4ZQMA

Crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the complex with xmp and nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
357
structure length
333
Chain Sequence
b'DPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSGGLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Mycobacterium tuberculosis IMPDH in Complexes with Substrates, Products and Antitubercular Compounds.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Oxidoreductase
total genus 101
structure length 333
sequence length 357
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zqmA00
1XBXA 3TROA 2JK2A 2ABAA 2VOMA 3LHWA 3LCHA 3GXPA 3P5YA 3KVKA 3M41A 5FEXA 3GLCA 1G7VA 4RK8A 3JRKA 2WJZA 1BTMA 1GPWA 2X1SA 1THFD 2YR1A 1QWGA 5EA9A 1NF7A 1SZGA 3LB0A 3B0PA 2B7OA 4BK9A 2CLFA 1TPB1 4YMZA 3WK1A 1A53A 5BNKA 3B05A 3SGZA 3W87A 5C6MA 3NQCA 2G97A 3MP5A 1J4EA 1JJKA 4GE8A 4OWGA 5KINA 2R8WA 2J27A 3HGSA 1DJQA 3QH2A 1OX4B 1PCWA 5DN1A 5HNRA 4IMFA 1TV8A 4MY1A 4QITA 3TQKA 1ME7A 3PULA 2E1DA 2CFFA 3HPSA 4UFKA 4UMBA 3CQ0A 4HPXA 2QCGA 4LRTA 4AB4A 3NA8A 5AFDA 2PRMA 2Z0IA 1TPC1 3IV3A 1EP3A 3DI1A 4KFNA 2ZZ1A 3Q37A 4L4LA 1B3OA 4FX8A 4E2BA 3TUUA 4I9AA 4O54A 1OK4A 1SW3A 3LOTA 1RD5A 4LOCA 4UC5A 1JUBA 4UFMA 3FS2A 3P74A 3W6YA 3BGGA 3USBA 4FIQA 3UWWA 3G0XA 4Z1DA 2ZZ6A 1KV5A 3O07A 3TXVA 4K36A 4PTNA 5G1TA 5F2MA 1KLYA 4MY9A 1A5AA 4N6FA 4K37A 2OZ0A 5I3FA 1JCXA 3SECA 3LHUA 2E09A 2NUYA 3A23A 4O57A 3HG4A 1X8FA 1JQXA 3BK0A 3F1QA 3QM3A 1JUKA 2WNZA 3MBDA 1FCUA 1X6UA 1B9BA 3TFXA 3IIPA 1FX6A 3MUXA 2B7NA 1Q6QA 3LX9A 2HMCA 2ZA1A 1FDZA 1Q45A 3QEZA 4AWTA 4UR7A 2QJHA 3GDTA 1DOSA 1QCWA 1TTPA 1LOLA 1SFJA 4O17A 3TC7A 5LNUA 4FIRA 3HG2A 1WAUA 4QQ3A 5IBXC 3INPA 2NWSA 3O06A 3BVJA 7TIMA 3FJLA 3C0JA 1ZENA 3LDVA 4DBEA 1W8SA 4JTTA 1LRNA 4GJ1A 4FNRA 2CLIA 1VR6A 4ICNA 3D0CA 3N2MA 3MW7A 2TYSA 3L5MA 1CI1A 2Y85A 3W07A 4OHQA 2B0MA 2DZTA 2G96A 4JNMA 4X9SA 1TTJA 3BG3A 5G4WA 3NG3A 3M5YA 5D38A 1LDCA 4ZQRA 5K2ZA 1FWRA 1QO5A 1J2WA 2AQWA 1JULA 1FBAA 4POCA 5LNWA 2R14A 4DXVA 5LNRA 3WK0A 3GDLA 2WQPA 5AHFA 3W88A 1VPXA 1H7XA 1OX4A 3DENA 3LV5A 4IWWA 3G1YA 3QJAA 5I3JA 5D09A 4UTHA 4UUIA 1RVGA 4GFSA 5DELA 1PL9A 3RLVA 1JVNA 3QSTA 5I3HA 1EWEA 4JTEA 3B06A 3TNOA 4MJZA 4AWSA 2DZVA 3S1UA 4IMEA 2ZRZA 4JXCA 1S5TA 3CPRA 2ABBA 5HR7A 3NO5A 4N9DA 4Z0JA 3O6YX 4M6QA 4LWWA 1MXSA 1HUVA 2A6NA 1VS1A 3SGUA 4IMCA 2WSRA 3PR2A 4Q4KA 4LS2A 3QF0A 4Z1AA 3H54A 4UTJA 3TU9A 4QNEA 3TFCA 3NNTA 4FXRA 1WBJA 3GXTA 3QSRA 3TC6A 3IRDA 1YDNA 3LCLA 4WY0B 1OF6A 4EWND 3STEA 3GDMA 1W56A 1FWWA 4N6EA 4LW7A 1EWDA 1QPQA 3HBLA 3IVSA 3KVJA 4O11A 2FPTA 4QISA 3T55A 4UMCA 3C3NA 4N9EA 2DU2A 2A1YA 3GVGA 3IEBA 2ZTKA 4KFOA 3L0GA 3W7IA 4JX6A 4BWLA 1TYGA 4LU0A 1OK6A 2DZWA 1XM3A 5AHLA 1FWTA 1V7YA 2QCHA 1O5XA 4QAIA 1OX5A 4BI5A 4DO6A 3LBMA 4E38A 2TPSA 3NQ6A 5AHEA 3TMQA 4MFDA 3I68A 1GYNA 1YTKA 1EUNA 1EPXA 1I2QA 1H7PA 2X1RA 2GQAA 2GPTA 5HUPA 2FPVA 3NPVA 5HWMA 2WV8A 3W2KA 3UWUA 1VC4A 3C2FA 3H55A 2H3BA 5LZLA 2E5CA 3VI2A 2NXGA 3WJWA 3VCRA 2QJIA 3CWNA 2Y62A 2P0OA 4IJBA 4UTIA 3LXAA 3C6CA 3IIZA 3BARA 3TJXA 1UBSA 1LRTA 4RXGA 3P80A 4S1FA 3B8DA 3P67A 3O8AA 3G3MA 3W1AA 1H50A 3ZWSA 1K02A 2X2GA 3KXQA 3TQ0A 4MJMA 1W5QA 3FYPA 4JYDA 4LVDA 1WOAA 2JGYA 3KAOA 3ZWTA 3QMTA 1GVQA 3TQVA 3LXCA 1KV8A 4NX0A 1GT8A 4JTIA 3W7GA 5J5RA 3S1WA 3HB9A 1XFBA 3C2EA 1R30A 3N9RA 3NQ7A 3TW6A 4RJEA 3EWYA 1LCOA 3W1LA 1QFEA 3PC0A 4A2SA 4HSOA 1ZCOA 5TQLA 3Q58A 5L6UA 3IVTA 4WUIA 4PEKA 4EVZA 3W73A 3ZFHA 3G1HA 5FF0A 1H1ZA 3O6DA 1IXPA 5EKYA 2Q3RA 5KTLA 4JIQA 1JQVA 2BZNA 1VH7A 2OT0A 3QPZA 3W85A 3MYPA 2Y70A 1WX0A 1UUOA 4FNPA 1OFOA 4O4WA 3KRUA 2RH9A 2C18A 5HUOA 4N02A 3R2GA 2A2IA 4NVTA 4MLRA 1UB3A 2CLEA 4WY0A 2QCLA 3N2XA 3KVMA 1EB3A 1EEPA 4JN6A 4O19A 4RCXA 3PBUA 1W54A 5CZJA 3UPBA 4TMBA 1ICPA 5J5DA 3V1PA 3HF3A 4MFEA 2NXIA 5HJLA 5DLCA 5K9CA 1KM0A 3S5OA 3MO7A 2YSWA 1ZJIA 2V81A 4JTHA 1JRCA 2H3DA 2NUXA 1B57A 3P61A 2E5BA 1AG1O 3W2MA 3L65A 1SPQA 4N9CA 1VLIA 3ZS4A 1ADOA 5BRBA 4YCOA 4LNYA 2FDSA 5IBXA 1QNVA 3MBFA 3W7DA 3M1ZA 1S5VA 4HNVA 3HGOA 4S2CA 1Y0EA 3NQVA 4OBTA 4OU1A 5FF3A 1JRBA 3DU0A 4O12A 3UWVA 3S6DA 2EPHA 3UZ5A 5CG7A 1DHPA 3DBPA 3P81A 3LM7A 1WV2A 2Y7EA 4JTJA 6ALDA 5F2GA 5FESA 3RK8A 1SSGA 4WXZA 3M6YA 2RDTA 4RKAA 2OT1A 4YLWA 3G24A 3DFNA 1GTEA 3T78A 3DHFA 3TDFA 3GAKA 1H61A 5HMSA 1TJRA 1RPXA 2J6XA 1RQBA 1WDWA 2TRSA 3EKZA 1I2OA 3EWWA 3WJXA 2X1TA 4FNTA 2TSYA 3OVRA 1CX9A 2YZRA 3EXSA 1O94A 4UTTC 5LHEA 1NVMA 1W5MA 1FDJA 5KZMA 2JKEA 1EUAA 1X1OA 3BLFA 3G8EA 2QUTA 4C1KA 3HPZA 1TV7A 3L68A 3SY5A 1FWSA 3EWZA 5C55A 2V82A 2ZRUA 1Q3NA 4LT9A 2ZZ2A 5BMWA 5DCEA 3W2NA 3ABRA 4FXSA 3T7VA 4WXYA 1VHNA 2ZRYA 4DF0A 1K7FA 3TA6A 4E0CA 1U83A 3TSBA 3DFQA 3W7EA 1XUZA 1QO2A 3FKKA 4OV4A 3G1DA 3C2RA 3L2IA 4N4QA 3W76A 5E0KA 1JCNA 4Y96A 2EHHA 1XBYA 1ZY9A 2PRHA 4PL2A 5C2XA 3UXDA 3W86A 3MWAA 1MEIA 3LCFA 1KFBA 3P8JA 1U5JA 2VC6A 3UZJA 5KZDA 3QMRA 4OGZA 3L9CA 3THQA 5G1YA 4WOZA 3LERA 4FO4A 4O15A 3R8RA 1PIIA 1T99A 3NEVA 5D2XA 1GJPA 4UFIA 4A2RA 4LV4A 1VGAA 2R91A 1MEWA 2V2DA 3L21A 2ZTJA 3DI0A 5DXYA 4NXSA 4C1LA 3LHZA 3E02A 2FTPA 1HTIA 5LSMA 2X1UA 2Y88A 4KWVA 2H6RA 4ONVA 4Y90A 1KM5A 3ABSA 3W70A 4UFJA 1FDYA 1YXYA 5FI8A 1AL7A 1OFPA 1B4KA 4X22A 4JTKA 1R2SA 3RLUA 1YDOA 2V2CA 5D30A 2QCEA 4DEFA 5G4EA 2FB3A 2C16A 3G22A 1P0KA 3S1XA 3SIZA 1GVOA 3DKJA 4ZQNA 4Q33A 3RNDA 1VCGA 2ZRWA 3W7NA 5EL1A 4FNQA 1GYLA 3P5ZA 1SZEA 1W0MA 3L0NA 2Y63A 3AJXA 3BPWA 4NNBA 4RXFA 1LM1A 3LHTA 3LV6A 3P62A 4XTIA 4NX5A 1SW0A 1OFBA 2WPBA 1QPNA 4M5PA 1KFEA 1HO4A 1PCKA 4LVBA 3QC3A 3R5EA 1ZAHA 3LGEA 1SUXA 3M43A 2RHGA 1ONRA 1H7NA 1C8VA 1IXOA 1JCYA 3SI9A 1W1ZA 2QCMA 2HS6A 4UCGA 1N7KA 3MYOA 4GUJA 4CLMA 2QAPA 3L5AA 4ML9A 4JTLA 3QZEA 4MY8A 4CNPA 4ADSA 4QNWA 4MOZA 3S0CA 3HJZA 1SO5A 2E68A 3W2UA 3RU6A 3FOKA 3OG3A 1MSSA 1H51A 1WBHA 3LRMA 4FNUA 1AK5A 2H8XA 1SZNA 4M19A 1DBTA 1SQ7A 1W5PA 4DPPA 4I7UA 1YTDA 3A24A 3CT7A 3W1QA 2J88A 1CW2A 2G95A 3GR8A 5EY5A 1AMKA 4LC6A 3WJZA 2VFEA 3QPYA 1Z42A 2A5HA 1TPVA 2ISWA 5D2TA 3NQ2A 2BX7A 5CZ0A 1G4EA 2VENA 3C61A 4LS1A 4IMGA 2A4AA 3SZ8A 1KFJA 3P60A 4YCPA 2YGYA 1R46A 2A6LA 4FX6M 2NUWA 1G69A 1OFAA 4Y6GA 1KM1A 1LRQA 4GUGA 1OFRA 4Z08A 1TRIA 4DPQA 4IX0A 3KRSA 4U28A 4ZL1A 4TR9A 5E1QA 3AO0A 3NXFA 2ZDRA 3PS7A 4K39A 3PAJA 4XTDA 3HPXA 1FXQA 1TPFA 3N14A 3UYCA 2CLLA 3W83A 1HO1A 1XBVA 3W7RA 1TJPA 4K6AA 3DAQA 2BWGA 1K7EA 1LLWA 4O53A 5U7SA 3W74A 1WA3A 4O13A 5F4SA 1G4TA 1SU5A 1ME9A 5FF7A 3O6CA 3EX6A 4M7TA 3N19B 3C56A 4UMAA 1RQHA 2CLKA 5D37A 2JBMA 4NNAA 5AN7A 4JX4A 1IIGA 2XN2A 1AW1A 3LCGA 3W1MA 3DXIA 3I65A 5K3VA 2Y7DA 1OFDA 3UQNA 1H63A 4HSNA 4NZFA 2XN0A 3S1VA 4BFAA 3THAA 2VEMA 3EWUA 4JTGA 3FFSA 1XC4A 3PB0A 5D2YA 4JD4A 3N3MA 4S2BA 2JKAA 3CEPA 1LROA 5FF4A 1MZHA 3PBVA 3IGSA 2PURA 1F2JA 3PG8A 5D05A 3ATZA 1ZAIA 4JS3A 2ZRXA 3MI2A 2RKXA 2DZPA 4UTTA 3LI0A 4TX9A 4ZQMA 3TX9A 3N73A 3S5ZA 4O14A 3NQGA 4P61A 3C52A 3LCIA 4Z0SA 5BW6A 4PA8A 1UCWA 2QCFA 1HL2A 1F05A 2OCZA 4QJ1A 4LY8A 2A0NA 3GYEA 4FF7A 4HNTA 2R94A 1Z44A 2EGZA 3WK3A 3RMJA 2YYTA 2ZZ4A 1SO6A 4I7WA 2CZDA 3PSVA 1JR1A 1IIHA 5A8GA 1XCFA 1K8ZA 1OF8A 1GQNA 4ZVJA 2BSLA 3U8GA 2GQ9A 3W9ZA 1SSDA 1T96A 1GVFA 1J5TA 1WQ5A 4PODA 3U2OA 3T44A 3W7JA 4UTWC 3HGJA 3LLDA 2B4GA 3B0VC 4O0KA 1DL3A 5D2VA 1OYBA 2A21A 3M9YA 4UR8A 4WOQA 2BTMA 3P8IA 1JUEA 3G1FA 1D3HA 1OVDA 1FXPA 4EF9A 4I7VA 4XZ9A 3RF9A 3MMTA 5CPLA 4WX2A 1H7OA 5LNSA 3NYZA 3BLEA 1VLWA 1LBLA 5LKYA 3TW7A 2OMAA 2Y61A 1GG0A 4HPJA 5HULA 2NZLA 3KVLA 1E51A 2Y7FA 1FQ0A 1XL9A 3LBCA 4QM1A 4R53A 3N34A 1OFQA 2ZQ0A 4M6VA 3MHGA 4ZQPA 3VFLA 3QMSA 2DJLA 1OG0A 2AGKA 2B7QA 4O8RA 4KFPA 3MI6A 5DY2A 3U6WA 1FWNA 3F4WA 4MVAA 3SSJA 3FA5A 1LZOA 1RR2A 3LLFA 1KLZA 4FNSA 1ME8A 4DO4A 5HWJA 3G1AA 1X7FA 3QW4B 3DHDA 1W3IA 1O5KA 3SFKA 3ELFA 4JIPA 3A9IA 2VFDA 4Z1CA 2VEKA 5D04C 3BG5A 3OVPA 5DBTA 5DBUA 2C15A 4IXHA 3NL2A 1TPDA 3GNNA 1BEUA 2NX3A 3O16A 1O60A 1TQXA 4MKNA 4WD0A 1VHCA 2V9DA 3ATYA 4MZ8A 1R2RA 2Y7GA 3G0SA 2EF9A 3NQDA 2JGQA 5MHBA 2QUUA 3LI1A 4CCCA 5C54A 5DY3A 3QQ0A 5DXXA 3VNDA 2Q3OA 4GUHA 3CB8A 3JS3A 5BMXA 1XBZA 3LRKA 3NZ1A 1XDLA 2WKJA 3CIWA 3W7LA 4AXKA 3MI3A 1Z48A 2TMDA 3LXBA 3PBYA 2PC4A 2ZBTA 1SW7A 3H53A 4JGDA 4FB7A 3FEMA 2VKZG 2HS8A 1VRDA 3G0UA 1W3NA 1T0OA 4MZYA 5HINA 4JTUA 3W1RA 2I14A 3FIGA 3ANYA 4IXXA 4IOTA 2FQIA 4O18A 2YFNA 3W2LA 2FPYA 1BWKA 4BI7A 3PB2A 2JKPA 3JR2A 2YCEA 5TBOA 1Q6LA 5AYYA 4M6PA 2ATMA 1OHLA 3ABQA 1TSIA 4XKYB 4H4IA 2HSAA 3TMLA 3VE9A 3CEUA 4HT3A 4W9TA 3PWAA 3V75A 4CNOA 4AAJA 3OHIA 4X3ZA 5T26A 4LVGA 2BLEA 4JX5A 2QCNA 3R13A 1XUUA 4WQ6A 1YXDA 2E6AA 2ZA2A 3TH6A 1MO0A 3G3DA 1GVRA 2WNNA 3W7PA 1NAL1 1PV8A 3S9YA 1BWLA 3B0UX 2KZHA 5D33A 3P7YA 4ADUA 3DH7A 4LVFA 4LC8A 1EP1A 1HG3A 3NAVA 4O0ZA 3LTPA 2CU0A 2E77A 4AH7A 1Q6OA 4KKXA 3BV4A 3L67A 1YPIA 3W1TA 1LOSA 6TIMA 5F1VA 3R89A 2EAWA 5FEPA 1VZWA 4WZHA 3TR2A 5F4WA 1TO3A 2QUVA 3W22A 4AEOA 4IQLA 3TSDA 3BLIA 1SO4A 1YDVA 1P4CA 3DFTA 4K8HA 2J9ZA 3A22A 1G67A 1L6SA 4JDBA 2WO5A 2GVLA 4LV9A 1VYSX 3PM6A 4IGHA 5AC7A 1KTBA 4UTUA 3PG9A 3EXRA 1JCLA 3I7RA 2CLMA 3TK7A 1V5XA 3W7OA 4NU7A 4CQ9A 5I3GA 1RQEA 1IGSA 2CZFA 1G4PA 4LUJA 4NXKA 1NEYA 3K30A 3A5FA 1F76A 1EA0A 2OX1A 5L9FA 4LVAA 3STFA 3BGJA 3M0ZA 3NOEA 1UASA 3W1XA 1GOXA 3ABOA 3CLMA 4NJIA 4R7JA 1JCMP 5G2IA 3C2OA 3OA3A 3QW3A 3CHVA 5F2IA 3W1PA 3W7MA 3KRZA 1ALDA 3DKLA 5CPNA 4K7YA 3OEXA 2F7FA 3BO9A 2FFCA 1DV7A 3EWBX 3NPWA 1A5CA 3DFOA 3SJ3A 1XI3A 2G5WA 2H90A 2RFGA 1UJPA 4PCFA 2YX0A 1DVJA 3BW4A 3HG5A 1ZNNA 3IIVA 4R34A 2DP3A 3A21A 4EOUA 1PE1A 1Z41A 5HQEA 4RX0A 4B5NA 3UWZA 4XKYA 4MUZA 1FCVA 5H2ZA 5KMYA 2YW3A 4UFHA 3PF3A 2CZ5A 5I3IA 1TCDA 1I8JA 1YYAA 2NXHA 4UTWA 3EB2A 1DQXA 3G1VA 3QQ1A 4NNCA 1A5BA 5F2LA 3S5YA 2C14A 1TMHA 4IPIA 1OYCA 1FUYA 4L4MA 1T8XA 4A21A 2CZEA 4AHPA 3OVQA 4EF8A 1TREA 3TE9A 2QCCA 1IXQA 2NV1A 4JY8A 4AWUA 3TSMA 3GB6A 2DZXA 4Y8FA 4IMDA 1F74A 1IF2A 4NT0A 3VKJA 5D02A 5G2HA 5IM51 1AW2A 2A7RA 2V2HA 3CIXA 3W2JA 1W5NA 1EX5A 4K7VA 5F4XA 2VELA 1L9WA 1PS9A 5LNVA 5CPOA 1KM4A 1KTNA 3EX2A 3OBKA 3PSWA 3BW3A 1KM2A 2IQTA 3NPXA 3T40A 4ADTA 3PUEA 1PHWA 4GRSA 3O1NA 5HWNA 1KFKA 2ISVA 4J9JA 5TIMA 4PFMA 5EPDA 2WNQA 4ORIA 2V30A 1LP6A 5K9DA 1C29A 5C5YA 3P82A 1ICQA 3W1NA 4A22A 5K4ZA 1LTDA 4JDYA 1UUMA 1F5ZA 3PUDA 4UTMA 1WXJA 4D2JA 5SWUA 2PE4A 4Y9AA 1G4SA 4O1DA 4DF1A 3W23A 4NJGA 3I7QA 4GXMA 5AHNA 2CWNA 4DELA 3UY7A 4UIOA 2YPIA 3CM4A 1KBIA 4O10A 2GOUA 1KFCA 2W79A 5CZTA 2ZZ3A 2W0UA 1DJNA 2QEZA 2QCDB 3NM3A 3HG3A 5H91A 5A5WA 1H5YA 3GNDA 5AYXA 1SR9A 5FEZA 2BXVA 3WJSA 1LLZA 4KWWA 2X30A 2DORA 4BI6A 2PRLA 5D2WA 4JICA 1L2UA 1DQWA 3PY2A 2O7SA 1OFEA 1OYAA 3W7QA 1EIXA 2V8ZA 2QAFA 1P1XA 2H8ZA 4EIVA 3QRHA 2Z6JA 5K9XA 2VFHA 3NZRA 1KW1A 1O4UA 1RZMA 2Z1BA 3GKAA 1P5BA 3YPIA 3LHYA 3MHUA 3G18A 2ZYFA 3HO8A 3QYQA 2V5BA 3G1XA 4N2YA 2YFOA 5FF2A 3P84A 1GZGA 1GEQA 1D3GA 4PL1A 1K3UA 1ZFJA 1QPRA 4R33A 3L66A 1F6PA 4AMAA 4QSHA 5GVJA 1YTEA 1R2TA 2RDUA 4RZ6A 1K8XA 1B4EA 2F84A 3G1SA 1HFBA 5DCDA 3WK2A 1G7UA 3SR7A 3BG9A 1AW5A 1F7BA 3NL5A 5F1UA 3W7CA 3DZ1A 1JCJA 1LBFA 1RV8A 4NJKA 3S5NA 3W1UA 2XFWA 4DF2A 3VE7A 1M7OA 4CQ8A 1SO3A 2ISSA 2VEIA 1M5WA 4GUIA 3S42A 1TQJA 1VYPX 4NUWA 3RFAA 4A3UA 3HOJA 4O50A 3L0KA 3STCA 3IGUA 5FEWA 1M6JA 3IGXA 1XXXA 3M5XA 4O52A 4O1BA 1P0NA 3C8FA 2FJKA 2ZFAA 1TPH1 4HHPA 1L6WA 5EBUA 4UNKA 3EX1A 1Q6RA 3W3OA 3UXAA 5EMUA 2UV8G 2NX1A 4A29A 4RZ5A 1PHQA 2FLIA 4IX2A 3PUOA 1W37A 4ZMGA 2V0TA 2NLIA 3LCWA 2NX9A 2DZUA 4MPQA 4MLJA 4UXDA 1K7XA 4JYFA 2XN1A 3OIXA 3TKFA 3CU2A 3STGA 4GNJA 1YADA 4RLIA 3M44A 4H3DA 3T4CA 1O95A 2V5LA 1PVNA 1QDSA 2CLHA 2Z2UA 3GDRA 4HNUA 3B03A 3I6RA 1H7WA 1KTCA 1H7RA 1ZHAA 2P10A 1ML1A 2YDAA 1TRDA 3DFSA 4HNNA 3KFTA 1TPEA 2FIQA 2QCDA 4JY9A 4BF9A 1LYXA 3FLUA 3TAKA 4YL2A 4XUGA 4ALDA 5I3KA 1I2PA 4DQWA 1C9DA 4Z1BA 3E0IA 1A50A 2Q8LA 3GIYA 3TCEA 5K7JA 2A7NA 3NQFA 4NQ1A 1H1YA 1KM3A 1GTHA 1SFLA 2E6YA 2QR6A 1S5WA 2HTMA 3GAYA 4FHAA 4GUFA 3W75A 1OX6A 5LGZA 3GKFA 8TIMA 1K03A 4IPJA 4PH6A 4AHOA 1TPWA 1QOPA 1H60A 3EWXA 4LUIA 1WYIA 3S8HA 2GJLA 4AHQA 4TMCA 2DJXA 3M5VA 1GG1A 3EX3A 5KSWA 4RZ4A 3SW6A 1I45A 1VCVA 3FYOA 2ZCGA 5DCBA 1YXCA 5LGXA 1LORA 4K38A 3E12A 4UTLA 3NQ8A 2OJPA 4WJEA 3UNDA 1TTIA 3A5VA 4NJHA 4XQ6A 3CTLA 4ZQOA 1F73A 4JR5A 5ABTA 4YXGA 3MHFA 1KBJA 3DGRA 1GWJA 1H62A 3F03K 1SZFA 4AVFA 1K8YA 1KM6A 1FY6A 3W7HA 3HQ1A 2WSYA 3CC1A 4AF0B 4IUOA 2VXNA 1ZAJA 3R12A 3W72A 1DKWA 4UTKA 2NV2A 2Z6IA 3LTYA 1TIMA 3HGRA 1KA9F 1QR7A 3Q94A 3IIOA 3B4UA 1W31A 4FEZA 4Q32A 3W84A 4FX7A 3BW2A 1OABA 1VYRA 5U4NA 2FB2A 3NQEA 4MYAA 3G8RA 3O15A 3NM1A 2X16A 4LTSA 1TPUA 2W6RA 3NQMA 3E9AA 5AHIA 4U4MA 3WJYA 2A7PA 1ZALA 4TIMA 4RV8A 2B7PA 1W3TA 1KFLA 3IVUA 4BR1A 4HKPA 3TXZA 5KZEA 2YXGA 1FCQA 1TB3A 2GVGA 1F6KA 4TO8A 3GXNA 5CZSA 4YWIA 1EP2A 2Y6ZA 3KX6A 3MP4A 2EKCA 2C1HA 5BOOA 4OQVA 1N55A 5LHFA 3EEGA 5CPMA 2C13A 2QJGA 3UWQA 3GZ3A 4O16A 2J9XA 1GVSA 3O05A 3E96A 1LBMA 5D03A 2GJNA 3M47A 4MZ1A 1VQTA 1QPOA 3GR7A 3M5ZA 4N9BA 2WSQA 3LCXA 3NR0A 4NJJA 4MYXA 3NGJA 4OE7A 5CSSA 4M7SA 2D73A 2RDWA 1X1ZA 1DORA 4E2DA 3W71A 2ZA3A 2C3ZA 4XWUA 1FCBA 3NDOA 4LS0A 3NL3A 4DBDA 1YPFA 1A5SA 1WOBA 4CNNA 2YYUA 3F4NA 2VEPA 3B04A 4GBUA 2ZRVA 2DZSA 1I2RA 2E6DA 3UWYA 3C2VA 3NPUA 5AC8A 4O4VA 4ORMA 3TAOA 1AL8A 4K8EA 4JTSA 4ZQCA 1QOQA 4ZZ9A 4X2RA 2C19A 4OT7A 3M7WA 1XKYA 2E6FA 1LOQA 3UY8A 3MJYA 3TIMA 1D9EA 2QF7A 3FJ6A 3TV8A 1BKSA 4PC8A 4WY0F 1XDMA 4HIBA 4P2VA 4RR4A 4DO5A 3PBWA 1NFBA 3NL6A 4G1KA 1VJIA 4H6KA 4O1AA 3LHVA 5CSRA 5AYZA 2J24A 1N8FA 3E49A 2YW4A 1VCFA 3GX9A 3EX4A 4XBSA 1M7PA 3IIXA 3UD6A 4TU1A 3NQAA 5AOUA 4HN4A 5G2WA 3L5LA 2QKFA 5G5IA 4AF0A 3MP3A 5CGQA 2WOQA 4O28A 2J9YA 2GVJA 4CQAA 2LLEA 1IXNA 5K4XA 5E93A 2C0AA 3C4UA 1L6YA 1R47A 1QMLA 3LTSA 4JTFA 4LRSA 2Y89A 1ICSA 3CWOX 3QFEA 1TV5A 3WFAA 1YLVA 1QAPA 1NF0A 3KOFA 4JYEA 4UFLA 1OJXA 4XBKA 4GC4A 4JEQA 3N9SA 2A85A 2ATSA 4NZJA 1I4NA 3M16A 5AHMA 3FKRA 2ALDA 2QDHA 3UPWA 1TTQA 2Q8ZA 2PCQA 2C6QA 1W5OA 3HIJA 4CCEA 2GQ8A 4OV9A 2CLOA 3DFPA 2NWRA 2GUUA 2QDGA 3O63A 3TJLA 5AC6A 4QIUA 3GDKA 4BWLC 2ZZ5A 3I7SA 5KITA 3EXTA 2P1FA 2AAMA 3GK0A 2CW6A 2O7QA 4GWEA 4O1CA 2VFIA 1NSJA 3HMJG 5HR6A 2VFFA 3ZR4A 1S3HA 2VFGA 2I1OA 3NVTA 4CCDA 1I2NA 4UNLA 2E5DA 5CKSA 4N4PA 3PVFA 1G6CA 2I9EA 3LRLA 3Q2DA 5D32A 2ZZ7A 3KHJA 5EYWA 3EKLA 3W7KA 5AB3A 4MIMA 1MEHA
chains in the Genus database with same CATH superfamily
3TROA 2VOMA 3GXPA 3P5YA 2OGYA 3GLCA 4GKTA 1CTNA 3VMOA 3RLHA 3JRKA 2WJZA 2VHLA 5IDIA 4U3AA 5EA9A 4E8GA 1HZYA 1K70A 1JPHA 5BXTA 3B0PA 4BK9A 3WQVA 5CJMA 1F3XA 1EC9A 4YMZA 1I9CB 3EWDA 1A53A 4ZOBA 5C6MA 2VJXA 5GNXA 3MP5A 4TV5A 4OWGA 1XIFA 5KETA 2J27A 3HGSA 4IGMA 1KCZA 1JG9A 5HNRA 1XIDA 4QITA 3M0JA 4JZ5A 4FAMA 2E1DA 3LPOA 2ZX6A 4IUGA 5CGTA 3K46A 2W27A 1RD6A 4LRTA 3NA8A 4MWAE 4P7RA 2QV4A 1VFFA 1Z8AA 1MFVA 4L4LA 4GYPC 4JKLA 2WNWA 4OZOA 4M29A 3LOTA 4HN8A 5T9BG 1JUBA 3W6YA 2PGRA 1C92A 2NQ9A 1UWUA 4LUSB 5E5CA 2HBXA 4JTQA 3O07A 4Y2WA 3L4XA 4K36A 1F07A 4PTNA 3F5LA 1H41A 1BTCA 4MY9A 3CUZA 3ABXA 3SECA 2BB0A 4MWAD 4DJED 3HG4A 1J79A 4IQEA 2WNZA 1BWVA 2DSZA 3MBDA 1X6UA 5E6ZA 2FVMA 4GMEA 2IUZA 3TFXA 3IIPA 1Q6QA 2YA1A 4AWTA 2QJHA 3VO0A 2YL5A 1DOSA 4AX6A 1LOLA 4IMAA 2UBPC 4XVDA 1B3XA 3F4DA 4U2ZA 3BVJA 1IEQA 3AXKA 1I75A 3GUWA 3SCWA 3U9IA 4JL2A 3ME3A 4JTTA 1JF5A 4I3GA 1V03A 1XPYA 2WBGA 4GJ1A 1VR6A 1GKPA 1E5NA 2TYSA 4F0MA 3QHNA 4H6QA 3H7UA 4L80A 2QT3A 3BANA 3NG3A 5TNVA 1FWAC 3LNPA 2WM1A 3E0LA 1J2WA 2AQWA 2VZVA 1LWJA 1HJUA 1FBAA 4W5UA 4W84A 3R10A 5LNRA 1U1JA 1HT6A 3ZMRA 1BVZA 4AD2A 4GXWA 3UFYA 1BGAA 3HU7A 4FMVA 3G1YA 1RAKA 4RL3A 1BAGA 1XLLA 4GFSA 4UUIA 3RLVA 1ADDA 5J04A 5I3HA 1NWRA 4WKFA 1XV8A 1EL3A 2DZVA 4Q4PA 3S1UA 4IMEA 4AMCA 2ZRZA 4JXCA 1S5TA 3CPRA 2JE8A 2XVLA 1HJWA 2DH2A 2J7FA 3NDYA 4N9DA 2XTKA 4Z0JA 3FHAA 3N1AA 1HUVA 3N2CA 3SGUA 3FV9A 3CB3A 4NRSA 4MWAC 4LUSA 4W7WA 3W6MA 3ZR6A 3TU9A 1GOIA 1LF1A 3AFBA 3O9NA 2Y8VA 4FXRA 2YBTA 3GXTA 3V5CA 1JNEA 1YDNA 3LCLA 3OLIA 4WY0B 4CCZA 3GH5A 3SCVA 3RIKA 2EPNA 5GNYA 1PKYA 1V6VA 1UR0A 2DEPA 2JQXA 1QPQA 1NDYA 3IVSA 3KVJA 3T55A 2FPTA 3R7MA 2PCEA 4N42A 3C3NA 3I3EA 5DQPA 2A1YA 3TYZA 3JUGA 4KFOA 3CUGA 3IV8A 4AZ7A 1XM3A 5AHLA 3AQUA 3H24A 4QAIA 2W91A 4XO7A 4F2UA 5C0QA 4Q8OA 4QGCA 1H7PA 4HCHA 2GSEA 5HMFA 2WV8A 3VGBA 3W2KA 2DQXA 1D8CA 3C2FA 3H55A 2H3BA 2PZNA 5M1TA 3HZ3A 4H7CA 4GG9A 4B5TA 3VI2A 4S3EA 2WSPA 1E1CB 1GUVA 1FWJC 5D9PA 1UBSA 2RGMA 1LRTA 1VFOA 3G2GA 2UY2A 5IRPA 3G3MA 5HQMA 1CNVA 4LYPA 4JL1A 3SCOA 2JGYA 3KAOA 3S5SA 3LXCA 5C71A 1PYMA 1A4LA 4PBFA 1DWAM 4K1GA 5T91A 4OUEA 1KKRA 2PWHA 2VNCA 4K68A 3NQ7A 3TW6A 4RJEA 1LCOA 4QSFA 3W1LA 3N15A 1U5HA 1QFEA 4I9MA 4YYFA 3TYAA 3PTDA 1ZCOA 2OQHA 3Q58A 3ONBA 5L6UA 2CHOA 2P0IA 4FALA 3VA8A 2Q3RA 3TTYA 4MB3A 2I17A 2BZNA 4WDXA 2XVKA 1S2WA 2AMGA 3LS9A 1NP0A 3PBGA 3AYRA 4CNSA 5CC3A 5FACA 1GONA 2C18A 4C6IA 1UB3A 4WY0A 3WBAA 3N2XA 8XIMA 5EMMA 1GEHA 1V7AA 2ACQA 3SDOA 1GQLA 4TMBA 1ICPA 2NXIA 3WLIA 5DLCA 4C7DA 3LPGA 1QNQA 1GOWA 4PUNA 1JRCA 1B57A 3P61A 4MNKA 1AG1O 3ZS4A 1L8PA 1EHAA 3CUXA 3IARA 4IFRA 3MBFA 3W7DA 2YCLB 3ONCA 3ZJ8A 4HNVA 1SR0A 1MW1A 5T9CE 2JF7A 3H7VA 3S6DA 2XVPA 2EPHA 1EXBA 1SM9A 2V5CA 4IJCA 1DHPA 1E9YB 1E1CA 3ARYA 1BG4A 1EH9A 3F5KA 4MB5A 5C9UA 6ALDA 1LWHA 3M0VA 2RDTA 5CC7A 1KXQA 3MCMA 3BAKA 3O2LA 3DFNA 1ISWA 4AIUA 4A35A 3GAKA 4GI8A 2HE5A 3OLDA 1Q8JA 1WDWA 1UPMB 3EKZA 4LAKA 2X1TA 1R0MA 3GC2A 4S3FA 1CX9A 2YZRA 3EOEA 3QGAC 3N4FA 3B9DA 4LEQA 5LHEA 3TYCA 4FLSA 4IPPA 1H11A 5KZMA 2JKEA 1X1OA 3G8EA 4C1KA 1HX0A 3HPZA 3IPWA 3SCSA 1XJBA 1N2VA 1UPPA 1H0IA 1CXEA 1MW3A 4WXYA 5A2BA 1VHNA 3UBPC 3I3DA 4EANA 3OTRA 4E0CA 3TSBA 3DFQA 1XUZA 1QJWA 4JNYA 3C2RA 2HK0A 1P0EA 3AMLA 4IIGA 1C3FA 2O4QA 4Y96A 2EHHA 3FHQA 2PRHA 4PL2A 1JFXA 3EOLA 1C8QA 4PRTA 3BQ6A 3MWAA 1NWTA 1MEIA 1U5JA 3ZXWA 4OGZA 2XUCA 4O15A 1XYMA 3R8RA 3ZR5A 1OCJA 3ICJA 3T07A 4UTFA 4HMNA 3A4WA 2R91A 5DF0A 3P3BA 1MEWA 2WVTA 3AHZA 2J47A 4NXSA 2R1MA 2PAJA 3LHZA 3CV1A 3E02A 2E9LA 2NV9A 4B90A 3G5EA 2GUBA 1V6TA 1UIOA 4CQBA 4DBUA 4ZOEA 1FDYA 2YCLA 1X6LA 2PWFA 1GPFA 2X42A 5FI8A 3A4JA 1AL7A 3POHA 1RCQA 3BSGA 3VMPA 4C90A 5G4EA 4LJ3A 2FB3A 4JFVA 4OTKA 3OZYA 4LF1A 4D6DA 3G22A 3O0FA 4C6JA 1FHDA 1Q6DA 1BXBA 3ZJKA 4ZCWA 1WB0A 3OQ8A 2ZRWA 3WQDA 3H2AA 2E40A 1J0ZA 3VD7A 2Y63A 4MKSA 3BPWA 3PNUA 3LHTA 2V63A 4HU3A 1QPNA 4LVBA 1GQKA 3MDUA 3LGEA 5FSDC 4DM2A 3M43A 4ZFCA 1JCYA 3TYBA 2QYGA 3MYOA 2QAPA 3GTNA 2IPGA 4ML9A 4MY8A 1A0CA 4ADSA 4LAZA 4MOZA 4DN1A 3QQWA 1EDQA 3AXXA 4P7QA 3RHGA 1JAEA 3AS0A 5T8GA 1DBTA 1IT0A 4DPPA 2O4MA 4I7UA 4ZTXA 4J3XA 5I2UA 1ZL1A 2GYIA 2Q01A 1FHLA 4PYSA 1E70M 2G95A 5FJRA 3QPYA 3DG7A 1LUCB 2O0TA 5D2TA 5CZ0A 1UR1A 2XIJA 3G6LA 2FYMA 3EWCA 1R46A 3UERA 2A6LA 4FX6M 2J66A 4B16A 1E55A 2JFEX 2XDFA 2NUWA 1G69A 4DPQA 4GI6A 4QX4A 4AIOA 4ZL1A 3AO0A 4K39A 4XTDA 4LUTB 1TX2A 1IWAA 5EBAA 3UJFA 3UYCA 2CLLA 3OW1A 3ARQA 4HK5A 4HP5A 2RJHA 1LLWA 5U7SA 3RRXA 2WC7A 1G4TA 3PJTA 1JF6A 4XBJA 5CG0A 4UMAA 3S83A 2DGAA 3A3WA 3FDGA 5D37A 4NNAA 1IIGA 1ONXA 3SAZA 4H9ZA 3ZSTA 4IH3A 2Y7DA 1GQIA 3N6HA 3UQNA 2PZ0A 1OQFA 4NZFA 4AC1X 1CGXA 4BFAA 3THAA 2VEMA 1YNQA 1XC4A 1XSIA 5D2YA 4K2SA 2HISA 3CHEA 2PDIA 3TONA 3MPGA 1O5RA 4TV6A 1XQLA 3ATZA 2C8NA 4R9OA 2DZPA 1XLJA 3AOFA 4B5UA 1QHZA 2W66A 1NY1A 3S5ZA 1DYSA 4DXXA 4US6A 3BOLA 3LCIA 2VGBA 2FZ9A 4Z0SA 4WEVX 2IXUA 1F05A 1R3TA 4NI3A 4FF7A 4HCDA 2EGZA 1Q6GA 1SO6A 3IJLA 4I7WA 4FOUA 1AFSA 1JR1A 1VKFA 3VGEA 1NOWA 2XSXA 4MDOA 3QZAA 1KB3A 1XCFA 3GXFA 3KBMA 1GQNA 3B8SA 1MQQA 3BDKA 3B4YA 4PUUA 1SSDA 1WQ5A 3U2OA 4J1OA 1JAKA 1LUCA 1CXHA 2B4GA 2G3JA 1KD0A 5D2VA 4LCQA 2A21A 1XYFA 1C8YA 4UR8A 4IJRA 1QUMA 2BTMA 1MUWA 1DTUA 1D3HA 4I7VA 3H22A 4ZOAA 1XRVA 3KL0A 4OKDA 4WX2A 3E3HA 3MJMA 5LNSA 3BLEA 3WNKA 2ZUMA 4GPNA 2Y61A 1GG0A 2J13A 3MCOA 4IICA 5FL1A 2Y7FA 4HYRA 3LBCA 1PYFA 1OCBA 2VCBA 4LUTA 1B54A 1OFQA 2ZQ0A 3S46A 4LCRA 3MHGA 3BTNA 3QMSA 2DJLA 2B7QA 1IZCA 4O1FA 1KBKA 1FWNA 3FA5A 1SFTA 1LZOA 4B5WA 1ME8A 3RGTA 1E6XM 4C6DA 3G1AA 3QR3A 2JF6A 4PUWA 2B31A 4PMUA 5DBUA 1L6FA 1PPIA 3GNNA 1TKKA 1BEUA 2PDHA 4TVDA 3O16A 3ZJ7A 2VUYA 1O60A 2GQ3A 3RPTA 4P5UA 4MKNA 2Z29A 1X96A 1Q85A 2VL4A 1R2RA 2F8QA 1NOUA 1RH9A 1A5MC 1J0JA 2EF9A 2XZ9A 1TR9A 4TOQA 5MHBA 2QUUA 3QQ0A 4ZEPA 5DXXA 2Q3OA 4GUHA 3CB8A 2VX4A 5BMXA 2FGLA 3LMYA 3RYSA 3NSNA 3T0DA 2X09A 2ZBTA 2V3GA 3OIHA 4FB7A 5D9OA 3AMGA 3OBAA 2HZGA 2VZOA 4MNJA 3G0UA 2DT2A 5A6SA 1I1WA 1XLCA 5ENLA 2BGQA 4JTUA 2I14A 3VKBA 4IXXA 1IZJA 2FQIA 3UWEA 2YFNA 1AQMA 4XKMA 4I8YA 4EE9A 2AL1A 2R1NA 3WLTA 2ZE0A 2PDUA 4LH8A 3EGJA 3CQHA 2ATMA 1TSIA 2NSXA 3FVMA 3MV11 1K6WA 4CNOA 4XZMX 3NXLA 1AD4A 4NSBA 4X3ZA 2BLEA 1LLOA 1AA1B 3WNMA 2QCNA 1BVWA 1JPKA 3GD6A 3CK5A 4ICMA 4AD0A 3OP2A 4A8LA 4HK6A 1DJZA 4HMCA 1BWLA 4IL2A 3B0UX 4ADUA 2AKZA 3DH7A 3OGRA 1MMFA 3NAVA 4O0ZA 4GCAA 3E0VA 4IIBA 4ZXOA 4QQUA 5LIXX 4AWEA 4PTXA 1LOSA 3SO7A 3R89A 1Z69A 4WZHA 3TR2A 5BU6A 1TO3A 1YIXA 2QUVA 3W22A 1JPDX 2BGSA 1K9EA 3BLIA 4QHRA 4CEUC 3VOJA 3A22A 3E5PA 2WO5A 1RK5A 1VYSX 3PM6A 2DIEA 1KTBA 1M9HA 3I7RA 2CLMA 2BY0A 4NU7A 3XINA 3RCYA 4N0RA 3UJSA 3UZZA 4YVPA 1UWTA 1XS2A 3K8LA 3RR4A 4US5A 5DMNA 1EA0A 3WENA 1Y5WA 5L9FA 3BGJA 3M0ZA 3R43A 1LG2A 1UASA 3W1XA 3ABOA 1Y8BA 3D5HA 3IJ9A 3AXMA 4F0RA 1EX1A 1LQ2A 1W1PA 1G5AA 3OA3A 3W1PA 3KRZA 1ALDA 4TXEA 4K7YA 1B5TA 3VKAA 3H8AA 4R3UA 3P0XA 1D3CA 2FFCA 3OJGA 3KOWA 1ZGDA 1BKHA 3SJ3A 4H1ZA 1AMYA 2GVYA 1UJPA 2GJPA 3HG5A 4X0VA 2VQUA 4EOUA 4DUWA 4B5NA 4YTQA 1FCVA 2FZDA 2WZHA 4M56A 4DJFA 2FH8A 4FOKA 2AKMA 5I3IA 3VOFA 3CT2A 1I8JA 1YYAA 5DRIA 2NXHA 3EB2A 2CYGA 3Q45A 3IJDA 1DQXA 3G1VA 3HV9A 3VIMA 3QQ1A 1H0GA 4NY2A 3W29A 1VJZA 3O7UA 1A5BA 3WMBA 1O1ZA 2VO5A 1B9ZA 4L4MA 1T8XA 4A21A 1M41A 2XZ7A 2GFTA 2EJAA 1DXIA 1TREA 5IDZA 1G1YA 3HN3A 1IXQA 4FA3A 4MKVA 2VR5A 4Y8FA 4AG0A 3WL1A 2HCVA 4X60A 4U5IA 4QCFA 1XIIA 3CIXA 2YKKA 1QI2A 1W5NA 3C86A 1F61A 2QS8A 1PS9A 2VELA 4DNMA 5LNVA 1ZBWA 3KM8A 4ZFMA 1KTNA 1RXOB 1JD7A 3B8UA 1M68A 3ENLA 1PHWA 3O1NA 5HWNA 4YNGA 3W6LA 3H12A 4J9JA 5TIMA 4PFMA 5EPDA 2WNQA 3ZLFA 3WQWA 1LP6A 3QV7A 4US5D 4IF2A 1XYBA 5C5YA 3VD5A 2E8ZA 1UUMA 3GFXA 2REQB 1G4SA 4O1DA 4DF1A 4GH3A 4NJGA 3U4FA 2CWNA 1JPIA 2GOUA 5CZTA 2QPSA 4XD3A 2W0UA 2GJXB 3ES7A 3GNDA 4HCLA 1MWOA 3UR2A 1VB9A 3G1RA 2DORA 4JICA 1OYAA 2VP8A 5H8PA 4EIVA 1CXLA 1C93A 4DJFD 3WF4A 3MHUA 3G18A 3EOUA 3CQKA 4GH1A 3AHYA 4J4KA 5FF2A 4GZJA 1CEOA 1QPRA 3WMSA 4ZGYA 1KWGA 1VENA 4RZ6A 2D2HA 2WKLA 5EMLA 4S39A 1KRCC 3SR7A 3IS4A 3NL5A 4QJ3B 5CGMA 3W7CA 3SUWA 3EA1A 4OJYA 2PD9A 3NYDA 4B2DA 4CQ8A 4W86A 1ISZA 2VEIA 1ZZMA 3GWQA 4A3HA 2YL9A 3CNYA 2A3CA 3RFAA 3HOJA 4WDWA 1ITCA 3R1ZA 1XXXA 4NL1A 4O1BA 3C8FA 4GIAA 2X05A 1U1UA 4HJWA 3WLMA 5EBUA 1RJPA 3K5XA 3UXAA 3GFYA 3CZ8A 4H9XA 4A29A 4AY8A 2BY2A 4JIRA 4F8XA 1W37A 4ZMGA 2KX9A 3ARZA 2DZUA 3CHCA 2WLZA 4MLJA 4JYFA 1R5YA 2VMFA 2XN1A 3OIXA 4J3TA 3WLPA 1JZ7A 4GNJA 4RLIA 3VNKA 4L6DA 3KWSA 3NZQA 1O95A 3K4AA 3QY8A 2ZWYA 2CLHA 1EYEA 4XD4A 2REQA 4HNUA 1EZWA 4HMDA 3ZT7A 4W87A 1KTCA 1PKNA 1ZHAA 4S3GA 1ML1A 1RSCA 2NSOA 4YTTA 3QZ6A 4HNNA 3KFTA 3TYDA 2GJXA 4JY9A 1UD3A 1X98A 2E8YA 1ZBVA 4DI9A 3N13A 1A47A 3TAKA 5GNZA 3MUY1 4DJFC 4ALDA 5I3KA 3CZLA 1JD9A 1A50A 3GIYA 3MC5A 3TCEA 3FYYA 2WC3A 2G0WA 1CBGA 1H1YA 1SFLA 2E6YA 2HTMA 3OZPA 4FHAA 4AEFA 5A2AA 3W75A 2D22A 1H1NA 2XIOA 1YKWA 4RW3A 4AHOA 1TPWA 2OYMA 2ZVIA 2GJLA 2DJXA 1GG1A 4KWUA 5KSWA 3KEHA 1ELSA 1CIUA 1QATA 1V77A 2HK1A 1VBUA 1I45A 3GG0A 4L1WA 3M0MA 5LGXA 2OLAA 4ERAA 3VCNA 4K38A 4E2OA 2BODX 4Z42C 3CAKA 4KERA 4W7VA 1XYZA 2W9MA 4B2DD 3H21A 1FP8A 2W92A 4XAFA 1ZRQA 1F73A 4YXGA 2VTFA 3DGRA 1XCWA 3F03K 4AVFA 1SZFA 3W0KA 1K8YA 1FY6A 3PPGA 2WSYA 5CC6A 5F7UA 3N4AA 2ZUVA 2Z6IA 1KA9F 3AS2A 3V35A 4HD5A 3LD5A 2Q6ZA 4PUDA 3ARPA 4W88A 4FEZA 4IIFA 3WO8A 4FX7A 3TEVA 1OABA 3VD4A 1ENUA 4F0SA 3S1GA 2FZNA 3NM1A 3BAJA 1Q13A 2J75A 4LTSA 1T6MA 2IKHA 4U4MA 2A7PA 2ZUSA 4NRRA 2B7PA 2D20A 4AD1A 4DYJA 3PANA 1W9XA 3CPUA 4TO8A 2D23A 3GXNA 1QW9A 4YWIA 1EP2A 1X6NA 4GNVA 3OQEA 2Y1HA 1C7SA 5AZ1A 1GORA 4ENLA 1IHIA 1ZCCA 5CPMA 1GZ1A 3GZ3A 2WC4A 4Q8WA 1DP0A 3O05A 3E96A 4H9UA 3M47A 2F2HA 2PBGA 4UQBA 1QPOA 3GR7A 4GI9A 1F8MA 4HZMA 2WSQA 4NJJA 3NR0A 4MYXA 1A5LC 3WEZA 4M8UA 4TTUA 1AZ1A 2HXUA 2F6KA 1BF2A 2RDWA 1DORA 4E2DA 3DN5A 4XWUA 1XGEA 3UJRA 1HNYA 1WDQA 4LS0A 6TAAA 1YPFA 2BY3A 2YYUA 3NZGA 5BWFA 2WXDM 3TAOA 1TUXA 4JTSA 2PWVA 2BOEX 1UKPA 4ZQCA 3DCPA 1QOQA 4H9VA 4ZBCA 2C19A 4OT7A 1XKYA 2E6FA 1LOQA 4LAOA 1QHOA 4TX8A 1UMLA 7CGTA 3APGA 1VEPA 2GVEA 3B8VA 1XDMA 5BRPA 4RR4A 2RUSA 2YZ5A 4DZHA 1JZ6A 5CSRA 3LHVA 4DAIA 1XINA 4HOZA 1VCFA 3BLPX 3EX4A 3DYMA 1X97A 3UD6A 4C6CA 2J7EA 1TMQA 1R86A 4GQRA 3NQAA 1MQRA 3MANA 2DH3A 1X38A 5G2WA 4DJDA 3RLGA 2XYLA 2VVNA 1V3HA 2WOQA 4O28A 2GVJA 1PX3A 1EGMA 1OWQA 4TUFA 4AZCB 1IXNA 5K4XA 1L6YA 1R47A 4AVOA 2XIBA 2BASA 3NO1A 3SN1A 1TV5A 1QTWA 1YLVA 3OGVA 4JYEA 4A3QA 5BXRA 4UFLA 1A3HA 4JIEA 3TOPA 1J9YA 4JEQA 2ATSA 3PZOA 2WQDA 2ALDA 2QDHA 1JZ4A 3UPWA 2WZMA 4FOJA 4FLOA 1E3ZA 2C6QA 4L6HA 1W5OA 3SCNA 4CCEA 5PTDA 2NWRA 3OYXA 1W1IE 3DHUA 3O63A 3TJLA 2VZUA 4WIWA 1S5MA 3GDKA 3KLLA 1TVPA 1FWDC 5KITA 2A3EA 2J6VA 4O1CA 3TYEA 3FW6A 4PMQA 1TZ9A 2VFFA 5A6LA 4K8GA 3PVFA 3WQGA 2I9EA 2O55A 1R3WA 3ISIX 4KESA 4RPPA 5CAHA 1IEVA 1WDPA 3V3WA 4PZVA 3R8GA 1MFUA 3UPMA 3GHRA 3LHWA 1TMLA 4XG1A 1UOKA 1XCXA 1G7VA 1BTMA 4H8UA 3KS6A 1E73M 3LB0A 2FGZA 2B7OA 2DPEA 2BBFA 4XIMA 1QVBA 3RITA 1ITXA 1EDTA 4ZOCA 2YB1A 3NQCA 2G97A 3GVVA 1MRAA 1JJKA 4RZBA 5KINA 1V3MA 2ACSA 1RALA 1DJQA 1E6ZA 3QH2A 4IMFA 1TV8A 4DJDD 3MKCA 5A6BA 2CFFA 2DT0A 4UFKA 3FJ4A 4FLQA 3CQ0A 1Q5MA 3SQSA 4RE4A 4AZCA 3IV3A 4DBSA 5I7GA 3R58A 3MV01 4DWSC 1BXNA 2FMOA 5DT5A 3TUUA 4O54A 1POKA 1RD5A 2AL2B 4UC5A 4UQCA 3FS2A 2PDQA 4DUOA 1XSJA 3W02A 3VKDA 2ISDA 2ZZ6A 5G1TA 5A3HA 1KLYA 1E6RA 4RUBA 1ONEA 3B9OA 1JCXA 6A3HA 3T0CA 4O57A 3WD0A 3AC0A 3BK0A 3F1QA 3QM3A 2CWXA 3BJSA 4I6KA 1B9BA 4Y7EA 1AD1A 1FX6A 3MUXA 3K8MA 4Q7IA 2HMCA 3LX9A 1Q45A 3QEZA 1CLVA 4UR7A 2ZUTA 3GDTA 1R3SA 1TTPA 2YDQA 5KEZA 4FIRA 3HG2A 4UQ9A 5JXQA 1DIDA 7TIMA 3FJLA 5I02A 3C0JA 1ZENA 4KGLA 4DBEA 1W8SA 2QUNA 3ID7A 5FSEC 4JQ1A 4FNRA 2J7DA 5CBBA 4ICNA 5CBIA 3D0CA 3N2MA 3U2CA 4QG9A 2Y85A 2B0MA 2QNEA 3LNMA 5D38A 1Y7VA 3VDHA 1VFMA 3PN8A 1FWRA 5JIPA 3F2DA 3GW0A 5AY7A 4Z2IA 3OYZA 4I8DA 4DXVA 5A6KA 2J7HA 4ZODA 3W88A 4H8VA 1WXZA 4XV0A 4ATWA 3DENA 3GHTA 1G0CA 3DC8A 5A6BD 4C60A 4X61A 1TR1A 1WDSA 1PL9A 1JVNA 4Y8EA 1EWEA 6XIAA 3RM8A 3TNOA 4MJZA 4AWSA 4XZHA 4FP1A 2GK1B 4F0KA 1W9DM 1UC4A 2E25A 3EOOA 3VVGA 6ENLA 5A6AA 3GNXA 4G2DA 5JUVA 3WUEA 5HR7A 1PZ0A 4UB9A 1E6SM 3O6YX 4LWWA 5JBEA 2E7FA 5DMYA 2XGBA 2NVCA 2AL2A 4HNLA 4IMCA 4PMJA 2WSRA 3PR2A 4Q4KA 4LS2A 3QF0A 4E2VA 3ZLGA 4QNEA 1T8QA 1JI2A 3NNTA 3CO8A 1BGGA 3QSRA 4Q4RA 8A3HA 1P43A 2FFIA 1DXEA 4AQLA 3GDMA 4PSPA 4F4RA 4N6EA 3T8LA 1JZ5A 4QISA 4O11A 3EYPA 4FF5A 2ZICA 4N9EA 3VK5A 2DU2A 4OIFA 2ZTKA 3W7IA 5HBFA 4BWLA 1TVLA 3ITGA 3KP1A 1V7YA 2NQLA 2IQ0A 4AY1A 1OX5A 4M3PA 3JZUA 1R9XA 4PMZA 4DO6A 4AZ5A 3PP7A 1ZP4A 3LBMA 2TPSA 2YOCA 3NQ6A 1XYAA 4MFDA 1GYNA 4DB7A 1EUNA 1QNSA 1I2QA 1F4AA 2ACUA 2GQAA 1OZMA 4U3CA 4V2XA 2DT1A 3FA4A 2PLMA 1L2QA 1VC4A 2R1PA 4FLRA 3R0UA 1FWBC 4D6EA 4LEFA 1UD2A 5LA1A 3D6NA 4JAWA 5LZLA 5I06A 4GINA 3F4CA 5CLWA 2OKOA 4HYWA 3WN6A 2QJIA 3WUBA 3AS1A 2Y62A 2P0OA 3WDHA 4IJBA 3LXAA 3OZMA 3C6CA 3SCTA 1ZBCA 2CPUA 1KC7A 3B8DA 3P67A 2V3DA 1CENA 1H50A 4MF4A 3RX2A 2ZE3A 3KXQA 5BOEA 1W5QA 3FYPA 1WOAA 5REQB 3ZWTA 2BVYA 2HNHA 3QMTA 4EAMA 3TQVA 3WLRA 1PDZA 3RX3A 4NX0A 3UZXA 4DYEA 3C5QA 5J5RA 1J0IA 2O92A 4GK8A 1XFBA 4AIEA 3PJWA 1R30A 5BROA 1ZJBA 1P6BA 3EWYA 2GK1A 3PC0A 4BCEA 4V28A 4HSOA 3MUZ1 4QEEA 4PEKA 3ZFHA 5XIMA 3JU2A 2VC7A 5FF0A 4ZTYA 1IXPA 3V36A 5KTLA 1AVAA 2VI0A 1JQVA 3W25A 1NELA 3SBFA 1VH7A 1YPXA 5HAOA 2OWCA 4ERIA 3W85A 3R25A 2CC0A 4Q7NA 1BYAA 4H9YA 4KCVA 4O4WA 3ALGA 2RH9A 3GBDA 3ZT6A 5HUOA 2A3LA 2CLEA 1F8IA 5I6SA 5M5DA 3LQGA 3KVMA 1SJBA 2C79A 4MHBA 3LYEA 3PBUA 4Q4SA 3KBVA 4CD8A 1K77A 4C6NA 3M0IA 5J5DA 3HF3A 4MFEA 5K9CA 4IM4A 4JOMA 1AQFA 2Y4SA 2P5NA 1AH4A 1XWYA 5FKYA 3MO7A 3PJXA 1ZJIA 4DX3A 1B31A 4JCLA 1N82A 3VZXA 4JTHA 1FWEC 1ZJAA 2NUXA 3VNIA 4MDPA 3TOYA 1AH0A 4AX7A 4KBXA 5CZKA 1VLIA 1DQUA 2Y5JA 4YCOA 1ZU8A 5IBXA 3VNZA 1EJVC 3TW9A 3NQVA 4OBTA 4OU1A 5FF3A 3KBWA 3B9EA 3DU0A 4PUEA 4O12A 1VBHA 3UWVA 2GDVA 1ISXA 1CCWB 3L12A 4MPKA 3UZ5A 3URQA 2WVVB 3EA2A 3QGVA 1QWKA 3LY0A 2GL5A 1CDGA 1SSGA 3GFZA 2E3ZA 1KRBC 4YLWA 3S6OA 1OIMA 3DHPA 3T78A 3DHFA 2DVTA 3TDFA 4ILSA 3H2NA 5HMSA 2YL6A 2J6XA 5REQA 3GH7A 1I2OA 3BGAA 4IFOA 4FNTA 1IE7C 3AXHA 2FZ8A 2HRWA 4D8LA 3OVRA 3SJNA 3UG3A 1KCXA 4JNZA 3UA4A 4UTTC 1NVMA 1CXFA 1QI4A 3TWBA 1FDJA 3N2OA 4JIHA 1EUAA 3IGHX 4QCEA 4HU0A 3SFWA 5DCEA 3W2NA 3ABRA 3T7VA 1AH3A 3I4EA 2ZRYA 4DF0A 5LIUX 1ZJHA 4B5SA 2I5QA 4E8DA 4LXFA 3FKKA 3GU1A 4OOUA 2XFRA 2BNJA 4N4QA 1NDVA 1E72M 4YHGA 5E0KA 3AHXA 3WQCA 4KWSA 1XBYA 3D47A 3P2VA 4GC3A 4UOJA 2PD5A 4A8NA 5I3DA 3MO4A 2EG6A 3LCFA 3P8JA 4LB4A 2GDUA 2V67A 4KQNA 1DPMA 3GXMA 3WQOA 4WOZA 5FJOA 1V02A 2OX4A 1V6WA 1T99A 3NEVA 1C91A 1GJPA 2VQTA 3W4RA 5DO8A 3DC0A 4W4QA 3R8HA 2CIPA 3CHFA 2ZTJA 3DI0A 4BF5A 3AHTA 1O6IA 4URIA 2BVDA 3PWGA 2Y0FA 2FTPA 2XFYA 5LSMA 5HNTA 5B80A 4L65A 4L1GA 2CKSA 2RAGA 3ABSA 2X0SA 1TZZA 3CL6A 5CH9A 3RLUA 2DW6A 9XIAA 4DEFA 4DAFA 1EJXC 1B1YA 1OM0A 1PKMA 2WVVA 4K1WA 2DDXA 3CYJA 1GVOA 1WE5A 3RNDA 3W7NA 3KWXA 4FNQA 3P5ZA 4HBKA 1J6OA 1JGMA 1W0MA 4GJJA 3L0NA 3TTOA 2WCSA 1SJAA 4XTIA 3P62A 4NX5A 4PB4A 2PDJA 2XU2A 3SCPA 2IKIA 2WPBA 1HO4A 4J35A 1PCKA 1XLHA 2VEGA 4HGXA 4P8UA 3MMUA 3QPEA 1ZAHA 3PZTA 3L4UA 3REQB 2RHGA 1C8VA 4L9YA 1IXOA 4J27A 4FXFA 2PTZA 1W1ZA 1EF3A 2HS6A 2QCMA 3TVAA 1PTAA 1N7KA 3OOQA 4JTLA 4QNWA 1PWMA 3S0CA 1J5SA 1SO5A 2E68A 3W2UA 3K1GA 3LPPA 3FOKA 3CMFA 3ZVIA 4FNUA 1AK5A 5IHSA 2H8XA 1SZNA 4M19A 2WMIA 2DT3A 3N9KA 4J7RA 1UZ1A 4GJIA 4MADA 5JBFA 1UKQA 1E9ZB 2VGIA 4Q8PA 3AALA 2ISWA 2P3ZA 4MSSA 4UR9A 5JU6A 3K4WA 4I90A 2OZ3A 4IMGA 1M7JA 1KFJA 5I5RA 3SADA 2GSJA 5A94A 2VEFA 3VD3A 3ABZA 3KRSA 2QJNA 5LXXA 3VZZA 1IEIA 2BG5A 2G41A 2ZDRA 3PAJA 3PS7A 4WKHA 3GVWA 1TPFA 2G37A 4QS6A 1XBVA 3W7RA 1TJPA 4GFIA 4IIEA 1HVQA 1QU4A 1WA3A 5F4SA 1MI3A 3O6CA 3L4ZA 3VIIA 3N19B 4BHYA 4PBGA 1AW1A 3LCGA 3I65A 5HOSA 3W24A 3UNTA 1OBAA 5JH2A 5CPTA 3T8QA 5DT7A 2WMGA 2PDYA 4HYVA 1H63A 3QBUA 1RA0A 3EWUA 1CGTA 5AYIA 1I0BA 2C1GA 1W9BM 3FFSA 3LA4A 4NAFB 7PTDA 1EEXA 3CEPA 5FF4A 3U48A 3IGSA 2PURA 4F2TA 3REQA 3PG8A 1ZAIA 3WFLA 2ZRXA 3M0LA 2RKXA 1E4LA 4L1XA 5EGRA 2ZUWA 3WCZA 3W53A 4JKKA 2VR4A 4G6CA 4RV3A 2WJDA 5BW6A 4PA8A 3UCQA 4S3CA 4LYQA 3WD3A 4OOZA 3TJ4A 3F7JA 3DECA 2VGFA 1M53A 1Y5XA 3K4DA 1DIOA 3VMNA 1GQJA 3FY1A 2D1ZA 4KCTA 2ZZ4A 3RX4A 3PSVA 2CBVA 3OU8A 1K8ZA 3FEQA 4ZVJA 2GQ9A 1ZB5A 1V0LA 3T44A 3OG2A 3TWAA 3W7JA 4UTWC 4O1EA 4PUKA 1OGGA 3GC5A 1DL3A 3T09A 1OYBA 3M9YA 1W91A 1JUEA 3VILA 5BWAA 2NT1A 4PMDA 4A05A 3M0YA 4P7LA 1H7OA 3GZAA 3GRIA 3NYZA 3RPDA 1E4IA 1LBLA 3TW7A 4HPJA 3HV8A 3KVLA 4W8AA 2BHUA 3AIBA 3AROA 4LCSA 2GSHA 5DFAA 3IK2A 3AMKA 1L0PA 1Q7MA 1GOMA 1US3A 4O8RA 5DY2A 1OB0A 3MI6A 3F4WA 4L9ZA 3LLFA 4FNSA 2XH4A 4DO4A 2J8TA 3QW4B 3DHDA 1O5KA 3SFKA 3V7PA 1WCGA 1HP5A 1UKSA 3STPA 1W2PA 3A9IA 5HA7A 2VFDA 2VEKA 5D04C 3GTXA 4GGBA 4AYGA 5BRQA 1XLKA 4BZYA 3W38A 4IXHA 2XM2A 1TPDA 2AQOA 3N25A 3WQ5A 3CZJA 2Y7GA 3VD9A 3KL5A 3EPNA 5FOOA 1WUFA 4NAFA 3RM9A 4FXJA 2E4TA 3JS3A 4DY1A 1VBGA 3NZ1A 3L4VA 2X8RA 2WKJA 1ZUAX 3CIWA 1AJZA 1QW7A 3WMLA 1O7AA 4AXKA 1Z48A 1QNPA 3E0WA 1N8IA 2MUCA 1TV4A 5BYWA 4ROQA 3NFUA 4BS0A 1P48A 4HVXA 1EYWA 1W3NA 1T0OA 3U5UA 3ANYA 2B81A 4U10A 2PODA 3O3RA 1UA3A 4O18A 4H9MA 4BI7A 1HJQA 1GK8A 1UZ4A 1S38A 5TBOA 4QLJA 3TA9A 9CGTA 4M6PA 4XKYB 2PSNA 3GUGA 3IJQA 3OODA 1VIZA 3NUKA 3V75A 4AAJA 5ECUA 2EPMX 3R13A 3KLKA 4WQ6A 4CKQA 3DYPA 2E6AA 4QJ5B 4HA3A 4W8LA 3H23A 1GVRA 3W7PA 1NP2A 4M81A 3UJ2A 1QNOA 4JQ4A 2XIIA 4LVFA 4LC8A 3MSRA 1WZMA 1HG3A 4M1RA 3LTPA 4RNHA 2CU0A 1ECEA 4WCJA 1Q6OA 3L67A 3H2OA 3OLGA 5AVNA 4V27A 5I23A 5F4WA 4AEOA 1DWFM 3R11A 4PMXA 1SMAA 4D6IA 4TVCA 1P4CA 3GE7A 2PLJA 3FGCB 3TN5A 1L6SA 1EJRC 3TN3A 5AC7A 3EXRA 2R9RA 3NIYA 1V5XA 3GTFA 4MMWA 3W7OA 4CQ9A 2F61A 1BG9A 1XIBA 5TF0A 2D2OA 1NEYA 5CJNA 4CU8A 3A5FA 1F76A 3PFMA 1X39A 4KMQA 4HK7A 3CLWA 1XPGA 3IANA 3FAXA 5FJJA 2ZWZA 3BAYA 1GOXA 1JYXA 4YHEA 2WANA 3C8NA 1FWGC 1VPQA 1QOXA 1US0A 4FSAA 1BYCA 4C6FA 2X1IA 3QW3A 3QV9A 3ZM8A 1FA2A 3NQBA 4R88A 1EHNA 5CPNA 1CGWA 3OEXA 5I03A 3LMZA 4B91A 1XRFA 3EWBX 4YWSA 1A5CA 1OEPA 3DFOA 1E15A 2RFGA 4PCFA 3RR1A 3URNA 4DWDA 3BW4A 4R34A 4C6BA 4XSLA 3CWHA 3ITCA 4RX0A 1PBGA 4BJHA 2PDLA 3EKGA 1R3RA 3MQTA 4XKYA 3UA3A 4M24A 3UG5A 2GOKA 4UFHA 4AVNA 3PF3A 4DHGA 4XD6A 1UKTA 2Z28A 1GJUA 2WKGA 1QT1A 4IIDA 4PCTA 3VKCA 5F2LA 1AUSL 2C14A 4Q4QA 3IWPA 1LQAA 3TTQA 4ERGA 4IPIA 1OYCA 4C6LA 4Z2LA 1UZHA 3BV7A 1R87A 2BGNE 2OOFA 2QCCA 3LLXA 4IGNA 2WSKA 3TSMA 3I3BA 3KHDA 1F74A 4NT0A 5GJNA 2YJQA 4PTMA 5IM51 4GACA 2OQLA 1L9WA 4UZSA 1F3WA 2QMJA 5C7VA 3FGCA 2EKGA 3OBKA 3GNPA 4KF1A 4J3ZA 3BW3A 4BY3A 2IQTA 3T40A 1LL7A 1A0EA 1GOOA 3AIEA 2EPLX 3A47A 3VNLA 1VIWA 3TCSA 2FHCA 3Q67A 4ORIA 1V6YA 5K9DA 4YVXA 1C29A 3PZVA 3WQFA 7REQB 1ICQA 4QJ4B 1V6XA 4MNLA 1MUCA 1QPKA 4QE4A 3T9PA 3FDKA 4UTMA 3U3HA 1WXJA 4Y9AA 4A3YA 3S9ZA 2DIJA 1WZLA 2FHFA 3UY7A 4HHHA 2YPIA 1E4NA 3BH4A 3CM4A 4O10A 1TX0A 2W79A 5CSUA 4I9JA 1JZ3A 5A8NA 1DJNA 3NM3A 2GUYA 3HG3A 3QOMA 3VIJA 4XK2A 3WDQA 1AQHA 5AYXA 1IGWA 1A3WA 2NVDA 3WF1A 4KWWA 3PWIA 4Z2GA 3CL8A 7ENLA 4UZUA 2V8ZA 4U2YA 2H8ZA 3OBEA 1KW1A 3BJTA 5BU9A 1P5BA 3LHYA 2YLLA 2ZYFA 1PZ2A 3GTHA 1GEQA 2V5JA 4PL1A 3LBOA 4PMNA 1K3UA 3GR4A 1UR8A 2X0YA 5HATA 4AMAA 5GVJA 3NSXA 2PF8A 3N6JA 1B4EA 2PTYA 5AC4A 3BUVA 1HFBA 4WJ8A 3APYA 3WLJA 1C90A 1AW5A 1F7BA 3WEOA 2G3IA 2JALA 5EB8A 3II1A 4NJKA 3S5NA 4DF2A 2XFWA 3VE7A 4HU8A 2J8FA 1M5WA 2ZXDA 3O0KA 3UZWA 4GY0A 3VXGA 3L0KA 3IGUA 2AAAA 3V0SA 3IGXA 3M5XA 4S23A 3T1GA 2ZFAA 4UWMA 3KZPA 1L6WA 3DDMA 1UP0A 5EMUA 2UV8G 1QK2A 2NLIA 3UEQA 3BAXA 4MPQA 4NYYA 3TKFA 1XYLA 3WNOA 3STGA 3A4XA 3NEHA 4HNCA 5GJMA 1BLIA 7REQA 1H5VA 1QDSA 1PB0A 2O9PA 3T2OA 1BXCA 1ZBKA 3KOYA 3QR1A 3GSMA 2WLYA 2IKGA 3B03A 3BMXA 4DJEC 1H7RA 3POCA 2NQJA 4AISA 1ZTVA 1MYRA 2BVTA 1TPEA 3CV7A 1LYXA 2INEA 2GGEA 3FLUA 4YL2A 4XUGA 2OLHA 5FL0A 1VRXA 3E0IA 4JFUA 4GQ0A 2FHBA 5K7JA 4HHMA 4ES4A 3NQFA 3EPMA 2OU4A 4NQ1A 3ITXA 2J25A 1GTHA 2OVLA 1NARA 1S5WA 3QTPA 4ACZB 4GUFA 1O1HA 4QLKA 3PFRA 3UF9A 5LGZA 1GOQA 3GKFA 4D6GA 1W6TA 3UCDA 3KOXA 3RJYA 1X1NA 2HDJA 3LK6A 3S8HA 3CZEA 2AQVA 1V4YA 2Z7GA 3AUJA 1HL9A 3SW6A 5DCBA 1YXCA 1LORA 1D8WA 4C6EA 4CUCA 1Y5VA 3E12A 4UTLA 4KPLA 2VM8A 3UNDA 1TTIA 4PE8A 4NJHA 2WJEA 3FXGA 3CTLA 5ABTA 3S47A 3MHFA 8RUCA 1KBJA 2I56A 3H2EA 4JTCA 2BP1A 1H62A 3W7HA 1KM6A 3TLQA 1Q6CA 3R12A 1YMYA 3W72A 4QEHA 1J6PA 3KE0A 4UTKA 1IR2A 2Z25A 4LF2A 5CQ1A 1TIMA 2XINA 2YBVA 4Q32A 3E2QA 3DOPA 3APTA 1XLAA 3OO2A 2QDDA 2FB2A 2P8CA 1EOKA 4MYAA 3UP8A 1E43A 3FSUA 4GLEA 2W6RA 5AHIA 2Y5EA 2XFFA 1ODUA 1ZALA 3VNJA 1E4MM 4TVUA 1W3TA 4D6HA 5KZEA 2D3NA 1FCQA 1F6KA 3N29A 3F2CA 2F9RA 4RDYA 3KX6A 3MVIA 3SGGA 2VUNA 4F79A 1XHGA 4ZXLA 1ISVA 3EEGA 1XLEA 2V5DA 3UWQA 5A6JA 4O16A 2J9XA 1GVSA 1EO7A 1P0DA 5D8ZA 2I5GA 3NGJA 4OE7A 2BMBA 3CJPA 1Y65A 3B9AA 4GHRA 1G94A 4AIBA 4ACZA 3HQOA 1SMDA 4QP0A 3VGGA 1I2RA 2E6DA 2ZX9A 5EU9A 3UWYA 4F9JA 3NPUA 1W9UA 4OFCA 4K8EA 3PPHA 1IV8A 3A13A 1HF6A 4KEMA 3TIMA 1RP9A 1D9EA 3SCUA 1WP6A 4PC8A 4WY0F 5AKQA 1DE5A 4PCSA 4IP5A 3NJ3A 3V0TA 4GIEA 3E49A 3CQIA 5JH1A 4XBSA 3IIXA 1UYQA 4R85A 2BV9A 1CXKA 2PFHA 1TA3B 2QKFA 3DFYA 3MP3A 3B8WA 2J9YA 4MG4A 5AC5A 3FA3A 4LYRA 3A3HA 1IR1A 2C0AA 1HJVA 5EMYA 5ECVA 2HPMA 1ICSA 1MZRA 3WH6A 1VD6A 4S3KA 2P8BA 1AQ0A 4XBKA 3K2GA 1XQKA 2A85A 1E0UA 2PWUA 3B0XA 3M16A 3HA1A 1XR2A 1XF0A 3K8KA 4ZO9A 2PCQA 5FJUA 4MAZA 3LZ5A 4NZ4A 2ANUA 1OD8A 2GQ8A 3ARVA 1UIPA 3RO8A 2CLOA 1W9PA 3DFPA 3SRDA 2GUUA 3CGTA 3PTKA 4EKJA 5FJPA 1P6WA 3R0KA 3PZMA 3EXTA 4J40A 2YCIX 2P1FA 1UWSA 4WDTA 3T4WA 2CW6A 2O7QA 3OHMB 4E6MA 1NSJA 3ZR4A 2JEQA 1Z6KA 4CCDA 1GVIA 1I2NA 4UNLA 3W37A 4N4PA 4C6MA 2DIKA 4QROA 1G6CA 5D32A 2ZZ7A 4YJ5A 3KHJA 2FVLA 1T41A 4B3ZA 1YQ2A 3R4IA 5AB3A 4GO9A 2DSVA 1BRLB 3QV6A 1XBXA 4LALA 3CV2A 3LCHA 1VJSA 5FEXA 2ON3A 1XIMA 3N11A 1J01A 1THFD 1UW9A 4JIIX 4LPCA 1QWGA 1O12A 1NF7A 4C7GA 3UVAA 1TWSA 2X41A 3UU0A 1RHCA 5G1MA 1ITQA 5BNKA 4YN5A 3B05A 3SGZA 4LYKA 4S3JA 1J4EA 3U7BA 5LIKX 1OADA 1PIGA 1JL8A 4XSMA 3A6OA 1OX4B 1UKOA 5DN1A 4AD4A 3UGVA 3GDBA 3WSUA 4M82A 1TA3A 3VUSA 4AYSA 3PULA 4UMBA 4PULA 3O6AA 2QCGA 3FN9A 1TPC1 5ABGA 1EP3A 2WHMA 4KFNA 2F38A 1OT2A 3E74A 3EB4A 5A2CA 3U0HA 1OK4A 2HPIA 4LOCA 3P74A 3VPLA 3BGGA 2QHAA 4FIQA 3M4HA 4REQB 2Z26A 3G0XA 3UWWA 4RPQA 4Z1DA 2WAGA 3PPCA 2QIIA 3WNNA 3DESA 3TNBA 5F2MA 1KQYA 1DJHA 1A5AA 4K37A 2OZ0A 3U4AA 2PGFA 1M04A 2PDMA 3LHUA 2E09A 2NUYA 2Z1WA 1X8FA 1JQXA 2XSAA 4QDPA 3HFTA 3E0FA 3CUIA 3TZNA 1GHRA 2WZIA 3T0BA 2PDCA 2ZA1A 3FSTA 1QW8A 3CIVA 4QG6A 5LA2A 4NZCA 2VWTA 1SFJA 3TC7A 3WEMA 3CH9A 5A8QA 1WAUA 4QQ3A 3A4AA 4W5ZA 3O06A 2G3MA 4NZ5A 4KEVA 3U5YA 3LDVA 5D8WA 1LRNA 1BRLA 3QN3A 2POTA 3WQEA 1J0KA 3MW7A 3NSMA 4GGHA 4S3DA 1B90A 3L5MA 1CI1A 3W07A 4OHQA 3WH9A 1FWHC 2DZTA 2G96A 3RM4A 4JNMA 1XLMA 3BG3A 4GYFA 4NZ3A 3M5YA 1M1BA 4ZQRA 3FNDA 4Q6XA 2WHLA 1CLXA 4G5DA 3XISA 4ZO8A 1UQYA 1JULA 3QYSA 4POCA 3PNZA 2R14A 4D6FA 4U31A 4AZGA 3WK0A 2D0FA 3MSYA 1K9FA 2EO7A 3GDLA 3VIOA 2WQPA 1VPXA 1I1XA 1W1B1 2OO6A 1OX4A 3NCOA 4UQEA 3QJAA 2OSYA 4UTHA 1RVGA 2OFJA 4NF7A 4CU6A 3LEPA 4R27A 5M17A 2V69A 3W00A 1EQPA 3B06A 5FCZA 3VGDA 3ZLHA 1KR1A 1NWUA 2C7FA 3LZ3A 3PJUA 2ABBA 3VX0A 4GVFA 3NO5A 3H2CA 2HBVA 4WHBA 1MXSA 3WX7A 2A6NA 2FGBA 1H4PA 3HJEA 4Z1AA 3ECQA 3MUCA 4UTJA 5HJXA 4REQA 1B3VA 1KCLA 3MTWA 3TC6A 1CXIA 3IRDA 9RUBA 1OF6A 1RK6A 2TAAA 1FWWA 1OCNA 1E56A 4LW7A 1MNZA 1EWDA 2PLCA 4NI8A 1GCYA 2NQ5A 3WDPP 2VCCA 2J8GA 3CUFA 3DGBA 4UMCA 1EJSC 3GVGA 3L0GA 1PWLA 1I60A 1FWTA 3AICA 2QCHA 9XIMA 3U2EA 1O5XA 4BI5A 4BQ3A 1KFWA 1MQPA 1S2AA 3I68A 4AW7A 1EPXA 2X1RA 2GPTA 3NPVA 5HWMA 1C9WA 3UWUA 4KRZA 3ITVA 1EBGA 4CD5A 4XIAA 1B3ZA 3UG8A 5FD0A 4E4UA 3WJWA 4JHMA 1EA9C 3TJXA 2HQAA 3BARA 8XIAA 4QLLA 3P80A 4S1FA 3GH4A 4YTUA 3O8AA 3W1AA 1V3JA 4D8ZA 3GY1A 3ZWSA 5CLTA 4GX8A 2X2GA 1IT8A 3AWNA 4L61A 1GVEA 1F3EA 1GVQA 1KV8A 1J0YA 1GT8A 3W7GA 3S1WA 3MSGA 2J74A 2ZOXA 3KCJA 1ONWA 4J2MA 3C2EA 4GKLA 4G56A 3LU2A 2PDKA 1XIJA 4DVOA 3IVTA 2DZBA 3GHUA 1KXTA 3O6DA 4GYPA 1E1FA 5EKYA 3IRSA 3VABA 3ANUA 1J12A 4KCWA 4CNTA 5CEWA 4MJ2A 6XIMA 2OT0A 1MVYA 1UUQA 1YE6A 4MWAB 5AZ0A 1R38A 2Y70A 4H8HA 1WX0A 1UUOA 4FNPA 3MY9A 3SM0A 1OFOA 1NJJA 1B3YA 1HQTA 4MLRA 1A5NC 3SIMA 2QCLA 2Z00A 3H4WA 2CITA 1XG4A 1W3LA 1EEPA 4JN6A 4O19A 4RCXA 1I0DA 2YXOA 5CZJA 2DUAA 3WNPA 3BOFA 1L8NA 4OUIA 4PBEA 3GXIA 5HJLA 2WHJA 1KM0A 4I9TA 3IUHA 3TN6A 1RVKA 2YSWA 1EKOA 1U5VA 1C7TA 4AXNA 1SPQA 1PKLA 1V3LA 2YCJA 4N9CA 1ADOA 5BRBA 5LIYX 2FDSA 4DO7A 1QNVA 3VYLA 3AJ7A 3HGOA 4S2CA 2OODA 1JRBA 1PZ1A 2ONEA 4GOAA 1P1MA 3ZQ9A 3WH5A 1DE6A 5CG7A 4H7VA 1VP5A 1YBQA 3DBPA 3LM7A 1TCMA 2Y7EA 1PX4A 4JTJA 4QTGA 4KIEA 4E5TA 4WXZA 3M6YA 4GVHA 3VM7A 2OT1A 3CH0A 4FZIA 5D4YA 2E9BA 4R5EA 1GTEA 1WZAA 3QR0A 1H61A 1TJRA 4KRTA 4WGHA 3GG7A 2TRSA 1IT7A 1D2KA 4FPSA 1KXHA 3IACA 3P6LA 3WJXA 3DBNA 5HPOA 4Y9NA 2TSYA 1GVYA 1W5MA 2Y8KA 4UQDA 3EDFA 3T0AA 1TV7A 2Y2WA 3L68A 1KGUA 1FWSA 3EWZA 3SY5A 2V82A 2ZRUA 1Q3NA 2V6AA 4B9ZA 5BMWA 3B9NA 1T7LA 4FXSA 1K7FA 4IPNB 1BQGA 2ZX8A 4PCPA 5EMJA 5B7ZA 3GS6A 2DW7A 1QO2A 3UZYA 3L2IA 4MWAA 1HVXA 2R1KA 4BF7A 1S2UA 2J7BA 3CO4A 1WDDA 4L7ZA 1TJ2A 1SJDA 1PDYA 3HPAA 1TWDA 3W86A 4F0LA 3FCPA 1VEMA 1K1DA 4F2BA 1HKIA 1KFBA 1VFTA 4HOWA 1EO5A 2GJRA 4I5XA 2WMJA 3LERA 1CGYA 1PIIA 5D2XA 4UFIA 4A2RA 3AUOA 1HIZA 3MZNA 1VGAA 4PMVA 2V2DA 3SN0A 3J7HA 3L21A 1PAMA 2ZXQA 5DXYA 4C1LA 2FTWA 2BXZA 2Y88A 1UOZA 4KWVA 2POZA 3KW3A 4ONVA 3W70A 1LQ0A 1YXYA 4JHOA 1OFPA 4X22A 2OG9A 1TWZA 1WXYA 3AISA 2V2CA 2QCEA 1XDJA 2NQHA 3HFYA 2BOGX 2W5FA 1IYXA 3S1XA 3WDRA 3DKJA 4PTWA 4Q33A 1W8GA 4HA0A 2QDEA 5RUBA 1W3KA 5HNUA 1O5QA 4D71A 4E4PA 2JIWA 3AYTA 2QULA 3AJXA 1EIBA 4NNBA 3LV6A 4YVVA 3ANVA 3NDZA 1SW0A 2IPWA 1OFBA 3N2BA 5GPRA 1NQ6A 4J3WA 3QC3A 3CQJA 3R5EA 2CHRA 3KBJA 1SUXA 1W17A 1ONRA 3WQ6A 1GW1A 4JCMA 4ATLA 2EPOA 1FHUA 1J18A 4CLMA 4GUJA 5EMKA 3L5AA 2Z1SA 4LY4A 3QZEA 3TN4A 3AZSA 4I5UA 1UMYA 4C65A 1Z3NA 2J7GA 3RU6A 3PPFA 4V1XA 3AS3A 1WBHA 1V93A 4WJXA 3C3UA 1XKJA 1W5PA 2BHZA 1YTDA 1V0NA 5I79A 4F0HA 2J88A 2BFGA 2PEVA 3GR8A 2RJGA 3PUGA 1NFGA 5EY5A 1AMKA 1R7AA 1A4MA 2VFEA 3V1HA 4PN2A 1Z42A 2A5HA 1TPVA 1U30A 4Z2HA 4PUMA 3NQ2A 2BX7A 2CESA 1G4EA 4LS1A 3V4BA 4LSBA 4YCPA 1EPVA 3KBSA 1XP3A 4H04A 1KM1A 4GUGA 4DYKA 1OFRA 1EQCA 1XH0A 2QUMA 4Z08A 1TRIA 4F40A 3EMCA 4IX0A 4FR6A 1UA7A 4U28A 4TR9A 3NXFA 1ZS2A 4G7FA 3HPXA 4IT1A 1FXQA 3N2TA 3RCMA 1CGVA 1HO1A 1W3HA 2WVUA 3W83A 4K6AA 3DAQA 2BWGA 3OVGA 2E1WA 4O53A 1G9HA 1RLDA 1EFZA 1FTXA 2PI6A 3GW3A 2DZAA 1SU5A 2J62A 5FF7A 3EX6A 4M7TA 1RJRA 4L9XA 1RQHA 1BFNA 2Q8XA 2CLKA 4MB4A 2JBMA 3Q65A 4JX4A 1DJGA 1OY0A 2XN2A 4MGGA 2GGGA 5K3VA 2ZADA 1UWAA 1OFDA 3ARRA 1JYWA 1A5UA 5A95A 2XN0A 3QVQA 4JTGA 1TE1A 3MT1A 4JD4A 1A5OC 3N3MA 4OBRA 1HP4A 3WLKX 1MZHA 3B97A 4JQ2A 3GYCA 2WVSA 3SRFA 3CAWA 4B3KA 4JS3A 3UETA 4D72A 4NZ1A 3D3FA 3LI0A 4TX9A 4ZQMA 3TX9A 2C0HA 2ZDSA 2XH2A 3NQGA 3DX5A 2FVKA 1UCWA 2QCFA 2OCZA 3EMZA 4LY8A 2A0NA 3KOZA 1Z44A 2GGJA 3WK3A 3RMJA 2OEJA 3BCJA 2CZDA 1IIHA 3IJ7A 1EC8A 3NURA 4GABA 2BSLA 3AU2A 1U1HA 2X7VA 1KCKA 4X2PA 1GVFA 4PODA 1Q8AA 1V0KA 4IP4A 1VEOA 3HGJA 3VOIA 3R0DA 3B0VC 4O0KA 5DX7A