4ZQKB

Structure of the complex of human programmed death-1 (pd-1) and its ligand pd-l1.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
106
Chain Sequence
NPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPESRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Complex of Human Programmed Death 1, PD-1, and Its Ligand PD-L1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Programmed cell death 1 ligand 1
total genus 20
structure length 106
sequence length 114
ec nomenclature
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zqkB00
1L7TL 1OLZA 2A73A 1U8PB 2PTTB 4OM0H 5T3XD 5K9KA 2ESVE 1FFPB 5I1KL 3L5IA 1ZXQA 1RU9H 5EFIA 2XWJA 1U41A 2EDNA 5DJ6B 4DFIA 3MLRH 4PJIE 4YXLH 1YMHB 2H9GA 1DUYA 3SCMA 3PNWB 1HEZA 4NQCA 4RBPH 2PXYD 4QRQA 2EKJA 2VXSH 1AO7A 1CE6B 5E5RB 1KIQA 1G9NL 1T1WA 2H3NA 1KIRB 5KSUA 4M6ML 3OF6A 5C09D 1UA6L 4WU5B 2O61A 1Q9WB 4TQEL 2C3VA 4WUUE 2JELL 1KJMA 4O02L 2P7TB 4HXAL 1R3LA 2E27L 4BSWA 1GIGL 4GQ9H 4OIIH 5FYLH 1T7XA 3KS0H 3DHJA 3UBXI 4XCYA 5E6IB 1CXHA 3HE7C 3HNTL 4L8SC 4QOKB 1I7RB 3ARTA 3VGEA 5F9OL 1DBBH 1P9MA 4P4KA 3VFVB 1I3GH 1OGTA 1EVTC 3RUGB 1X5LA 3LIZH 3OKLA 4LVOC 3S88H 1OAXH 4KK6C 4QWWC 3UPRB 1UKQA 3GI9L 3CLFL 4GAGL 5DI8A 3RNQA 3JWDC 4NBZB 1P69B 4FZ8L 3O45B 1CE1L 1QTYT 1IM9D 2CUHA 1RJLB 5IVXA 1MH5A 3K2UH 5J4MA 5B3JF 1II4E 1HSBB 1Q0YH 3OXSA 5D6DA 2DQFB 4FQJH 5E08H 3HKFA 4TULL 3SDXA 1BQHB 4JANB 3AU1B 4KHTH 4QXUL 1YECH 4QCIA 4MAYA 5DWUH 4OZIA 4PP2B 3PGDB 2Q1EA 1KTDA 3QAZB 4OF6A 3VFWB 4GRMB 5DMGD 1XEDA 3LV3B 3P4NA 3WJLA 3B9KC 5HI4C 3IVKB 2LV4A 3UZVB 2F54D 4IEFB 5HVHB 2AJSL 3O3DB 4QXGL 3U1SL 2NXZD 2VABB 5IW1A 1Q72H 3VA6A 3VFMB 4K94C 3EFDL 3ARWA 1IT9L 4F58L 1VGKB 2PETA 1JZ5A 4KQ4L 4LRIA 4LRIC 4UTBH 4ODSH 1FN4A 3G6JF 1RPQA 4AEIH 2D7TL 3HZKB 1DEEA 3B2VH 4RAUA 1VFAA 3V52H 2V5SA 4GAYA 4NQSB 2FRGP 1LO0L 5I1JH 3F7PC 2NY1D 2XWBA 2ZUVA 1OSZB 3BX7C 2NW3A 4QKXB 2CKNA 4UT7L 5EIVA 43CAA 1P7QA 5GS2H 1N6QH 1DFBH 2NLJA 1HH9B 1TZHB 3ULUF 3WJLC 3MV7B 2ESVD 4N8CH 2NXZB 3C09B 4JDTH 4XVSH 3QO1B 4AENA 1JN6A 4KHXL 3ZKXC 2J4WH 1BZ9A 2V5TA 3P0VH 1OGAD 3QQ3B 5C0AE 1G7QA 1JF1B 5HI5D 3OAZK 3GB7A 1IQDA 3WDJA 2VRAA 1AHWA 3QULA 1IGML 4PP1C 2VUOA 5I8KL 4Y16C 2W65B 5TE7H 2XXCB 5I18L 3WUZA 3FQUA 1IAIL 2Q87A 5L9DH 1WBZB 4HPOL 4IS6B 3GRWH 5IB2A 4YDJB 4WNQB 3S35X 4XGZB 5CJBA 3PWJA 4ZD3L 3ROLB 3QYCA 3PHSA 4DKDC 4YHIB 5MEQB 2V5YA 2R2HA 4JPVL 3GMMA 4LHUD 5DD5H 2HT4D 1NGXA 4QHKJ 3WL9A 5D96C 3EYQC 4KKCD 2OP4H 5ICYA 2DIAA 4ISVB 3S36L 1QSEA 4C56E 1ORSA 4Y4HA 2BMKB 5DRZA 4XBGA 4MWFA 4L3AA 2WIIA 1NCDH 3EO9L 3U6RB 3FT3B 1ES0B 4UV7H 4OQTA 5INDA 5E6ZA 1MCPH 1TMCB 4QRTA 1NFKA 1W72L 2KDGA 1EERB 3UJTL 2VLJD 3I6KA 3CZFB 1J88A 1KBGL 3BKYL 2HRLA 4LLMA 3DURB 4X6FB 4PJHF 4HGKC 1LP9B 5KVEL 1NGZB 2EEDA 1CS6A 5HHXH 3TJHD 3QQ4B 1BLNB 4XCFL 3QXTA 2BSSB 5CGYC 3W9EB 5E2VL 1S9WA 3CVHH 2DQUH 1FDLL 1MI5A 1S5IH 5I15H 5H35A 1NGYB 2PW2A 2QTEA 5DVKA 2ZCKL 4OV5B 2H8PB 2LU4A 5CP3A 5I66B 1IEAA 2QADD 4U1HB 1WCQA 1OWRM 4JQIL 2WMPA 4PRPA 1CXKA 2Z31A 4IIQC 3FZUD 4AG4H 1IILE 1S7RB 2QSCL 4KTDL 5FO7A 5JNYA 4PY8J 9CGTA 3LS5L 4X9HA 4YX2H 5GQBA 2ICES 2COQA 1IM3A 3K7UA 4GUPB 4DVBB 2R0WL 4PREA 3JSSA 4K7PX 4HXAH 1UWGL 3KPLB 4FMKA 2YOCA 3H9HA 3MC0A 2DMBA 2W60A 5E2UH 2APFA 3MO1B 1A6AA 1MELA 4NRYA 1HHKB 4RGOL 3OZ9H 3RWDB 2OZ4L 3MGTA 1I4FA 3BKJL 3LB6C 3P4MB 3QEQA 2CDFB 2F53A 1MIEH 4F7MA 3D39A 3QA3B 4WU7B 2BVPB 3VWJD 3WFDL 4ZOEA 3TBTB 3C8DA 4OLYH 4TUOA 5E5MB 4HV8A 3ULVL 1LE9B 1OSPH 2VDKL 4FN0A 4NNXA 5ETUA 2AJYH 3CSYB 4JPIB 3KAAA 3RVXC 1MJJA 3KYMA 2R1XB 4XNMB 2R23B 1T7VA 3H42H 4RMTA 3NIDF 1DN0A 4KJQC 5D7JA 1GZPA 5LWYL 5GJTL 3P30H 2HFFB 5EB9A 3ZSTA 4LLYB 4HG4J 5ERWB 4UNVA 2GJ6E 5A16A 3EDKA 3BN9C 3UCRA 3D85D 4HFWA 4DKFH 1YYML 1D5MA 4Q58C 4JVPA 4PR5A 4WWKC 4K23L 4E0RA 2FJHA 4TNVF 3LHPH 4YFLI 2FJFA 1HQRB 2YPLE 2O5YL 3EOYG 5SWSA 1ADQL 1X4XA 3KXFE 1CBVH 1IARB 1MLCB 4R9HA 2JJVA 4DZBB 2JCCE 3JV6B 3B4NA 5BRZA 3OJ2C 5C0DB 3AB0B 5MEPB 3JTTA 4MA7L 5HI4D 3GBML 2HFEA 3PQYB 2P5WE 2DYPD 1HI6A 3C8HA 4N0FA 1PVHA 4LNRB 4M61A 5TF1H 3RY5A 3PP4H 5C09B 3BP6A 3OGCA 3GNML 5TFSH 2X05A 3T65A 1Q9LB 2Q7NA 4JDTL 1ETZA 4RFNC 4NO2B 3U9UB 1KN4L 1F42A 4KPHH 4JFPB 5D7KD 3PHOB 3SBWA 4AM0B 4ZFOA 5JW5A 4HBQA 4UU9B 2XZCL 2AABL 2XY1A 4ZAKA 2ZUQB 2DWDA 2GK0A 2Y7QB 3DO7B 3V5DA 4FP8L 4DOHE 4RQQB 4XI5C 3ZT7A 2FL5B 5IBTH 5J8OA 2E6PA 4NO0B 2B1HH 2VKXA 5D71H 4DGYH 3QI9D 3PIQB 5IVXE 5TE6L 3BYTA 5E99H 4JFOA 3NFPA 5HVHC 2HJLA 4NO5A 3KPNB 4IMKA 2GTZA 1MFNA 1Z3GL 4KWUA 4R3SA 4Z7VA 2IANA 5HHNB 4XCEB 1PD6A 4HWZA 5J9PA 1H0DA 3U30C 4MNQE 3QUXB 1KOAA 3GJEB 2Z93A 5D8JL 1GSMA 2HFGH 4XNUL 4H88H 2X4TB 2VH5L 3VH8B 2ED7A 5CBAA 2F19L 4JRXA 2JJTA 1QKZH 2ZJSL 5ESAB 3O3EB 3IGAB 1MRFL 1XIWA 2VLJA 5SX5H 1FYTB 2HRPL 4ZMAT 1IAMA 2D03L 1ZE3C 3V4UL 3C09C 5IVNA 4N0CD 5E70A 1UGNA 1F4WL 1MNUH 1U92A 5DEFB 3B6SB 4OCMC 3OKEB 3T4AA 3ZYJA 3OWEA 5DJYB 1YEIH 3R1GH 4U1LB 2NQCA 1J87A 5TH2B 1X5YA 2VAAB 2IF7A 5JQHC 4MXWH 1MCKA 2XPGA 4M1CC 3U36A 4MHHI 4D0BB 4GQ9L 3LKSA 2IH3B 2AI0H 1CTNA 3HC4L 5HHMB 1N8ZA 4U2ZA 1UXSB 5FOJA 4PJ9B 5E94B 1CL7L 4RFEB 5GZND 3MRCA 3DVNA 3V7MA 3OG6B 4BYHA 1EHLH 1CLYL 3RFZC 4Z7QE 3D18B 4JZNB 5F89B 5LBSL 2QKIA 5CZKA 2R56L 4P23D 4H5SA 5IMOA 4FG6C 3MA7A 3I3EA 1JIBA 3U2SB 3CX5J 4WFFE 5TQ0H 3VFPA 3PDGA 4RGND 2WBJA 5C6TH 2XXMB 2P44B 2FX8H 2R0WH 1KCRL 3REVB 2QQKH 5IESL 3VD4A 3HNSH 3HI6L 3IB4A 1FL3A 2MHAB 5D7LA 4GBXA 1DQQA 4Y16B 2EZ0D 1S78D 2Q76A 3C5ZD 4OM1L 2XA3A 2XZQL 4OFIA 4R4NC 4U3XA 5FYJH 3MJ9A 5F1IB 2F54E 2XG4A 2J3SA 4JRXE 4P5MA 4ERSH 1JPTL 4WHCA 1KPUA 4G9FA 4Y2DD 1HOCA 4R8WH 1U6AH 5D7JD 1WAAE 3QJFA 2DLFH 5EBMB 1IFHH 5E8PA 3UTSA 1S9VA 2RR3A 4AIOA 3MRBB 1IAIH 4G7VL 3S3JA 1HSAB 3C60B 1A4JA 2VISA 1T89A 2BNUA 4MX7B 1AHWC 1S7UB 3K3QA 5KTEL 3AREA 4NJ9H 1JZ4A 3P0YL 2D7NA 3GMLA 5T1LB 4HIHB 1T2QL 1I9RL 2VZSA 3GMRA 2Q86B 2KKQA 5D2LB 2CJUL 4QEGA 1KNOB 3WDIA 3DRTB 5DUBB 3U0PA 4HKBA 3LDBC 1NBQA 4XP4L 3D85B 1I8LC 2X4UA 3WDHA 4LQ1A 2W9DH 4G6MH 4XC1L 1I8KB 1LEKB 1QVOB 3FQWB 5H2BB 4UV7L 3V0WL 2E8YA 4TVPE 1MHPH 4J3UA 1SJEA 3DXAB 3FT4A 4F15B 4ZS7H 2V5RA 3QDHA 1NC4A 4OLUL 4JN2A 2VDLH 1PYWA 1E4XL 2VERN 1V05A 3EYQD 3DX9A 3F5WB 1LGVA 3WSQL 5BJTA 2AJUL 1OOAA 1A6UH 1PG7X 1V5JA 4QHKI 3HG1A 3GSXA 2DQEH 5D1ZC 4GKSB 2WUBL 4XMKL 1ZANL 3TYFB 1B90A 4G80B 3LN4A 3MBXL 5CSGA 3DUHA 4DVRL 2DQUL 4QXGH 4PIRF 3VFRA 5FYJD 3MGOA 4NZJA 1HWGB 3X3GL 1IGJB 4N9GB 2L7JA 4DKAA 2FEEL 5D5MB 2H1PH 2AI0L 2X4RB 3T4YA 3H3BC 2WANA 1GGIL 4J3WA 3QEQE 5EG6C 1RMFL 1KB9J 4FP8H 4K3JH 5DJXB 4EXKA 2R2EA 1SYSB 3QB7C 1AKJD 3CFIC 2OSLA 3WFBH 3MRRB 3WFEL 4X6DF 5K33A 1N6VA 3BE1H 3DETD 5IEKA 4KY1L 4Y88A 3KPQB 1I7UA 1KTLA 4EQ3A 1FLRH 1NGPH 5F9WC 3VXSB 5J6HA 1HXYA 1A9EA 1DQDH 1W0YT 2OJZH 3OJMB 1HNFA 3N1MC 3QDJD 3LKPB 3AB0C 3TIEB 4L3CB 4KRMB 1C7SA 4PJGB 2B2XH 1K5NB 5GISH 3SDCD 4LCCB 4LVNC 4L4VD 3EJYC 4K8RL 1FZKB 4Y2OA 4R2GC 5DEGB 4IRSA 4P9MH 5DJ2B 4M7ZB 2KZWA 8CGTA 1INDL 2AQ2A 4KI5F 5GRXG 4RFNB 2J8UE 4XPTL 2MMXA 1T21B 4KKCC 1A6VH 4PLKC 4WWKB 3BVNB 4XXCA 4G5ZH 4XWOD 5GJTH 2OL3A 2Z31D 3C6LA 3CLEL 4XWOC 2VDPL 5IVZA 4UIMB 4HPYL 1J0IA 3S5LG 5DRXB 1CDBA 3GSOA 5JMRA 4F37F 3Q3GA 3SKOB 4QHUA 1FPTL 3W9DB 3HMWH 2C4FT 4X7TB 5DD3L 4RGOH 1LVEA 3ULVC 4OSUH 4PJ8A 1J1OH 1KIPB 1S7VB 1PKQA 1RZKC 4APQA 3VXNA 3AROA 4NUGL 5LGJB 3ARDA 1FORL 1D6VH 4GMSH 1OHQA 1UVQA 5DURD 3OKMA 1NCUA 3BKCH 3LSOA 5HPMB 2V2XB 3QEQD 3RPIA 4MD5A 3REWA 3SCMC 5HGGS 3LPFA 3O0RL 4X6BB 4NN6B 3TT1L 1BBJA 5EOTB 1F2QA 2P8PA 3PWPB 3L3IB 4JFFA 3P77A 4Z78B 2R8SL 4CUCA 5KVDH 1JZ3A 4HBCH 5ALBH 4HULB 2JJSA 5FAAA 2P42B 3ZTJH 1T1YA 1ONQB 1LNUA 5HGBA 3GSNB 3J8F7 3I9GH 1X6LA 4PLNC 4YEEA 4EN3C 1R5VB 5GS0C 3FL7A 4G9FD 4Y2DA 5F72S 4H25A 4HIJA 4D9RE 4K23H 3CFKA 3MLZH 4O02H 1A6TB 4QXWA 4OCRH 4U1GB 3DYPA 5DVNA 3LS5H 4P46B 2NY2C 5IOPA 3MMEB 3F12A 4YWGH 1OW0C 1T4KB 1HKLL 1AGFB 5HBBA 1LEGA 5JOFA 1VPOH 5LWYH 2SEBA 1OAZH 4FQPA 4HC1A 5KS9F 3KLAA 2OJEA 5D1ZD 1XGQA 4P5TC 1WZ1L 4NM8L 2OZ4H 3ULUE 1H15A 4X4YA 4CMMA 4NKDA 4JGJA 1H8NA 3T2PA 3WYRA 1G7IB 1H3PH 4UINH 5BOZG 1X3DA 5E8NA 3T0EE 5F44A 1UH4A 1OAYH 2HP4A 3SKUD 3WEXA 3R0MA 3UJIH 5FB8B 4CADA 3IXAB 3NPZB 1PKQE 4OGYL 3CH1B 2X4SB 3GRWL 4PJEB 3GMQA 5FO9A 3LQZB 2BVTA 3L3DB 3NZ8B 1U8IB 3CSBA 2NMSA 2X4PB 4QRSB 5AYUH 1N4XL 3EFFA 4DGYL 4M6NL 1KXTB 4JPVH 1FNLA 5DD5L 4ODXA 1M05B 2ZSVA 5CLTA 3L5HA 3C2SA 4O58L 1NAKL 3MJ9L 5E1AB 5E1AA 2FJGA 1KV3A 2OP4L 4ODXB 5DRWA 1KB5A 4HK0B 4OGZA 4KZDH 5HYFA 3WIFA 2G9HB 1U8IA 3QUYD 5HY9B 3L3DA 3L5XL 3LQZA 3WV0A 1KLGA 4MD0A 4WTZA 3QEHB 1A7NH 4UZGA 3SJVB 1MI5E 3IXAA 3NAAH 3RHWK 4OFVA 5CBEB 5FB8A 1FL5B 4UT7H 3MNVA 4LPTA 3UJTH 5E8NB 4D3CH 5KANG 3BKYH 4LPXA 1G7IA 3ULUC 1JHLH 4K3JL 5JUEH 3BQUC 1ZHBB 4JRXD 3VWJA 1LMKA 2Z31C 3Q1SH 4NN7B 2IMMA 3IU4L 3WXVL 5F7HA 3O6ML 4ZQKB 2A1WH 4BFBD 5HHOE 3WNMA 3HI6H 4NNPH 5C8JB 4OBSA 5FGCB 3OB0K 3S5LB 2Y5TB 2YN3A 4G6JL 3WS6A 3IDMB 4MZ2A 2QV2A 2H26B 1AR1D 25C8H 4Z7WA 4P46A 2P49B 1NMBL 5EU7E 4ETQA 4POZC 2BDNH 3C60C 3SE9L 5I75B 1FNGA 3ZE0E 1CLYH 5HI5C 3HN3A 4G43A 4OLXL 5AWNH 3QHFH 3GSNA 3SDAD 4GXVL 3GMPA 2JTDA 3ZHLA 5FUOH 1KUMA 2HFGL 5BZWB 2DLEA 1F00I 1U9KA 1VGEH 3L3IA 3PWPA 1FHGA 3TCLA 4P59H 3B5TA 1AQDA 5DC0A 3O8XA 4LDOB 2CXKA 5AYQA 3OJDA 3RJDA 1U8LB 4WFGE 1V8HA 4AH2B 2AK4D 5JDJA 4TVPH 3W81A 3OKMB 1A7PH 1SY6H 4DEPC 3PWNB 2PR4L 4UDUB 5LGJA 4K9EH 1S7VA 5IQ9A 4GT7A 4PJ8B 3L5JA 3V0WH 2WW8A 1QBAA 4RDQG 3O9WA 5D1XC 1XMWA 1C5CL 3UTPE 1TQBC 3U4EB 1AD9B 4JM4H 3GSOB 5IHZA 2NY5H 4X9IA 4OIBA 2OL3B 5CKAA 3T2OA 1RVFL 2K7QA 3GM8A 1FGVH 3DX6B 4PRHA 3TNMB 4ZUSA 2AKRA 4KJQD 4OQTL 4XWGH 2DD8L 3VWKB 5FO8A 3S3PA 1RZGB 4YDLC 2EE3A 1JWMB 3QXDA 4FQ2L 4YHLL 5LQBL 1U58A 5DF0A 3GSQB 4OCLC 4M8VA 1T04B 2PF6A 1MHCA 3EO1B 4P2QA 4DKEL 1LO3H 1FZKA 1A0QH 1EO7A 3MRPB 4LCCA 3TLRA 43C9A 5D70L 1PG7L 4KK8D 3K74B 3TIEA 3UP1A 4XVTH 1XGPA 4Z7VF 3S3SA 5FUCC 2VLME 4N9OB 4JKKA 1RUAH 5ISZD 4ZXBC 5IEKB 4U1NA 5J57B 5JORB 1CLOH 5E8EA 5I9QC 2OSLB 3EYOA 3AS2A 4XP4H 4CAGA 4XX1E 3IU4H 4Y2DC 3HAEA 1U95A 2LAAA 1TPXC 4E41E 1ITCA 5I8EB 2J2ZA 4S0SD 3OL2A 5I1LB 2ZCHL 1F3JA 3LEXB 4O2FB 3DHMA 3STLB 5EULV 5EIIB 3BUYA 2YPLD 1JHKL 2Y25A 4NOBA 2OQJA 4Z7UE 3TYGH 3QHZL 5TE4L 2A6JB 4U6VH 3LN4B 4G80A 4M6MH 1QPPA 5FYKH 3RI5F 2CDEA 4XMKH 4I8DA 4WTZG 3P9WB 2DLIA 4UDTA 4Y5VB 3HG1B 3O2VL 1L6ZA 2ORBL 2EDOA 3G5ZB 5KSBF 1QNZL 3ME0A 4YO0B 5BJTB 3L6FA 4JPWH 3DX9B 4WGVB 4P46C 3F7VA 4XX1G 1KTRL 1OTUC 4JFEB 1PYWB 3P9MB 4XPGH 3FFCB 1NCBL 4JN2B 1NC4B 1NGWA 3CX5K 4PJ5A 5FGBA 1YNLL 3DXAA 1G9ML 2YRZA 4PBWD 3DMMD 5H2BA 1I8KA 1QVOA 3FQWA 1EV2E 5F7FA 5HDQH 2VXUH 2JJWA 3ARGA 3CLFH 1FORH 2ADFL 3GJFH 3X17A 3RY6C 3FO9B 5IMLB 4JFEA 2XT1B 1BQLL 1J1PH 1RK1A 4R96A 1SHMA 3ILQC 3ZTNL 4QF1A 5A1AA 3OKDB 1UENA 2HH0L 3O0RH 1QLEH 5ADOH 1AD0B 1RIHH 3PV7A 3MRHA 3TO4D 2CDEB 3GHEH 3LZFL 5D6CB 2FD6H 5A3IC 4D9RD 1KIUA 4HS3B 3BUYB 3MRBA 5IROC 4PG9A 4ZS6D 1S9VB 5JA9A 3WN5C 4O2FA 3QJFB 1F3JB 3LEXA 4HQQH 4CU6A 2DD8H 2VLRE 1KPUB 2HJKB 3C6LD 4IRJD 4LU5H 2ZNWA 1DTUA 1UKSA 1DJSA 2AGJH 3LRGA 4XI5D 5IKCA 4P5MB 3I6LD 4QRRE 5C6WH 3THML 4PB9L 4NRZA 3ARRA 5E56A 1CFQB 1HYSD 3EYOB 1U8MA 4G9FE 4HT1L 5JORA 4U1NB 2NTSP 2VO5A 3NFSL 1O7VA 4GBXB 1IE5A 5DMIH 1J86A 1FRGL 4LCWD 5I1JL 3REVA 3QI9C 2BOCA 2HVKB 1YY8B 1XGPB 4QY8A 1RUAL 2DQIL 3VMPA 4HZAA 3U2SA 1NBYA 2D7OA 3CVHB 2C7UA 2ENYA 2DN7A 5IHUL 1KJ3H 1EO8H 4UV4H 4WENB 5F7LB 2E7MA 3EO1A 3MLUL 1PZUB 1QHPA 3B9KA 3IFLL 2OR7A 3ARQA 4OZHE 4ONFL 4K94H 5IWLA 4JHAL 1Q94A 4YHPA 3RWIB 4G7VH 2AV1A 2X9XA 3QXDB 4XPTH 4L29B 1PFCA 3Q5OA 4PRBB 5T33L 4MAYC 2I60H 3DX6A 1T1XA 3TNMA 3LH2L 5DUPH 5DXWA 1IRAY 4M02A 1XGTA 4XP9L 3AMLA 5J56B 3U36B 2QQLL 2NY6D 1MPAL 4U31A 2ZCLH 1EAJA 4JVWA 1AD9A 4JB9H 1XGUB 3DTXA 3NIFE 4WY7L 1BFVH 2D3VA 2ICCA 4LFHG 1D5IH 3B6SA 3QQNA 3T4AB 1OP3K 4KV5E 2JCCB 3TZVD 5IQ9B 2J6EA 2W9DL 4G6ML 4XC1H 1NCTA 4YUEH 1KN2L 5F7YC 1IGYB 3IGAA 1ZLUH 2NY3D 4CVXB 3O3EA 4LRNH 4OGXL 4ODSL 4AEEA 4H1LH 1G9MH 3VH8A 2ENSA 4ZTOL 5DR5L 4JG0L 3TBYA 3CUPB 3TCLB 2HKFH 4KK5D 3MACL 1JP5A 2G75A 2Z93B 5M95B 1NCNA 4R90L 3Q1SL 2DLGA 3MLXL 4HJ0D 4KRPB 4XCEA 4XHJC 1N0XH 4L4VB 3N9GH 1K6QL 1OTSD 3K4DA 3KPNA 3NFPB 4LMQI 5ITFA 1H8OA 4G43B 3PIQA 2I9LA 5KZCB 5MI0C 1R3KA 2JE8A 3L5XH 4ETQB 2GFBB 4RQQA 2JB5H 3EZ8A 4J12A 1WFUA 2LFGA 3V5DB 2BHUA 4Z7WB 1Q0XL 5GGVY 4KROD 2H26A 4UU9A 1TLKA 4ZFOB 4AM0A 1RHHA 2AXGA 1Z9OA 4HQQL 3VXQA 4JO1H 4NCC2 4YDLB 5C8JA 1ETZB 5KVGH 4ZFGL 4U6HB 3T65B 1MEXH 4ZQKA 3OJVC 3RZWA 4DEPB 4FNLH 3D1MC 2EEBA 3IFOB 5EWIL 3G6JE 4ELKB 1L7TH 4K8RD 4KK8C 1H3PL 4UINL 3FJTA 4N68A 3U7WL 2X9WA 1T5WA 3HMXA 3OXRA 3MNVB 1MJUL 1WCBB 3UC0L 1A3LL 3JV6A 2DI8A 1JPSH 5CBEA 5BVPL 2VC2H 2IADA 4JFED 4P9HC 1PSKL 5EH1A 3P9LB 4PJIB 5JIIA 2K1MA 1KLGB 1M4KA 2X4QB 1M71A 1R3IH 1CU4L 2DTML 1HQRA 5HY9A 1TFHA 4OCWH 2OXHA 3VCLB 4PRAB 12E8L 1KJVA 2AJ3A 2VDMH 4IRZL 1Q9KB 1AGCA 4RGNE 2NTFB 3VRJA 4HFWB 2D4DA 4P2RA 5MENB 3UBXG 3H7BB 4MAUH 2G5BA 2DS4A 3ZTNH 3BP7B 3D39E 3MRMB 1B6DA 5HPOA 2ZSVB 2RCSH 3GK8L 5TGBB 3V9FA 4PV9B 3H42L 5IFHH 1TVHA 3MTRA 3BW9A 1AFVL 2ED9A 1GXEA 4U6TA 1L6XA 3CFBB 4QRSA 2OBGA 3FB8B 5FO9B 2R1XA 4XNMA 4PJEA 4F15C 2F58H 3CH1A 3VGAB 1MJJB 4CDHA 3MQIA 3CSYA 4JZJC 4F3FA 5F6IC 4ENEC 2DM4A 5DMYA 1TENA 2ARJB 3FO1A 3TBTA 3IJYB 1YEJL 4Z8FH 5I74B 3D39B 1BPVA 1UJ3C 3B9DA 2CDFA 2F53B 2OTPA 4X4YB 1I4FB 5H37G 1BF2A 4LASL 1HHKA 5F70A 4HUWA 1U8HB 4J1UB 5F9DC 2PUQT 1XGQB 1U3ZA 1I9IL 3KLAB 4M6AA 4ONGL 1KCUH 2R0ZL 5F7WC 3LKQB 2J4WL 1BD2E 2VZVA 4RMVA 5FUZH 4PJAA 1AGFA 1OB1B 5JOFB 3TFKC 1IM3B 4X6CE 1S7QB 1JNHB 1Q38A 5FO7B 5JNYB 4NZRL 1S7RA 3HE6B 3TN0A 1EGJL 5M7QA 4PRPB 5EO0A 3CFKB 3I6GA 5JQ6L 4Q9CA 5A2JH 3JWDL 1MQKL 2OK0H 1IEAB 4HAGA 1LO3L 3RZCA 1TVBB 4LHUA 1FSKB 2DWEB 1ONQA 5FM5O 1S9WB 3O3BA 3W9EA 5JXEA 4HLJA 3V0AC 5T3XH 2HKHH 4JFHE 3QQ4A 5IW6B 1MRDH 4AL8H 4LIQH 4LCCC 2P8PB 2RHEA 1BBJB 1E6JH 5EOTA 4POYA 4IBLT 4X6FA 3T3ME 4DOHB 4KHXH 4LLMB 1RUPL 4MD5B 2V2XA 5D7IF 2DQJH 3I6KB 3LSOB 3BKCL 5ECJE 2BY1A 4N1CA 1UYWL 3HPLB 3MBEB 4NM4L 2ZG3A 3C5ZC 4R4ND 4S1QL 4APQB 4YEFA 1S3KL 1UC6A 2UVFA 1CR9H 4J6RH 2KL6A 2O5YH 3MV7D 3U6RA 2V7HA 4FQJL 5E08L 4Z7VE 5LJYH 2X4OB 3S97C 4MWFB 5DRZB 4POZD 1U0QA 3T0ED 3T0BA 1MRFH 3UYRH 2IAMD 2PYEB 4P4RA 4KVNL 1EFXD 4QO1A 5FYJU 4P46D 5B22A 2VE6B 1T03L 1CGXA 1RUMH 3N1PC 2O5ZL 3WL9B 1D7FA 2EIDA 3GMMB 4LGPB 3OKKB 5GRJL 4M43L 3MRLA 3BVNA 5MEQA 5CS7A 1IAOB 1N0XL 2IALB 3GNMH 3VU2A 3ROLA 1G9MC 4WNQA 4KH2A 4YDJA 3DGGA 4ZNEE 4I3RH 3PE9A 3ZE1F 3FQUB 2E5EA 1MCFA 4JN1H 1DVFC 2Z0BA 2HWZL 3S4SB 2X89D 2VDOH 5C3TA 5FA4A 3MUJA 5BVJB 5BMFH 5JIKA 3KDMA 3G08B 4M62L 2D0HA 1JHLL 4PJGA 2EO1A 3QULB 1MAML 1YJDC 3G04A 1HH6B 3QI9B 4O4YL 3DYOA 1HXYB 1MCWM 4WWID 3ALXA 2E7LC 2EZ0C 1KTLB 5JW4R 3T08A 1BZ9B 1JN6B 3QO1A 4AENB 3NFSH 4OZGA 3KWWB 1UWGH 4HK3J 1RU9L 1XGYL 2BSED 3Q6GH 1JTTA 1EFQA 2Q3ZA 4PJ7F 3SGKC 2J8HA 3WHE0 5FYKD 4YHYC 5DJXA 1KB5L 2P5ED 2VN4A 2HTKC 3HZYA 5FYKE 4RNRB 3T09A 4OTXH 3TESA 1Z9SA 3VDCA 3SE8L 3GEWB 5I16A 2X4RA 3IDJB 5D5MA 2BHYA 5HJ3A 5A43C 3FB6A 2FCBA 2JELH 3U79A 4ZODA 5CEYB 4C57C 3MGOB 3O3DA 4KKLC 2E27H 4S2SB 3LZFH 3IVKA 1MQKH 3FFCE 4I13B 4X80H 4UQ3A 2OK0L 2GAZB 2DLFL 2JJUA 5AAWA 2XQBH 4RGMB 1EJOL 1RIVL 3W39A 4Y7MA 1QBMH 4MMXC 2RCSL 3GK8H 4H8WC 4CU7A 1LD9A 3PGDA 5DMIL 3F5WA 5E2UL 5D7IA 5TDNA 4QCIB 1OAKL 5ENWB 1ZVHA 4HUUB 5K9JL 4PRHE 1SJEB 3FT4B 3E1F1 3QFJD 2FHCA 1I8MB 4HUNB 3WIIL 4Y4FB 5ISZA 1IC4H 4U7SA 4XNZC 1Q0YL 1ZT7B 4FQ1L 4OCNC 3KR3L 3THMH 3ZL4H 1MH5B 4YX2L 3ZT5A 4GSDL 3U0PB 3DRTA 5DUBA 4YR6A 1VA9A 1F90L 4J3TA 4MLSA 3RUGA 2W91A 2Q86A 4KDTC 5E2WH 4DGVL 4HIHA 4G6FB 2CD0A 5IIEB 2WSKA 3AREB 2FYYA 1S7UA 4BKLA 1MFBH 2YD8A 3VXRE 2XZZA 3GJFA 1HSAA 4XAWL 1O0VA 4HWEH 3DIFA 5E7BA 1KJMB 2ZCKH 3O4LD 5EBMA 3MJGX 4OZ4B 2V17H 6FABH 5I1AA 3WS6C 5KZCD 1HOCB 4ZO6A 5KSUB 1KIRA 2H3NB 3U82B 4NN7C 1KIQB 1PLGL 4WV1A 3WIHL 3WNPA 5D1QD 3W82A 5I71B 1MFDL 4HUXA 4M00A 3I50H 5SWQA 2B0SL 2IAND 4JQXC 1HEZB 4NQCB 2Q76B 2VR4A 2GK2A 4CNIB 5JXED 3H3PL 4Z95H 3H3KA 2HLFC 3D0VB 4WHTB 5EFIB 5KW9H 1DQQB 3FRPA 5D7LB 4XVSL 5FYJE 3WLWC 5GS3A 1U8PA 2PTTA 2FH6A 4RMRA 5J1SC 4YHZL 3SKMA 4L9LB 3BDBA 3GRWA 4K07A 3B3IA 2VOTA 3KJ6L 1WT5C 3R4DA 5H8DA 1T0MA 5I75C 3MA7B 1GPOH 4X4XA 3HC0B 3UTOA 1F4XL 3LMJH 3VFUA 2FHFA 5KS9E 3GI8H 3O2DH 4JZNA 5F89A 2ICWI 5SWZB 1U3HA 5ILTH 1N59A 4JO4H 1JZ6A 4Z76A 5C0BD 2AVGA 2N7AA 3DVNB 3UX9B 3MRDA 2WBKA 4OF5A 5GGUA 3A67L 5E94A 4RX4D 3GSWA 4M5YH 1L0QA 4F9LC 2V2TA 3HHRB 5B39A 1N3NA 4HIXH 2B1HL 2H2PD 2FGWH 1F8TL 4N1EA 3VFGH 1DCLA 2FEDC 2CR3A 2YRPA 5HI3C 3OB8A 3WO4C 2IC2A 1QRNE 2O5ZH 1YMMA 2P1YA 1OWWA 4XPFL 4JKMA 1I3RB 2XZCH 1UACH 4U1LA 1MVUA 3OAZH 4JFYA 2E9IA 4P23A 4P2OD 5FYKU 3QUMB 3QNZA 4NKIL 3NACL 4S1RH 4QYOB 1FNSH 5D2NE 1LO0H 2DBLH 5FK9B 1FNFA 2VLJB 4N0YL 1MJUH 2LABA 3BSZL 1BVKA 1E4WL 5DK3A 2DM7A 4LCWB 5C0CE 2YD4A 2DYPB 2HKFL 3NBNA 1MCEA 1CIDA 4G8GB 3GJEA 1HKFA 2R15A 5JW3H 4XH2A 5HHNA 2HN7B 4Z7VB 3QO0B 1NANH 1FZOA 4L8DB 3RVWD 2GTWB 4R0LC 1EBPA 4K71B 4X5WA 2MJWA 3EDJA 3H9SE 1CN4A 1I1FA 1RZJC 1OD7A 2JIXB 3ILQD 3CXDH 2VKWA 4NQUA 4XVUD 2PCPB 4ERSL 1RZ7L 1F4WH 1MNUL 2QR0B 3T0VA 4LOUD 5I8CA 3LN5B 4OKVB 4LVHB 3ARED 2NCMA 4ZXBB 3DYMA 4JFPA 4M5ZL 4J3VA 4L8CB 4OZHA 1RZIB 4MJID 4HUKB 3BP6B 1MFDH 3Q2CA 2DRUA 2FX8L 3EYSH 1W8NA 4LNRA 5I73B 1OPGL 5I76A 3WJJC 2WUCH 3RRQA 3RAJL 1CXIA 3PQYA 4LSRL 3FT2A 3VFSB 3JTTB 2R4RH 5MEPA 4PP1D 2ICWA 5C0DA 2BNRD 1FNAA 2G60H 1SMOA 4WHYH 4DZBA 5CEXA 2UWEE 5SWSB 5B8CA 1UFUA 4I2XB 3EDFA 4PJFA 2JK5B 3KR3H 2IANE 1CT8A 1N5YH 1B2WH 5FOBA 4EDWH 4HF5L 3GIVB 3PDOB 1AXSB 3LCYA 4JO3H 4WUUD 4MAUL 1NDGA 1F5WA 3RWEB 3U4BH 3PWLB 2FECL 3GMNA 3QXAA 5EU6B 5C07B 3MXVL 3MUHL 3GMNB 5E2WL 2D4FA 1A5FH 1H8SA 1Z2KA 3HC4H 2EDBA 2HFFA 1YC8A 3DV4A 4PJHE 5D7JB 1DN0B 3KPPA 2R23A 3KYMB 4I2XA 4JPIA 3JV4B 1OARH 4NNXB 4S1DD 2FHBA 2CLZB 2ZNXA 3EGSB 1KENL 1S9YB 5E5MA 4CVZB 1IFHL 4J3OC 4YDIL 2IEPA 2CR6A 4WJ5B 3VFSA 3MV9A 1LEIB 2EIBA 3QA3A 4WU7A 3SQOH 3DUSA 4ZUWA 3BZ4A 3OBAA 4YE4L 5TQ0L 2Y6SC 4ZUTB 3T2NH 5DMJB 2BNQE 4JQVA 4BQBA 1LWRA 1A6AB 1FCCA 3QDJA 2W60B 2HT2C 2F5AH 2VSDA 1EDQA 1HHIB 4PJ9C 4YQXH 3MXWH 4BUHA 1MCOL 4GUPA 4OKVA 4DVBA 5IGXL 4FQXB 4XP1H 5C0BA 2PCPA 4KUZL 2P5WD 5I2IA 4WFHD 1Q0XH 3NABH 3W0WE 1KF9B 3BESR 3ORJA 3QXVA 2QL1A 3QIWD 1X9QA 4J7RA 5EU5A 2DKUA 4I0CC 2PW2B 1ZLWK 4P9ML 5F96H 3R0NA 1F97A 3IDNA 4Y0GA 1YMMD 4WFED 4XH2B 3K2MC 4EIGB 4DTGL 1ZOXA 3X14B 4JKLA 3ZDXE 4X6DE 4ZTPL 5EU6E 2GSGA 5I8OL 2PO6C 2IPUK 4XMLL 5C0JB 2HVJA 3U7WH 4APQD 1FQ9C 2YMXH 1IZKA 4AMKL 2PW1A 1ZMYA 3EYSL 4QRTB 2Z8VC 3HZVA 3BDYL 4GOSA 5MP6H 5INDB 2WUCL 4S1RL 3FT3A 1J1OL 3S98A 4MA3B 5JIPA 3QNZB 2WIIB 3N85H 5CWSB 4JFYB 1MY7A 1MVUB 4NUGH 3HC3H 1ORSB 4Y4HB 4U1KB 1BJMA 4N5EC 1NCWH 3NN8B 3GUTB 3B5HA 3GHBH 4MLIA 4TUKL 5ICYB 2C3GA 1WISA 5DVOA 1ZHLA 3FO0H 1B88A 2YN5A 3G6DH 1DSFL 4PJEF 3HAEG 4DN4H 2R2HB 1IGTB 1T20B 1A6VL 4EI5A 1C5CH 5F3HA 2V2TB 1UQSB 3GSWB 2Y36H 1QLFA 4NNPL 4AZ8A 5GGUB 1JMXA 1XH3B 1VHPA 5GSRA 1PG7W 1N59B 1U42A 2W65A 3KLHD 4OQTH 5K93A 4LLAA 5CCKH 4MJ2A 4X4XB 5FDWB 3HMXL 4AIZA 4FQIH 1AJ7H 3VXUB 1T0MB 1EMTL 5JTWA 2A6KA 1YEHL 3GB7B 1WZKA 3RNKA 5C0RH 4PY8I 4EIZC 2DIBA 3A0OA 3OB0H 3TBSB 1BZQK 3WFEH 4LVEA 3BIKB 3S34H 2VYRE 4NC2B 3UDWA 1QSVA 3MV7A 2R0ZH 4WHTA 1CFBA 3KXFA 2YHGA 1QKZL 2M26A 2NLJB 2ZJSH 3D0VA 4FFYH 1P7QB 43CAB 2EXWC 5EC2A 1OSZA 4OFDA 4HUXB 2KH2B 1KEGL 1NL0H 1VFAB 1JZ8A 1OTTD 4XNYH 3S88L 1FN4B 1YMME 4WFEE 1LP9F 2R69L 4NO0D 2V17L 6FABL 3QWQB 1B0WA 1CFSA 5GXBB 5HSFA 3U7AA 5I8KH 3O4LA 3GJFB 5GS2D 4J4PD 3IDGA 1QO3A 1DBJH 2HT2D 3QEUA 2FYYB 3HI5L 1NFDF 2ITDA 2GHWB 5IIEA 1AY1L 3VJ6B 4XAWH 4OZIE 3VFWA 1GHFL 1QLRB 3KYAA 4RWYH 1XF4B 1F6AB 4PP2A 1F4HA 4YHZH 3JBG7 1PAMA 1I7TB 1BQHA 3SDXB 5DT1H 3JVGA 1G6RH 1ZT7A 1S3KH 4DQOL 1BREA 5C08D 3NTCL 3SGJC 3UROR 1MHPL 2FX7L 1I7TA 4WI8A 4HUUA 2YMXL 4AMKH 4HXBL 1KCRH 5ENWA 5CD5C 5J7CC 1J7VR 5TDNB 3UJIL 2NZ9C 3OKOA 1QYGH 4MNGE 1LD9B 4D3CL 4N5UA 4Y19A 4FA8A 3OKLB 4RA3A 1GGTA 3W39B 1OGTB 5JOEA 4P4KB 2H2SC 1I7RA 3VJ6A 2GAZA 4UQ3B 2ITDB 5AYUL 3LD8B 4ETYA 3INUH 3MREA 4KI5D 4OD3H 3IDGB 3TT3L 3RGVD 1A3RL 3IDXL 2R9HC 3IFNH 3O4LB 3VGAC 4FXLA 4TPRL 4HWEL 4S2SA 1G1YA 1R3LB 4Z7QF 2P7TA 5CEYA 1CFSB 1F45A 3IDJA 1JNJA 4WU5A 2O61B 3SDCC 4RNRA 3RWCA 4KUZH 2GJJA 3A6OA 4JREC 2QQNL 5EC2B 3SCMB 2Q6WB 3VMOA 2H9GB 3KPTA 5DJ6A 4YXHH 1P5VA 3KWWA 5CJOH 4OZGB 5F7EH 3WHE1 2PTUA 5K9KB 4GW4A 1NFDB 5SX4H 3O6LH 4IOFD 3C5SB 3BIKA 5DO2C 3RVTC 2A73B 4LPUA 3TBSA 2Y06L 2AK4A 3RTQA 4OD1L 1JGEA 4M7LL 2A6KB 3G04B 4NQEA 1ERNA 1TQCB 3VXUA 1P4IL 3I2CL 4PLKD 5FDWA 4FQLH 2EC9T 5CKGA 5BVJA 2R4RL 5FA4B 4ODUB 5CD5D 1JRHI 3MOAH 1HCFX 2B5IB 2Y23A 3S4SA 3MRGA 1FSKC 5FHBL 1XH3A 3EO9H 5HVFB 3DGGB 1QLFB 4MQTB 5D2NC 4WCYH 1G9NH 5CSBA 3SGEI 2NW2A 5F3HB 4KI5C 1IAOA 3TO4C 5IQ7L 3FQNB 4WUKL 1IVLA 1IGTA 1T20A 3MRLB 3TA3D 3S37L 2DF3A 3OKKA 4EI5D 3QZWG 2E7HA 3PWUB 4OZHF 1ZHLB 2VE6A 1QR4A 1LO2H 1RQ5A 2E6JA 4Z7UF 2WV3A 5D1QA 3GUTA 3DARA 4ALAH 3HNVH 1T7WA 4YDVA 1ZLUK 5CWSA 1NEZG 1Q1JL 3EJZD 2V7HB 1OQOA 5FHAL 5CINH 2C26A 3BH9B 2FX9H 4EN3D 3VDAA 4MZ3A 3HZVB 1UCBL 1I9EA 5T5NG 5A2IH 1D3CA 1U8NA 2DQCH 2NY3B 3QRGL 3TA3B 1FZMA 4TVPL 3T0DA 1SVZA 1AGEA 1JPFA 3VXME 2PR4H 4HJ0C 2HVJB 4TOYL 3FOLB 4NNYA 2D7TH 2CUIA 2GSGB 3T77A 1B0GB 4NHCL 2FR4A 4KJYB 3O3BB 4LSUH 5AZEL 1V3LA 3P40A 1VERA 2DWEA 1INQA 1WF5A 4TTDD 1T2XA 5F88A 5GGVH 4CMHB 1EK3A 1Z5LB 3WKNA 1TVBA 4JFZL 1G0XA 3D9AH 1TJGH 2XIDA 4O5LH 3S6CA 1WQVT 1VEOA 2WWKT 5EO0B 4B50A 5I2IB 2NY4D 5C0BB 1FNEA 1S7QA 3SE9H 4GG6E 5DTFA 5EOQL 2VQ1A 1Z0MA 1FIGL 4JEGB 1ZLVH 1OB1A 1KCVL 3RIFF 4PJAB 5HHOA 1HHIA 5IT2L 3C2AL 5CIPA 2YEZA 4L4TE 1I1YA 1NH6A 2NXYD 4G8EA 2BVQB 1U8HA 3UTTD 3IDUA 4HUWB 4UT6H 4UQ2A 1KC5H 3PG2A 4UIKL 4Y1AB 3PGFH 4ZUTA 3SHSA 3MV9D 4J3SA 3BZ4B 1VFOA 5I8OH 2NY4B 3DUSB 4UAOC 3IDYB 3CDFA 4OV6F 3IJYA 4OLZH 5DQ9B 5D1QC 4WJ5A 3GMOA 4LHUG 4W81A 1A2YA 1AP2A 2ARJA 4EBQL 4NDMB 2B1AH 3EGSA 2CLZA 4F3FB 4ELMA 4U1MB 4M7LH 4S11A 4X7DC 3RI5K 5KAQG 3CD4A 5L0QB 1RURL 1MFCL 4Y89A 3X13B 1DN2A 5D2NA 1EHXA 4BFEA 3BW9B 4PV9A 5CD3B 1SJVA 4Y5YC 2AJVL 5TGBA 3V6OE 1BMGA 2P8MB 5H94A 5C07A 2P5WA 1NAKH 3MJ9H 3MRMA 5HI3D 4U0RB 3RWEA 5LGKA 3H7BA 3RJQB 2NTFA 4YQXL 1AGCB 3MXWL 3VRJB 5IQ7H 3V4VL 1H3TA 3GIVA 1IKFL 1MCCA 4PJCB 2FNBA 2Q3AA 4M9PA 4O2CB 4B41A 5B8CB 3CFCH 3P9LA 3PP3K 2J8UA 4PJIA 4RA0C 4M03A 4XTRC 4Z0BL 5CEXB 2YZ1A 4EZMA 2N4IA 4S1SH 5DFVC 1UM6H 1T5WB 5L6YH 3OSKA 3FT2B 2WLYA 1SM3L 5F7KC 4LGRB 5E95B 4Y5YA 4K7FA 4U6VL 3IFOA 2DQCL 3FFCD 4BUGA 1ZKAA 3O4OB 4JQXA 4NM8H 4KRLB 3TCXA 1JNNL 3UEZA 4I18B 4NRXA 3SDAC 3CK0H 5E4EC 1LQSR 1GOHA 1GVIA 3VXQB 4W4NA 5DYOA 1RIUL 4GAJL 1YC7A 4LAQL 3NCYP 4R6UA 1E6OL 3OR7B 5EOCL 1WWCA 2YS4A 2QR0A 3OKYA 1KELL 2VWEC 1T7ZA 3WFCH 1EEYB 3RVVC 1P9MC 4P4KC 4NJAL 3KHQA 1N4XH 1I1FB 3QH3B 1R5IB 4M6NH 1J9CT 2ICWJ 1FYHB 3RWGB 3V95A 2RQ8A 2NXYB 4LCUB 4L8DA 2DTMH 1BQHG 1P1ZB 1QLEL 5DJ0B 2HN7A 5JW4N 3TVMD 4C56B 3QCTL 5D5MF 2G75B 4ZSOE 3CUPA 3RBGA 3TBYB 3EYUH 3N50A 1A02N 4FFZH 4TNWF 4V1DE 1MIML 1BVKB 4EUPG 3BSZH 3GM0A 4CVXA 3HE7B 4L8SB 1T0NA 4W4OA 2RB8A 4HZLA 2W0LA 5HHQA 5FK9A 3SEPA 2X70B 1ZGLM 2JCCA 4ZO8A 3NTCH 3DPBA 3M17B 4YUEL 4YHKL 1I3RA 1WICA 2OYPA 3CXHK 3DTXB 4LHJB 1YMMB 3AY4A 3B5GA 2JJTC 4LQFH 3G6DL 3HRPA 4HIIA 3ZE0F 1T1XB 5B39B 4KQ3L 1J5OH 3K81A 1GGBH 2AV1B 1CVRA 4GQPH 1S5IL 4YHPB 3RWIA 1Q94B 4ZPTB 3O41B 1S9XA 4Z76B 4BM7A 3VDBA 3B9KB 1U3HB 4JFZH 5SWZA 4Z0XB 2UZIH 2WUBH 2IBZX 2DJSA 2XYCA 3K4ZA 1WUNT 5EC1A 3B3IB 4QY8B 2CKBL 4ONHA 1E4KC 2FX7H 4S1DC 4L9LA 1KN2H 2DLTA 2HVKA 5JZ7D 4NQDA 2JKXA 3QWOB 1DFBL 1PEZA 1YUHA 1SVCP 3HLAB 5J12B 2GY5A 4N8CL 4U33A 1MFAH 1FFNA 5GGSY 1FRGH 5C2UB 5JHDA 2HMID 5A2LH 5SWQB 1X7QB 3MOBH 1E28B 4F33B 4NRZB 5GGQL 3WFBL 4WV1B 2I9TB 4M8QA 5TF0A 1IEBB 1DBMH 2ZPKL 3V4PL 3RX7A 2HJKA 5FM5M 4JFDD 4X5LA 1BEYL 1OCWH 2VLJE 5I1AB 4OZ4A 1RFDH 1A1OA 2QSVA 3MLWH 1HQ4A 4NC0B 5LXGH 1JYVA 2K3TA 4JHAH 1JWUB 3DIFB 4HS3A 2FIKA 1ZS8A 5FDYA 4IOIB 4YDKL 3CIQA 1JUFB 4OZFG 2Z9TA 4R90H 4XWGL 4BKLB 4U6YA 3Q5TA 3QSKB 2J6EL 1E4XH 3ESVF 1JMZA 2VR9A 4XMLH 4QF1B 4F7CB 4R96B 1XGRA 3BXNB 1RK1B 2XKNB 4YR6B 5I1EL 4JFHD 5ANMB 3W5NA 2F74B 2JJSC 3RVUD 3ET9F 5D96B 3ARGB 5T1KD 1Q1JH 2XACC 4JPKL 5AAMA 2YXFA 1QBLH 5ISZB 4Y4FA 1I8MA 1L7IL 3MV8D 4HMCA 4OLWL 4YFDB 3BD3A 1NGWB 3BGMA 4PJ5B 3FFCA 1OAKH 1RZJL 5D7IB 3E6FA 4LPVA 4UAOB 3O11A 1H3UA 3G5ZA 4Y5VA 2OL3L 3LOWA 5TQ2L 2CIIA 3MV8E 4HHAB 2A6JA 4PD4K 3PL6B 2CRMA 2OQJB 4KKBD 2YWYA 2Q7YB 5EIIA 2RIKA 2VITB 1WVZA 2DDQH 1I9JH 3FB6B 5HJ3B 5I16B 3KPSD 4GW1B 1W0WB 1AFVH 1ZGLP 1JPSL 1T7YA 5BVPH 5EOCH 1MFBL 4Z7OE 5I1LA 1R3JA 2WQRA 1QSFD 1KELH 3HZYB 2OCFD 3IF1B 3NCEB 5ACLA 4OGAC 4WO4C 1U95B 2QSCH 1WWBX 1JPTH 1BFTA 2YC1A 5ELIA 1YY9C 1IAKB 4WUKH 5E8EB 4RMSA 3MCKB 3GSRB 4M6OH 2F9BT 5E00B 5T5FH 4ZFGH 4K7PY 4M1DH 3BH8B 3MA9L 4KRPC 3EUUA 3TWCL 2W38A 4LASH 1ODAA 2CK2A 1WBXA 1YNLH 3QI9A 1HH6A 4NJ9L 4KV5F 2P46B 5CSZA 1A21A 1RIVH 2CMRH 3WFZA 1I9RH 4KROC 3G08A 3KDMB 2DQGL 3MRPA 4FTVB 4UOJA 1K3ZA 2MPAH 2KQMA 1MHCB 1KSRA 3UTZB 4FZEH 1U58B 1RY7B 4MA8H 4GRWF 5E4EB 3D3VD 2OR9L 1JWMA 1NLDL 3KPRD 3NA4A 2IALA 1DQJA 1FYTE 5JLZB 2QHRL 5FO8B 5EBLB 1QUNA 2AKRB 4OFYA 4XMPH 3CVHL 4PRHB 4XZUA 4MXWL 4IMLA 1NAMB 2NY0C 3SE4A 1W72B 2YD9A 5IHZB 2PYEA 4P4RB 3U4EA 2P24A 1FGNH 5SWZD 4EXPX 2X89A 4UIKH 2X4OA 1OQXA 4QTIL 4LDLB 2X09A 2NXYC 4DQOH 2Y9RT 5HYIA 1V7NL 3MBEA 3HPLA 4UT9H 5CFHA 2BXYA 2FBJH 2YSSB 2MQ0A 1U8LA 4OFKA 1GYAA 4HMDA 1AQDB 4PGDB 2C3XA 4GKZB 5IW6A 2KZ1B 3LPGA 1R0AL 1X44A 1TVDA 3PV6B 4PGBB 3GMPB 1N64L 4R4FL 3BKML 1JNLH 4LHUB 4DJMA 1TXKA 4YJZL 3FB7B 3RZCB 4KGLA 3GSNL 4NP4H 2R1YB 3I6GB 1FNGB 3BAEL 4LOUC 4AEFA 2XTJD 2ERJB 4QGYA 5C07D 1DBML 3HE6A 3TN0B 3B8SA 1A1MA 5F7NC 1JNHA 2B2XL 3VXUE 5HVWA 4H1LA 4PJXB 3P4OB 2Y5TA 3S5LA 3VFOB 3LKQA 4MVBC 25C8L 1UT9A 5LVEA 3TV3L 3A67H 2CUMA 3JV0A 1F58L 1FE8L 4J1UA 4CVWA 4M7JL 4ODHH 5IB5A 3MBXH 4NQVA 3VWJB 1QRNB 3QFJA 3OX8B 1ZHBA 1L9MA 4H88L 3ZKMD 4OLZL 1DBAH 4QTHB 4HSQA 1AXTH 4M48L 3FO1B 3NIGF 3QUXC 3U9PH 2WBJC 4QRPE 4L3ED 1I85C 1BJ1H 1QQDB 5IF0B 4MD0B 1PZ5B 1YNKH 3FB8A 3NPSC 3NAAL 4TSBH 3IJHA 2I27N 3CFBA 4LHQB 1QFWM 5HXMA 2YD1A 1TVHB 2YRLA 5DRWB 4KVNH 1H3GA 4MCZB 4RRPG 3BP7A 4KPHL 2G5BB 4P2RB 5MENA 2QEJA 1AC6A 5L2JB 1Q9KA 3EFFB 1KJVB 1I1CA 2AJ3B 4PRAA 5JIHA 3VCLA 2X4PA 3D2UB 3NZ8A 4JO3L 4DAGH 1M71B 2X4QA 2X4SA 3JVGC 3HG1D 3SGDI 1RK0B 2IADB 4DUXA 4OF7A 4CADB 4G6JH 3WEXB 4GMTH 3DMMC 2VAJA 1WCBA 3O6FB 5IB1A 1DEDA 3OXRB 1IC5H 3T1FA 5AG9A 1X5IA 1OM3L 4N8VG 4G3YH 1X4ZA 3O2DA 4CMMB 4ELKA 1H15B 2MQ3A 3JWOL 1V7NH 3M45A 1CICA 1W8OA 5F6HI 2X10A 1T80A 4OLXH 4QRPD 4U6HA 3FB5B 3TNNB 5KSAC 3GFUA 1FJ1A 2OJEB 5KW9L 1K4DB 2BERA 1WFOA 4M1DL 3Q0HA 1P84J 2AXGB 1RHHB 3AM8A 1T4KA 3RL1A 3MV9E 5IOPB 2IWGA 2EDEA 4CVUA 1DQLH 1CD9B 2WBWB 4Q9BA 5IG7B 2GFBA 5E6IC 3QG6B 3UTTE 5D72L 4NJAH 1R3KB 3GZKA 3V5KB 1QFOA 5CJXA 4HIJB 4H25B 1XF5A 3IDIB 1E4XI 4RBPK 4XTRD 2I9LB 1R5VA 4ENED 2I25N 3MLZL 2WQ8A 5ITFB 3VG9B 1WTGT 3QQ9D 3GBNH 3ARFC 1MREL 1LNUB 5HGBB 2HA1A 1T1YB 1JGDB 4L4VA 3ZE1E 5ITBH 3QRFM 4ZXBD 4HCRH 3MLTA 4Z78A 3O8XC 2IQAB 2EE6A 4JFFB 4RIRB 3JXAA 4X6BA 3QUZB 5ID0B 4V2CB 3REWB 4KTEH 5I1IH 1N7ML 3OF6D 3M8OL 4JY5L 5HPMA 1IGYA 1UVQB 4E5XB 3G5XB 2R56H 1YJDH 1PQZB 4YLQT 4Z7UB 5ID1B 3VXNB 1IC4L 3VRIB 1KIPA 5JR1L 3S9DB 4C83B 3ZL4L 3O6KL 2X7LB 1D6VL 4GMSL 4W6XB 1ZLSL 5J06A 5SWSE 3RY6A 3LDBB 2A9MH 1ZK9A 1C16B 3SE4C 3H3PH 4G7YL 1XGUA 5ALCH 3W9DA 4QHUB 1J8HA 3Q3GB 4MXVE 4MA1C 5DRXA 4NOFA 4X99A 1AIFB 4PJ8D 1MCJA 4UIMA 5D7IE 1T03H 3C6LB 2A9NH 1XGTB 3ARDD 4PJ9D 4AIXA 3VWKD 1GGCH 4PRBA 4O5LL 4JR9L 1F8TH 4L29A 4LARL 4QHMB 1TCRB 4D0DA 2YUVA 3UYPA 5FCSH 4YNYA 4ZUUA 4IRSB 1U6AL 3NCJL 1Q9OA 4Z7WE 4MNHA 2EDKA 1YEKL 5JZ7C 2C7UB 4KAQH 1A7OH 1F4YH 1NBYB 3BGFC 3CVHA 5JOPE 3F58H 4OUUB 2R4SL 1YY8A 5H37H 2BOCB 3PGFL 5J6HB 5EZOH 3VXSA 1RZJH 1E4WH 1MCIA 3UMTA 1I7UB 1IC5L 4MSWB 3KPQA 1UM5L 4M5ZH 3HZMA 3QXUA 2NPLX 3D3VB 2JCCF 1FV1A 3EYVB 4X98A 3MRRA 1EMTH 4XHJD 5FF6B 2UYLA 4X7CC 5I1EH 1P5UA 4FQXD 1XR8A 5JPMB 1U8MB 4LF3B 1CFQA 4F57L 3PWPE 4K2UL 1SYSA 4C54A 4HT1H 1JYXA 4NKIH 5IKCB 3CFEA 1GOGA 5IEHA 4GAGH 4QRRA 3CC5B 3UTPD 3V0VA 4K3EH 4OT1L 1ITBB 1R5WB 2X1QA 4PG9B 3W2DH 2DB8A 5I1DB 4CDGC 3E3QC 2ESVA 4N9GA 2BZDA 3MV7E 2L4OA 2OR9H 4HDIB 5D6CA 1DE4A 4HWUA 4R2GB 3TYFA 4X9FA 1D5XB 3DX8A 1RZFL 3MRHB 3WXVH 4F8TA 3OKNA 1AD0A 5T5NF 3IDYC 3GSXB 1OSPL 4EVNB 2XTJC 4TQEH 3PXHA 1JI1A 4S10A 1FO0H 3OKDA 1MY5A 5ADOL 5I30H 3NCBB 2R1WB 1RJZB 3ARUA 3KLSA 2XQYK 5IMLA 2OTUB 2AXFA 3FO9A 3O2WL 1FC2D 1VENA 1T2JA 3TVMC 4G6AD 2FWOB 1NKRA 4JO2H 3VI4E 3IS0X 1C5BL 3DUUB 4O4YH 3NCFB 2Q8AH 1CE1H 5AEAA 3P9MA 1KT2B 3BPLB 2R0LL 5KS9B 5F1OB 3F7VB 2V7NB 1KNOA 3L6FB 1YEDA 1ZWIA 4YO0A 5JUEL 1XR9A 5T1LA 3GMLB 4UDTB 3RZCC 3SE3C 1ADQH 1AE6H 4KMLB 5CEZD 5DSCB 2BNRB 4MX7A 2BNUB 1A4JB 2VISB 2DLHA 1T0PB 3C60A 3MSPA 4LSVH 3WLWD 1GGBL 3I02B 5B8CC 2IBZY 1BM3L 2CLVB 3ARBA 3NPSB 3STLA 4K8RH 3UTSB 4MB5A 1GOFA 3J7HA 4V1DB 5IK3B 1RULH 3QIWA 1P84K 3IKCB 5I8EA 5F9JA 3K4AA 4HJJL 3HAEB 5CZXC 4CJ1A 1CLZL 1C8PA 2OI9C 3JTSA 1U36A 5DWUL 1BBDH 1I1AD 3PP3H 5IBLC 4LL9A 3U4BL 1NKOA 1K3IA 1MI5D 4R26H 2MHAA 1Q8MA 1FL3B 1DL7L 3FAWA 2NR6D 1MCQA 5CAYB 5E6YA 4ZFZB 1EGJA 2FSEA 2WBJB 1J11A 1CQYA 3VFPB 4FTVE 4NFDA 3DBXB 4KFZC 5L8LB 2IH1B 2ORBH 3F7QA 43C9B 3GI9H 4HH9B 4JDZA 4UT9L 4YFLF 2QKIB 3LEYH 4P2QB 1T04A 1QPXA 3D18A 4TRPL 4NIKB 4UILH 4G8GD 3UDWC 4MD4A 3GSQA 5D8JH 3CFDA 3PWPD 3ZKXB 3MRCB 4U0QB 2V9TA 3MV01 4FQCH 3VFNA 3DRQA 1RZGA 4JFEE 3GO1L 4LVHC 4PJ9A 4ESKA 3QUYC 3VWKA 5IMMB 3QPXL 3MOAL 4ZUSB 1N8ZB 1AC0A 4N8VB 1XAUA 5GJSL 4XNQB 4D0BA 1INEL 4YGVA 3VXTA 1TITA 1TTUA 3HG1E 3VG0H 4X0KA 3O9WB 1BECA 3Q5YA 3OKEA 4OZFA 2C1PA 1U92B 5DEFA 3FTGA 1WAAF 1S9KC 3ARFB 3IETA 5I15L 4UDUA 1ZT1B 4OLWH 3D2UD 4LCYB 3PWNA 4CW1B 2Z8RA 1NCBH 1DZBA 3U9PL 4AH2A 3CNKA 3OJDB 2GCYB 4JRXB 1OGAB 4M93C 1PG7H 3O8XB 2X4TA 2LU3A 2NZ9D 4PJBB 6CGTA 5IHLB 3WO3B 5BZWA 5EORH 3QHZH 3QUXA 4JM2D 5C0RL 4P2QD 1H0DB 1OW0A 4HWZB 5J9PB 1W72H 1G1CA 1PDKA 2IANB 4JCMA 3CFJB 4R3SB 1HYRC 3B9VA 5M94B 4P49A 2HJLB 2ZUYA 4NO5B 2J88H 5J13B 1F3DH 1QFWI 1I9JL 2UY6A 2VL5A 1CDUA 4MJ4A 4JJ5A 1HZHL 2X1PA 1RFDL 4NO0A 4Q0XL 4XP1L 3WE6B 2FL5A 3ZHKA 4XBPA 1X5KA 3U30B 3QUZD 5E0QA 2Y7QA 1T66C 3V6FB 1G7JB 4PGCB 1MVFA 5JW5B 3IDMA 4NQCD 3PHOA 2PXYA 1BFSA 2QADC 1RULL 4X8XA 3U9UA 4NO2A 5GPRA 3FHAA 1CGVA 1NUDA 1R3IL 1Q9LA 2X6MA 1UZ8A 2ADGB 4LLQB 4BQ9A 5C09A 1Y6MR 2MCPH 3IJSA 4XCFH 4M61B 4U1SA 1JFQL 1ZAGA 5C0BE 3SY0B 4ZAKD 2HLFD 1HI6B 4RDQF 3EO0A 2VXQL 1FO0L 1DBAL 2HFEB 4ZO9A 2DBLL 4OZGF 2FO4B 1ACYL 3RGVB 4BQ8A 2VLRD 3LQAH 1PKOA 3LVEA 1FL5A 4L1DA 2YPKA 4JO2L 3QIBC 2A2QT 3SJVA 1MRDL 3QEHA 4Y19D 4AL8L 2M2DA 1C5BH 1G9NC 4NZUL 5EN2A 2FJFB 1WZLA 1EIBA 2G9HA 2FJHB 3CMOH 3WIFB 2FLRT 4E0RB 1D5MB 4LSSL 4HWBH 4HK0A 1KB5B 2XZAH 3C8KB 4TUKH 5A16B 5F1SA 3DROB 4JY4B 4PJ7B 2FJGB 4ORGB 2M1KA 4P5KA 4DK3A 3KS0J 4LLYA 4RFOL 1M05A 1DLFH 3ARGD 1B0RB 1XIWD 3IXTB 3P30L 1IKNA 3QDGB 1CICC 1YPZE 3GMQB 3F8UB 2CXGA 2EDWA 2XY2A 3QWRD 2AP2A 5JHLL 5ETUB 3STZB 2R69H 4R0LA 4KJPC 5B4MC 1MSPA 2CRIA 2ICEB 3KHOA 4TUOB 4GRWE 1NCAL 5HD8C 3IFLH 1ND0B 4YHOH 3NA9L 4R97C 1OT2A 2BVPA 1Y18A 3EOTH 2ZOKA 1A7OL 4F7MB 1A6PA 3G5VB 4NKDB 5HVGB 5C9KA 4GG8A 4OCSH 4NRYB 4XPBL 3MO1A 4EOWL 2F5BH 3BMWA 4MA7H 3ULVE 2GJZA 3O6LL 4U2YA 2SEBB 1LEGB 3K1DA 3IAQA 5I1GL 3F12B 3ISWA 3MMEA 3K2UL 2OMBA 4FTVD 1U8QA 2KPNA 3RX8A 4DGIH 4PJBE 3SQBA 1A6TA 3KJ4B 2A83A 2QHRH 4X4ZA 3NABL 1OY3B 3V6ZB 2IQ9L 4U1HA 3TPUB 3WKML 3GJFK 4Y2DB 5I66A 1RIUH 4TVSa 4CRPA 3TJEH 4OV5A 1NGYA 4TVPD 4GBXD 5C0IB 1MI5B 1MFCH 4RAVA 1TJHH 3TYGL 2BSSA 3SBWC 1BLNA 4HEME 5JXAL 3TT3H 1EA9C 1C5DA 3P77B 2NY7H 4KROB 1LP9A 3QNXA 2BY3A 3DURA 2M8XA 2V9QA 3RPIB 1A3QA 2NZIA 1F13A 3BPLC 1LK2B 4RGNB 1QSZA 4TN9A 5EWIH 1CD1A 4WHYG 4P23C 3ARDB 4LPCA 1PKQB 1CDJA 3BDYH 4FRWA 2HJFB 3O6KH 3X3FL 2X42A 4R7NA 3BFOA 3OMZA 2YA1A 4I9WD 1QSED 2BMKA 2DMCA 2Q8AL 4NC1C 4X7TA 3UXFA 1QSEB 1NAMH 5GRYA 3SKOA 3TH4T 1CGWA 5GS1A 1JV5B 1RD6A 4QHNA 1CFVH 1SM3H 1TNNA 5E2TL 1YEJH 4JFXB 4BK4A 2UUDK 5IVZB 5DMKB 2HTKD 4ZAKC 4ORZC 3QCVL 1NGXB 2QLVB 3WLBA 4WI3A 1RUKL 4WWKA 5HHMD 4YHIA 2EH8H 1T21A 1NMAL 2VDML 4IRZH 1AR2A 5E2VH 3I85A 3BPOC 3NGBC 4OZIF 5C08B 1FDLH 1Y6NR 4JRYB 2EYTB 5IB2B 4IS6A 1WBZA 3SGJA 1BM3H 5GGVL 5ISZE 5DJ2A 5HDBF 2J8OA 5DEGA 2IPKB 5SX5K 4HC1H 1FO0A 5JHDE 3QUMH 3K46A 2LU7A 5IVXF 1K2DB 5J89A 4WFFD 1K5NA 1KB5H 2E6QA 4L3CA 1AJ7L 4OTXL 1KLUB 1VFBB 3LKPA 4XNXH 3QZWA 3UTTA 1A9EB 4JG1L 2KBGA 5EZIL 4KDTA 1G7QB 4NWUH 1IEHA 2YD3A 1FL6A 1NCAH 1FVDB 1XZ0B 4PRPD 3VXRA 3L3HA 3S34L 4R26L 4RZCA 4Q9QH 4M7LT 3C87A 1TCMA 1DL7H 4M7ZC 3WIHH 8FABB 4Y8AA 3QJHA 3T04D 1GCFA 5D4QA 2NW3B 5C6TL 5HDOA 2R2EB 1J8HD 1Z9MA 3NZHH 3ZKMC 1GGYA 1UEYA 4RAUB 1DEEB 2VH5H 1TZIB 4WFGD 4QOKD 1RUPH 3B9AA 2ZUUA 4MB4A 3FMGH 5LBSH 3T4YB 1K85A 1C12A 5I1GH 3VFMA 1JHTA 3UZEA 3D48R 1JVKA 4ONFH 1IGJA 5GHWH 1MREH 3VFRB 1DBKH 4LLWB 5D9SB 5ICXA 1CD8A 2EDQA 3JZ7A 3O9WC 4GKSA 4LVOB 3WKMH 3LV3A 3P4NB 2DKMA 4MJIB 4OAWB 3RDTD 3MLVL 1KTDB 2O93L 4OZIB 4MAYB 2BJML 4AQ1B 3AU1A 1MFEH 5DUMH 2DJUA 2YPVL 4IRSD 4FFWD 2A0LD 3BWUC 5HD8D 1QA9B 5FCUL 1TTGA 3SKNB 1LEKA 1HSBA 1QZ1A 2E8ZA 4HJJH 2X4UB 3JWOH 2VLKB 5IVXB 3D85A 1RJLA 5KOVC 2DQJL 4HKBB 3KPMA 3O45A 2MWCA 5IT2H 5DI8B 3TGXA 4EEEA 3UPRA 1T6VN 1ZT4B 5BMFL 1RMFH 1C1EL 2J5LC 2C4XA 5D2LA 5A2KH 5HYQB 2VSCA 3GMRB 2DI9A 5SWSD 5E6IA 1EHNA 4M7KH 4XCYB 1VESA 1PBYA 3UPCA 1NPUA 4U6XB 4EDXA 4IOFC 3RVTD 1BVLB 4LARH 4JRWA 5CJQH 5TDOB 4LEXH 3S4SG 5E8PB 1Q9WA 3MNWA 4WW2C 5CGMA 2QADB 3V4VH 5BRZE 4G9FB 4JCLA 2X1OA 5GGQH 1M1SA 2L7UA 1CFTB 4DGIL 1LILA 1CE6A 1AO7B 5ADPH 2J1KA 4XPAL 1J18A 3WFCL 4ZOCA 3HS0B 5F1IA 5CJXC 3PNWA 1DUYB 4QRUB 4Y16A 1YMHA 3TVMA 3LB6D 3VI4F 4KZEL 2XWJB 4P2OC 1WC7B 3V79C 5KAQF 2YPLB 1TETH 2AEPH 5DD0H 5AUMA 5J3HC 3U83A 3V7AG 3VG0L 4LMQE 4WVRA 1YJDL 1M7DA 5DURB 3E2HB 1JNNH 4KC3B 3ZDZE 4W68A 4FS0A 4LIQL 4YK4C 1A47A 1EAPB 4XNUH 3MOQA 2XQBL 1SY6A 2YBRB 3VE0A 1CVSC 4G8FA 3EYUL 4JN1L 4H5SB 5IMOB 1WK0A 2OX5A 4DWHA 3P2TA 4UBDC 3CPLA 3S36X 1BOYA 3MFFB 5F9OH 4RFEA 3ARBD 4G8IB 1UXSA 2CKBB 1GJIA 5GZOC 2IH3A 3LKSB 1EEQA 5BV7L 1INEH 4WDIA 4XCNA 5E2TH 2XPGB 5GRUL 5DJZB 3PDDA 4F7PB 2EYRB 2VAAA 1NFIB 5DLMH 5TH2A 4IJ3B 1RZ8B 5EU7C 1ZA3B 5DJYA 1YQ2A 1JYNA 1AGDA 3JV5A 4OM0L 4JRYE 4TUJB 5HGDA 1FYTA 1EH9A 5DJDA 1XIWB 2LAGB 5L88L 4NT6B 1VKXA 2Z4QA 2ADJA 2IPTH 2YK1L 5D93C 5ESAA 3FOMB 1U91A 4V1DD 4CL7A 3RBSA 3AFLA 5CBAB 4Q2ZA 3C6LC 1VADA 1MAMH 3ZE2F 1MCSA 3G6AA 1XF3A 3QNYB 4K7PL 1AI1L 2VZUA 4G5ZL 4HKJB 3H6JA 5T1MA 1VACA 2GTZB 2YR3A 3OHXA 4JFOB 4IRSC 5J3HD 3T3PE 3UO1L 3AGVA 1UKTA 1MF2L 4U49A 3VH8G 4PGEB 2EDTA 5GRZA 1BZ7A 2QSQA 1A7QH 2BFVL 2EC9U 2EH7H 1BFOA 3B83A 5DK0B 2DWDB 2GK0B 3DO7A 4YH6A 4R4BA 4ZAKB 2EE9A 1YEIL 1CLOL 3R1GL 1D6EA 3CZJA 5GGTA 5EA0L 1EXUA 3KLDA 3OAYH 3VRLE 4WW1B 4OGYH 5EDXA 3OGCB 3L5WA 1JJUA 4HBCL 3TP4A 5KSBB 1CF8L 2K7PA 4BH8A 5IBLD 3ARDC 4N0FB 5JXAH 4Q74A 5J11B 2F54A 5I18H 4B7IA 1QBML 2XKSA 2F8XC 4MQ7B 5IR1B 1TQBB 2DICA 2I07B 3LQAL 5EO9A 4BZ1H 1GC1H 4WTXA 4LP4A 5BRZB 3ZYOA 1MLCA 3NA9H 4G6FD 3WIIH 4KMTL 1U8KB 4ZNEA 1T5XA 1RUQH 1Q72L 1QBLL 1UB5B 4F9PC 2R29L 1KXVC 4PR5B 3VFTB 3S36H 2EE2A 3KGRA 4LKXB 3EHBD 5LXGL 1MCRA 1MWAA 2ZG1A 5ERWA 1LDPL 1G84A 4OLVL 4U4BA 3O8XD 1HHJB 1DLFL 1Z6JT 5B3NA 1IJ9A 4NGHL 1NC4D 1UH3A 3P0GB 1GZPB 4QGTA 4BSVA 4R4FH 1JK8B 3GHBL 1UB6A 4AEHL 4P9HL 3X3GH 3I9GL 3MRQA 3MYZA 3CDCA 4K3DH 3SO3B 4OJFH 2FB4L 1BEYH 1OCWL 1PJ9A 32C2A 1LE9A 4HV8B 2ZKHL 2EYSB 3MPCA 5EU4B 3ES6A 3MLWL 4YHOL 5BO1L 3BZEB 2DM2A 2NY6B 7CGTA 5DMGC 4N5ED 2CKBH 3P4MA 3QEQB 5MEOB 3MGTB 1LK3H 3BP5A 5LKNA 3RWDA 3X12A 3FONA 2DQTL 3H9SB 2Y07L 4KZEH 3HPJA 2VB5A 3AVEA 3KPRB 4DFHA 3H9HB 2KUTA 3KPLA 5KSAD 3TV3H 1KFAL 4ODBD 1EJ6A 1F58H 1FE8H 3IFPA 4LNVA 5I17A 1M6OB 4XPFH 4PREB 1F11B 4NUJB 4GW5B 5IM7B 2WAHA 5C09E 35C8L 2CLRB 4L3EE 2GSIB 1DLHB 2DQHL 2PO6D 4G8GE 1JRHH 2J5LB 2Z31B 1BGXH 3G9VA 1VSCA 4Y5VC 3LKOB 4IRJC 3WD5L 1FFRA 4YXLL 5KANI 2H8PA 2PXYC 5H35B 3BD5A 3D3VE 5GHWL 1KCLA 2VDQL 3FQXA 1TIUA 4A6YA 1QSFE 2AW2A 4KMQA 4H1LG 5C0GB 1A6WL 1NGZA 3FQRB 5D2LE 3DI2B 4H0HB 4N1HB 1PY9A 4PUBL 3MZTA 1KPRA 3CZFA 3MBED 5EZJB 4Z9KB 1G7LA 4WV1C 5D2LF 3BD4A 2ZWLT 1CF8H 5L6YL 4BH7A 1ES0A 2AQ3A 1A7NL 3U46A 4ODTH 4XCCH 3RIFK 2OR8A 4LSDA 1I75A 1OARL 4XBGB 4J3XA 5I1IL 1J1XH 2Z35A 5KBNC 4WHDA 5HTSA 1GC1L 4L8BB 4ISVA 3ZZ1A 1J10A 2F8VA 4YK4B 1KGCE 4HKXA 3FQTB 3SGEH 2EDXA 2VDNH 4POUB 3KPOB 4XVTL 4WW2B 1CGSH 1OF2B 2Z91A 2V6HA 4MNGB 4Z77A 4PJBF 5GIRB 1ZEAL 3KPSE 4P3WA 1J0HA 3PWJB 4XGZA 3T0AA 4ZYKA 3BKMH 2EDYA 1QR1A 5FXCH 1U3JA 4WGWB 1BWMA 1M7IA 4JHWL 2MPAL 3AREC 2XICA 5GRVK 1FIEA 3ARGC 3FMGL 1KACB 2XI9A 3MUZ1 1GGCL 3SDXE 1U3YA 5DRNB 2E3VA 3LEVL 4D8PA 4N0RA 5L2KB 3RWJA 1HN1A 3EIFA 3RL2B 3KYOB 4E9LA 1AHWB 1IQDB 4TULH 1JF1A 3GSUB 4PJCF 4U7KA 1EX0A 3ZO0A 5FUCE 3E2HC 5F3BA 2D31B 5E4IA 5AZ2L 4B7LA 3QQ3A 1T3FA 3AS1A 5EPMB 4M6OL 4LSQH 5T5FL 1W0VA 5DZOA 3BWAA 3PXJA 1TZHA 3MA9H 1HH9A 1QEWA 3W11D 5CEZL 5DD0L 3O3AA 3T2NL 4NO3A 2UZYB 4NKMA 3PL6C 4ZG1A 5K9JH 2XWBB 1N6QL 4NQSA 3FZUC 4JO1L 2ZOLA 4GAYB 5FEBA 2OTWB 3HZKA 3P73B 4YAQA 1QNZH 1RAMA 1RJCA 1J05B 1LO4H 1O5DT 4J8RB 1HIML 3BZDA 1VGKA 1YN7A 3ZKQD 4PJGF 5D7KE 2XZAL 4GRLD 4OCYL 3C08H 1QD0A 5D70H 2VABA 5IW1B 2VXVH 4XPHH 5JO5A 1DDHA 1N5YL 3I2CH 1YNKL 4ONOA 5KVDL 2ZCHH 3ARZA 2LTQB 4HK3N 5TE7L 4AT6A 4CN6A 1SEBA 4GRMA 4O2EA 2XN9D 4PTUA 1P2CA 1AO7D 4YHML 4JG0H 5HHVH 3BI9X 1BQSA 5TDPB 5D93B 4JANA 3ZKND 4EUPH 3TH3T 2HT3D 2DQFA 3H7LA 1WAAA 2VUYA 4PJAF 3VXRD 3OXSB 3V8OA 2HYMA 3NACH 3CVIL 2AJZB 4MDIA 4OKDA 3D69A 3HI1B 1L7IH 3NFNA 2ADIA 4M48H 2GY7B 4XPBH 4Z95L 4Y5XA 3RNQB 3CDYA 4EOWH 3VGGA 1VFUA 3EW3B 5D1ZB 2PYEE 4JKWA 4LU5L 4P4KD 2WP3T 5MP6L 5JOPD 5MI0B 3VFVA 1WIPA 2VZ1A 4QOKA 1OL0A 2D7PA 5CP7B 5KN5B 4UTAL 2XNAB 4QHLA 3D0LB 3H2WA 5C0AB 3ZLQC 3V5HA 3ZMRA 4BSWB 2XWTB 2C5DC 2C3VB 4JAMB 3O2DL 3QIBD 5ILTL 1FZJB 4KKNA 3SGKA 3RWFB 3VXPB 2X41A 1T1WB 3PQYE 1KEGH 3RDTA 5HYJA 2J7LA 3QXWA 4JHZA 4QRQB 3IU3B 5C0EB 5E8DL 5EUOF 5IHUH 4YPGB 1D9KD 4HIXL 1ED3B 5DQDH 5BZDA 2D0FA 1CDHA 1VFMA 3W5MA 3NH7H 2V9RA 3MRNB 4RISL 3CSPA 5IHBA 3FCTA 5F9WB 3DGCR 2R0KH 1FFPA 4BA8A 4PJFE 1FG9C 5EUOA 4K94L 1IL1A 3AXLA 5DDHB 1JCKA 4HKZB 3ELAT 5J0BA 5C3LD 3CCHA 1DANT 1HINL 2GJ6B 4LVNB 2PYFB 1VGEL 1DBBL 4IRJA 1CFNB 2A74A 4B53A 3MFGB 1OAXL 4IIQB 2ZZUT 4ZDHA 4OB5L 4ZPVB 2APTA 1S5HB 4CKVX 1K8DA 4PJHA 2A6DA 4NQXA 3WS3B 5I6XC 2AAVA 3A6CH 2ITCB 3MJ8B 3ZKSD 3HRZA 1DBKL 1WFTA 3L3KA 5EU3B 1FFQA 1S7TB 4OZFH 2WBJD 1CXLA 2MKLC 4KJWC 1KCKA 1LDPH 4OLVH 2HH0H 5J6GA 5HYSB 5KVEH 2F53E 4N0UA 4KXZH 5FECA 4M4RA 3O9WD 5CHNB 1HHHA 1JGLH 3KYKH 3C5ZA 1D5BB 4OD2B 4HIEA 3U4AA 5AZEH 3ZDZF 3F7RA 1P4BL 1I9IH 4GRWH 5ACZB 1KCUL 3GKWL 3MUGA 2YUWA 1MCBA 2X4NB 2FBOJ 4NKOB 4QLRA 2XA8L 5HYEA 4UV4L 3R06A 5D7JC 1PX3A 4OLYL 4JZJA 1CK0H 2VDKH 4KK6D 4QWWD 5ABDE 5E03A 3W0WB 2UWEF 1IAIM 3KNBB 2JB5L 5CMAA 5DHYB 3H9YA 5DHVB 5FYLL 3TWCH 1R3HB 4ZUVA 1C08A 3HE6C 4HCRL 4LSTL 4Z5RA 1MOEA 2EKSA 4JY6B 4KUCD 5KSVA 5DS8A 2O5XL 3MRJA 4H8WL 4PRDA 2B4CL 2CO7B 4L4TA 1MHHB 3GKZA 3BRDA 2AK4E 1A64A 4LCIH 4DKFL 4UT6L 1AH1A 1BWWA 2HLAA 1VEPA 5F8QC 1MLBB 3IS1X 5JW4Q 4JR9H 4MCYA 2YA2A 3SPVA 5DQJA 1SBSL 4ZSOB 2AQ1A 1IGMH 5D72H 3UJJH 3WUWA 2J88L 3DMMB 2BSRB 2FATH 5E5UB 4KDVA 4KJWD 2AXHA 3Q6GL 5ALCL 5E9DB 1FAIH 3QDAA 4BZYA 2AABH 2I5YL 2NY5L 4NZDA 2FIRT 4FABL 1RURH 3I75A 1DUZB 1TETL 1JTPA 4QXTB 5FGSA 3QFDB 4FQHA 4LLDA 4F7TB 3KPSB 3BO8B 4P2RE 1K8IB 4RCAA 3BEVA 1GAFH 2ZUQC 1KGCD 4MQXD 2MOVA 4P3CH 2XOTA 4HX1A 3ECBB 2ZUSA 4P2CG 4HS6A 2H32H 4DKEH 1LO5B 4KQ4H 1CQKA 1YQVH 4LLDB 1A1NB 2Q20A 5IMKB 5IBUG 1G6RL 1QACA 1S7XA 3VI3E 5KSAA 5JR1H 1CL7H 1MHEA 1YDPB 3HR6A 1CBVL 4QRPB 2UWEB 1LHZA 3WD5H 2AV7B 1X5XA 5IJVB 1FPTH 2DI7A 3MRIA 5E9DA 1ZVSA 5B3JE 5D71L 4UBDD 2YUZA 2LVCA 3MV8B 2PO6A 4G42B 1BJ1J 3DMMA 3BZFB 3ZKNC 4OSUL 4I48A 1UM4L 2VTFA 3Q6FB 1B6UA 3D39D 1YN6B 3MJ7A 1K4CA 1DSFH 3GSNH 4NP4L 1LE5B 35C8H 3QIBA 1I85A 4K2UH 5ESQA 1KULA 4OUOA 4HWBL 4LSVL 2FDBP 1EEZB 1Y0LA 1MHHA 3BE1L 3PABB 1AGBB 2GT9B 1KN4H 4H26B 4P57B 5HYJD 4YPJA 1WWWX 1XCQB 3TO4A 1YPZB 4R2GD 3UAJD 4NBYB 4XBEL 1G7MA 2DJ4A 5ALBL 2XRAH 1C08B 1FBIL 3V7AE 5K59F 4Z7NF 4MJ5A 4G3YL 4OCXL 4XVJH 1BOGA 3ARPA 3C9NA 5EUKA 2BCKA 5CZVL 3VW3L 4OFPA 1CK0L 5FYLE 3R06B 4MDJB 5TE6H 4MXVF 1N2RA 3MUGB 1QHOA 4S0TD 4BJLA 2GKIA 4Q6YA 3KPRE 2Y06H 5HGHB 2A77H 1D5BA 3O2WH 1HHHB 3HNVL 5SWZE 3MRFB 2BY0A 3LKNB 2EXYD 4N0UB 2PTVA 4FMFA 2VLLA 2BRRH 2EDJA 4JFQA 3FRUA 4BK5A 5DFTA 1UJTA 3MYJB 5KVFH 4ZFFB 5K9OB 1P7KA 2B1AL 1I3VA 3HRZB 5T3XE 1X5GA 4S1QH 5T3ZD 1XCTB 3EOBB 3HFML 1EHAA 3DOSA 3QR2A 3V4PH 4DN4L 4GG6F 4NHCH 2BP3A 2A6DB 1NJ9A 2BY2A 3B9KD 2AERT 4B0MM 2O26U 5C7XH 4IHOB 3G5YA 2P5EA 1FFOB 1JI2A 4LLUB 3TN0D 1X6NA 4X6CB 5BW7C 4MYWB 4KGJA 2BX5A 3ZHDA 3WHXB 3CCHB 4PD4J 5E24E 4PJ8C 3QCUL 5DDHA 2HKHL 1BD2B 1ORQB 1CL7I 1WSST 3LHPL 4D2NA 2FX9L 1G7PB 3AXLB 3W11C 4KKLD 2BRQA 3CVIH 5C71A 4OBRA 1S7WB 3HA0A 5E2JA 2GITA 4X4ME 1FIGH 3WN5A 3JWDH 3QUXD 4JM2A 3MRNA 3I84A 1YNTA 2Z92A 4NYLB 2Z8SA 3X11A 4Z8FL 2MCG1 1XF2A 4XRCB 4I3GA 3DSNA 2APVA 3L9RB 2P8LA 3VXMB 3VXPA 4JDVB 5JPNB 2XV6B 5IWLC 2BFVH 4LBEA 5T3XL 2HMIC 2QQQA 1MCHA 5GJSH 5L8JB 3T0EC 5EBWB 4JAMA 5IB4A 4PYGA 4AEHH 4R7DB 1XIWC 5D7LE 2JB6A 2CIKB 5T1KB 4YIQA