VF 4HFWA 4NZUL 4PJ5D 3AXLA 4P2OB 4WNQB 4ODSL 5DXWA 5TF0A 1YN7A 1JFQL 5I1KH 2F54E 2UVFA 5IP4A 1DN0A 3MV7A 4M7ZC 5BO1H 1FSKC 5DMKA 1CCZA 1SJXA 4NWTL 1VCAA 2I9LA 4WV1B 1MFAL 2D7MA 3HUJB 4PLJD 2F8OA 3HS0A 4GAJH 1U92A 1SMAA 3NCCB 1WAAE 5BQ7A 3RVUD 1LGVA 4WGWB 5I8OH 1NEZB 35C8L 2PW2B 5BZDB 1VA9A 2BHUA 4C56A 1N2RA 1T2QH 3C08L 3JUYA 2Z4QB 1Q94A 3QQ4A 5C0AB 3U7WL 3QIBC 5EIQA 2WUCH 3TN0B 2GAZB 3CZFA 1TETL 3WD5L 2HA1A 2P8MB 1BVLA 4JZOB 3ECBA 4A6YL 1A47A 3HC3L 5A2FA 2GK2A 3ARRA 5I30L 3FFCD 3KLAB 4IRZH 2Y7QB 4LSSH 2RIKA 2VITB 3K4ZA 4DKFH 1N6QH 4I3SH 3M07A 2VLJB 4JREC 5J3HD 1ZK9A 1LEKA 5FKPA 1MAKA 3O11B 2UVEA 3D6GA 3BMWA 4NN5C 4UT6H 3VMPA 3QUML 1FIGL 1N6UA 5BRZE 1RJYA 2B0SL 5DJZA 3IU3A 1ZHKA 4LVOB 4HIJB 2VDML 1TVDA 2HJLA 4OAWA 4QT5A 1G7JB 3ULUH 2XZZA 3MRBA 1QOKA 3QUXC 1T3FB 1KACB 1NEZG 4UBDD 3TJHC 3EYFA 1U8LB 2C3VA 2ZOLB 3PL6A 3QO1A 3BP7A 4Z7NE 3L5XL 2Y5TB 3BDYL 2BERA 1M71A 3O3EB 3RWIA 1YEKH 4PJHE 5EPMA 4TTGA 3GIZL 5DFVD 1KELL 3FQNB 4YK4B 1W0VB 3MRHA 1C5CL 3RU8L 4HEME 4P57B 2J8HA 2NXZC 5ECJE 4HXBL 3TWCL 5LXGL 3PWVA 5CWSA 1MNUH 4E9LA 1CYGA 1JPGA 5IMMA 5CLWA 1LEIB 2R2HA 4B0MM 4HUUA 4Y19B 4KROC 5FO9B 3JTSA 1E27A 4CRPA 1F3DH 5C0GB 4X5XA 4I5BA 2EDXA 3PP3K 5FM5O 3OG4B 3KYOB 5K93A 1J0KA 1T6VN 4NQVB 1FZMA 4ZAKB 4YGVB 1LD9B 1MJ7H 1UWEL 3NFPB 1EAPA 5E5MB 4Z0BL 3MRRA 4LCCC 1DDHA 4I2XE 2X41A 1RIVH 1RUAL 4M03A 1YNTB 2HN7B 2OS7A 5D2NA 3P30L 3S3JA 2JB5H 4J6RH 1T04A 8CGTA 4P2QD 1AH1A 2E6QA 1AQKL 3DO7B 4EUPB 5I1IL 1BD2E 3FOMA 3RUGB 4UV7H 3EYVB 4RGNE 5A16A 4P23C 1T7XA 1H5BA 2P4AB 2X4NA 1S7WB 1IAIL 1NGWB 4RAUB 4RSVA 2D31B 4G6FD 4DN4L 5BS0A 4JY6B 3MRJB 4CADA 3W39A 2NX5A 6FABH 3FB5B 4KTDL 5HGDB 3O6FA 3HNSL 3MRFB 3DUUB 2N56A 3WKML 5J1SC 4H88H 1IGTB 3F65A 2IBZX 3F8UB 4HJJH 4EEEA 1ZA3A 5GS0D 4OD2A 2YUZA 3G5VB 1KTLA 1NBVH 3Q6GH 4OZIF 1HOCA 1I8MA 1A1OA 3C60A 3GSOB 1MFEH 4GJTB 5EIIB 5HHPA 3FB6B 4FQCL 1MCFA 4KDTA 5C08B 1II4E 5D7KD 2BNQE 1ORQA 4OUUB 3QRGH 4OF0A 1H3TA 4MNHB 1BJMA 2DMKA 2WINA 3DMMA 3VGEA 3FQXA 3MJ8B 5DEZA 3RVVD 2QSVA 4K3DH 5E1HB 3VG0H 3HKFA 1G1YA 5FIEA 4FABL 1M6OB 2AJZB 1D5BB 2EE2A 3UO1L 3FO0L 5E6YA 1NMBH 4OCRL 1CGXA 4J4PD 4ODWB 3O4OB 2R1YA 4E41E 5CEZH 1U8HB 2EICA 5GJSH 4P0DA 5MENB 1JF1B 3FAWA 5IEKB 5FB8B 1NMCB 4PRHE 1JK8B 4UV4H 4WNQA 1WWWX 2FX7L 1CE6B 3MUZ1 3QUYB 5F7HA 1V8HA 1QSFB 3TO4C 1UJ3B 4C57C 3AVEA 3PGFH 3OTTA 1YNLH 3GK8L 3VFTB 3LQMA 1JWSB 4JFFB 4WHTA 4WV1A 1X9QA 5I1CL 1GVIA 2XY1A 3HUJA 3KPSE 5EU6D 4ZFOB 4ELKB 4BQCA 3UJIL 2ATPB 2DKSA 2I5YL 1Z0NA 2IQ9L 3ULUF 4NT6A 2HTLD 3RGVB 3AUVA 3SPVB 5I73C 4NUGL 3MMEA 1NEZA 4XXCC 2PW2A 3U46B 5BZDA 5IB4B 1PVHA 1E6JH 3LS4L 2JIXB 1MCPH 2Z4QA 2FO4B 3VD4A 3VFNB 5KVGL 5C0AA 3QHFL 3TN0A 1LO2L 2B5IC 5C8JB 5JDSB 5HVHC 2P8MA 3V4UL 1U3HB 3O9WC 4JZOA 1U42A 4IRJB 4J3VA 3MLRH 5IVXE 4TQEL 3MUGB 4GG8B 1GIGL 3HMWL 4Q6IB 1NAKL 3KLAA 2Y7QA 4YHZH 4L9LB 4XNZB 4ZQKB 3MV7D 1CTNA 2HH0H 1VB9A 4L3CB 5IQ9B 3IFLH 1KPVB 1WIPA 2VLJA 2NY0B 3Q6FA 2ZUTA 3O11A 4J3WA 4LSUH 3HE7B 1IKNC 1TPXC 3ZDXF 3N0PB 3NFNB 2X5PA 1CXEA 1UT9A 3OX8B 4C56D 1JTOA 4M6NH 4HIJA 4I0KA 1G7JA 3AM8C 5JW4M 3BJLA 5GGVY 5AAMA 1HZHL 1T3FA 3UAJC 1JPTL 4GBXD 5FHBL 2AK4A 2ZOLA 1U8LA 4G8FB 2IH1B 2IG2H 2Y5TA 4IS6B 3O3EA 1C08A 1LMKA 3VFMB 3FQNA 1TQCB 4H1LB 1XGQA 4P57A 4C4KO 1RJCA 5DR5H 5GRJH 2BK8A 2HT2D 3F58H 5FHAL 3MV01 1LWRA 4HULB 3T4YB 1OARL 2YPVH 2EC8A 4Y19A 3EZ8A 1XFPA 2IAMC 4NHCL 5FO9A 2IMMA 5T3XD 5C0GA 3MO1B 1KGCE 3KYOA 4YPJA 1UM4H 4YXLL 4PJAE 4NQVA 4ZAKA 2MKWA 4YGVA 1LD9A 3NFPA 5DI8B 3OQ3B 4PPTA 5E5MA 2DOCA 1GOHA 3U0TB 1A6VL 5C3TA 5CJXC 5EB9A 4P59H 1LVEA 4QWWC 1UXWA 1YNTA 2HN7A 1K6QL 3QIWC 3SJVA 5C92A 1FVDB 3PV6B 3BYTA 1G9NH 4J3OC 5H2BB 2VB5A 3PL6D 4EUPA 3VGFA 4ZD3H 1J87A 9CGTA 3EYVA 2Y36L 5E5RB 4XP6L 1G7LB 1S7WA 4H20L 4RAUA 1NGWA 5CP3H 5TE6H 2AJ3B 4JY6A 3UBXB 3MRJA 4K8RH 4BA8A 3FB5A 5HGDA 1JNHB 2BDNL 3MRFA 4ZUUB 3DUUA 4QY8B 4H1LH 4H1LG 1KJ3L 2KKQA 5JORA 3RA7L 4WFHE 3MSPA 1JPFA 2MMXA 3GBMH 4HMCA 5FFLA 1QFUH 4ERSL 4JKWA 3FO1B 4PGEB 2X1QA 3HPJB 1CDGA 1JE6A 3GSOA 1NGZB 3WFBH 5EIIA 3FB6A