4ZQKB

Structure of the complex of human programmed death-1 (pd-1) and its ligand pd-l1.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
114
structure length
106
Chain Sequence
b'NPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPESRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
molecule tags Immune system
source organism Homo sapiens
publication title Structure of the Complex of Human Programmed Death 1, PD-1, and Its Ligand PD-L1.
pubmed doi rcsb
total genus 20
structure length 106
sequence length 114
ec nomenclature
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zqkB00
2YSSA 4ZUTB 4MNHA 2Q8AH 4KTEH 2BVOA 2DQHH 1FNGA 1VERA 3FO9A 4QF1B 5IF0B 4I4WB 3ARDA 4HGMA 4NKOA 3PF2A 3VXNB 4DZ8A 1A14L 2PUQT 4IRSD 4FQXC 5DJCA 3ARED 2NTFA 1J8HB 4FXKB 4NM4H 1P7HL 3O2DA 2NR6D 3PGCB 5J6GA 1M7DA 1YEGH 5EULV 4Z7WF 1XMWA 1I9IL 2PYFB 5I1DA 4F7TB 4UINL 2B5IB 4PJ8D 4MXQC 2ATPA 5JPMB 4JFPB 1IQWL 1P4IL 1QBLH 1IAIH 4JRXA 3UTSD 4Q6IA 5EZIL 1INEH 3QXVA 3I02A 2LAAA 3PNWA 4MQTB 4KJYB 4U1KB 2EE9A 1A5FL 5GJTL 4K7PX 3LKNA 3D18A 3S34H 5E00B 1Z9OA 2APFA 2AV1A 3UTSA 4XCNA 5I8OL 4M1DL 1FG2B 4X99B 4WTZA 2OXHA 4R7NA 4QGYA 1S7TA 4MX7A 1OPGH 5AEAA 4G9FA 5B8CB 2C1PB 2EDKA 2NY2C 1CXKA 3P0VL 4S0SD 1LDSA 3AREA 2F19H 2GAZB 3JUZA 4F9LA 4MJID 5C07B 5I2IA 2LAGB 3RGHA 2WP3O 3ULUD 1CDUA 2C1PA 1PX3A 1A9EB 3L9RB 4BFGA 4XPBH 2C7UB 1T89C 1CD0A 5DJYA 4IIQB 3PWPB 3SDAB 1I7RA 4YBHA 1CQYA 4L4JA 5ECJE 4UDTB 3SE9H 1NC4B 1OGAA 2FATH 1MFCH 3R06B 2UWEA 4JGJA 5KS9A 1BQLH 2DS4A 4YHIA 1DQDL 3IJSA 4JJ5B 4YHNA 1A6AB 2VLME 5F7FA 4YX2H 5TE6H 5F9JA 3DO7B 4GS7C 4Y2DD 3WO4B 3DX7A 4O9HL 1DQQA 3LZFL 4YO0B 3MFGB 1D5XA 4JFHE 4OGXH 5H8DA 4J4PA 1A14H 3VXOA 4LLDA 1JI1A 1BX2B 3OTTA 5CEXA 3GSQA 1SJHA 3EDKA 1XR8B 3OX8B 4X6DB 1V3MA 2H8PA 1M1SA 1H3PL 3CFDA 5FYLD 2Q8AL 3ARDB 1T3FB 3BAEL 4X6DA 2FR4A 3ZT7A 4HK3N 5JA9A 4YXHL 3BRFA 1TLKA 4PJGA 1A4KB 1BX2A 2VUYA 4XP1H 3STZB 4JR9L 3MROB 5E8NB 2YSSB 3PL6C 4YO0A 5IHLB 3RIFK 4I18C 4GG6B 2CDEB 1MFNA 3FT2A 3F58L 5F96L 1NCTA 1NAKH 2DBLL 4KWUA 3QHZL 5E1AB 5ACZB 1ZSDB 2X4QB 1A6AA 5DRXB 1UA6L 4F8QA 2RFXA 2F53A 2LVEA 4PLKC 5IQ9B 3DXAD 1FV1B 5IB5A 1PG7W 4LLUB 2IPKA 4O51B 3KJ6H 3P4MB 4WWKD 1ZTXL 3SE8L 3JWOH 5E5MA 5EO1A 3MA7A 3T2OA 3GO1H 3ZMRA 3VFWA 4DGYL 2ZZUT 4X6BA 4J3VA 1WCQA 3T2QA 1JTOA 3JWNC 3L3IA 4P5TB 3V7AE 4AM0A 3VD3A 3GSVA 2GK2A 2DMBA 2VISB 4D0CA 2HG5B 2H32A 3DNKA 1OD9A 3I3BA 4JFQA 5GRJH 1S7TB 1OSZA 1TCRB 2R0ZL 2HT4D 2DYPB 1S7QB 3ARBB 1TENA 3WNOA 2YA0A 2QSCL 3FB6A 4Y2DA 1KEGH 4LSUH 2AV1B 4O00A 5DUBA 1QLRB 1T83C 3TBSA 4PREB 4GLRH 4V1DE 2X4UA 2Q6WB 3ZHLA 2A83A 1IRAY 1QLEH 1RULL 4OQTH 1D5BB 1H8OA 2APTA 3MPCA 1P9MC 3O3DA 4MQ7A 1Q9WB 4M6MH 3JUYA 1QBMH 4KQ4L 1YNLL 4WO4A 3VWJB 4QHUA 1JVKA 2PETA 1XIWA 5IOPB 2R1XB 1WT5C 3BVNA 1C7SA 3O6ML 1TZIA 3LH2H 3LN5A 4ZTPH 3WIHL 1D5MA 4KTDL 4KGLA 5L9DH 2NTFB 2JIXB 3NH7H 1T21A 1JZ2A 3O4OC 1H15A 4EI5C 3QEHA 4P3CL 4WFFE 3SJVE 3IDGA 1RPQA 3LD8C 3HB3C 3WXVH 4XAKE 2YC1B 2W65A 3CFCH 1WFTA 4KRMB 4KK6C 4ODTL 5DD0L 2DWDB 4MNGB 1X5IA 1LO4H 4MNQE 1HIMH 1AGEA 5IESH 1ND0B 1MHCB 5CKGA 2J7LA 5DD3L 1MAMH 1J88A 2F54B 4HPOH 3ARWA 1JFQH 1NUFA 4L4VE 4PP1D 4S2SB 2CMRL 1MHPL 5BQ7A 1KB9J 2GEEA 3DVNB 5F88A 3VRJB 3DSNA 4WHCA 5SWZB 1KN2H 5D70H 2G75B 2A74B 4N8CL 3FB8B 1C16A 3INUH 1QSEE 4MA1B 43C9A 3QCVL 1PVHA 4XVSL 5J9PB 4HS8H 2AI0L 2H2PD 3SDXA 1VGKB 3KWWA 1NL0H 2KZWA 5GS0H 1MCLA 2NX5D 2QR0A 5KANI 4NQED 3W39A 1QSFD 2VSDA 4G43A 4YZFE 4WUUE 5HXMA 5DGQA 3BJ91 3L5WA 2J8OA 3RRQA 1UM6H 5J13B 3MOAL 4XNZB 2CIKB 4J1UB 2G2RA 2F15A 5D9SA 2Y7QB 3S35L 3WEXA 1JNNL 5D7LE 1U8MB 5K9OA 3IDNB 1DL7H 3KHOA 1MREL 1YMME 2QTEA 2BNQE 3WJLC 4NNPL 2R0LL 4I0CC 3RTQD 1A6VH 4JM4H 4NFDA 2H2SC 5I18L 4ODXA 1CIUA 4HKXB 4P4KC 5AYUL 5FGCE 1P1ZA 3EW3B 2DMKA 4IDLA 1YC7A 3BP5B 1LD9A 4HPOL 4PJ7A 3OAZK 3QG7L 3QIUC 4Y5VC 1GSMA 4WFFD 3SJVD 4B7IA 5IVNA 1UXWB 4WHDA 3WV0A 5E2TL 1YDPA 4FFVC 4LSQL 4RFOH 3KPRB 4U1GB 4Q9RH 4K3JL 3CVHB 1NEZB 2B2XH 4NQEA 3WXWH 1I3UA 5DJXA 2A77H 4H88L 4P2OA 4LCIL 4MCYA 2AABH 4PJAB 3NCJL 1UB5A 2XV6B 1C08B 3GSXB 3O81A 4PP2B 1JZ7A 1UJ3B 3E8UL 4KROC 3U4AA 3OXRB 4DWHA 4NHCL 2F74B 4OF7A 5JOPE 1AR1C 5DEFB 5E6ID 3W0WB 4ZTPL 4XP9H 1HNGA 1NAMA 2NYYC 5EZLB 3V6ZB 3H42L 3NCCB 1HOCA 4Y4HA 4L1HA 4ZODA 1Q72H 4PGZA 4UV7L 1F97A 1BQUA 4YFEA 1KJ3H 1DBAL 1FORL 2BVPA 4XNMB 3TV3L 1MCNA 4FQCL 4K07A 1CCZA 1MCOL 3ROOB 5F1NA 5GGQL 3P11L 4RBPH 5TE7L 1CU4H 4A6YB 4CAGA 1U58A 5DJAA 2O61B 4XMPL 1IAOB 5DHYB 3LKPB 4FS0A 1KCSH 2BY0A 2DQJL 2DF3A 2QADB 3B83A 1SJEB 5DVKA 2OL3A 4G3YH 5GRJL 4PYGA 1A7OL 3IKCA 3OKKB 2ZSWA 5J57B 2Q87A 1OAUL 3ETBF 4X6CE 3HC4H 3GSOB 1BQHA 4JFFB 3VFVB 5DD5L 3ZDXF 3MLWH 4M8QB 4I0KA 1XR9B 3NTCH 1CDBA 3U83A 2A6KB 4P48A 3V0WL 1EFXB 3ARTA 3U2SB 1B90A 1FYTD 5B39B 2VLKD 4ETQB 5JMRA 2VLJD 1R3HB 1LMKA 3SPVB 3X13A 3QI9A 5BV7C 5IMOA 3DROA 1KUMA 4PR5B 4HJGA 5JW5B 4WHYH 1HKLL 3JSSA 3HUJA 4BH8A 3D9AL 5FHAH 1OAQL 3MLYL 4O4YL 4CU6A 3EO1B 2QQLH 2MMXA 1FVDA 4NQSA 4H8WC 5F96H 3U36A 3V4PH 2DQGL 1FPTH 5GSRA 2UV3A 4RMTA 4ODSL 4OM1L 4JR9H 2MSPA 4FXGB 4R0LA 4GQ9H 1JHKH 3CFKB 3DGCR 4G8FB 5EG6C 5DI8B 1K4DA 5F3BA 1OCWL 2W9EL 3F12A 1LK3H 4OSUH 3TFKC 2CH8A 3T0VA 1C5DA 3VA6A 2CXGA 3MLTB 1GGBL 3NIGE 3LN9A 4PJIF 1TVDA 5GZOD 2X4RA 3WL9A 4GUPB 3GB7B 1G7JA 2Q7YA 3LKRB 1MRFL 1KENL 3PP3H 3RWGB 3C6SB 1OVZA 2VKXA 5I15H 3MLRH 1LO3L 5FV1L 2LTQC 2NYYD 3VGAC 5FYKU 1EHNA 3QIUB 3UZEA 4PB0H 5E8DH 4R3SB 4XNXH 4JAMB 5SWSD 3K8LA 5KVEH 4X9HA 3L3OB 1CTNA 5CZVH 2HKFH 1SBSL 1MRCL 2HT4C 3G6AA 5FV2A 1I3RB 4LVOB 1T66C 3V7MA 1KLUA 4K3DH 3TIEB 3WS6C 4OF5A 3LKQA 2RQ8A 4DUWA 2X7LA 2FLRT 3REWA 5LQBL 2VDKL 5GRUL 4QNPE 3O6FC 3T2NH 4FRWA 3TH4T 3LOWA 1NCAH 3FOLB 1A2YA 2OSLA 3QDJD 4Z7WE 1BOYA 2ORBL 5F6IB 2IPTH 4G8GA 1FAKT 2HRPL 4OKVB 5IQ7H 2C3GA 2D4DA 3TBSB 4IOSD 1A8JH 1AXTL 1BM3H 2BHUA 2ZCKH 4YK4B 4HF5H 1RZFH 3OKLA 5FYJU 1OL0A 3GRWH 4RZCA 5FOJA 3ZKMC 3PDGA 1UCTA 2NY4D 2OZ4L 4RAVB 4QWWC 2ZWLT 5I1HH 4HIJB 2GSGA 1P7QB 4PJEE 1IGIH 3M1BA 3GMNA 1ZWIA 3H9ZA 2JKXA 3QA3A 3OKOB 3HMXL 4ZUVB 3HI6L 2GTZB 5I0DA 2F58H 1MWAL 4G7VH 1F4YL 5T3XH 4U3XA 3UC0H 3HZKB 3OPZL 3S3PA 4LMQE 4XPTL 2XFXA 2FLBT 4HLZG 4ZXBD 8FABA 3JVGA 5L8LB 2IFGA 3TCLB 4JFDB 3FOMA 5BV7H 5IQ9A 1NEUA 5H94A 3ULVD 4J8RB 3NA9L 3O6LL 4WU7A 2F53B 2VYRE 3GSRA 5EZJA 1IFHL 3TC9A 4LOUC 1YPZE 3DIFB 2XN9A 3VD7A 1HI6A 1N59B 1CE1L 4G6KH 3BWUC 4S1DC 3NZHL 3U82B 2VXTL 4PV9A 1MWAB 4GG6A 4X9FA 4XMKL 5EA0H 5C6TH 4X7SL 4NO0B 4ZSOB 2UVFA 1CG9A 3LIZH 4PJGB 1FVEA 3OHXB 3MV7E 4HDIB 3GSNA 3ZYIA 2V17H 3ARQA 3BW9B 4ZDHA 1D5ZB 3MBXL 2H8PB 4MXWL 4YEEA 2JELL 1X5HA 3MLXH 1NDMA 4MAYA 1X5YA 5J12C 3U79A 7CGTA 5CGTA 1QFWH 4L4VA 1BF2A 2VLRE 3WJLA 5I71B 1YPZA 1A6UH 1AQKL 2BOBB 1A4JA 1GJIA 1BAFL 4GMSH 2Z93A 3OMZA 2DKSA 4NKDA 3UBXG 4KAQH 4LK4A 3SDDC 4LBEB 2GUOB 3EOBB 3OZ9L 4JKPL 1T66D 3KPSE 4JREB 5DD6A 1BWMA 4XP4H 3CH1B 4FQXD 5D7IF 2XTJB 5D5MA 1AP2A 3MV7A 4P9HH 3RZCD 5LKNA 1RAMA 1P69B 2NY0C 2NY6B 3BXNA 4ODVL 4BH7A 5HYIA 3D2UD 1FNEB 7FABH 1WZ1H 4PJXE 4WUUA 1WCBB 4P4KB 4NRXA 2GJ6D 1ES0A 1ZA6B 4UUJA 3RA7H 3EJJX 1JF1B 1SY6L 3IXAA 1MCHA 4ORGA 2AV7B 1ZANH 1HH9B 2Z8RA 4LIQL 5K9QI 2VWEC 1W8NA 3EYVB 1S78D 3JV5A 2EH8H 1PG7L 3PL6A 2JK5B 4PJIA 4OD3H 4JVWA 1A7PH 4JDTH 1ZA3B 5HYSB 5HYSG 4MNGE 3VFOB 4ZO7A 5E0QA 4FQIL 1LVEA 2AJZA 4EBQL 1B6UA 3V6FA 1JZ6A 3NIDE 3TVMD 5C2UB 3WLWD 3MJ8B 4ZYKB 3QI9D 5EU5B 4IOFC 4FQHB 1Z5LB 2R1WB 4M6NL 4XAWH 1KB5L 2W0LA 2DBJA 3VI4E 4FQHA 3NABL 1RFDL 5JW3L 5EU5A 4RDQF 1WFNA 3MA9H 4CKVX 4MJ2A 5F44A 4B53A 3BIBX 4LOUD 5HGHB 5C09B 2AEIT 4JGUA 2GI7A 1ZLVH 1DFBH 4YUEH 1EV2E 1I8LA 3AU1A 4PJIB 4NN6B 4M4RA 1CR9L 1KGCE 1NBYB 3IJYA 3EYVA 3O6KL 5EBLB 5GRVL 1KB5B 4M7LH 3B2UC 1DE4A 1JF1A 4GXUM 5B4MC 3IDJA 2NW2A 1AY1H 4ZS6C 3P9WB 3QEGH 5ENWB 4NN6C 5ICXB 1U3HB 1U8KB 4X4YB 4U0QB 4FNLL 3ARPA 1DR9A 4NQDD 2Y23A 2BNQD 1IAKA 1RY7B 3C87A 1YECL 5LBSH 4KXZI 1O7VA 4XZUA 5B21A 3L5JA 5JHLH 1HWHB 1WIPA 5B3JE 2VL5B 5F7WC 3PV7A 1UYWL 4LBEA 2ADFH 4QNPF 1YQVH 4NSKB 4JKWA 2D03H 3ARGB 2NX5E 3QQ4B 5I8EB 4ALAL 4GRMA 4LF3A 2I5YL 3C60B 1IC4H 12E8H 2Q1EA 4KDTA 5I75B 3VW3H 2NY5C 3FB5B 4X5XA 4DGVL 4XP6L 4J2XA 4D0DA 4PJDA 3I2CL 5ALCH 2O26U 4LSSL 4P5MB 2ADFL 5FUOL 4BSWB 1J0IA 3KPTA 4U2ZA 3TN0C 1EO7A 1VFMA 4PLJC 3T3PF 3VGHA 1FIEA 1JNHA 4RAUA 5JHLL 3CXHK 3KR3H 2Y5TB 5GGUA 4LRNL 4N5EC 4Z95L 4XXDA 4M9PA 2BERA 5D1ZA 1RJYA 3VXSB 5I6XB 5I1AB 3O41A 5KVFH 4BQ8A 5ERWA 3RU8L 2XTJC 1HI6B 5IVXA 5LVEA 1ZS8A 5GGTA 4W6XB 1A6ZA 2ZOLA 3JV4A 4MCZA 1DVFA 1PEWA 1F3DJ 3EAKA 4HIHB 1R5IB 5MP6L 4G8GE 1I1FA 3JXAA 1WAAF 3ZKQD 1QR4A 3G9VA 4XNQB 3MMEA 2VN4A 1H8SA 4MNQD 1PFCA 1W72H 2AXGA 3W9EB 3RL2B 2CDGA 2CIIA 1MNUH 3HS0B 1CGWA 3NN8A 4S1SL 4M03A 3CVHL 2VDOH 1JN6A 1YEHH 1IAMA 1DJSA 2OTWB 1KGCD 1BOGA 1IT9L 3B2VH 3H9HA 5AZ2H 1HCFX 1WZMA 1S7XA 5IEKA 2FECL 3B6SA 4WUKH 3EYQD 4XAWL 4M6NH 3BKMH 1RZ7H 3RJQB 1TJHH 1FO0L 2CGRH 2XA8H 3B9AA 3BGFC 5F7LB 3Q3GA 3UMTA 4GKOA 2ZKHL 2YD8A 5B4MD 2X70B 2GJZB 4LEXH 4QHKI 3LV3A 5F3HA 2ARJA 5L2JB 5CGYC 2UY6A 1IEBB 1JPFA 5IB4A 5IWLC 5LXGL 1QYGL 1BMGA 4Y5VA 5IGXL 2APVA 4GRLB 4PJ9B 1XAUA 1DQMH 4NM8L 4UAOC 4Z0BL 4UB0L 3AXLA 1G9ML 2IQ9L 4C83B 3O6FB 4LP5A 5EIIA 2X7LB 4NN5B 1KXTB 1FYHB 4B5EA 1EHXA 2XWBA 1MCFA 3VWKD 3GGWA 4D9QE 3RVWC 3U7WL 2AJXH 3P4OB 3CJJA 5ESAB 5TQ2L 5J6HB 5JQ6L 4TUKH 3QIWB 4JFEB 2F5BH 3UTTE 4FTVB 1YYLL 3BP6A 1YNKH 4WU5A 3EZ8A 5DD1H 4Z6AT 1EXUB 3DX6A 4AT6A 1CS6A 4XCFH 4M61B 1F4AA 4K2UL 5TDOB 5E9DA 4HFUH 4MAUL 4U1MB 5CLTA 5CJXC 1EO8L 4B7LA 2WBJD 1WUNT 5DDHB 4NO5A 4PJEA 4P5KA 2IFFL 4MA7H 1KCUH 2FECI 3QDGB 4JFEE 1ZGLB 2PYEA 3FQNA 3RVXC 3PHSA 1MVUB 1AXIB 4WHTA 4Z76A 1PDKA 3ZDYE 4LQ1A 1I1AA 4EIZC 2VH5H 3IAPA 4D0BA 3WNPA 1N4XH 1RUQL 3OJVC 4LGPB 1QRNB 4MXWH 4FFYL 4WI5A 5FF6B 2R56L 1DBML 1JPGB 1NFDA 5K59E 2Z0BA 4E42A 5C6PB 3ZKXC 1NLBL 4PRBB 5DUML 3RWHA 2A0LC 5HI5D 1AD9A 4OLVH 1P2CB 5KSAC 5IK3B 1S5IH 5DJ2A 1UACH 3MV8E 4HZLB 5DVNA 5LGKA 8CGTA 4YDIL 1WWWX 1I85C 3GHEH 4HWBA 3X11B 4I2XE 3FO0H 3LQZB 5E8OB 3IETA 1P6AB 1ZEAL 4GRWF 3VU2A 1I7ZA 4HWBH 1FGNL 4XB7A 2J2ZA 3TIDB 2P5WD 4YH6A 2HAZA 5C70A 1MFAH 4QY8B 3I3EA 4YNYA 5DZOA 2KL6A 3V6BR 2Z31D 3U2SA 1FL3B 4S1RH 1EFXA 4PJEB 3C5JA 2E6JA 1T1YB 4PJ8A 3K4AA 5T3XL 2YUXA 2A9NH 3O4LD 3U30C 1Q1JL 4IMLA 4L8SC 2A6IA 5IFAH 2PNDA 4OCYL 4JY5H 1WEJH 4ZXBA 4IDJH 1H3UA 4P2RD 4OI8A 4B41A 2RBLA 2C4XA 3DX6B 2QQKH 4HZAA 2AXJA 4X98B 4WU5B 4YPGB 4RX4A 3WFEL 1OSPL 3IKCB 3OKKA 1KPRA 1A3RL 2HP4A 3TJEH 1NGZB 4JFXA 4NKQB 2XZCL 1RIUL 4RGND 3WIIL 3KPOA 3S88L 2NY7L 1Q0YH 1T03H 1QQDB 2NY5L 1INQB 3BP4A 5HGGS 2NW3B 3LN4B 4GAFB 2R29L 5FYLE 3DYPA 5IQ7L 1L4IA 4U1IA 3VXUE 3WFEH 3BJLA 3BZ4A 3O4LE 2ORBH 4I0PD 5I16A 1I4FB 5EOQH 5KSAA 1K8IB 2YUWA 5L2KB 2ADGB 4K71C 3O8XB 3AUVA 1RZKC 3QO1B 1HHIA 3L5XL 3DMMD 2P8LB 3V5KA 4E0RA 3MLVL 1MFAL 1QFOA 2D7QA 1FLRL 3C08L 4PJHB 3MODH 2YPLD 1T80A 4OZFH 5IHUL 2B1HL 5DJ6B 5FM4A 3PQYB 4OZFA 5DJ2B 3LKOA 4G9FE 1SBBA 3EYFB 4OZIE 1BIHA 3CK0H 3BPOC 4MJIA 1MJJB 3O3EB 1FDLH 2NNAA 5I15L 2ZG1A 3W5MA 3RVVD 1H8NA 2VLJE 3K46A 4NYLA 4OLWH 4Y4HC 5DK0A 5HI5C 1EHLH 3MUGA 5KSAD 1VA9A 3VJ6B 2F53E 1I1FB 3TM6A 3GUTB 4BKLB 1DBMH 4RMRA 4QRRD 4WHTB 2VR5A 3U0TB 5L88L 3FT3B 3G6DH 3U48A 4KRNA 1ZS8B 2KQMA 3QDGA 9CGTA 5FECA 1UENA 3DETC 1HXMB 2I07A 1U8JB 2IGFH 3FO1B 3IS1X 2D2OA 5EPMB 1KIRA 3QH3B 1XFPA 5MERA 4QHLA 1OAXH 1S7SA 5K9QG 4J1UA 4BELD 4OZIF 3TP4A 5KJRL 1M7IB 3TT1H 3ROLA 5GSVA 3GMPB 4NJAL 3MGAA 5I66B 1AKJB 2PTTB 1N64H 1KJMA 4MLSA 4WW1B 3MLYH 1SEQL 1QP1A 3ARFC 5BXFA 1RMFL 3X3FH 4KUCF 3VXUD 4RMWA 4GXVL 3ULUH 3TJHD 1IGYA 3DHMA 5BS0A 3GGWB 3MV9E 3P4NB 4KKLC 3W82A 4EJ1C 4F9LC 1UM5H 5EFIA 4GG6F 2GITB 3N1GC 1A6WL 3PWLB 3TT3H 3PGDB 4YFLF 5GGTH 2G75A 3KPSB 3PWPE 35C8L 3G6JF 3NTCL 3DSFL 3V5DB 4ZTOH 4G80A 3PWVA 1WICA 4I3GA 4KKNA 4YHLL 4ZO8A 1R24A 1UB6B 4JQXA 5I1CH 4F3FA 5GS1B 1QVOA 4NZTL 4DGIH 1MEXH 1N3NB 1AGEB 2X2YA 1XT5A 4MS8D 4MD5A 3TVMA 3DVGB 2BOCA 1I7UA 5LGHH 3H0TB 1JGLL 5F7MC 1TQCB 4Z7VE 1B88A 5F9OL 1V5JA 5BMFH 2MHAA 1QNZL 1RURH 3U7YH 4FQCH 5SWQA 4PJ7F 1DBAH 1FORH 5FKPB 5IVXE 4BSJA 1PYWB 2GJJA 2G9HA 4JY6B 4X80H 1G7PA 5DHVH 3UJJH 5C6WH 4JHWH 1FZJB 2QADC 4D3CH 4OB5H 3I9GH 1Q72L 3WIFB 3VMPA 1EEZB 2J6EA 2W0PA 4E9LA 3HZVA 5HBBA 1NBVH 4MD0A 1KG0B 3CUPA 2EC9U 1F5WA 3UPAA 2VLLA 3RDTA 2X05A 1DVFB 3CX5J 2O5XL 2PW1A 1GHFL 4HW6A 3MV7D 3P0YL 4TTDC 5D4QA 3U0PB 5CUSL 5AUMA 3WJJA 3T3MF 5I1IH 5INDB 2L7UA 3BRDA 1EBAA 1SMAA 4XXDB 2ENSA 5LGJA 4HAFA 1S7QA 32C2B 2DYPA 3GKWH 3MRKB 3MYZA 5ACLA 3LB6D 1JNHB 2UZYB 4RAUB 4RFOL 5J1AB 1F4XL 4JANB 3QWOA 4EVNB 2VISA 4I3SH 4OF0A 2BXZA 2F8VA 5CJXA 5D2NA 5MENE 1MI5A 2DJUA 2MPAL 1HH9A 5GGTL 2WBJC 1YEJH 3MACH 3VXQB 3AS1A 5AYUH 4UUJB 2DLGA 2I26N 3I2CH 5SWZE 2W38A 4HUWA 4Q0XH 3DRTA 4Q9QH 5CBAA 3P4MA 1TXKA 12E8L 1FV1A 5CZXD 1C7TA 2YXMA 3U7AA 4YDJA 1ZLVK 3HI5L 5CSZA 2NZ9D 1FE8H 4I1NB 5LCVL 3QCUH 1FFOB 3CH1A 2MOVA 1AGFA 3X3GH 1MJUL 3OAUH 1PBYA 3Q6FB 1DUYB 4NIKB 4OLYL 5FFLA 2ZJSH 4NCC2 5CJQH 3STLA 4Y19D 3IDJB 3J7HA 1HZHH 3EYUH 4P5TC 2B4CC 3F65A 1O5DT 4L4VB 4EI5A 1TZHA 1YJDC 3NZ8A 4KI5C 1T3FA 1AY1L 5KS9F 4HFWA 1VGEL 3SEPA 3UPRA 1FL5A 1KN2L 1IGFL 4LCYB 3QWOB 2E7LC 1ONQA 1G7HA 1CICB 1EHLL 3B9KB 3ZDYF 3K3QA 5LCVH 1G9NC 3R8QA 3F7YA 4PB9H 4KPHH 1J5OL 2Z31C 2EZ0C 4Y89A 4WHYG 3T0AA 2QV2A 4M1CC 1CLOL 2ZG3A 3EYSL 4M62L 3ZE0E 1L0QA 3F7RA 4Q9QL 3QXDA 1LP9E 2F5AH 4Q0XL 5DURD 4EUPG 4NQCD 3D39B 4G8GD 4Z9KB 5KS9B 4PJAE 3RHWK 5EU6B 5JR1H 4MD0B 2AXFA 2YBRA 3HI1A 4LHJB 4AIZA 4XT1C 3WLWC 5K9KA 4HXBH 1CLZL 3I6KB 1S9YB 3S4SG 4AG4H 1PYWA 1S7RA 4ZQKA 1AIFA 3PL6B 4EBQH 2DIBA 4RFNC 1CBVL 2Q8BH 1Q9OA 4JDTL 5GHWL 1RV6X 5ITBL 3E2HB 2X1OA 1ES0B 3M1BB 2CXKA 2EH8L 4NRXB 5SWSA 2WIMA 4GRWH 4ZPTA 1K8DA 1CFTB 1RULH 2ICWB 3DX9B 4QOKB 4HIJA 5CCKH 4WUUB 3VRLF 3MBEB 5DHXB 1FG2A 4JLRB 4A6YL 2EH7H 1FNEA 1CDCA 4KC3B 3GIVB 4XCCH 4KKBD 5D1ZC 4TOYL 2EIEA 1OSPH 1T1XB 4P2QD 5EBWA 2ZPKH 3H9SB 4D3CL 4JHWL 4X9BA 5FO9B 3GDBA 3RNQB 4CADA 4R97C 4IDJL 4JPWL 3RWFB 2VIRB 1JWSA 4V1DA 4L4TE 2HT2C 5JO5A 1NDGA 5D1XB 5FA3B 3GZKA 2WMPA 1QLFA 2CD0A 3UP1A 3MV8B 5BXFB 4M7JL 3SKMA 5T33L 1EAPB 1E4XI 1GGIL 3GMMA 5D7LD 3S5LG 1RU9L 2P47B 3DURA 5I66A 4JPVH 1ZVSA 3RFZC 1ZEAH 4WI9A 4XPGL 1FVEB 4H0HB 3BPNC 1V3KA 4CRPA 4KI5D 4R6UA 4TNWF 3IAQA 4NN7B 4LCCA 4OZGB 3B3IB 35C8H 3BDBA 3V7AG 4P2QA 3W9DA 1PG7X 2XN9B 3TT3L 1AO7D 1TZGL 1U8NA 1T22B 3KPQB 4XMKH 3FT3A 5DLML 1FYTA 4LKXA 1SEBA 1YMMB 4I18B 3BOVA 1R5VB 4Y88A 3T3PE 1GGCH 3MLTA 3ULUE 4D9LH 3VFSA 4F8TA 2YD2A 3SBWA 1VACB 5A2JH 4NRZB 1A7BA 3HUJE 4W6WB 3BPLB 5C0AD 3P2TA 1SJXA 3CFKA 2Y6SD 2IFFH 3QEUA 1JGDB 1FG9C 4HX1B 4OTXH 2ZSVB 5K9JL 1ZAGA 1A47A 1KN4L 3U0WH 1U8NB 3P9MA 5GSRB 4GG8A 3B5GA 4UU9A 1QFPA 1W2KT 1NUGA 3GMNB 4U6XB 3RNKA 5FM5M 2OMBA 3KPLA 4OCRL 3GM0A 1T0MB 5DC9B 3LRSA 3HPJA 3V5KB 1IZJA 1KCKA 1ULVA 1BVKA 1YYLH 2EDHA 3SGEH 4RMVA 5E6YA 1MFCL 3S4SB 5DJ0A 2YHGA 1IEHA 5D71L 3QO1A 1ZOXA 3O9WA 3LMJH 3GHBH 1CFQB 4G6FB 4LHUB 3WO4C 1IC7L 1CTOA 3GIZH 5J8OA 5L2KA 2A6KA 3GRWL 4MAYD 4JPKH 4GFTB 5FYLL 4Z7NF 4YAQA 1V3JA 5I1LA 3P3YA 2OK0L 2VDML 3BZ4B 3C8DA 2QQQA 3GK8L 4LVHC 2HLAA 4KKCD 3FFCE 1MH5B 3P0VH 4EOWH 4PY7A 3DWTA 2DQIL 4WY7L 4U6HB 1CGXA 5CWSA 5HYJD 3C08H 1XCTB 4U1HA 3UTZA 5BRZB 3WHXB 3RIAK 2W0KA 4ORZC 1FFRA 2YWYA 3AFLA 5C0NC 4BZ2L 4LNRB 1I1AC 3N06B 4XH2B 2B7DT 5DGRA 1U58B 5DJAB 2O61A 3S34L 1IQDA 5T3XE 3VCLA 3QIUA 3R0MA 3MRNA 3BI9X 3D0LA 1MVFA 4KRPC 3W81A 3DX8A 1INEL 5J1TC 4U31A 5FHBL 1INDH 4Y16B 1HOCB 4Y4HB 2P8PB 3C60C 4Z7VA 1FP5A 2W92A 3HG1E 2CR3A 1EFQA 4JRXD 4NZJA 2VDPL 1UXSB 1XH3B 5FCUH 3SDCB 4WIQA 1MRFH 4R96A 2F74A 1S9YA 4X0KB 4FZ8L 4NO2B 5FDYA 3L1OH 4XWOD 1UM4L 4KJQC 3F12B 1GOGA 4HPYH 5KVDL 2IAMA 3A6CL 3MR9B 5CSGA 3DMMA 2IH3A 2RAMA 4QXWA 1Q1JH 5IFAL 4Y4FA 3U0WL 4LLQA 4N9OB 5DMKB 3P0GB 2H26A 4KVCH 4UDUA 4C58B 1ORSA 4CN4A 5CZKA 3FT4B 3DROB 3QPQC 5E8EB 2WWMC 1G7HB 1ONQB 1GGCL 2PF6A 4PLKD 1DBBH 3LS5L 3SQOH 3NZ8B 5D2NE 5C0RH 4WWKC 1K4CA 4EI5B 4NKIL 3IAGC 3B8YA 1JI2A 1I9RH 1KLGB 4JCLA 3MACL 3MRCB 3SHSA 3ZDZE 5ETUA 5GJSL 1IKNA 4RFNB 4CU8A 3PHOB 1D3CA 5FA4B 3CZFB 1OGTB 4P2RA 5DEGA 5D7IB 1R3IH 3QIWA 4P23D 4JFOA 5A43C 3OR6A 1H3VA 4PJHF 3KWWB 1NCWH 1CE6A 3H7BA 3AM8A 3MGTA 5FOBB 2BRRL 3LY6A 3G5VA 4HUUA 1KBGH 4HKZB 2EE6A 1G7QA 4DQOH 5DJDA 3W11C 1P84J 5J9PA 1DANT 4AQ1B 3RI5K 4LSRL 4ZFGH 4P3DA 5IW1B 5D6DC 1LDPL 3HE6D 3O6KH 4EXKA 1HYSC 4RISH 4ERSL 2ZNWA 5CJ8A 2DQUL 4GRLA 2Y36H 3SKOA 1JV5B 3STBA 5F88B 5GGQH 4RGNC 1MCOH 2VUOA 4K2UH 3AB0B 2H3NA 4GBXB 1MY5A 3O45A 2GJZA 3QWRD 1DFBL 5EZLA 3DTXA 4Y4KB 1YNKL 2DM4A 2DLTA 3QO0B 1XGTB 2AKRA 4Q9CA 2BVEA 1X5LA 4L1DA 2OP4L 5KZCB 2AXHA 3BUYB 3AS3A 1ZLWH 3OKEB 1JYNA 3WHE1 1DBKH 4Q58C 1CGVA 4NT6A 1Q94B 4Z0BH 4NM8H 5AAMA 2PW1B 3SDDB 3DBXA 5D6CB 1BJMA 1Q9LA 2AABL 5FGBA 5T1KB 5SV4A 3ZL4L 3I6GB 4Z7NE 4DN4H 3NAAL 1GC1L 4XNQA 1A6TA 4TVPE 1NQBA 4UIKL 5EO9A 2WAHA 2ZCLL 43CAB 1V05A 4WWKA 4P2YA 4OD1H 2LV4A 1PG7H 1CFVH 1FHGA 1FZJA 1G7PB 1A6ZB 1RIVH 1MHHB 2PCPB 4WDIA 4P57A 3CDGB 4ZNEE 5AZ2L 1EBPA 4ZOEA 2VDNH 4S11A 4PREA 3L5IA 1IARB 3C5ZD 3ELAT 3HC0B 3U4EB 1QLRA 1RJYB 3MCLH 3MFFA 5D1ZB 2EIBA 1HINL 2Y7QA 3WEXB 1BBDH 1KJVB 3H7LA 1ZGLM 2IANE 1LQSR 5D2LE 1T0PB 3EKCA 4NDMB 3QO0A 1J5OH 3S35H 5E5RB 1A21A 4X5WA 4P5TA 1VGKA 3QCTH 5T3ZE 1PX4A 1JZ4A 5IW6B 5DFWH 3ZTNH 5GS0L 3B9KC 2BXYA 3ARGA 5I8EA 3GM8A 1T1WA 4DAGH 2IGFL 4CMMB 3Q5YA 3PGDA 1RUKL 1CN4A 3U4BH 4LSDA 5KVFL 1DP0A 1R0AH 2B0SL 1DBJL 3ILQD 1JNLL 1R3IL 4P46B 4S2SA 2MKWA 3WUWG 2JB5L 3UDWC 3MXVL 1MHCA 2NXYC 3ZSSA 4GKNA 2A2QT 5KSBA 4G9DB 5DEGB 1M7IA 3HI5H 1G0YR 4WGWB 5DWUL 4OCMC 3O9WC 5F97E 1A4KA 1QBAA 4HBQA 2NX5A 4TVSa 5EDXA 3WFBL 2LFGA 25C8H 1QSEA 5JNYA 2X4TB 4OZ4B 2HJKB 4JJHA 3AMKA 1AE6H 1U95B 2CLZB 3OB8A 1T21B 1MHHA 4P2CG 1MQ8A 3GBNH 2R69L 2WUBL 2ADJB 2EE2A 4JFZL 5DA4A 4BSVA 1ORSB 43CAA 1ORQB 4M5ZH 3VMNA 3VJ6A 4KQ3H 1OAZH 3DGGA 3MLZH 1WC7B 3LDBB 5DMKA 1PZ5B 1LP9B 3I6GA 4QRQA 2WQRA 3VH8A 2AAVA 3DBXB 3SDDA 3SDCC 1YNLH 1TVHB 4PJBF 1BJ8A 1OM3H 4FQ2L 3BO8A 2X4UB 2Q6WA 5A16A 2MKLC 4U1SA 2B4CH 2QHLA 5FCUL 3OKEA 1O0VA 4XGZA 1U2HA 2K7PA 4WRLA 4HT1H 4YHYB 1W0VB 5I71C 1ADQH 3OJ2C 3UAJD 2XZCH 3DV4A 4D0CB 4KHTH 4KTYA 2IPTL 5FHBH 1OB1B 1F6FB 4X80L 3UJJL 4PD4J 3MQIA 3T2NL 4WV1B 5C0DB 4IMKA 4JY5L 4DJMA 4L29A 1I8MA 5B8CA 3MRRB 4HC1A 1R3KB 4OT1H 5DVLA 1K8IA 4P4KA 3OJDA 1JWUB 1BP3B 2P44B 4NQDA 3IGAB 4QHKJ 2F8OA 2I60H 4LSTH 1I3VA 3ZE0F 3EDFA 3GRWA 3IDMA 3R4DA 5GS0C 4D9QD 5I1GH 1CFSA 2VE6A 1N0XH 1Y6NR 4DOHB 4TYUA 3PV6A 3QUMB 2W9DH 4ZFOA 4DTGH 3BEVB 2EDQA 2LABA 2Q76A 3WHXA 3KYKL 3ARXA 4JHAH 1NGWA 2G60H 2EDXA 4KJYA 4U1KA 2YEZA 4XNXL 5HHQA 3C5SA 5HYJE 3GK8H 3PIQB 5J11C 3CZFA 5FYLH 2F8XC 2Z93B 3PHOA 4MSWA 5IIEA 1S7WA 5HD8D 3SY0B 1A3QA 4OBSA 1KLGA 3F58H 4EN3A 1IC5H 1T1YA 4PJ8B 1NLBH 5DUMH 5FKAA 4X6FB 4K7FB 2R9HD 2FGZA 3MNVA 4M02A 2XKUA 3PGFL 1YJDH 2XWTA 3VWKA 2IPUK 3ULUL 3TFKD 2V9QA 4DFHA 4QRSA 4QF1A 3GSQB 5IF0A 1Z9MA 4X9IA 3LEYL 1BVKB 4P9HL 5IB1B 1I7ZB 4ZPVA 4GQ9L 3GMQA 1E27B 4FFWC 1U8HB 3M17A 5JPNB 2CSPA 1DUZA 1FRGL 1U6AL 5IEHA 1FBIL 4X6CA 4PV8A 4G8EA 3WN5C 1U9KA 5HHME 1JJUA 3I50H 2YA1A 5IMMB 3HCVA 2FBJL 3GJFA 3D3VE 2FDBP 2LQRA 4UT7L 4HX1A 4YHIB 2VZVA 1Q9KA 3LEYH 1HHKB 4D9LL 3D9AH 1E6OH 4QXUL 1NFDB 1YJDL 3SCMD 4EQ3A 4RFEA 2V5SA 5GGRA 3HAEG 1JZ5A 2JJTC 1MJ7L 4L8SB 3MZTA 4WW2C 4LCCC 5C3TA 3D2UA 2P8PA 5C6TL 1WZKA 2PYEB 3O2WH 1FDLL 4PLNC 3HMXA 1HHHB 3DRQB 3BQUB 2BJMH 3HE7C 4OIAA 4UB0H 1FVCA 5HJ3B 3W0WE 1EJOH 3HC4L 5ALBH 1N5AB 4Z7QF 3T04D 4QTIH 2G60L 1UCBL 5FDWA 2ZCHL 5LXGH 4PY8J 4BK5A 2B1HH 3QNXA 5IBUG 4PRPB 2DD8H 4M7JH 5T33H 4JO1L 3P73B 4XX1G 3SBWC 3HR5A 3MV11 3QNYB 1ZVSB 5JHDA 3QFJB 3HG1D 5J4MA 4LSTL 3FB7B 2V9RA 3A6BH 3MXWH 3BKML 4CDGC 3KS0H 5GRVK 3MCKA 4G7VL 4Y8DC 2ZUWA 5IVXF 3ZKXB 5C7XL 4DOHE 1IT9H 3B2VL 1P53A 4MVBD 4ZNEA 1NDGB 5JO5B 5I1DB 3CVHH 1QBLL 3NPSC 4OIIL 4YAQB 3QIBB 4URTB 4K8RL 4PJ9A 4U7MA 5ICYB 3VXNA 4HHAB 3QFJA 3T0EC 1T5WB 3MYJA 2X70A 5F3HB 3KLHC 3WLBA 1BF8A 3D85B 3E8UH 4R4NC 4C4KO 3U9PH 1KELH 3Q3GB 2CR6A 2HRPH 5IJVB 5CP7A 3ULVC 1R6VA 3KPLB 3MJ7B 5GGSB 4U6XA 1WFUA 3DRQA 2E6PA 1WEJL 3BIKA 3LPWA 3IVKB 4GG8B 4J3OC 5IKCA 4NKMB 3KNBA 3NFPB 5E4IA 1BD2D 3LKRA 1NCNA 5DQ9B 2R2BA 5E2TH 3NCYP 4LPCA 4H8WL 1U3HC 1AIFB 2WBWB 5HYEA 4X4XA 1HSBB 4K8RC 1OP5K 5IHBA 4ZFFA 2BSED 3KJ4B 4Z5RB 5CJOL 25C8L 4Z7UB 1R5VA 2PTUA 2YD3A 3O11B 4XHQA 2ZUQB 4M62H 3ARBD 4KU1A 5C1MB 3GI9L 3SCMC 2I5YH 5JXEC 5IMMA 4XB8A 3TO4B 2HFEB 4M43H 4HMCA 1WQVT 2C1OA 4H20L 1Z9LA 5BZDB 2QQNL 1UM6L 1RZKL 3B3IA 2EYRB 2JB5H 3C6LA 5F1IB 3F7YB 3F7VB 5IR1B 5M95B 3SPVA 2LU7A 1YECH 2ILLA 4LCYA 3EYUL 4QT5B 4FQJL 4F7EB 1MFBH 3UPRB 4TNWK 5F21B 1L0YA 4HFWB 3SKMB 1HHJA 4D0DB 3HHRB 4MDJA 4IEFB 3EGSA 5B38B 4MSWB 2R23B 4V1DB 2D0HA 2Y1VA 1FZOB 2HFFA 4LPTA 3LRHA 4W68A 3H3BC 2FZ3A 5HHQB 1F02I 1OAQH 4C4KT 2OL3B 5FO9A 5DD1L 2VAJA 1BBDL 1QHPA 3HE7B 3U1SH 5C0FB 5DHYA 4HK3J 2BDNH 5ILTL 4ODTH 3FZUC 2Z91A 15C8L 2NY3D 2ZUUA 3V52L 2AVGA 4AEHL 4OM0L 3IGAA 1ZLSH 4LKCB 1G9EA 4MYWB 1U3HA 4X4YA 1OW0C 1S3KL 4LIQE 5ENWA 3RUGF 2VITB 2NW2B 5DSCA 2AJ3A 4X7FC 3MJGX 4PJFE 5E2JA 2C3VB 2XZZA 5C3LD 2BMKB 3ESVF 5DRNA 3ARRA 2AJYL 1DVFC 2XZAH 5DEFA 4MJ5A 2GTWB 3OKNA 4JANA 2EDTA 5T3ZD 1OTSC 1LEGB 4X6EB 5D1QC 5I30H 1KV3A 1IM3B 3P0YH 3FRUB 4YHML 5I75C 2QHRL 5DUPH 4ELKA 4BFIB 4HUXA 5T5NG 1BFVL 1CU4L 2PO6B 1FFPB 1A0QH 1EO5A 5C0BB 1TVHA 4POZD 1BEYH 4YHZH 4MJ6A 1KEGL 4OUOA 3EJZD 4ZS6D 4XTRC 1P9MA 5EORL 3MOBH 3DGGB 4S1SH 3FQRB 3OXSA 2EXWC 3TYGL 1LD9B 4JZJA 2DJ4A 2VDQH 4XCYB 4OZGF 2Z4QA 3MOQA 4LHQB 5HYSA 1S9VB 4RGOL 3SJVB 1KT2B 1U95A 5ISZE 2DI8A 3JWDH 5C0CB 1T4KA 4K7PH 4KAQL 3C8KA 3QUKB 3VRIA 3VXUA 3PUCA 5HHOD 2AV7A 1G1YA 3IDNA 2J12B 1U8MA 4N0FB 2DQEL 2A77L 4H88H 4DW2L 4EQ2A 3DVGA 4LCUA 1WCBA 3WNNA 4I48B 1UQSA 5IM7B 2ESVD 2JELH 3Q6FA 2YK1L 4G43B 4G9DA 5K59F 4KZDH 4ZTOL 4NQCA 4F33B 1P4BL 4IHOA 1X5XA 5D5ME 3W0WD 3GSNL 3U46A 2HJLB 5C71A 3R0NA 1AC0A 4X7SH 3V5DA 1DQLH 4PRAB 2ITDB 3IYLW 3WFDL 2R2HA 43C9B 4L8CA 1ETZB 2VABA 5JOEA 1DBBL 3CCHB 3FMGH 3B5HA 1K2DA 4OZIA 5SWZA 3FQXB 4OV6F 2FGWL 3WFZA 5FXCH 1HWGB 5EFIB 5IW6A 4ZFZA 4O5LL 5BS0B 1YQVL 2DI7A 1ITBB 3R1GH 4XNUH 2NY3C 5AD0B 3MOAH 3TEUA 4BZ1L 1I8LC 1XGUA 1MI5B 1RD6A 5EU4B 5H37G 1AXSB 3FONB 2COQA 5CFHA 3S35X 3GMPA 1PY4A 3GSNB 4OF3A 5LBSL 4RAHA 1NL0L 3BKYH 2DWDA 4MNGA 1J87A 1QBBA 3MRKA 1FNSH 4F7CB 5KSVB 1FLTX 5MERB 3EZJB 1L6XA 3VFMA 4O2EB 1W8OA 2ICEB 3HMXH 4HV8A 4I8DA 1MWAA 4M93B 3LRGA 4FP8L 1RI8A 4APQC 1J11A 4U6YA 4WDIB 2Z35A 4KK9D 4LSPL 1X5JA 2DJSA 4Y1AB 4E41E 3WE6A 2YPKA 2ZOKB 3FQTB 4NGHL 1U8IB 3ULSA 1AGBB 3CUPB 4JM2D 5EU6E 1N7MH 2ICES 4WO4B 1QO3A 2NZIA 4ONGH 4YEFA 2YZ1A 4IRJA 1FCCA 1WWAX 3BH8A 4XBGB 2HT3C 2CDFA 2G9HB 1SVZA 2V2WA 3IJHB 4JY6A 5CEZH 3PG2A 1J12A 1Z0NA 2FCBA 3RI5F 2BSTB 1TTFA 4L4TA 4HS3A 2DI9A 1VEOA 5GRUH 1X4YA 1J86A 1CL7H 3ARUA 1F3JA 2JJVA 5HTSA 3BMWA 4EDWH 5F9WC 3D0VB 3ARGC 1XF3B 3WIHA 5HSFA 4PJHA 3L5XH 4HWUA 4QOKE 5FAAA 4YDVB 5L9DL 1MCDA 3BN3B 1F8TH 3WIHH 4QHNA 4LLMB 1A5FH 1F58H 3HA0A 1LE9A 1U42A 3VI3E 3HRZA 2K7QA 4OD3L 4G5ZH 5JHDE 2ADGA 4L4TB 3HR6A 3B9DA 2NXZB 2X42A 5EOTA 4LDEB 4N0CD 4U1JB 4UINH 3OGOE 1OWRM 1NFIA 4OCLC 1CDYA 4LRIA 3BKCH 2RCSH 4NBXB 4KUZL 2EDWA 3WIIH 5F7UA 2GITA 1QR1A 2HWZH 1I1YA 4KROB 1B0GA 3O2DL 1QQDA 4BM7A 3H7BB 3MGTB 5DXWA 3FCTB 1DDHB 4PJ5D 2BRQA 3P77B 4I3RL 2EE3A 4EN3D 1KPRB 2W9EH 2VZSA 3QFDB 3A67L 4YPGA 4WEUD 2VERN 4Y5YB 5E8NA 5KG9B 4DKFH 3OKDA 1LGVA 4IMLB 4KJWC 2VXUL 1DEDA 3T0DA 1VPOL 2ED9A 1DQJA 1KIRB 4B0MM 1QSVA 4PJDF 3K2UH 3FFCD 3MRJB 5T5FL 5D2NC 3WFCL 1L7TL 5TH2A 1XF4B 5IFJA 2BC4A 1Z6JT 5KVGH 1UZ8B 4B50A 5JXEA 1KTRL 1MF2L 4YDIH 2WBJA 3KDMA 4JRWA 1K2DB 3DVIA 4UDUB 5EC1B 2NY4B 3Q48A 5DVOA 4DCQB 1QSZA 3DO7A 5HHMB 1UZ6F 1BJ1J 4PGCA 2XNAA 3WDJA 1MCCA 5IK3A 3CSYA 1P2CA 3FFCA 5C9KA 1HH6A 3B4NA 3QUXD 1G6RB 1JL8A 3RIFF 5CD5D 3RTQC 4JPVL 1VFAA 5KANG 5FF6A 4WI8A 5IM7A 2L4OA 4I3RH 2OZ4A 2C7UA 3F5WB 1PSKH 1W0WA 4JDVA 5HDQH 4YDKH 3X13B 4OGXL 4HEME 5I2IB 4NUJA 4ZUSB 2FHFA 4ONHB 3RY4A 2GAZA 2E6QA 2XWJA 2LE9A 3D87B 4U3HA 3MBEC 4JPWH 3QBTB 4U05A 4AH2B 5INCA 4PRIB 1DQDH 3MRNB 4J6RH 1OTTC 3EFDL 4G5ZL 5E9DB 3DI2B 3WS6A 1RIHH 5IT2H 3GSOA 3L7FB 4OI9A 1CT8B 1INQA 3U7WH 4OFKA 3UTTD 2HH0L 1MLBA 4KXZH 1PEZA 1QSED 5HGBB 3O3UN 5ID0B 3PNWB 1SJEA 3I02B 4U1HB 5GGVY 3QJHB 4JO3H 5CWSB 5C0BA 2R2EB 2RGSA 4XNZC 4Z77A 3I6LE 3O4OB 5F7HA 5EBMA 3WSQH 3PWJB 4OLEA 1BHGA 1ZKAA 3FN9A 4ELKB 1TETH 2R15A 3CFEA 3OB0K 2Q8BL 3VRLE 3Q5TA 4C83A 2J1KA 5J56B 1LEGA 4X6EA 3TBVA 3HNVL 1MCIA 5J6GB 3IXTB 4YXKL 3L3HB 5DJCB 4YE4L 1IKFH 2VKWA 2R0KL 4N0RA 2JTDA 3ZE1E 2FIKA 2P1YA 3QUZD 2BNUB 4R90L 3C2AH 4CU7A 3MUZ1 5ANME 5DSCB 2D0FA 2NY6D 2HKFL 1P7KA 4ODWB 1T0MA 5H35B 5KVEL 3PJSA 4QRPB 5HDOA 3UO1H 3TA3C 3N9GL 3QUYD 3RNKB 1EEYA 4WCYL 3LQZA 3MJ9L 2R0LH 2JJTA 1QFHA 4S1QH 1NCBH 1NFDE 1LK2A 2DTML 4WJ5A 1N2RA 1NKOA 3GMOB 1E6JL 4GAJH 3MO1A 3CFIC 1NFKA 3LPGA 5IG7A 3BESR 1H3WM 1VEPA 4TUJA 2HKHL 1YEGL 2VXSH 4PRBA 3RWHB 1NKRA 4PRHB 2E7CA 5MEND 2KUTA 2P5WE 4OKDA 3EYOB 2WBKA 5KSUB 4PJ7B 2BVQB 4H1LH 1RZJC 1HXYB 3LSOA 5CSBA 1S7UB 4D0BB 1R5IA 4I18A 1U92B 4ZO6A 1P1ZB 3KGRA 1EUUA 2Q7NA 5ADPL 2D9CA 2UWEE 4LRNH 4QT5A 3QEQB 1YN7B 4OM1H 2J8HA 1U8PB 4E5XB 2HTKD 2N1KA 3VXTA 1A1OB 3F7VA 3QCUL 5F1IA 2K9UA 2CIKA 4FZEL 1PZUB 4E5XA 4K7PY 1EXUA 2D7NA 2OQJB 4HIXH 5BZDA 1JWMA 2YK1H 5HHVH 4NNXA 4Z7WB 5DR5L 3ZE1F 1OTTD 1ED3A 2IQAB 4MHHI 4JE4B 4DW2H 4UTAL 3AGVA 4OF6A 3RWDB 3ZKNC 5F93C 3BP7A 2W07A 1BBJB 4HKBB 1WBXB 1JWSB 1JHLH 4PRNA 5JOFA 3JV0A 2UWEF 3EJYC 1F4WL 1KCVH 3MLWL 3O3BA 1X4XA 1MCBA 2PXYD 5KN5B 1QRKA 4YHOH 4GOSA 3TF7C 4RSVA 5EBWB 4XZUB 3MV01 1YEKL 2Z8SA 1A7QL 3E3QC 4G3YL 3QULA 3TZVA 3NPZB 1RZJH 2IH1B 4KDVA 1JGVH 1HNFA 4S10A 5CUSH 1EEYB 2FYYA 1KCRL 3MJ7A 1MPAL 3B6SB 3VXRB 2O5XH 4OQTA 3QUZC 1JNJA 1K85A 3IFNH 4GRWB 3ARGD 4LPYA 4PG2A 1NBVL 1UH3A 1JN6B 3VFUA 1MLCA 5JMOC 3L6FA 5ICYA 4ZQKB 1KIPB 3QRFM 4OB5L 2JIXA 3UZVB 5ESQB 4ZUWB 3GMRB 2X40A 2XYCA 1U93B 3BWAA 5E4EB 3ZKSD 4XP9L 3CC5B 1CXEA 4GJTB 3NABH 5JW3H 2E27H 3VWJA 1RUAH 2NY4C 3PWJA 4UQ3B 4AQOA 4YFLI 1BLNA 3BE1L 1CVRA 4N1EA 4N1HB 2GHWB 2AEQH 3KJ4C 3C5ZA 2GFBA 3IS0X 3NCJH 4XVUC 5EU3A 3WUWB 4X83A 5IVXB 3CIQA 4MB3A 4Z7WA 2JJUA 1GIGL 1JWMB 4M9OA 3UDWA 4DGIL 3NCYS 1RJZB 2BNRE 5I1AA 2XQYG 5DR5H 3QNXB 4Y4KC 4MXVF 4HWNA 3ULUC 5INCB 3TZVD 3ARFB 4QXTB 4KZEH 2D3VA 2JIXD 1WISA 2FX7L 2IWGA 3GI8L 2YPVL 5F71A 3K4ZA 1UM5L 1EEQA 1U92A 1CI5A 2AJSH 3RUGE 1U8QA 2XZQL 3MRBA 4GRMB 4HMEA 5EO1B 1RMFH 2DLFL 2BNRA 2L7JA 5I8KH 3VGEA 1VFAB 3OAZH 2W9LA 3M45A 3TT1L 3MUHL 4OIBA 3VWJC 1WJ3A 1AP2B 2EDRA 2XNAB 5D5MB 4ZAKC 4J7RA 1WWCA 2B1AH 3VFPA 5TPWH 2D31A 4NRYB 4O9HH 4PV8B 1OAKH 2PXYC 2YOCA 3JTTB 5CBAB 2NCMA 5EC1A 3UZQA 2AI0H 4NKDB 3KDMB 3JVGC 1GGUA 4YX2L 1A4JB 4NWUH 5IB1A 3EIFA 5F7YC 3MBXH 1DTUA 3RKDC 5CD5C 2V17L 3K80A 1KB5A 5BV7B 1RQ5A 1ZK9A 3VWKB 5A2IH 1I3GH 2YN3A 4MA1C 1E4WL 4KMLB 5JUEH 5L7XH 1D5ZA 1PQZB 4X6FA 2VN7A 3RGVD 2EEDA 5HHNA 1CXLA 1MAKA 1QFUH 5BJTA 3S6CA 2C4FT 1CG9B 1EZVX 2XTJE 1WZLA 32C2A 5IESL 1BFTA 1JRHL 2FSEB 3WFHA 1D5XB 5HPMA 3TNMA 1H5BB 2IANB 2HTLC 3KPRE 1JMZA 5HHPB 1XCQA 4E41B 4OGYH 5JHDD 3FJTA 1FLRH 5E24E 1OPGL 3REVA 3TO2B 2IBZX 5GZOC 5BV7L 2NMSA 4O58H 2HFGH 1LP9F 3X12B 2FD6L 3RDTB 5ISZB 3OPZH 5GRXG 2P7TB 4IRJD 1KJ2H 4JFDA 3V6FB 4XPAL 1RZIB 4XVUD 5J3HD 3LH2L 1OP3H 1I7RB 2F58L 4MLIA 3B9VA 4QRRE 4POZC 5EOQL 3QUZA 3ULVH 5FKPA 3ZDXE 4XTRD 3PXJA 4WV1A 5C0DA 5C07A 5IB3A 1WITA 2XACC 3QQ9D 5I1HL 3SE4A 1F3RB 3CSPA 3T1WA 4YLQT 3IU4H 4FQLL 1YEEL 1XIWD 4MX7B 4HF5L 4IS6A 4YDVA 2YD4A 2AP2A 4X99A 5F9DC 2IALA 1N3NA 4C57C 3U30B 4M8VA 3UTSB 5DQJB 4F80A 4NHUA 3T4AB 4PG9B 4GXUN 2OR9H 3BO8B 3UYOD 4L3EB 2BSTA 3L95B 2X4SA 2CDFB 5CMAB 1G7MB 1UVQB 4QRQB 1ZLUH 4F9PA 1OOAA 3C8HA 3CFJB 2KPNA 4XWGH 3MLUH 3CFBB 1ORQA 4M1GL 2F54E 1MUJA 3RWIA 2HA1A 4N0UE 3SE8H 3KJ6L 5DMYA 2AK4B 2X41A 3PGCA 4PFEA 2P5EA 2DMCA 5D5MF 3EO9H 1FNHA 4U6YB 1U91A 4PB0L 2X4TA 1AFVL 2H9GB 2ICEA 3FO9B 3WUZA 2Z92A 3WNKA 4R3SA 2Q3ZA 1T1ZA 5JW4Q 4H5SB 5E2VH 4H25B 2OJEB 5IP4A 3SO3B 3RGVC 4JFFD 1KNOB 1FRGH 4N90D 3FFDA 4DKFL 5HDLA 1RZGB 5CD3B 4TSAH 4N0UB 5L2KD 2APXA 5AD0A 5EZJB 3GEWB 1EAJA 3QNZB 2P5EE 4NBZB 3MGOA 4DKEH 4I5BA 4R8WH 3OSKA 4L8BA 2H2PC 1JHKL 4KY1L 5LWYL 4MA7L 8FABB 1YZZA 3QDMA 1F2QA 4APQD 1JGUH 4DN3H 4F58H 4JKKA 3LZFH 5E2VL 1D6VH 5AG8A 1JE6A 4OJFL 3EYFA 1HEZB 4NHUB 4GKZA 4R4BA 2OTPA 3L3DB 1HKLH 1V8HA 4GO6B 5IJKA 1FVDB 4NQSB 4QXGL 3QFJE 1X7QA 5TQ2H 3HUJB 4BH8B 5C08D 3WS3A 4QTHA 2BFVH 5D1QA 2P8LA 2AEPH 1N0XL 1R5WA 2V9TA 2R0WH 2AEQL 4XPBL 5AYQA 1NCCH 4F15C 2X5PA 1RUAL 3MRHA 1TCMA 1S9VA 5E56A 1A2YB 2OSLB 2R39A 1KTLA 2ICCA 4KJPC 4L5FL 3TPKA 4WWKB 3VFVA 3H9SE 5CEZL 4QLRA 3LN4A 3OXSB 5T1LB 4EZMA 5A1AA 4Z18A 3S36L 3GMLB 3D25B 3WE6B 5C2BH 1VFUA 1FO0H 2XA8L 1TJHL 1XZ0B 4PGDA 1RHFA 1X5AA 2OR8A 5FUZL 4NT6B 2BSSA 4MA8H 4L9LC 1J1PL 5E6IC 5FB8A 2CLRA 5HPMB 1T2QL 5KSVA 2VDOL 1JGVL 4TN9A 2PTVA 1MIML 4FQ2H 4YXLH 2IMNA 3KPNA 5GS2D 5BJTB 3C5JB 3OKNB 5TDPB 1AXSA 3FONA 4YNYB 3NOIA 3QDJB 5CIPH 3TNNB 3BKYL 4WTZG 4GUPA 4Y0GA 3SKJH 5CIPA 2JLLA 4JN1L 4U33A 4KI5F 1MHEA 3PP3K 3RJDA 1GZQB 4U1GC 1AR2A 3GBNL 3OB0H 4P2OC 2GCYA 2NY2B 2YD6A 1C5DB 3IETB 3OJMB 4HD9A 4K94L 2LU4A 2VSCA 4PP2A 4YK4C 1ETZA 4KTEL 3D3VD 4KRLB 1JMXA 3DUSB 4HH9A 3G5VB 4HUUB 1F45A 1AD9B 2APBA 4HIXL 6FABH 3FQUA 4P4RA 4W70A 3S97C 1BZ9A 1N26A 1JPGA 3GSNH 5B22A 1WLHA 4PUBL 5D7IA 2HFFB 1FZOA 2X4PA 3VDCA 3B2UD 1ZVHA 3RBGA 1YUHA 1SHMA 4HJGB 4XP6H 4DGVH 5JW5A 2Y72A 1JNLH 3CDFA 4NN5C 4LVHB 1TQBC 1ZT7B 2NXYB 4G42B 4R2GC 1R3HA 5E9DE 2MTPA 1MCQA 3IFLL 4JRYB 3VRIB 3PWUB 1BVLA 1RUKH 1IM9D 1QOKA 5I1JH 1X5ZA 2OCFD 1UYWH 3QEQE 3BD5A 3ARFA 5DDHA 2FB4L 5BVJB 4FG6C 5SWZD 2QSVA 2PYEE 1D7FA 4XBEH 4JN2B 4TNVK 4Q6IC 4PJCA 4ZAKB 2X4PB 4KK8D 4LHUG 4M00A 4OCXL 5EUOA 3LCYA 5SV3A 2NR6C 2XRAL 1K3ZA 1UADC 3TYGH 3S9DB 3O0RH 2DTMH 3E0GA 2VLKE 1BQHG 5BCAA 3QRGH 2P46B 3MJ9H 3MRFB 4WCYH 2IH3B 3MOBL 4UQ3A 1T2QH 1PAMA 1ZVYA 3GI8H 3FN0L 2VZ1A 3G6JA 3FRUA 3O6FA 1IM3A 3MCG1 5J7CC 3AXLB 4XNMA 4NO2A 1U93A 4YUEL 1CFVL 1UXSA 5SX5K 2IADA 2H6PA 4TUOB 4N5UA 5IB4B 4Q9BA 4IRJC 3MLSL 2DQFA 1KJ2A 5DQ9A 1J9CT 3WN5B 2XTJD 2AJ3B 3HNTH 1YQ2A 4ONFL 3ZL4H 1UWEH 2VITA 1NMCB 5L0QC 5DK3A 3WXVL 1KB5H 5IEKB 4RBPK 1B0RA 1FIGH 1DBKL 2IH1A 2YC1A 5FYJL 4XCEB 4Y19B 4MMZC 3MYJB 4AEFA 1D5IL 2GJ6B 4RIRA 5D72H 3U9UB 4LEOB 2AEPL 2NLJB 3V52H 3HS0A 3NN8B 1NGQL 3V8CA 1TJIL 3O3BB 4KQ4H 1TZIB 4J6RL 5EWIL 3BT2H 1WBXA 4UNVA 3BP7B 4LIQH 1T83A 2NY0B 4JFDE 3EGSB 4PYHA 1D9KC 1D6VL 2XKNB 1CK0L 3O3DB 1Y18A 4MQ7B 4EXPX 5JW4M 5I1LB 1CFNB 4F57H 3VDBA 2YD7A 3RZCA 3H3KA 4NUGH 1WZ1L 1PLGL 1PSKL 5C07E 4J4PD 1RZJL 2DB8A 3HR5B 3QNYA 5T1MA 4R2GD 3D39D 1MFBL 5HHOE 1NC2B 3HPJB 5MENB 3C6LB 1K5NA 2ICWI 1IZKA 1N5AA 2H32B 1YN7A 4P2RE 4PJ5E 1NFDF 1XEDA 3GSVB 1ZHLA 3UJTL 4R4BB 5LJYH 5GJSH 4X5XB 3PL6D 4RGMC 3JWOL 3QEUB 2IAMD 5I1JL 2DM3A 4L8SA 5C0RL 1K3IA 3DETD 4KKAD 3VFWB 4NSKA 2DL9A 3GI9H 1VACA 2EYTB 2W60B 5HHVL 1UA6H 4ZFFB 3DXAE 3HKFA 4WI3A 1AQDA 4WUUD 4S1DD 4NFBA 2DM7A 4FZEH 3DVNA 1SEBB 4BUGA 1KPVA 5FYKL 4FMFA 2RFXB 1C1EL 2BNQB 1FYTB 4PJ5A 3NPSB 3WDIA 4TSBL 3BPOB 3H9SD 4Z8FH 2WINB 2IG2H 5JPNA 2I27N 5E5UB 5AZEH 1WWBX 1OGAD 3VH8G 3CNKA 3TBYA 4YXHH 1GCFA 3ZDZF 1SQ2N 3MNZA 5MHSE 1CYGA 4YHKH 1OARH 2JJSC 3JV6A 3KPMB 2FR4B 1Q38A 3A6CH 4QCIB 4K7FA 4HHAA 4TSCH 1EAPA 2HWZL 2APWA 2YPLE 3AU1B 4LVEA 4RX4D 1XGPA 3U9PL 3TH3T 5BOPA 4PBXA 2X1XR 4D8PA 1FYTE 4Y1AE 5D7LB 4HK0A 4G9FD 5IV2B 5BZWB 5HGHA 3FTGA 4LU5H 1HHGB 5BS0E 3VD9A 1DANU 1I7TB 3NFSL 4LCWD 5EBMB 5CP3A 4KHXH 1JIBA 4Q97A 1BQLL 4UBDC 4KJPD 3P9LA 5JORA 3C5SB 2FJFA 1B4RA 4K23L 1SY6A 3L95A 1BD2A 1S8DA 4GSDL 4EIGB 1BFOB 3WD5L 3QUMA 4ZFOB 3KS0J 1TTUA 2YKLL 1CFSB 2VE6B 3P40A 1NPUA 4R90H 4NO3A 4PIRF 5ABDE 3A6BL 1BM3L 2X1WL 5C2BL 4O58L 5FDWB 4YE4H 3T8XA 2QLVB 4HG4K 1A6PA 1TCRA 4TPRL 3ZTJG 4JO1H 5SWSB 3L3KB 3VXMB 3QUML 4WY7H 1I8MB 4TVPH 1OW0A 2Y5EA 2KBGA 1T7YA 2XWJB 4HUVA 3D69B 2CJUH 2FL5B 4P49A 4QTIL 5LQBH 5IB3B 2FEEL 3DECA 3MRMB 1HKFA 3IXAB 2M2DA 2XXCB 2VZ3A 2R4SL 1ZA6A 2BNRD 5JZ7D 4ZFOL 4H26A 5HD8C 3F5WA 3DV4B 1MELA 4KH2A 1IJ9A 4FTVE 2YKLH 3A0OA 4IOFD 4G8IA 4UOW0 4RFEB 3TZVC 2CUIA 3WKNA 2IPKB 5DMGC 1I3GL 3PDOB 5JOPD 2P7TA 1MJ7H 4K23H 3G9AB 3F7PC 5B3JF 1DN2A 1IQWH 4WI6A 3LKNB 5DRXA 3WDHA 3X14A 4LVNB 1RJLB 2C3XA 3MRDB 3TO2A 1ITCA 4NC1C 1KPUA 2F54D 4PGCB 5CHNB 5JORB 1HSAA 3K7UA 5KSBE 1FNSL 3BISA 4FFWD 5IEHB 4XVJH 4W81A 1P5UA 2B1AL 1JP5A 2ATPB 2I9LB 1TVBA 2GY7B 3I50L 3V5HA 4F58L 3MROA 5DRZA 4BSVB 1UZ8A 5BZWA 5D7LA 4KY1H 4QRSB 2P43B 4CJ1A 1N5YH 1J8HA 3OF6A 2JJWA 2NY1C 3GBLA 4PJCE 1G1CA 1LK3L 4OSUL 3LEVL 3BW9A 1OWWA 4I4WA 1SJHB 3OX8A 4HWEL 2NX5B 5FKAB 4APQA 1IGJA 5FGCB 3QDMD 2IG2L 1MI5E 5D2LF 4MB5A 3SY0A 5IIEB 3STLB 1L0XA 2YPVH 3V5HB 4F9PC 4Y5YA 3RVVC 1DQLL 2A6JA 5H37H 2DQGH 2WINA 4I2XB 3EOAB 4XMLH 1AGFB 1NGPL 3HNSH 4CMHB 5CHNA 3VFNA 2HVJA 4L3CA 4O4YH 5A40E 3MRDA 2OJZH 3VFTA 4GAGH 1MF2H 3SE3A 3IJSB 4JJ5A 3X14B 1G6RL 5FM8A 1VENA 1I1YB 3LHPL 4XPGH 1L7TH 1QR1B 4HCRA 2Y06H 1JPST 1OAYH 4Q74A 4YQXL 1T1WB 4UT6L 3WKML 4U1JA 4XWGL 1X5KA 1ZT1A 2GT9A 2VXUH 3TN0D 4PLJD 3VD4A 5DTFA 5HDBE 1LWRA 3HRZB 3KPRD 5IVZA 5I73C 3AREB 3V2AR 1CDJA 4PJBA 4HUVB 1DLHB 1X6NA 2AK4E 3QB7C 3RX8A 3F6IA 3VXMA 2BCKA 5T3XD 3TH2T 2VC2H 4BQ9A 2FH8A 3MUJA 3RVUC 4Y16C 1PLGH 3AY4C 4C56B 1YMHB 4RCAA 3THMH 1DQTA 1TPXB 4BUHA 3D39E 3O2DH 5LGJB 5CS7A 1KB9K 4HBCH 2C9AA 4RZCB 1BEYL 4NO3B 5E00A 3T0ED 2KZ1B 5E6IB 2FNBA 4U1SB 3BKCL 4A6YH 3IFNL 3U0PA 4OKVA 1KC5L 3RZCB 1BFOA 4GAYB 2ED8A 3ZYJA 4MXQD 4AK1A 3TV3H 2V2WB 3HFML 1LP9A 4ZD3L 5I30L 4C56E 5GHWH 1KG0A 1I7TA 4J3WA 5TQ0L 2L0DA 1A22B 3O4LB 3S3JA 4F7TA 5DMJB 4JFYB 5IV2A 2X44D 4DKDC 3WIFA 2V7HA 2ADJA 4KQ3L 1KJ2L 2V6HA 4ZUWA 4FXKA 1NBQA 2DQCL 3VA2C 1CLZH 4HJJL 3S8WA 5D7SL 4HXBL 1V7NL 4JFZH 2FD6H 3EYQC 1S3KH 3KPMA 1JUFB 1FFNA 4LLVA 3UTSE 4PGJA 5HY9B 5JR1L 3RL1A 5D7KE 1II4E 4AEHH 3PWPD 1FZKA 4LCWE 2C3HA 2BOCB 3DI3B 3TVMB 1NC4D 3T0WA 3U1SL 2FYYB 5CEZE 2I9TB 1MY7A 1TIUA 2HT2D 5F6HI 3MJ6A 4Y4KA 3RWGA 4LDLB 4NNYA 3UBXI 3QULB 3RPIB 1XGUB 1KJ2B 3ME0A 1J05A 3D3VA 1M71A 2N7BA 2EDNA 2H6PB 4TUOA 4V2BA 4G80B 3EFFB 3D5OF 4LSPH 5F9AC 1VKXB 1EMTL 3QYCA 3LQAL 3KPSA 4PBWD 1VGEH 2YRLA 5HPOA 3G6JB 1MQKL 1MCWM 1UWGH 1I9JH 5DJ8B 2OL3H 3P4NA 2Y9RT 1IGYB 4OZGE 4UV4H 5CBEB 1MCRA 3ARDD 4G6AD 3OR6B 4JPIA 3WNMA 3PQYD 3ULVF 5H2BB 1DEEA 4PTTB 3CGTA 1UQSB 1OHQA 5L6YL 4MD4A 1OGTA 4WFHD 5IWLA 4I77L 5T1KD 3HPLA 3J8F7 4JN2A 2EXYC 3VXTB 2OL3L 3MRPA 1U8PA 2VZOA 1FFQA 4M7KL 3UJIL 5B39A 4R7DB 4D2NA 1T4KB 3FMGL 6CGTA 2YR3A 2VDRL 4P57B 1HINH 2Y6SC 5D70L 2ATKB 2VXVL 4NN7C 1Y18B 4G42A 4CN6A 2CMRH 1NMCC 5L0QB 2EC9T 4BKLA 2A0LD 3D1MC 5F89B 1RJCA 3RZWA 3WO3B 2UYLB 1RIVL 4XPHL 2BVQA 1FAIH 2NXZC 4HGWB 1VSCA 4NYLB 4PJFF 2R0KH 1IKFL 1VDGA 1B0WA 4AEEA 2FJGA 4Y4FB 4P5TD 5IROC 1A9BB 3GKWL 2VB5A 1GIGH 3P30H 2X89A 1WV7T 3LKOB 3MO1B 5D1QD 2AGJH 3GMOA 4XCEA 4BFIA 4UBDD 3WSQL 4YJZL 3O3AB 1CZ8L 2EIZB 4JN1H 4JVPA 4RGOH 1GHFH 2SEBA 3PJSB 4QRPA 5H35A 1CGYA 4LLYB 3HC3H 3SDCA 4PRDA 3PDDA 4X6DF 3KPSD 1QG3A 2ZG2A 3HAEB 3WN5A 5DRNB 2H3NB 5HDBF 3ZT5A 2E8YA 2XIDA 2YN5A 4PTUB 5E4EC 2ADIB 2BHZA 1QKZH 4KVNH 5GGSY 3HFMH 5I16B 1TJGH 3KPNB 1QLEL 1QPPA 2X9YA 4ODHL 2UUDH 4JKMA 2EEAA 4U1IB 3OWEA 4MNQB 2EDOA 3RWCB 1E4XH 1G7QB 5HDQL 4UOW1 1C5BH 2VO5A 4P2OB 1CD8A 1A9BA 3FN3A 2GJ6E 3CLFL 3AC0A 5BRZA 3UTZB 3IFOA 1UKSA 5GGVL 1FN4B 1QA9B 3D25A 3EO0A 4J23A 2AJYH 5EUOB 1TQCC 5GISH 3L7FA 2MNUA 3N1FC 2R23A 1O7SA 4ZXBB 1MFEL 5AWNL 3QIWC 5I9QB 4GQPH 1BQSA 1CXFA 4WO4C 3WMSA 1YY9C 5C0BE 4DGYH 1JYVA 4PRHE 4AH2A 2E7HA 5CLWA 1FL3A 2F53D 2H1PL 2FEDD 1KIQB 2BFVL 1YEDB 3KLDA 3O9WB 4JRYA 2DWEB 5ILTH 2FH6A 4GRLD 1CLYL 3QPXL 3MRPB 1S5HA 5E8EA 3V95A 2NY1D 5DT1H 1SJVA 5HVFB 4GXVH 2VLRD 1IEAB 2OJZL 3GNMH 1PKQB 3BSZH 3DJ9A 3KLAA 2BY2A 5E8OA 2DBLH 2H26B 5H2BA 5KSBF 1JGUL 1CD1B 1FZMB 4HKJA 4JFED 1JPTL 2WWMD 5FGRA 2A9ML 5DJ8A 1J8HD 5C0EB 1D9KA 4JRYE 5D7JB 1LEKB 1C16B 1H3PH 2OTUB 2DDQH 4CL7A 4TSAL 2JF1A 3PGFH 2CRMA 1QSFE 4KK9C 3MGOB 5HI4D 5I19H 5FGBC 3MRIB 3ARSA 4YGVB 1HILB 1H3TA 5TH2B 5IFJB 3MTRA 4FZ8H 5E08L 1Y0LB 1OTUC 3WNLA 4Y16A 1FJ1B 3FFDB 4Y8AA 3MRGB 4JZOB 5IBTL 4QRRA 1KNOA 2EKJA 2IPUG 3BPCB 1DQJB 4HSQA 3SGDI 1FNLA 4H25A 1AFVH 2YRPA 2Z8WC 4XC1H 3ZHKA 5F7DB 1V7ML 4M61A 2AS5M 2Z92B 4JHAL 4P4KD 3C2SA 4Z0XA 3UO1L 4DTGL 1ZHNA 1T5WA 2YZ8A 4EDXB 4Y4FC 3MODL 1JHTB 3QEHB 3OG6B 4M1GH 3C2AL 4XXCC 3MLUL 3P77A 1BWWA 2E9JA 5C07D 1DDHA 3LN5B 4U6HA 2I60L 3RWIB 4OGAD 1MUJB 5T1LA 2R1XA 4IM8A 2DRUA 4QHUB 3TYFA 4NZUH 1VFBA 5EUKA 2EC8A 1UJTA 2F19L 5ESVA 1VB9A 2OR9L 3Q1SL 3QAZB 4N8VG 4TVPL 1TETL 4HC1L 4LQFH 5CMAA 3RNQA 2XA3A 4KI5E 4LARL 4N0CC 4L3EA 4LHUA 3VXPA 5FO8A 2OK0H 1AR1D 5LAXB 4Y2DB 4LAQH 3T65B 1XF2A 3F62A 3WS3B 3S88H 3VXME 3MBEA 1RIUH 1D9KD 3BDXA 2ICWA 2Q86B 5E94B 5I1KL 5C09D 3K4DA 1AD0A 4YIQB 1C8PA 2D7MA 1X6LA 2QADD 1EVUA 3L3DA 4JY4A 3WBDA 4M6OH 4J4PC 3L3IB 4IMKC 3L3JA 1JGDA 1OAZL 4GMTL 5GQBA 3GBML 4FQ1H 4L3EE 3IJHA 4P2QE 4RRPG 3I6KA 1CF8L 3RWEB 5K9JH 4YDKL 4UQ2B 1I1AD 3FRPG 1RZIA 4AJ0A 1QO3B 4QRUA 4I0PB 4JZNA 4WI4A 1HHKA 4OGYL 2DD8L 5BW7C 3R1GL 4XNUL 1FQ9C 3QQ3A 4OCWH 2J8UE 3JV4B 1JPSH 3GJFB 3V4UL 1UWXH 2VQTA 2Z35B 3I6LD 1EJOL 4KKAC 4P2QB 4G8EB 5E2UH 1QRNE 2CDEA 1D6EA 5HI4C 5TF1H 5C0CE 3WFDH 3FL7A 2WSKA 5GGUB 4W4NA 2AQ3A 3WHE0 3G5YA 2E9WA 3U6RB 3KYMA 1G84A 3JTSB 4MJ4A 1DN0A 2XWTB 1UFUA 3QUXA 4FQPA 1CFBA 3GMMB 5KVGL 4AMKH 1R0AL 3K1KC 3MV8D 2P5EB 4FFZL 2VH5L 3MNWB 3C6LC 3KYOB 5SX5H 1RU9H 3VFRA 3VXOB 5D7JC 1HDMA 5DRZB 3HTLX 3EOTL 1H9VA 5BO1L 3CFJA 3L5HA 1I8IA 2CRZA 4NCDA 4F7MA 5IROA 1DUYA 2VIRA 2DTSA 3JTTA 3DX7B 3PIQA 2D31B 4NRYA 2R2HB 5F8QC 3VXSD 3OGCB 2ITDA 5KAQG 3CAFA 4HFUL 4MAUH 2Q76B 3H9SA 1KTDA 1T1XA 1X5GA 1BGXH 1T04A 3T77A 1ZXQA 3T4AA 3MREA 2FX8L 1TPXC 4F33A 2AJSL 4YPJA 2ZPKL 1NMAL 5JTWA 4JLRA 3LEXB 4PGBA 5EORH 5ITFA 4TUKL 3DX9A 4QOKA 2VNCA 4IS6B 1EHAA 5DC0A 1CK0H 1EDQA 1A0QL 3QG6A 2V7NB 1JRHI 5F6IC 4U1LA 1FGVH 3VXUB 5HYQA 1GPOL 4QXTA 5ITBH 2GYSA 3SJVA 1U3YA 4JKLA 1AO7A 5IGXH 1Q0XH 5J1AA 4IBLT 2Z4QB 1GZPA 1CGUA 1F58L 1J0KA 1G7LB 3LS4L 4XNYL 3SGKC 1F8TL 5HGAB 2D9QB 5C0AE 2GK0A 1N6UA 1GRWA 4EDWL 4MJ6B 2VLJA 2ITCB 1A1MB 3N85L 4G6FD 4OT1L 1MRDL 1UWEL 2GK0B 1PZ5A 4ZYKA 5D8JL 1U8OA 3T1FA 5JPMA 4POYA 2BDNL 3IDXL 3TNMB 3HZVB 1R3JB 3HE6A 2AW2A 2FO4B 3C9NB 2VAAA 4F2MB 1G7LA 4WFGE 5EN2B 3BGFB 3TO4C 4KHTL 4ISVA 1MNUL 3VG0H 1M7DB 4ONGL 1BIIA 5DJZA 4YBLC 5EOCH 2O93L 4OF8A 4XHJD 4QWWD 5TE4H 4HT1L 1AJ7L 2CLVA 4NGHH 3QIWD 3VMOA 2PR4L 2GIYA 3KXFB 1B9ZA 4WNQA 4PGEB 1YY9D 4ZFGL 2EDLA 4LSRH 4AYFA 4MNHB 1H3GA 3BEWB 2HLFC 1TFHA 2QBWA 3VXRA 4R4FL 3QRGL 2XICA 4WW2A 4MD5B 4LKCA 4O2FB 1YEKH 3LEXA 4ZS7H 3RU8H 5DHVA 3MLZL 5J13C 3ECBA 1QVOB 2ZJSL 5CJQL 3SOBH 2MWCA 2WNGA 4M5ZL 5B39G 3RIAF 3MREB 1R24B 2BNQA 4G7YL 5ICZA 2NPLX 1MJUH 3RTQB 2VTFA 3CX2A 3QDGD 4HXAL 3QUYA 4ODBD 2FB4H 3SGEI 3CMOL 3NMEA 4JREC 2GUOA 4HIEA 4F7PB 1I9RL 1WAAE 4BZYA 2AK1L 1U8QB 4KGJA 1H0DA 4U0RC 1UEMA 3TBWA 1YPZB 2UZXB 1IVLA 4IRSB 1JZ8A 1NDMB 3OKYA 3T09A 1ED3B 1B4JH 4KRPB 3BIAX 1YEJL 1AHWB 2B8OT 4O2CA 1AGCA 2A38A 3QAZC 4NDMA 3X17A 4GG6E 3EJYD 2OQJA 5F1SA 1E28B 2WZPD 5CEYA 3V6OE 4TTGA 4RMQA 3MSPA 1CGSH 1KJVA 2AJUL 4NO0A 4ZSOA 2AERT 2X4NB 1F4XH 3N1QC 2YD9A 1RUML 2DICA 3ARVA 1OY3B 1N59A 2LTQB 5E8PB 5EZOH 5FECB 1WK0A 4DFIA 2GFBB 5EU3B 4UILL 3QEGL 2XKNA 2VQ1B 3JWDL 4POUB 3L1OL 4XXCA 2BX5A 3O11A 3QWQB 3IKKA 4XVTH 3RY5A 4JEGB 4TQEH 2VXSL 3C09B 3EYOA 4UQ2A 5GS1C 3MRQA 5JLZB 4JFHD 4QEGA 4H1LG 3TA3B 4X4XB 5D6CA 5B3NA 3BH9A 4MJIB 1QSFA 5GPRA 1NBZA 4OIIH 4NWTL 4LEOA 5HVHB 3L3JB 2PW2B 2ID5A 1DCLA 3N9GH 3PQYA 5K33A 1M4KA 5IKCB 3S5LA 1T2XA 3SDAD 1QNZH 1RURL 3U7YL 1I7UB 1A3LH 4MXVE 4YGAB 3LPFA 4UTBH 2ZP0T 4JDZA 1XF2B 1F90L 2X4OB 3S36H 4JO2L 2LVCA 3PABA 4NOFA 4PJFB 1CD9B 4DZBB 4YXKH 5EU7E 4DEPB 3O8XA 3BMVA 2Z31A 1NAMH 3QZWB 2FIKB 2XZAL 2N7AA 3TLRA 4ELMB 1YNTB 4MJIE 1JV5A 3PE9A 1MI5D 4CVZA 3CDYA 5C0IB 4Y4KD 4G6ML 3TBVB 3CH8A 2JCCB 3HMWL 2VDMH 3OR7A 4M5YH 3DLQR 3O2WL 1KFAH 1BBJA 4HKBA 3GIZL 5KZCD 4DVBA 4U1NA 4HULB 1T7ZA 3ZO0A 1KLUB 2R2EA 3VI4F 4WEBL 5D71H 5KOVC 1MAJA 5K93A 5I0ZA 4PJGE 4QXGH 4K9EH 4Y5XA 4M3KB 4CN1A 1NMAH 1AKJA 1U3JA 3EFDH 2VL4A 3JWOC 3L3OA 4ENEC 4Q7DA 2JCCF 3FKUS 1MCPH 2W0FA 3BZEA 3BRGC 4ZAKA 1U3HD 2A6DA 4X4ME 5F7DA 5ETUB 2AJVL 3ZYOA 4UT7H 4JM2B 1M7XA 2FBJH 4HMDA 3RAJH 1K4CB 1AC6A 1M6OA 5KJRH 2ERJB 3FO1A 1FVCB 1QHOA 1W0YT 2IC2A 4XRCA 2DKUA 5EOCJ 5HJ3A 3L3GB 3MRGA 1FBIH 3N1PC 4R97B 1FJ1A 4RQQA 3PWUA 5JIPA 1L6ZA 4XWOC 4ONHA 1JK8A 3GB7A 5C0JA 1ZT7A 3DXAB 2DQDL 3FT4A 4M4PA 1NCWL 1HXYA 3LSOB 4GW4A 1ZV5A 5L88H 1N6VA 5D1XD 5KSUA 2OTUA 1AHWC 4OLZH 5DK0B 1U8LB 4OZHB 3T0EE 1URLA 4K3EL 2ICWJ 3DV6A 5D2LA 3O3EA 4IRSC 5CILH 3LIZL 5J11B 1AKJD 3CSYB 4H20H 2J8UF 4OCNC 5FO7A 2JB6A 5CP3H 5TFSL 1N2RB 1YEFL 2O5YL 1LK2B 4LLAA 5E2UL 4RMUA 2CUMA 1KYOJ 2NXZD 1EJ6A 4P59L 1X5FA 3NCBB 5D7KD 5JA8B 1E27A 3MRLA 3EO9L 4NQTA 3BQUC 4UNTA 4R96B 3RUGA 4PR5A 5IMOB 3NA9H 3O6LH 3DXAA 5E6ZA 3LVEA 4Z7VB 3T2PA 2BNUA 1B2WH 4OCSL 4KROD 3MNVB 3QDJA 3TNNA 1N0LA 1KIQA 4JCMA 3CZJA 3L3HA 4Z7UF 3SDYH 3DX8B 4N0YH 4HIIB 4UT9L 2VLMD 5IMLA 4MMXC 4U1MA 2CKBA 2YUZA 4BA8A 4M8QA 3QJFB 4RWYH 4GS7B 3HI6H 1IQDB 4MA3B 1RK1B 3EUUA 4N90E 3TWCL 2X9WA 1BFSA 4HPYL 4IRZL 5KVDH 1CICC 2WLZA 1KELL 1YPZF 1G7IA 5ESAA 5J6HA 1XZ0A 1MLBB 2N4IA