4ZQMA

Crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the complex with xmp and nad
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
357
structure length
333
Chain Sequence
DPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSGGLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis IMPDH in Complexes with Substrates, Products and Antitubercular Compounds.
pubmed doi rcsb
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
molecule tags Oxidoreductase
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 101
structure length 333
sequence length 357
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zqmA00
3GAYA 3A22A 3RLVA 5FEWA 2NV1A 4L4LA 3TKFA 4JGDA 4QISA 4DO6A 3S5OA 3LXBA 3SECA 2FTPA 5CGQA 5I3IA 3CIWA 5D03A 4L4MA 1DBTA 4Y8FA 3FA5A 1TIMA 3A9IA 3MHUA 5D38A 5EA9A 1LM1A 4KFPA 4FHAA 4QITA 3B03A 3TIMA 3MBFA 4YL2A 3TC6A 1MEWA 1VCFA 3IIOA 2JGQA 3BLFA 4Z1BA 4ZQRA 2RDWA 3B0PA 4QNEA 3CEPA 4ADSA 3FLUA 4DEFA 4JYFA 5IBXC 3F03K 2OX1A 2X30A 1X1OA 4XWUA 3EB2A 3I7RA 3HJZA 3VKJA 3F4WA 1XBXA 3P67A 1TPH1 3B04A 4UTWA 4KFOA 2PURA 2WSRA 5T26A 1SW0A 4GNJA 2VXNA 3NR0A 3PWAA 1SU5A 4LS2A 3TSMA 4IQLA 3CT7A 1FXQA 1T99A 3M5VA 2W6RA 3NXFA 3LBCA 3LHWA 1TJRA 1XDMA 1QO2A 4OWGA 2V0TA 4LV4A 1JR1A 1H7RA 5BNKA 3S1XA 2YCEA 5LNUA 1VC4A 1YTKA 3VI2A 1DKWA 1G4TA 4LWWA 4N9EA 2Q8LA 5FF7A 3FJ6A 1SUXA 5MHBA 4FNSA 3DGRA 1HL2A 1VCGA 5K4XA 1JVNA 4PH6A 4GFSA 2H8ZA 4LVFA 4PL2A 1KFEA 1JCNA 4H3DA 3W7RA 1I2QA 1ME8A 2WV8A 3BW2A 1PHWA 1FWWA 2ZZ5A 5DY2A 2ZZ3A 1KBJA 3I7SA 3QEZA 3ZWSA 4BI6A 3UWQA 3Q94A 1GYLA 4UFKA 3NQGA 1SFLA 4JTJA 3LLFA 3EXTA 4IPIA 3MYOA 3ZS4A 1NF0A 2WNQA 1YPFA 2NXHA 1GT8A 3TUUA 1P0NA 4ZQPA 3GDRA 1PHQA 4AHPA 1FDZA 3HPSA 5EKYA 3TXZA 2CLOA 4UTLA 3GR8A 4HNVA 3KX6A 2E77A 4NZFA 3W7MA 1TPEA 3PS7A 3M41A 3LTSA 3W72A 2JKAA 1P4CA 3QC3A 2YDAA 4LV9A 2FPTA 3TQ0A 2JKEA 1VR6A 4DF1A 4EF9A 1E51A 3ABSA 2QUUA 1HO4A 2OCZA 3EX3A 3D0CA 3LXAA 1Z41A 3N3MA 2ZRZA 3IGSA 4AEOA 1R30A 2ZTKA 3TSDA 1WYIA 2C14A 1OYBA 3TMLA 2A2IA 2ZZ4A 5D32A 3W1TA 1W5OA 1PCWA 3PB0A 3TFXA 4GUJA 2YFOA 1GG0A 4FX6M 1YYAA 3HGSA 3KHJA 1K8XA 4RJEA 3IVUA 3O07A 5FEPA 5HJLA 3W2UA 1H5YA 3MWAA 3U6WA 3NL5A 4CNPA 2V5LA 2EF9A 5AFDA 3NPVA 3HGRA 3G24A 1R2SA 1IF2A 2FFCA 2X1SA 2XN0A 4NJHA 2Y6ZA 1P1XA 2FLIA 3LGEA 3LBMA 3M6YA 4UIOA 1U83A 1DQWA 2B0MA 1JCJA 5AC8A 3KRZA 1NAL1 3KVKA 4UFLA 4A29A 1OFEA 4JTSA 1A50A 1L6YA 5D37A 3HG5A 1ONRA 3BV4A 1G69A 5U7SA 3G0UA 1Q6RA 3P61A 4OGZA 1IXOA 1L2UA 3OA3A 1RZMA 1QCWA 3LHZA 4E38A 3A24A 4M6QA 4QQ3A 1I2RA 2V2DA 1B57A 3W1AA 1OX4B 1SFJA 1X8FA 4JX4A 3JS3A 4NJKA 4N4PA 4PA8A 1EP2A 3EWWA 4QNWA 5D2TA 1LYXA 3W7JA 4WD0A 5D30A 1LTDA 3LHUA 4RXGA 3IV3A 4DF0A 3SGZA 1I8JA 2CZEA 4O0KA 5C55A 4MY8A 3MW7A 3EX2A 3RF9A 4IMDA 1W3TA 5AC7A 4KFNA 4YWIA 1ICSA 3VE7A 4O14A 3W7NA 2TPSA 2TSYA 2G95A 3HQ1A 4JTGA 1Z42A 4O53A 1R47A 3W3OA 2GJLA 2Q3OA 3W7HA 1EB3A 3BVJA 4ALDA 3B0UX 1GVRA 2DZWA 2E5BA 4OHQA 3BW3A 1B9BA 3C56A 1VJIA 3UYCA 2QJGA 4N6EA 3VCRA 1LDCA 5EPDA 5I3FA 3WJZA 5HQEA 2X2GA 3G8RA 4POCA 5BOOA 3G0SA 4JTEA 1EP1A 2DJLA 1M6JA 5G5IA 4JTFA 3P82A 3L67A 1R46A 3HO8A 4ZVJA 2Y61A 1XBZA 1JJKA 3PR2A 2G97A 3M5ZA 1SZFA 3GDTA 5F1UA 2H90A 3LV5A 5AOUA 2CFFA 2E68A 4I9AA 5TBOA 3TR2A 3W83A 2QCHA 1ALDA 5A5WA 2WO5A 3MUXA 1R2RA 4O8RA 3NZ1A 4ONVA 2J9XA 3UXAA 2A6LA 3O6YX 3EWZA 3LCGA 4A21A 2A85A 2FDSA 4O0ZA 1Q6LA 2QUVA 2VFDA 4K7YA 4WOZA 3W7DA 3F1QA 3EWXA 4K8HA 2C13A 3DBPA 2CLLA 1SW7A 1GVOA 4GJ1A 3W22A 2ZRVA 1GJPA 3NDOA 2VFEA 1YADA 3UY7A 1WBJA 1UCWA 4XQ6A 1KFJA 1OX6A 4BK9A 4MY1A 1Z44A 4U28A 1DORA 3A23A 1AL7A 3L5AA 3DFPA 5CG7A 5KSWA 5DXXA 4EIVA 1A5AA 4AF0B 2ZA1A 3KFTA 1DHPA 1GEQA 4GUIA 1QOPA 1ML1A 1SW3A 1LBMA 1TRDA 3DI1A 1PE1A 5AHNA 4O17A 2WJZA 1P5BA 1RD5A 3T78A 3W1MA 4J9JA 3NO5A 4I7UA 1P0KA 5H2ZA 5HR7A 3GZ3A 1G4SA 1IXQA 4UFHA 3U8GA 3TC7A 4CQ9A 2ATSA 2P0OA 3UZJA 2ZFAA 1QFEA 3W86A 1VYSX 3NL6A 5TIMA 1JUKA 1SR9A 3WJWA 4FNQA 1TTIA 3V75A 4JYDA 1OG0A 5DBTA 4S1FA 2P10A 4NJIA 3MBDA 3EWBX 1TREA 4UFMA 4D2JA 1OVDA 1Q6QA 1UUMA 1WXJA 1ICQA 2QUTA 3TFCA 2NXIA 5FF0A 4RZ5A 4EF8A 3S8HA 4A2RA 3H54A 1H1YA 3ANYA 1X6UA 5AHMA 3W2JA 4UC5A 3LXCA 3LCFA 4BR1A 5K9CA 3MP5A 4YCOA 2C16A 2DU2A 4Q4KA 4QIUA 1THFD 1TTQA 4HPXA 4O10A 1HO1A 2ZDRA 1ICPA 4MYAA 3HPXA 4IMFA 4CQAA 1M7PA 2VC6A 4O12A 1XFBA 2WNNA 5EMUA 5D2YA 3R8RA 4CCEA 2TMDA 4JTKA 2JGYA 2CZ5A 1D3GA 3M44A 1LBFA 1QPOA 3P8IA 5D04C 1VHCA 3QMTA 3THQA 3LDVA 2Z1BA 4JX6A 1WOAA 3G3MA 1YDOA 3K30A 3LHTA 3QSRA 3JR2A 5DELA 5F2MA 1QAPA 2ABBA 4JXCA 1XCFA 4IWWA 1KTBA 1GVFA 1FX6A 1XXXA 1F7BA 3TW7A 5ABTA 1LOLA 3EWUA 3DU0A 4E2DA 1KFLA 4LVAA 1M7OA 3F4NA 4NX5A 3A5FA 4OV4A 4FIRA 1I2PA 1W3IA 4AVFA 3TK7A 4OQVA 3RU6A 1K7EA 1SSDA 3DFOA 2BSLA 1LCOA 1K02A 4GC4A 5LNSA 1RR2A 5G4EA 4OV9A 1EWEA 1EUAA 5IM51 2CW6A 1PVNA 5CPNA 3IRDA 3TX9A 2C18A 1Q45A 3IGUA 4WJEA 3LV6A 3ATYA 1AK5A 3S0CA 2VEPA 4MVAA 1GVQA 5J5DA 4FXRA 2W79A 2E5CA 3GVGA 2DZUA 3PB2A 5AC6A 5HINA 5K7JA 5C6MA 4LRTA 1NVMA 3R12A 4MFDA 4A22A 5K4ZA 2I9EA 1XC4A 1D9EA 5CZJA 2J24A 1WBHA 4BWLC 3P84A 4WY0A 3L68A 4LOCA 4M6VA 4YXGA 4WX2A 4IXHA 1W5QA 3N9SA 3EKZA 1XI3A 1YDVA 1IXNA 1TSIA 1F2JA 3O6DA 3TCEA 4DPQA 4HNUA 4YCPA 3DFTA 2AQWA 5EL1A 4WQ6A 1W8SA 1VRDA 3QPZA 3W7GA 4PC8A 4KWVA 1G7VA 3W7IA 2QCDB 3KVLA 1TB3A 1IIGA 4A2SA 3N34A 4Y6GA 1NEYA 1SZGA 4GBUA 3GIYA 4LVDA 1K8YA 2NUXA 4Z08A 2E09A 2E6FA 2C6QA 6TIMA 4TR9A 3W9ZA 5CZ0A 2BZNA 1F74A 1R2TA 1WX0A 3GNNA 2HSAA 2VENA 3S1UA 3CWNA 2QCFA 3DI0A 2E6YA 1X1ZA 2R8WA 1U5JA 1TV5A 4I7VA 1GZGA 1AMKA 3E02A 3H53A 3PUEA 3GDKA 4NJJA 1JQVA 3CHVA 1B3OA 1G4EA 3P81A 2WOQA 3C3NA 3WK2A 3NQ8A 4JR5A 2WSYA 3CM4A 4JTTA 1KLYA 1OK4A 4O13A 1KFKA 1S5VA 3HIJA 5HWNA 4K8EA 3P5YA 3I65A 3M16A 4K38A 4O16A 3HB9A 3W7KA 2FIQA 4FO4A 3OHIA 2RDTA 3O05A 1H61A 4FB7A 4UUIA 3DFNA 3G1AA 4CNNA 2YW4A 5BMWA 3C2FA 3EXSA 2QF7A 5CZTA 3RNDA 1W5NA 1VYRA 2GQ9A 2NWSA 2ISVA 3NM1A 2CZFA 4GRSA 2UV8G 4MOZA 2NX3A 1RVGA 2GUUA 2YW3A 3WJXA 3IIZA 4DF2A 1TQXA 3S5NA 2ZA3A 4ZZ9A 2ZTJA 3FEMA 3LCXA 2YX0A 5CPOA 5K9DA 1FXPA 3MHFA 5LHEA 2Y62A 4O19A 3SW6A 3NVTA 4Y90A 4ZQCA 2WQPA 3PC0A 1XBYA 4JD4A 3TU9A 3NL2A 5F2GA 3G3DA 5FF4A 3T7VA 3W6YA 3KOFA 4O1DA 4EWND 3HOJA 4AWUA 5D2XA 3S1VA 3ZWTA 1F6PA 3RK8A 2VFGA 3CIXA 1KM0A 3BPWA 3DFQA 3S9YA 4NNAA 1GOXA 1H63A 4JDYA 4ICNA 1C29A 2QCNA 1CW2A 2A7RA 3FYPA 3SGUA 5L9FA 3GXTA 2DORA 1FUYA 3YPIA 2R94A 3SJ3A 1SQ7A 2NV2A 2E1DA 1FQ0A 1LRTA 1RQEA 1ZALA 1T8XA 5L6UA 3MI3A 1SZNA 1QO5A 4RXFA 2C3ZA 4UNLA 4M19A 2ZYFA 3TROA 1F6KA 1FDJA 4MZYA 2YXGA 3DHDA 4OU1A 3BLIA 3O15A 2J6XA 5BRBA 1RQHA 2WPBA 4UTKA 3IGXA 3QMSA 1WOBA 4C1LA 1V7YA 3LI0A 3GLCA 4S2BA 3P7YA 1OFAA 4OT7A 4W9TA 3OBKA 2WNZA 3OVQA 5I3HA 2QKFA 5K2ZA 4JIPA 1TJPA 3G8EA 3TH6A 3M7WA 2O7SA 1GTHA 5LSMA 1VCVA 1W5PA 4HN4A 3RMJA 1XBVA 1FBAA 1KM4A 3W74A 3PULA 4X3ZA 1WAUA 1S5TA 2J9ZA 3NPUA 2YFNA 3L5MA 3NQ2A 4UTWC 2Y85A 1H7NA 1PIIA 2V2HA 1MSSA 3P8JA 5K9XA 3S42A 1QWGA 3HBLA 2QCEA 3E49A 4ZQOA 1KM5A 3TAKA 3LERA 2VKZG 1EX5A 3LCHA 2QJHA 3PBUA 5G1YA 4CQ8A 4R33A 3SY5A 4UFJA 2O7QA 4A3UA 1WA3A 1UJPA 2XFWA 4IGHA 4JTLA 4JIQA 1KM3A 3ZFHA 2FPYA 1ADOA 3EX6A 4HHPA 2Y7EA 3BGJA 3W73A 4R34A 2ALDA 5AN7A 4JICA 4O52A 2XN1A 1BTMA 1YLVA 2QAPA 3ABRA 3C4UA 4NJGA 1J5TA 1WV2A 1J4EA 1YPIA 3NOEA 4K36A 4LTSA 3OG3A 5DY3A 4UTHA 3SI9A 4ZQNA 3MJYA 3TAOA 4ZL1A 5CZSA 1EIXA 2I1OA 2G5WA 2PRHA 1H62A 3DZ1A 3QW4B 1OYAA 2CWNA 3KRSA 1SSGA 2OT1A 3SSJA 4MZ1A 1IIHA 1GYNA 4QAIA 3L9CA 4UMCA 3TQKA 3PM6A 4HKPA 4RZ6A 4AHOA 3C0JA 3N2XA 3GDMA 3IVTA 2ZA2A 1SO6A 3MMTA 1UB3A 3STCA 3G1XA 4JTHA 4UFIA 5CSSA 3G1SA 4NXSA 2DZVA 1I4NA 2X1UA 3SIZA 4Z0SA 4JYEA 4GUGA 5LKYA 4JEQA 5F2IA 3IVSA 4XZ9A 1K7XA 2GVLA 1OJXA 2BWGA 3E0IA 5C54A 5D2VA 5C5YA 2H3BA 1WQ5A 3T4CA 1H1ZA 1QPNA 1TTJA 4MLJA 3VFLA 2YZRA 1OFBA 4LNYA 3R89A 5F4XA 2F7FA 2RH9A 3GAKA 2RFGA 3P74A 3GX9A 2GQAA 3ABQA 2A7PA 3QJAA 3LRLA 4RR4A 3TJLA 3UXDA 1WDWA 2Y70A 4EVZA 3R5EA 2E6AA 2QDGA 1K3UA 5DCDA 2A7NA 4UMBA 4B5NA 4BF9A 2GQ8A 5D05A 4N9BA 3LLDA 3QQ1A 3IIPA 3W84A 3W1UA 4IPJA 3N2MA 1FCVA 1LZOA 4X9SA 1XUUA 5F4WA 2VELA 3G1VA 4LT9A 2QDHA 1XUZA 4UTUA 3O16A 2CZDA 4LC8A 1OFQA 3GB6A 1KW1A 3LHVA 3MHGA 4M5PA 3BG5A 4N2YA 3W1PA 3DFSA 3W76A 2A4AA 1LP6A 1DQXA 3BG9A 3G1YA 1MEIA 1IGSA 4RZ4A 3MI6A 1XM3A 3QPYA 4HSNA 3OEXA 3VNDA 1KM1A 4LVBA 4TX9A 3LCWA 1H7PA 1TQJA 2TYSA 2ZRXA 3EKLA 1TMHA 2VEIA 3G18A 5LHFA 3CC1A 3NNTA 4O11A 2A6NA 3W1RA 1O4UA 2J88A 1Q3NA 1YXYA 4CCCA 4KWWA 4LUIA 2XN2A 2YYTA 3GXPA 2ATMA 3NQ6A 1BWKA 3NQ7A 2V5BA 5KZDA 4QM1A 5E1QA 3FS2A 3O63A 3HG2A 1X7FA 2X1TA 3E96A 3QF0A 4FNPA 1JUEA 2C0AA 4O18A 2I14A 4N4QA 5CSRA 1OFPA 1FWNA 3DHFA 4AHQA 3L0GA 3LM7A 1TTPA 4DELA 3W7OA 2QR6A 4WXYA 5KINA 1LRQA 1ME9A 4JNMA 4O50A 5H91A 3BO9A 3WJSA 2HS8A 1W56A 1YXDA 1ZAIA 3I7QA 2WKJA 4FXSA 4JTUA 2DZTA 3LI1A 1LOQA 5FESA 3B8DA 5CPLA 4ADTA 3NM3A 4TMBA 1W5MA 4JTIA 3TXVA 4PEKA 1OX4A 4HNTA 3QW3A 4UTMA 1F73A 3STGA 5C2XA 2EPHA 4ZMGA 4IXXA 4IOTA 4AB4A 1KLZA 3DXIA 1JCMP 3MO7A 1S5WA 1TV7A 5AYZA 2JBMA 3UWUA 3V1PA 3STFA 3BK0A 3FKRA 1HG3A 4O57A 4E2BA 3LRKA 1FWTA 2CU0A 4DO5A 2FB2A 2Y7FA 2ZQ0A 5HMSA 2A1YA 3ELFA 3CQ0A 3PVFA 3UPWA 3W23A 4YLWA 1YXCA 2LLEA 1VQTA 1MO0A 3CLMA 4MIMA 3M9YA 3KVMA 4MLRA 5I3KA 1Z48A 3NQMA 1SO3A 1VPXA 3W07A 2VEMA 1GQNA 2GOUA 3TNOA 1OF6A 5I3GA 1O94A 4MJZA 1VLIA 4NUWA 4R7JA 5DLCA 3NQAA 5D09A 5HUOA 3W85A 1TPUA 3M5YA 4AAJA 4XUGA 1H7OA 4BFAA 3A21A 3HG3A 3SZ8A 1HTIA 4RX0A 3NPWA 4Y9AA 4WZHA 2Q3RA 1G6CA 1FWRA 2HTMA 4H6KA 3O8AA 4FF7A 3W7QA 3W87A 1W0MA 1OX5A 1O60A 3G1DA 1FCUA 3LTYA 3C6CA 1ZAHA 5FF3A 2ABAA 4M7SA 2FB3A 4TO8A 2JKPA 1O5KA 3MP4A 3BGGA 2Y63A 2H8XA 1MZHA 4ORMA 5HULA 3TW6A 3TJXA 3WJYA 3STEA 1YTDA 5FEZA 3CWOX 2EAWA 4GWEA 4HPJA 1O5XA 1F5ZA 4JDBA 1JCXA 1PV8A 1KM2A 2DZSA 5I3JA 3E12A 2BLEA 3NAVA 3W7CA 1YDNA 3R13A 5AHFA 2ISSA 2CLIA 1RQBA 3EEGA 1LROA 1H51A 4IUOA 1UASA 4LW7A 5G1TA 1MXSA 5AB3A 3U2OA 2P1FA 3LCIA 3R2GA 4H4IA 2NX9A 3O1NA 5GVJA 3C8FA 3UY8A 1V5XA 5AHLA 3KVJA 4Z1DA 4YMZA 1SZEA 3W1QA 4UR7A 4NVTA 1GTEA 4CLMA 5LGZA 1LOSA 4AF0A 4Z1AA 4LU0A 3T44A 3W1LA 5LGXA 2CLHA 2V9DA 1H7XA 3GKAA 1W54A 1ZHAA 4FX8A 4JS3A 4FNTA 1M5WA 2QCLA 1PCKA 1MEHA 3GYEA 2GVGA 2HMCA 5HR6A 2NX1A 5G2HA 1N7KA 2EKCA 4WXZA 1G4PA 1I2NA 3PAJA 3N9RA 3C52A 2FQIA 3DAQA 3USBA 5D33A 3ATZA 4WUIA 5G4WA 3TE9A 2DP3A 3O6CA 5HWJA 3C2RA 3QMRA 4MZ8A 3P62A 2NZLA 3WK0A 7TIMA 4LVGA 5F4SA 1BKSA 1DL3A 4NZJA 5K3VA 2CLFA 1N55A 1HUVA 4K39A 4EOUA 3HF3A 4OE7A 1L9WA 1H50A 1O95A 1N8FA 2Y7GA 4BI7A 3SFKA 1ZNNA 1VGAA 3QM3A 3TV8A 2R91A 1S3HA 2BTMA 3P5ZA 1ZJIA 3M43A 3N19B 4LY8A 3ABOA 4WY0F 3L66A 2C19A 1EUNA 3GDLA 4O15A 4NQ1A 3RFAA 3LRMA 3S5ZA 3HG4A 3EWYA 1DJNA 3L21A 4CCDA 4XBSA 2J9YA 4N9DA 2EGZA 3UWVA 3AJXA 1OYCA 1QDSA 1T0OA 4Q32A 3PF3A 5E0KA 4N9CA 3PG9A 2J27A 2NLIA 3L5LA 3W70A 4HSOA 3OVRA 4IX2A 2A5HA 3GK0A 3MP3A 2CLEA 4NNCA 4UTIA 5KMYA 4UCGA 3G1FA 1TCDA 4LS0A 3NQDA 2BX7A 4P2VA 1KTNA 1J2WA 2QCMA 1DJQA 3W88A 3RLUA 4UTTA 2ZCGA 4JX5A 1XDLA 2ZZ6A 2PRLA 1TPC1 3DKLA 2YSWA 4MUZA 4G1KA 1FY6A 1ZENA 3P60A 4JY8A 4ORIA 3UWWA 2ZBTA 1W31A 2V81A 3LHYA 4O1AA 4K6AA 3B0VC 4ML9A 1UBSA 5KTLA 1OABA 2QJIA 4HNNA 2X16A 4NX0A 5E93A 4S2CA 4XKYB 3M47A 4Y96A 1OFRA 1TPFA 4GUHA 2GPTA 3LX9A 4GXMA 1SO5A 5DCEA 5LNVA 3L2IA 1KFBA 3DENA 3FJLA 1H7WA 4O28A 5D02A 8TIMA 1OFOA 4FIQA 4RKAA 2BXVA 3E9AA 1A5SA 3TSBA 1EP3A 3QFEA 3WK1A 1JULA 1AG1O 3GNDA 4RCXA 5G2IA 4MKNA 2X1RA 2E5DA 3I68A 1A5BA 1W3NA 3MI2A 1ZCOA 3FKKA 2HS6A 3B4UA 3HGJA 2IQTA 4AMAA 3LOTA 2OZ0A 2OT0A 3NZRA 2B7NA 2QAFA 2DJXA 1JQXA 2JK2A 3PBYA 5TQLA 1FCQA 1EEPA 3DKJA 4XTDA 2H3DA 3TQVA 4FEZA 2YGYA 1KTCA 3W75A 2DZPA 1XKYA 5EBUA 5CPMA 3T55A 3LTPA 4XBKA 3UWYA 4BI5A 1F76A 3B06A 3A5VA 3PBWA 4GE8A 4MPQA 4XTIA 3MYPA 1W1ZA 2QCDA 3S6DA 2YR1A 1AW1A 1LORA 2WSQA 4O4WA 1G67A 2RDUA 3L0KA 2G96A 3W1NA 5BW6A 1G7UA 3S5YA 2YPIA 2ZRWA 1H60A 3QYQA 4PFMA 3UZ5A 1JCYA 5DN1A 1UUOA 3NPXA 1EPXA 5FF2A 2RKXA 1VZWA 4UNKA 3Q2DA 4NU7A 1FWSA 3KAOA 3W7LA 1LLZA 1TPWA 4WY0B 1ZFJA 4MJMA 1EA0A 1KFCA 2KZHA 1HFBA 2CLKA 4M7TA 3QQ0A 1GWJA 2OJPA 5LNRA 1TPVA 3IIVA 1DV7A 3G22A 5AHIA 1LRNA 3QRHA 4UMAA 6ALDA 5J5RA 4MYXA 1KV8A 4I7WA 1TV8A 4HIBA 2EHHA 3CB8A 1B4KA 4NT0A 3PUOA 1GG1A 1IXPA 5F2LA 5DCBA 2R14A 2ISWA 3C61A 3G1HA 3I6RA 2QCGA 1QMLA 4WOQA 3G0XA 1DOSA 3O06A 4KKXA 4TMCA 2RHGA 2PE4A 3UD6A 4RK8A 3TMQA 1VS1A 1W37A 4DBEA 1JUBA 4RV8A 1NSJA 1QPRA 2A0NA 4RLIA 5EYWA 5DXYA 2C15A 1KM6A 4UTTC 1CI1A 3AO0A 2D73A 1ZAJA 4N6FA 2Y88A 1AL8A 3NQFA 3N73A 2ZZ7A 1I2OA 1VH7A 4UR8A 1SPQA 1OK6A 2GVJA 2A21A 2FPVA 3GXNA 2Z0IA 2YYUA 3EXRA 3B05A 3KXQA 2NUWA 3WK3A 4NXKA 5AHEA 5HNRA 2W0UA 4IMEA 5FI8A 4MFEA 2V2CA 3C2EA 3FOKA 1XL9A 2V30A 1I45A 5CKSA 1CX9A 2PCQA 3CU2A 1B4EA 4FNRA 1SO4A 3T40A 4NNBA 3HPZA 3GKFA 1RV8A 3HGOA 3LB0A 4LUJA 4PODA 2NUYA 1A53A 1YTEA 2CLMA 1QOQA 3UPBA 4BWLA 5EY5A 4C1KA 1OHLA 2DZXA 1T96A 3SR7A 2AGKA 2F84A 2ZZ1A 2OMAA 3HMJG 3THAA 3FFSA 4IMGA 4AH7A 5LNWA 5KZMA 3M5XA 2TRSA 4PCFA 1F05A 3CPRA 3WFAA 4PTNA 4AWSA 3NGJA 2NWRA 1Y0EA 2VFFA 1FCBA 2AAMA 1K8ZA 1AW5A 3PY2A 1JRCA 3W2KA 3IEBA 1EWDA 3NL3A 1C9DA 3UNDA 4Z1CA 4UTJA 2B7PA 1VLWA 2C1HA 1TPB1 4CNOA 3FIGA 2ZZ2A 1C8VA 3S1WA 1KV5A 3BG3A 3VE9A 2V8ZA 1QNVA 3P80A 1FDYA 3W7PA 1K03A 1NFBA 2VEKA 5U4NA 1GPWA 1AW2A 1L6WA 1L6SA 3H55A 4OBTA 1A5CA 4DXVA 3M1ZA 1NF7A 3PSVA 3UQNA 4K37A 4FX7A 5IBXA 2Y89A 3W2MA 1Q6OA 2GJNA 2ZRUA 5AYYA 1QPQA 4E0CA 2ZRYA 1JRBA 1D3HA 2FJKA 1PS9A 3JRKA 1TRIA 1PL9A 4GUFA 4QJ1A 3BW4A 3Q37A 5A8GA 4U4MA 1TO3A 4X22A 4XKYA 3W1XA 4Z0JA 3GR7A 2PRMA 5KZEA 3CEUA 3FYOA 4O1CA 5HWMA 4O1BA 4DBDA 3INPA 3NA8A 4HT3A 3TA6A 4AXKA 3W71A 4PL1A 1VYPX 1DVJA 3W2LA 5BMXA 3EX1A 1TPDA 3UWZA 3PUDA 1VHNA 2Z2UA 3N14A 4JY9A 1K7FA 1LBLA 4IMCA 1KBIA 3TDFA 1QR7A 3QZEA 2B4GA 3C2OA 1LLWA 3Q58A 5FEXA 4N02A 3NQVA 1RPXA 4MY9A 4R53A 2V82A 3BLEA 3CTLA 3EX4A 4O4VA 3NEVA 4JN6A 4LC6A 1GVSA 5HUPA 4ZQMA 2VFHA 2VOMA 3KRUA 1ME7A 3DH7A 2VFIA 2Z6JA 3NYZA 2PC4A 2Y7DA 3LCLA 3C2VA 1OF8A 5DBUA 3OIXA 5AYXA 4IX0A 4DPPA 3PG8A 1OFDA 3NQEA 4P61A 5F1VA 3NQCA 2NXGA 2Q8ZA 2QEZA 3OVPA 5G2WA 3QSTA 4UXDA 4Q33A 5LZLA 4FNUA 4M6PA 5SWUA 1KA9F 4TU1A 2B7OA 3BARA 3PBVA 4IJBA 3L65A 4K7VA 5KITA 2B7QA 2QCCA 4QSHA 4DQWA 3M0ZA 2E6DA 1JCLA 1BWLA 4O54A 3W7EA 2Z6IA 4TIMA 4ADUA 3NG3A 4AWTA 3L0NA 1ZY9A 3W2NA 3IIXA 4DO4A 4LS1A 3PSWA 4X2RA 1BEUA 1TYGA 3ZR4A 5D2WA 3QH2A 2H6RA 4LRSA
chains in the Genus database with same CATH superfamily
2PDMA 3RLVA 5FEWA 3ID7A 5MF5A 4QISA 4DO6A 3PZIA 3S5OA 2CLPA 1EJRC 5CGQA 5I3IA 4ZTXA 4KCUA 1LM1A 4KFPA 4FHAA 1BSLA 1FVPA 2HISA 2IPJA 4BCEA 4QITA 3V4BA 2Q71A 1ECEA 3TIMA 3MBFA 3G77A 2E9LA 2GDUA 3TC6A 3AYRA 1PDZA 4J3WA 4Z1BA 3B0PA 3M7SA 2OB3A 1R9XA 5IBXC 3F03K 4G6CA 2X30A 1X1OA 2CPUA 4XWUA 3RXZA 1QJWA 3HJZA 4C7DA 3PJUA 1JEZA 3P67A 4JFSA 4KFOA 1RJRA 1O7AA 4WSJA 3HURA 1SU5A 1WZKA 2OWCA 4E8CA 3CT7A 3N04A 1QI4A 3WQ6A 4FOUA 3VX1A 1T99A 4JFVA 4GYKA 5FIPA 4LV4A 4AZ7A 1BG4A 4LCQA 1VBJA 3S1XA 2A3HA 2YCEA 1VC4A 4R7WA 1UC5A 1E4NA 4MKSA 4LWWA 2R1PA 3HQNA 2Q8LA 4NZ1A 1VIZA 5EGRA 3QXBA 2HROA 3DGRA 2I7GA 2G4JA 1VB9A 1WKEA 3PTDA 1WUEA 1UOKA 4QRNA 5A6JA 3QHOA 1C8QA 2BP1A 2BNJA 3V3WA 5TF0A 3VVGA 1KBJA 3N2TA 3L4VA 3V7PA 2QJMA 4UFKA 3NQGA 4MB5A 3MQTA 1AFSA 4GX9A 2WJEA 1RY0A 4KH2A 1ONWA 1YPFA 2NXHA 3BLDA 3TUUA 2XHYA 2NW0A 4AFYA 4UTLA 1EBGA 3KX6A 4IJRA 4NZFA 3PS7A 1J0ZA 3R94A 4MTVA 1HXJA 1PYFA 4G5DA 2YDAA 1DWGM 4HD5A 1QPKA 2DDXA 2FPTA 3K8LA 3R0DA 2GK1B 1XHGA 5DT5A 1HO4A 3LXAA 3IGSA 3JW7A 3WENA 1VRXA 5F7UA 3W1TA 2X1IA 3VNKA 4F0SA 4ZB0A 1GG0A 3KHJA 1EGVA 3IJ7A 3U6WA 4TVUA 1UMLA 1BF6A 2EF9A 3AXXA 3ITYA 3AZSA 1VFTA 4YHEA 2Y6ZA 2FLIA 3LBMA 4RUBA 3SY1A 1UR8A 1NAL1 3NURA 4GKLA 3AOFA 1PWMA 3P61A 4C7FA 4CUCA 1VFUA 2OYMA 1RZMA 4M6UA 3LHZA 2PDGA 2J7HA 3GO2A 4QQ3A 1I2RA 1B57A 1LJYA 1OX4B 1X8FA 3JS3A 1QBBA 1YE6A 3EWWA 3R8GA 3F2BA 3W7JA 4WD0A 4RXGA 4CKQA 5HJYA 4DF0A 3TN5A 3SGZA 1I8JA 4MG4A 3MW7A 3EX2A 3RF9A 2QUMA 1W3TA 1IEIA 3WF4A 3W00A 1PX3A 4YWIA 2FYMA 2QJJA 2R6OA 2SFPA 4FLRA 4RDWA 1KCKA 2Q3OA 3W7HA 1EB3A 4PMDA 2FHCA 3ARYA 2E5BA 1D3CA 3OP2A 4L65A 3WQVA 1UOZA 3F5KA 3AWNA 3WDJA 2X2GA 4HTBA 3VKKA 3G8RA 2A79A 3UYIA 1EP1A 5G5IA 1M6JA 4HCHA 4QJ5B 3DYMA 1XSJA 1BQCA 3P82A 4JKMA 3WBEA 3VZXA 2VEFA 4ROQA 4ZVJA 1G5AA 4FI4A 1JJKA 1SZFA 1SJAA 4LBUA 3B8UA 4HVXA 3TR2A 3B8WA 2PTDA 3MV11 2YXXA 3UGVA 4QJ3B 3MUXA 1R2RA 3ARRA 2P76A 2CERA 1V3KA 3M0YA 3LCGA 5G1MA 4A21A 2A85A 2QUVA 4WOZA 4K7YA 1TWSA 3MU7A 3EWXA 3BDKA 3GHRA 4K8HA 4B91A 3CMFA 1SW7A 1JDAA 2VZSA 1UIPA 4PN2A 3CZJA 1YADA 3UY7A 1PTDA 2O9TA 1UCWA 4KCWA 4LPCA 3WUBA 3I3DA 1JZ2A 1DORA 2VZOA 2VX4A 4KF1A 5KSWA 2D1ZA 5DXXA 1A5AA 2ZA1A 3KFTA 1UA7A 1LBMA 3KBWA 1FWEC 1TRDA 1PE1A 3MY9A 5AHNA 2D2OA 2IKGA 3CL7A 1P0KA 3IJLA 1XYZA 3GZ3A 2FZBA 3I3EA 1TVNA 1IXQA 4UFHA 4D6CA 3C8NA 5H1WA 1RA0A 1UWAA 3UZJA 1XCXA 2X41A 3SURA 1VYSX 4AD0A 2V5JA 4WDWA 5CC5A 4FNQA 1TTIA 3BAXA 1OG0A 3BJTA 4S1FA 4FOJA 2YL8A 3TN6A 3EEZA 1TREA 3R58A 1OVDA 1WXJA 2NXIA 1A0CA 2J47A 3CUGA 1UC4A 4EF8A 2CYGA 1EC7A 2R1LA 3I10A 4NILA 3VOIA 2FGBA 4WEVX 5K9CA 2PWFA 2ZX6A 4QIUA 1THFD 4XD4A 5AKQA 2YA1A 2WM1A 1L0PA 3HPXA 4ZBCA 2VZUA 4IMFA 1M7PA 4C6QA 1XFBA 5D2YA 2NQHA 3CQIA 4JTKA 2VYOA 3KBMA 3PAOA 1D3GA 1LBFA 1QPOA 4A05A 4GQBA 5D04C 1PTGA 3P0WA 1YRRA 2CBJA 2Z1BA 1WOAA 5JVLA 3CUXA 5C9XA 1P1MA 3OOQA 4NAEA 1XCFA 1KRMA 3OLEA 4R7OA 1XXXA 1F7BA 1UMYA 2QGYA 3HV8A 3EWUA 3DU0A 3SN4A 2J7EA 3GHTA 1KFLA 2W61A 2B31A 3AJ7A 4AVFA 2ASHA 3CV1A 3N29A 1D8CA 2VZVA 3H70A 1EWEA 3SCTA 2QS8A 3NGFA 4GO9A 3B3DA 4HZ6A 2PODA 2GWGA 4GJIA 4L61A 4WJEA 3R0UA 4WDUA 1BGGA 2Y8UA 3PK7A 3AXKA 4PMXA 4Q8TA 5C70A 3TYZA 1XLDA 4Q4RA 1VENA 1IEWA 1RCXB 3H2EA 2D2HA 1MUMA 3AU2A 3GVGA 2DZUA 4C5YA 3EPOA 5AC6A 5HINA 5C6MA 3L4ZA 1VFHA 1XLGA 4GKTA 3EA2A 1V6VA 2PFHA 3VIJA 1HW6A 3RHGA 4EXQA 1GHSA 2X8RA 1GJWA 2J24A 2ZUNA 1O66A 4KEVA 3G5EA 1ZQ5A 3URQA 2YDQA 1B31A 4WX2A 4I9TA 1UP0A 4LCSA 7XIMA 2XIOA 1YDVA 3GBEA 4J3VA 3Q4DA 4B9ZA 4HNUA 2E4TA 4ZGYA 4YCPA 1KO0A 2AQWA 1VRDA 4FLQA 1UWSA 1PZ3A 3RN6A 4A35A 2A3AA 4HU0A 1JI1A 3KVLA 2BBFA 1EOKA 3N34A 1NEYA 5DT7A 4BZYA 1SZGA 4LVDA 3WLPA 5AZ0A 4Q22A 4R5EA 2NUXA 4Z08A 2E09A 2E6FA 6TIMA 1VJZA 3W9ZA 2BZNA 1R2TA 1WX0A 3GNNA 3K8KA 3WBYA 1YNYA 3UG3A 4Q6JA 3DYPA 3C2YA 2E6YA 1U5JA 2G3MA 3W29A 1AH4A 4AY8A 4HPHA 1RCQA 3RX2A 1GZGA 3E02A 3GDKA 3HU7A 2WOQA 3C3NA 4JFWA 4DIAA 3NQ8A 3SQMA 3CUHA 1VEMA 1UR1A 1VIWA 4D71A 4AIOA 1KLYA 1OK4A 2RJHA 1EZWA 4ZCWA 1S5VA 1GJUA 4PUNA 3S6OA 4K8EA 3I65A 1E6SM 3M16A 3SRHA 3QV7A 3S2MA 4O16A 1GOIA 2VUYA 1K6AA 3KOYA 1VFFA 3FHAA 4FO4A 2BV9A 3QHNA 3O05A 1X98A 4UUIA 4FB7A 3G1AA 2YW4A 3WNLA 3C2FA 2PS2A 3RNDA 1VYRA 2ISVA 3UG5A 4GRSA 4IICA 3EMQA 2WK2A 2NVAA 4OVXA 4E5TA 2BY2A 4DWSB 3GM8A 3CMGA 1TE6A 1KR0A 4UQEA 2YX0A 3APTA 5K9DA 1V0LA 1HP4A 1FXPA 2OWWA 5C8BB 1UD8A 1NOWA 3ENLA 4L64A 3IUIA 4O19A 3WD4A 3NL2A 1E4MM 2VOTA 3CIVA 4GG9A 2WZHA 5D9PA 3SCUA 4PUEA 5FF4A 3T7VA 3W6YA 3KOFA 4EWND 2CWXA 1P0DA 3ZWTA 3RK8A 4X2PA 4H04A 1UWRA 4JDYA 1C29A 4QG9A 2PGWA 2IUZA 2WC4A 3SGUA 3GXTA 3CUIA 2Q01A 4GCAA 1J79A 1FUYA 2R1NA 2R94A 2W5FA 5BCAA 3E38A 1MQRA 3MI3A 3THUA 4S3KA 1XF0A 1PYMA 3E0VA 1VAHA 2VQTA 3T1GA 2YZ5A 3H26A 1F6KA 4MZYA 3BCJA 3QY8A 3ZVHB 2IS7A 3NEHA 1RQHA 2WPBA 4UTKA 5J04A 2YB1A 4NRRA 4GZ7A 3GLCA 1AD1A 3RR4A 1OFAA 3NSMA 1X8CA 4OT7A 3ZIZA 5E6YA 2G4FA 1GZJA 3SO7A 5HMEA 2J75A 4JIPA 1B5TA 1TJPA 3G8EA 2O7SA 1XH1A 1IV8A 4H7CA 1PO9A 4HN4A 4TV5A 4Q8OA 1EQCA 2FHBA 1SJCA 3BE7A 2QPXA 1KM4A 3EA3A 3EDEA 4MDOA 1AVAA 2J9ZA 4I5UA 3L5MA 2Y85A 2OGYA 1J9YA 1YIXA 5CH9A 2QCEA 4JEJA 4A4AA 3PNZA 4TOQA 2OQLA 4G56A 2XU2A 1EX5A 1NP0A 4R33A 2O7QA 2AQOA 2NLYA 5I23A 4JIQA 1TV2A 5A6TC 3EX6A 5EMLA 4HHPA 4PTMA 4QGCA 3W25A 4O52A 2XN1A 3SFWA 4YPJA 4RNJA 4Z2HA 2V3FA 1WV2A 1J4EA 4HMCA 2OKOA 2BVDA 4UTHA 1R9YA 1PZ2A 4IH3A 3TAOA 3CH9A 4TX8A 4IG2B 4D6GA 1WDDA 2I1OA 1H62A 3KOXA 3QW4B 3KRSA 1NTHA 4G8TA 3KCJA 4MZ1A 3IRSA 4JTCA 3WQEA 4UMCA 1E3XA 1XD1A 4H9UA 4PMRA 1SO6A 1UB3A 3BQ5A 3KLLA 4UFIA 1R86A 3T2PA 3G1SA 2Y8VA 4X61A 3GHSA 4MAVA 2HXUA 3SIZA 3GHUA 1SYTA 4IQJA 2DT2A 3RM8A 5D2VA 4DJEC 5C5YA 9CGTA 2VQUA 1F07A 1BXCA 4QEHA 1OY0A 2QW5A 1ZSXA 3GU1A 1XWYA 3VFLA 2YZRA 3OBAA 3BAWA 2F7FA 1ECQA 2RH9A 4LSBA 1E71M 4P7OA 3URBA 2FZMA 3CV2A 1RPKA 3TJLA 4DXKA 1DJXA 2BB0A 1XRTA 4PMYA 5DCDA 4E2OA 2FMNA 2A7NA 2BOEX 4UMBA 5IRPA 2AAAA 4QLJA 4Q8MA 3TZFA 2GQ8A 1RLDA 3V0SA 5D05A 3OJGA 1KRBC 4X9SA 3W6MA 1US0A 3WO8A 3GRIA 2QDHA 1NFGA 3GUGA 5A95A 3V5FA 3GB6A 1J01A 1KW1A 3N2BA 3LHVA 2PUZA 3BG5A 1DWJM 1B54A 5I03A 3GY1A 3DFSA 3V35A 2J78A 1DQXA 4DUXA 1IGSA 5A2BA 3VNDA 3VD9A 4A8IA 1E0TA 5A8QA 3EKLA 1TMHA 5LHFA 3ITTA 1L6GA 3W1RA 1O4UA 2Q09A 4PSRA 5M17A 3PTQA 3NQ7A 1V7AA 5JXQA 1W3JA 3O63A 1EH9A 1TV3A 4XBJA 3DEQA 3GNOA 2DT1A 2I14A 4XD6A 1FWNA 1LLOA 2WWDA 3OW1A 4J27A 2G0WA 1MXGA 2QR6A 4JNMA 5H91A 3S4TA 2O92A 3WJSA 1W56A 3ZR6A 4ZR8A 2WKJA 4JTUA 1CLKA 1LOQA 3I3BA 1PXGA 3NM3A 1HL9A 4NG3A 4XV0A 1X1NA 4AEFA 4PEKA 1CXFA 1OX4A 3QW3A 4B90A 5C2XA 4U10A 5KETA 4IXXA 3BLPX 1B3ZA 2FMOA 1KLZA 4B5TA 2JBMA 3GUWA 5IFTA 3TTYA 4ASTA 3DX5A 5GNYA 3LU2A 1HG3A 2FH8A 4Z2GA 4E2BA 1B3YA 4AZBA 1GVEA 1FWTA 2Y7FA 2ZQ0A 3WD0A 1LL6A 4IT1A 4JQ1A 1MO0A 1A49A 2TAAA 1TR1A 3GE7A 1BYAA 4AVOA 2JEQA 4A8LA 3GVVA 1Z48A 4I5RA 7ODCA 3UFYA 1VPXA 1AQ0A 3CS2A 4GIRA 5I3GA 1O94A 3KZSA 4ZXLA 1GUVA 1HJVA 3MCNA 5A2CA 5D09A 3W85A 1TPUA 3M5YA 3S2CA 4AAJA 4XUGA 4BFAA 1R3TA 1HTIA 3NPWA 1MWOA 1G6CA 4XIAA 3VM7A 4QDWA 2NVDA 1OX5A 2PCEA 3MCMA 2YBUA 1FCUA 3LTYA 5FF3A 1XLBA 1JXKA 2X7VA 3GTFA 2HDJA 1TJ1A 2B81A 2BXYA 2D2GA 3WJYA 1UKSA 3STEA 5FEZA 2EAWA 3KBVA 3R25A 3UA3A 4HPJA 1A47A 1MQQA 1ODZA 3EWCA 3ZJ7A 4PUWA 4ACYA 2BLEA 2D3NA 5C9UA 3MO4A 2CLIA 2EPLX 3EEGA 1LROA 3DG3A 5B80A 4GI4A 5G1TA 2IXVA 3ECQA 4K3ZA 2VC9A 1X6LA 3KWSA 3B8SA 3LCIA 4H4IA 3LSBA 2PWDA 1ZPTA 3N6HA 4L9ZA 4IFOA 1SZEA 3AHZA 4CLMA 3M0VA 2W66A 2ZUUA 2UY4A 5A6AA 3T44A 5LGXA 2G3FA 1CT5A 2QUNA 2CLHA 4UZUA 1W54A 3LM3A 4FX8A 2QCLA 2OLSA 3PWIA 2J8GA 5CC6A 2HMCA 3FK4A 1N7KA 2EKCA 2WZIA 1M41A 2O9PA 3E0WA 1G4PA 5BYWA 2VR5A 1V8EA 2INFA 4DJDA 3N25A 1PKMA 1RHCA 4AZIA 2FQIA 3DAQA 2HE8A 2BS9A 3ATZA 5G4WA 1RBLA 3WLIA 1KGWA 5HWJA 5E9AA 4MZ8A 4M3PA 1LUCB 1UWQA 3HPAA 1A3WA 2G50A 1H2JA 1Q6DA 4NZ3A 3VD7A 4Z17A 3WMSA 1UH2A 1DL3A 1HJXA 1NFPA 4RE0A 3EOEA 4OE7A 1L9WA 1EOMA 1H50A 3VU2A 2PDQA 4BI7A 5MKGB 2BTMA 1ZJIA 2ZXQA 4R85A 3GFXA 2V6AA 1RY8A 4GFIA 4JBRA 3GDLA 1NELA 1FH9A 3UERA 4NQ1A 3RFAA 1VJSA 2D20A 3THDA 3N17A 1JYXA 4N9DA 1XLLA 4I3GA 1XICA 1YBQB 2VO5A 5D4YA 1QDSA 4CU8A 1T0OA 4Q32A 1R38A 2PBOA 2XWEA 4N9CA 5AYIA 2V63A 3GIQA 4X9YA 2OQHA 3WF1A 2EG8A 3W70A 4HSOA 4IX2A 2A5HA 4RL3A 3GK0A 5KMYA 1H1NA 3G1FA 3AXHA 4P2VA 1J2WA 2QCMA 4HMDA 2L5HA 3CL6A 3HFYA 3W88A 4UTTA 4M81A 3GS6A 4E4UA 1XDLA 1AMYA 2Y24A 2ZZ6A 1LWHA 4ML4A 2ZICA 4JY8A 4ORIA 4NL1A 4URIA 4MGGA 3WEZA 1BG9A 4CD8A 5C71A 2HPMA 1UBSA 5KTLA 2J7GA 2QGHA 1OABA 2X09A 3B8TA 3TYCA 1OFRA 1TPFA 4CD6A 4GUHA 1X6NA 4JN7A 2ON3A 2QPSA 2FZ8A 3DG7A 1BHGA 3L2IA 3WLTA 1KFBA 3DENA 4DZIA 2WMIA 1GOOA 3GU2A 4GQRA 1WXYA 1OFOA 4B2DD 4FIQA 5FOOA 3TSBA 3ZLFA 5BXSA 3WK1A 2XSBA 2DSVA 2GGHA 2Z2BA 3H23A 1W3NA 5B7ZA 2J79A 3HGJA 2IQ0A 3AI0A 2IQTA 3A4AA 2OT0A 4LALA 2B7NA 1JNEA 1LT8A 2W4XA 1Q7ZA 1FCQA 2ZUSA 1EEPA 1Q7MA 5CPSA 3WSUA 1GQIA 1GNXA 5CG0A 1KTCA 2DH2A 3H7UA 3N3TA 5CQ1A 5CPMA 3T55A 3WBWA 1GPFA 3UWYA 3NOYA 1M9HA 4AMCA 3PZMA 4MB3A 5REQB 2XIMA 1W2VA 4ZO8A 4US5A 3CNYA 1GW1A 2PTWA 3MKVA 3VKBA 1G67A 1Z69A 1KGUA 5BW6A 1G7UA 3S5YA 2ZRWA 3UZ5A 1WNOA 1JDDA 1JCYA 5DN1A 1UUOA 1H11A 3I4EA 1EPXA 5LIUX 1HZYA 4UNKA 3SY8A 4WY0B 3FA4A 1ZFJA 3RDKA 4NASA 5I6SA 1HFBA 1WZLA 1GK8A 2W62A 3VGDA 1DV7A 4JFUA 3H4WA 1XH2A 3QRHA 2XUCA 1FWDC 3SSZA 6ALDA 4MYXA 1C92A 3P3BA 2YL5A 4HIBA 2EHHA 3T0AA 3PUOA 5F2LA 3TNBA 3FGCB 1S38A 5ABFA 4WOQA 1XYLA 1C93A 1VPQA 3UD6A 1QPRA 4Y9MA 3LYEA 2A0NA 3TLQA 1J0YA 5EYWA 5DXYA 4J3UA 4IIDA 3AO0A 4Q7IA 2D73A 1QXLA 1AL8A 2ZZ7A 4BF7A 1I2OA 1VH7A 4FSAA 1SPQA 2QYGA 4PRWA 1C90A 2Z0IA 3EXRA 5I5RA 3B05A 3KXQA 3WQ8A 4QTGA 4UQ9A 5AHEA 4WVXA 2W0UA 3T8QA 1SJDA 2VX7A 1CX9A 3CU2A 1SO4A 3IJQA 4YTUA 1FHLA 4DWSA 1RV8A 1C3FA 3LB0A 5HNTA 2CLMA 3NO3A 1E9IA 1XYMA 4BWLA 5EY5A 1T96A 1T5AA 1UUQA 3CHCA 3GH4A 3SR7A 2F84A 1C7SA 4C6NA 1K9EA 1XGDA 4JIIX 5JIWA 3M5XA 3V18A 2WYSA 2DY3A 3VIMA 5I07A 3CPRA 5CJMA 3KOWA 1K6WA 3NGJA 1Y0EA 1J8VA 1JFHA 4XZHA 5DMMA 1FCBA 4YVXA 3W2KA 3IEBA 3NL3A 2I5QA 2B7PA 5JBFA 3VNIA 4CNOA 1YPXA 2ZZ2A 1C8VA 4O0QA 4F0HA 2R1KA 3S1WA 3VE9A 1EJVC 3W81A 3P80A 3BUVA 3MSDA 1A5CA 4DXVA 5I06A 4C7GA 1SMDA 3S46A 4F2TA 3PSVA 3UQNA 4FX7A 3ZVHA 3R79A 1J12A 4CEUC 2PDIA 1E9ZB 2P8CA 3JRKA 4B9YA 1PL9A 3BW4A 2ZUVA 4N7QA 3MMWA 4XKMA 3S83A 2WC3A 4N42A 5KZEA 4O1BA 4DBDA 1TZ7A 4W7VA 5E6ZA 1VYPX 1DVJA 3OODA 5DANA 1ZBKA 3W02A 3PUDA 1VHNA 2Z2UA 3N14A 1RBOB 3WIJA 4HSHA 3E5PA 3BMWA 3TDFA 4C6LA 3C2OA 1LLWA 4LF2A 4JIHA 3MVTA 1RPXA 3CPGA 4GQ0A 4R53A 1L2QA 2V82A 4O4VA 3IV8A 4J3ZA 4XZBA 3NEVA 1MZRA 2RUSA 3K2GA 2VOMA 2BVTA 2VFIA 3TR9A 2Y7DA 1GKPA 4B5UA 2DEPA 4IX0A 4DPPA 4QR6A 1CYGA 4E3TA 1JZ8A 4P61A 3VMOA 5A69A 1E6QM 4IG2A 4QCFA 3OVPA 3K8MA 4XX6A 3WLHA 4UXDA 4ZE5A 1KA9F 3IJ6A 1K77A 2VD9A 1A5MC 4G7EA 1EEXA 2FDMA 1HGWA 2DUAA 3BAYA 4S3AA 3W7EA 3W26A 2D3LA 1GQKA 2ACRA 4AWTA 1PIGA 4KS0A 1UROA 2VWTA 3PSWA 3QGKC 2QLYA 4X2RA 1F8MA 1BEUA 3E1F1 4FR6A 6CGTA 3CT2A 3H2FA 2H6RA 4LRSA 3HMCA 3AISA 3VPLA 5IDIA 4IP7A 2DW7A 2PLMA 1FWGC 3UZWA 3CIWA 5D03A 2ZX9A 4IPLA 5I79A 4DYEA 1BKHA 3C0SA 4YL2A 1HKVA 4Q8QA 1JIBA 4HCDA 2JGQA 3BLFA 4ZQRA 4L4OA 4QNEA 3TYEA 3MCOA 3FLUA 3VDHA 2VMFA 4ZSTA 1NQ6A 5TNVA 1TVPA 2WPGA 3B04A 4QHRA 3NR0A 3BLLA 4LS2A 3ZYZA 1SM9A 3ZVIA 5FSEC 3LENA 3LBCA 5DRIA 1Y65A 1F3WA 2E25A 2QXWA 1XYFA 4JHZA 3RG6A 3NUKA 1H7RA 2DZAA 3C5QA 3A4XA 1QNQA 2PGRA 1DKWA 4KQNA 1UPPA 5FF7A 1SUXA 1HL2A 1VCGA 3RPTA 4RE4A 4GFSA 2H8ZA 4H3DA 1I2QA 1IE7C 1KCLA 3BW2A 1PHWA 1FWWA 3AUJA 3U2CA 3I7SA 4BI6A 3M0LA 4PRTA 3Q94A 2PF8A 1POKA 4RDZA 3MYOA 5BXPA 3ZS4A 1OT1A 2WNQA 3ONBA 4TUFA 3BURA 2WHKA 1P0NA 1HJSA 3GDRA 1PHQA 4GX8A 5EKYA 1UP3A 2PTZA 3W7MA 3QQWA 4HYRA 3W72A 1MFUA 3PZQA 2JKAA 4H9YA 3VO0A 3WDIA 1QWKA 3SQSA 1UR2A 1EHNA 2JKEA 3OLIA 1VR6A 1E51A 3V5CA 3AUOA 3TYUA 1Z41A 4NI8A 3VUPA 4M51A 4IGMA 4AEOA 3TSDA 2C14A 5D32A 3ANUA 1PCWA 2NQLA 2UZ9A 1AA1B 2EQDA 4GA8A 3HGSA 1K8XA 4RJEA 1E73M 3P14A 3W2UA 3V1HA 4GYPA 1K9DA 2HEJA 3GC4A 2OEKA 2FFCA 3FSUA 3K4AA 3LGEA 2J4GA 1U83A 1VBGA 3G1RA 2OYLA 3KVKA 1A50A 1L6YA 5D37A 3HG5A 4JTAA 3FVMA 5U7SA 5M2FX 4GK8A 1QNSA 4AZHA 1XDJA 4L9YA 4E38A 4OOZA 3A24A 2VT0A 2I5GA 3W1AA 4MAZA 4P7NA 4PA8A 4ZEPA 1T6MA 5CC7A 4QNWA 5D2TA 1LYXA 4EPEC 3EPMA 2W3ZA 2CZEA 5C55A 3N18A 4MY8A 5HBFA 3WQGA 4ZA0A 3GIPA 4KFNA 1ICSA 1VBRA 2DGAA 2TPSA 2G95A 1Z42A 1C8XA 1R47A 2PMQA 1T7LA 2GJLA 3W3OA 4IGSA 3BVJA 3DIPA 4LUTB 3KM8A 1Q6CA 4ZENA 1GVRA 3FEQA 4IUGA 5CAKA 4OHQA 2PDUA 3BW3A 4N6EA 2QMKA 2PTYA 1ZCCA 1LDCA 1A5UA 4PGLA 5HQEA 1A4LA 5BOOA 3TOYA 1Y7VA 4JTEA 4MJ4A 2DJLA 4KPLA 3L67A 2Y61A 3PR2A 1F3EA 2G97A 3M5ZA 4D8ZA 2EPOA 3WX7A 5TAOA 5F1UA 3LD5A 3FN9A 1N8WA 3BAIA 1BQGA 3SGGA 3LV5A 2CFFA 2E68A 1W1YA 5DRCA 1FWBC 4P7LA 1Q6EA 2QCHA 3SADA 1ALDA 5A5WA 2E8YA 4O8RA 3O6YX 3EWZA 4IZGA 3N2OA 4O0ZA 4CQCA 2VFDA 3W7DA 3F1QA 2Y5SA 3DBPA 4S3GA 2GJXA 3ITOA 4GY1A 1GVOA 3ZJKA 3TEVA 2VFEA 4O8AA 3VIKA 3VDBA 1KFJA 1LUCA 4MY1A 4X63A 3KTCA 4UR9A 4U28A 3IJDA 2PDNA 3DFPA 2IQDA 3GTHA 4DJFA 4AF0B 3HM7A 2H9AA 4GUIA 5C9RA 4MWAD 1EKOA 1OWQA 1QTWA 5MKGA 1XGZA 3DI1A 1HKJA 1XQKA 3NIYA 4H9XA 4O17A 2R9RA 1P5BA 1GW9A 1RD5A 2PLKA 3T78A 3AS2A 1CECA 4J3TA 4XZMX 1AH3A 4AZGA 3B0YA 3U8GA 3TC7A 2P0OA 3W27A 1YBQA 3ALGA 4HPGA 4JNZA 3W86A 2WVVA 1WKFA 3O3RA 2CBVA 1WAWA 3GFZA 2BODX 3QC0A 5CZKA 1OD8A 3V75A 4NHVA 5DBTA 5TD4A 1U22A 1V3HA 4GNKB 1MI3A 1UJQA 3DESA 3SDOA 2V3GA 3VUSA 1Z9AA 1Q6QA 1UUMA 3TTEA 2DH3A 1ICQA 3TFCA 5FF0A 4RZ5A 3QR1A 3S8HA 3H54A 1H1YA 3ANYA 2X42A 1U30A 1V3IA 3JZUA 3L2MA 4TTUA 1QW7A 1XIEA 4YCOA 2C16A 2DU2A 4B5SA 4AD1A 1E72M 4CU7A 3IK2A 3QV6A 1RP9A 2VX5A 1L6FA 2Y5JA 3MJMA 2VC6A 2D0GA 3CYJA 3R8RA 1IZCA 3BGAA 3KBNA 1V02A 3M44A 3L23A 4U33A 1R3YA 3SUVA 3QMTA 3TTQA 2ADAA 2VTFA 3G3MA 1H0IA 3K30A 3QSRA 1QAPA 4JXCA 4D6IA 3VC5A 1KTBA 1GVFA 4Q4SA 1FX6A 4JTRA 1S2CA 1R85A 4W8LA 1V6TA 4TTGA 4K1GA 2F8QA 4LVAA 4NX5A 4WLCA 4FIRA 3BMVA 1WO2A 2QIWA 4OQVA 4EPDC 1DJYA 2W67A 1VEPA 4OKDA 3DFOA 4TVDA 3W0KA 1LCOA 1K02A 4OV9A 2RGMA 5IM51 3BLOA 1KKOA 3R7MA 2HV5A 3CO8A 3Q65A 3T07A 3TX9A 5H8UA 1Q45A 3WH6A 1W9UA 4W93A 4G7FA 3CUFA 1A5NC 2VEPA 4MVAA 1GVQA 5J5DA 3HZ3A 5REQA 3RCNA 3OZPA 4JKLA 4ZB5A 1AH0A 4MFDA 4A22A 4MMWA 4C6KA 5HMDA 1AJZA 4S38A 4CD5A 1WBHA 1QT1A 1XGEA 4BWLC 4WY0A 4I6VA 2XDFA 1DPMA 3KS6A 3L68A 2OQYA 4LOCA 1WUFA 1CLVA 2OO0A 4M6VA 4V27A 3UR8A 1E6RA 4YXGA 4IXHA 8XIAA 4XAYA 1W5QA 1FOBA 3PP7A 1IXNA 3MC5A 1NDWA 3ARUA 1Q63A 1CGUA 2QDDA 2UY2A 4WQ6A 1P6CA 3FGCA 3P6LA 3VIIA 1KQYA 1IWAA 3KL3A 2TODA 1W1B1 1TB3A 3RAOA 1XISA 4F4RA 1E70M 2OZ8A 3PTKA 4WKFA 4GBUA 5DEZA 4W89A 1B3XA 1K8YA 2YXOA 4YTTA 3VD3A 2WZMA 1SGJA 5CZ0A 3AIEA 1F74A 1K70A 3AS1A 2HSAA 4AZCA 3FDKA 4LCRA 3KDNA 1CGWA 1TV5A 1UR0A 3S2JA 4PZVA 4I7VA 1U1HA 3BICA 2ISDA 4NZCA 3PUEA 4XAFA 3EOSA 4NJJA 4F79A 1B3OA 3P81A 1TJ0A 2ZC8A 2R24A 1JAEA 3B97A 4GYJA 3KLKA 2Z1KA 2P50A 1V6WA 4JTTA 3K1GA 1KFKA 5I00A 3VKCA 3HIJA 5HWNA 3P5YA 1FFQA 2J25A 4Y9OA 3WH9A 4QE5A 1XP3A 4GI8A 3W7KA 4DUWA 2FIQA 4BKNA 1H61A 5HMFA 3CH0A 3DFNA 3R0KA 4LYPA 3WLQA 1XFCA 4PTVA 2CITA 4MWAE 2F2HA 3CGTA 2NWSA 2XIQA 5LA0A 4WK9A 2NSXA 2PSNA 2UV8G 5E09A 3WD3A 4MOZA 1KXVA 2GUUA 2YW3A 3WJXA 3IIZA 4KWOA 3S5NA 4OJYA 2ZA3A 3QFWA 1TELA 4ILSA 5CPOA 3BCDA 3HQPA 5LHEA 4DXXA 4ZQCA 2J77A 2GDQA 4KMQA 4Q8NA 1S46A 2ONEA 3G3DA 4CNUA 4HHLA 2DV0A 1CZ1A 3CIXA 3W01A 4QLLA 3EAUA 3S9YA 1GOXA 1H63A 4ICNA 1HJUA 4MNLA 1CW2A 3CV7A 3WQWA 3BSGA 3YPIA 2BY0A 2Z29A 3SJ3A 1B30A 1FQ0A 4FXFA 5HAOA 1RQEA 3A9BA 1ZALA 1J6OA 4W5UA 1QO5A 2GSJA 4UQBA 4UNLA 1PJ9A 4M19A 4OUIA 2X05A 4B3LA 4PMNA 2YXGA 4D72A 3QMSA 1E1CA 1I1WA 1WOBA 3BAJA 1V7YA 3MVIA 1M1BA 3QHMA 4W9TA 3OBKA 2WNZA 3OVQA 1EYEA 5K2ZA 4X0VA 1TZ9A 1GTHA 4PMQA 3SCPA 2ODOA 5LSMA 5A8MA 1VCVA 5CBIA 3H2NA 1FBAA 1AJ0A 4AW7A 3AHTA 1RK5A 2YIHA 3NTYA 1RCOB 4ATDA 4PMJA 2YFNA 3NQ2A 2FTWA 2XZ7A 1OZMA 1OB0A 3P8JA 1V0NA 3T0DA 2W27A 2OKTA 4WSKA 4UQCA 4A6GA 1XSKA 3E49A 2VKZG 2EPKX 4CQ8A 1XLAA 5G1YA 4UFJA 4A3UA 1R3QA 2OXNA 4PR4A 3CYVA 4IGHA 4P8WA 1NIUA 1AZ2A 1KM3A 3ZFHA 2FPYA 4AIEA 3GW0A 3W73A 4R34A 2ALDA 1DTNA 4JICA 2AL1A 3C4UA 3IWPA 1MQPA 1J5TA 1A80A 1OIFA 2FZNA 3UJRA 5DY3A 2A3LA 2IKJA 4GIYA 4XZLX 4JHOA 3MJYA 4AX6A 5CZSA 4M80A 3XINA 4GQGA 2ZOXA 3A3HA 1SSGA 2OG9A 4IIBA 2P3ZA 5FACA 5AYBA 4QAIA 5BXRA 1TWDA 2O4MA 3HFTA 3L9CA 3PM6A 2JFEX 4RZ6A 2XSAA 3C0JA 3RGTA 2JF6A 4HU4A 4AIBA 3D46A 3IVTA 2ZA2A 4UQAA 3STCA 5GJPA 5CSSA 4DYJA 4XAZA 2WC7A 3HA1A 4CVUA 1Q65A 4AD3A 4GUGA 4W5ZA 1XW8A 3R8HA 4F48A 4IP4A 5FJUA 5LKYA 5F2IA 1CGYA 4RNHA 5CC3A 2VX6A 4D6EA 3LQLA 3E0IA 4FLSA 3UG8A 4XAPA 3LZ5A 1WQ5A 2HPIA 4RV3A 4Y8EA 1QPNA 1EC9A 2OPJA 1TTJA 1I9CB 2EG7A 4H19A 4XVEA 4LNYA 3R89A 4DZHA 3F4VA 3ABQA 2A7PA 3QJAA 1DWIM 2OVLA 4RR4A 3E2SA 4GYPC 3TYAA 2Y70A 4GI9A 2CETA 3AYTA 3R5EA 2E6AA 2QDGA 1W9BM 4I5XA 3VIHA 1JGIA 4B5NA 4BF9A 3LLDA 3TTOA 4ZFCA 4HYWA 3ES8A 4G9PA 4IM4A 1FCVA 1LZOA 2I9UA 1LT7A 1XUUA 4HN8A 3G1VA 2JE8A 4LT9A 4ZO7A 1RJPA 3O16A 4LC8A 1OFQA 3R11A 4W85A 3LQGA 1VFMA 3BMXA 4YWSA 1BYBA 4GH1A 3C0QA 2GL5A 2ZC1A 5EMYA 2BOGX 1TUFA 4RZ4A 3QZAA 3KE0A 4ZOEA 1P43A 4KBXA 4TX9A 3RX4A 4QBXA 1IQ8A 1R9ZA 3VNLA 3OZMA 3ARPA 1S1RA 1GKRA 2PDLA 4CCCA 3U48A 2PWUA 3VKDA 4LUIA 2ATMA 3NQ6A 3VMPA 1CBGA 5FD0A 2W92A 4QM1A 5E1QA 2J66A 3HG2A 1X7FA 2X1TA 1XSIA 1CXEA 4Q4OA 2BY1A 4FNPA 3H2OA 4JN8A 4N4QA 4WCJA 1OFPA 3HV9A 3NQBA 4H8UA 1JPIA 2X2YA 4WXYA 5KINA 2ZXBA 4DBUA 3AMCA 3BO9A 2PD9A 2HS8A 2IPFA 4L7ZA 4FXSA 4RW5A 3B8DA 1UKTA 1I75A 3TOPA 1W5MA 3APGA 4JTIA 3TXVA 2BFGA 3T09A 3LN3A 4UTMA 3STGA 4J7RA 3URNA 4AB4A 2PI6A 5AYZA 3ARTA 4PTDA 1U5HA 2QMJA 1LQ0A 3EDKA 4U5IA 5HNNA 3UWUA 5E70A 2FGLA 3JZEA 5JIPA 1N2VA 4OOUA 3LY0A 2CU0A 5HMSA 2A1YA 2YA0A 4JQ2A 3CQ0A 3W23A 3ZSSA 3UZXA 2CHNA 1VQTA 2CHRA 3M9YA 4GYFA 4FF5A 4PRRA 4MLRA 4NF7A 3QBUA 1JL8A 3K5XA 2QJNA 5E0FA 3PPHA 2GOUA 5GJNA 4LAKA 5FJRA 2MUCA 4MM1A 1QNOA 4MJZA 1B2YA 4NUWA 2V69A 3NVDA 5DLCA 3M0HA 4DJFC 5HUOA 3F5LA 5DMLA 1R3RA 3FAWA 4WHBA 1O68A 2POZA 3NZQA 4Y9AA 2HTMA 3O8AA 1BFNA 3MSGA 3ONCA 1ZJHA 1X96A 3BV7A 1YEYA 4QEEA 1ZAHA 2WWCA 4TO8A 4JKKA 5T9CE 3UJEA 4O1EA 4PB3A 1JF6A 3BGGA 2VD8A 1QI3A 2J62A 3PJWA 3GC5A 4DVOA 1AD4A 5I24A 3REQB 2E8ZA 3CAWA 3B8VA 1HIZA 1S2AA 5I0DA 4JDBA 5CEWA 5I3JA 1EQPA 1GKQA 1BD0A 3A3XA 3IUHA 2Z1SA 3E12A 4G1NA 1QW8A 1OGBA 4YVVA 4AZ6A 5AHFA 2ISSA 4KEMA 4WGXA 4HK6A 1DE6A 3QKEA 5DMNA 1N82A 1H51A 1EDGA 4IUOA 1UASA 3MS8A 3WQFA 1KKRA 2WSKA 2P1FA 3A47A 2X0SA 3S2LA 3O1NA 5GVJA 4QDMA 3KVJA 1YW1A 4C6JA 3W1QA 2A3EA 4B4HA 1GTEA 4AF0A 4IISA 2CBIA 2PGEA 1ISVA 2JQXA 3KTXA 3CMJA 4LU0A 4IL0A 3GG8A 1QU4A 1H7XA 4FNTA 2VGBA 4XZWA 1MEHA 1XG4A 3IAQA 4NP7A 5HR6A 2PWGA 2NX1A 5G2HA 4WXZA 3WQOA 4ZXOA 1UBPC 3PAJA 3C52A 4ECLA 4IMAA 3TE9A 1UKOA 1F3XA 3AIRA 3C2RA 4B4FA 1PZ1A 5FCZA 2NZLA 4TX6A 2PDKA 4DO7A 4LVGA 3O0KA 2CLFA 2F38A 1JI2A 1HUVA 3RLHA 4EOUA 2F6XA 3OQEA 1N8FA 1NWTA 1VFLA 1ZNNA 1VGAA 4BQ4A 5E5CA 3CQKA 3M43A 3GXDA 3ABOA 2PDXA 3L66A 1RA5A 4M56A 3VOGA 1EA9C 2C7FA 3S5ZA 3HG4A 3EWYA 4M1RA 2J9YA 1OYCA 4LQ1A 1H49A 3AALA 4JIRA 4XISA 2J27A 2NLIA 3L5LA 5CJNA 3OO2A 3OVRA 1MUWA 4UTIA 1ZTVA 2DT0A 2I5IA 4K8GA 5EB8A 1O12A 2ZUMA 3NQDA 2BX7A 1KTNA 4H2CA 1DJQA 1JNDA 2ZCGA 5I77A 4JX5A 1R87A 4IIEA 2GSHA 3OGRA 4YVPA 4X60A 2CKRA 4L6OA 1FY6A 1MW2A 3SJNA 3UWWA 1W3KA 2QPUA 2QVNA 1W31A 1Z3NA 3GG1A 4O1AA 4K6AA 2ZIDA 4HOXA 3B0VC 2P8BA 4HNNA 4NX0A 4S2CA 4XAGA 3ITCA 4Y96A 3VYLA 1J0HA 4P8XA 1SO5A 3SB0A 1DJWA 3MUIA 2FHFA 3H21A 3VIGA 2PGFA 3NZPA 3OPSA 3RILA 4O28A 4TVCA 4OFCA 3OGVA 4MSSA 8TIMA 4V2XA 4RKAA 3EOOA 2BXVA 3E9AA 2YJQA 3QFEA 1EL3A 3VD5A 4DB7A 1AG1O 4HZ7A 4RCXA 5G2IA 1BRLB 4W8AA 2X1RA 2IPGA 3AXMA 1FWFC 1A5BA 4L9XA 3TN4A 1ZCOA 3FKKA 4LB3A 2HS6A 1NM9A 4IIGA 4GBDA 2QAFA 2CBUA 2VGIA 2BOFX 5DMYA 2DJXA 3BSHA 5HOSA 2VP8A 4XTDA 1PAMA 4PB4A 2EXOA 4QS5A 3TQVA 3TONA 2PA6A 1JD7A 3PJXA 4EXBA 1XKYA 1W9XA 3RYSA 3GG7A 4A8NA 3H4GA 5GPRA 3PBWA 4ZTYA 4AX7A 2AOSA 4MPQA 4XTIA 4JIEA 3CAKA 7CGTA 4HNLA 3XIMA 1LORA 4O4WA 3L0KA 2G96A 3GR4A 3WL0A 1OBAA 1CB7B 5GNXA 2D24A 1H60A 3G6LA 4PFMA 1E40A 3E74A 1U1UA 3N2CA 4NU7A 6XIMA 1LLZA 1TPWA 4MJMA 2ZXAA 1RALA 2KZHA 4KGJA 1TPVA 1E5JA 4GVHA 1KWGA 3M0XA 4V33A 3G22A 1BYDA 3U2EA 2O0TA 3LZ3A 1B4KA 3II1A 4NT0A 4C1NB 3EOLA 3PFRA 1BVNP 1IXPA 1UZ4A 4LF1A 1RVKA 3I6RA 3URAA 2QCGA 4NY2A 1QMLA 3G0XA 2RHGA 4H83A 4DBEA 1A3HA 4LYRA 2ACSA 1XIJA 3GNXA 2C15A 2FVMA 3SN1A 5AECA 4DBSA 1CI1A 2C8NA 4R9XA 2Y88A 1Q4WA 3KOZA 3NQFA 3N73A 4MB4A 4C65A 1OK6A 2GQ3A 2A21A 3ITGA 3FNDA 4NXKA 4IMEA 1LG2A 1TUXA 2J8TA 2E9MA 2HE5A 2V30A 1I45A 1P0BA 1MRQA 1B4EA 1F61A 4NNBA 3HPZA 3GKFA 3DECA 3G6MA 4D8LA 2NUYA 1A53A 3T0TA 5CLWA 4HJWA 1C91A 2AL2B 1OHLA 4E8GA 5FJJA 2DZXA 4U5KA 4P7RA 1HF6A 3M64A 3DFHA 1HL8A 4HOZA 1CCWB 3HMJG 4H6EA 4R88A 1REQA 5KZMA 2X0HA 1MUCA 3AQUA 3F2DA 2P0IA 2EBNA 4LB4A 4PTNA 5CJ5A 2NWRA 4UZSA 3DOPA 2OZ3A 5C7VA 3PY2A 1JRCA 4J2MA 3UNDA 5HK4A 4UTJA 2C1HA 3QTPA 1S5MA 4B5VA 3ZO9A 1GQLA 4AD4A 3MSYA 2BXZA 1KV5A 3BG3A 1R3WA 2MANA 2V8ZA 1RP8A 1FDYA 2PDJA 2BVWA 1A5OC 4Z42C 4LH8A 1AW2A 2GWNA 1XIIA 3CWHA 1NH6A 1L6WA 2WHMA 3T0BA 3TCSA 3H55A 3M07A 1V4YA 4HZMA 3WUEA 3VOFA 5IBXA 2Y89A 3W2MA 3GNRA 1Q6OA 1PZ0A 2GJNA 2ZRUA 5AYYA 1QPQA 3ABXA 1US3A 1A3XA 5DFAA 2ZWYA 3Q37A 3W82A 2UY5A 4XKYA 1TMLA 1S2VA 3WZ0E 5HNUA 1XPYA 3L4TA 1MMFA 3BTNA 3INPA 3AMDA 2VDHA 3TA6A 3SRKA 2XSXA 4B5WA 5T91A 3UWZA 2PZ0A 3AHXA 1F8IA 5CXPA 5I7GA 4JY9A 1KB3A 4Q8WA 2Z24A 3H24A 3M0MA 3BOFA 3QZEA 2B4GA 2Z26A 2E67A 4N02A 2CKSA 1NOFA 5JBEA 4YNGA 3TVAA 2HNHA 4Z2KA 3EX4A 1GVSA 4R3UA 4KGLA 1OCJA 3HN3A 3QGAC 3KRUA 1ME7A 3DH7A 3CUJA 2Z6JA 4DUOA 4FPSA 1RAKA 2UY3A 1EHAA 4UOZA 3OIXA 4MB1A 2PP1A 3VNJA 3QY7A 3WEMA 1G1YA 3PG8A 3H7VA 3NQEA 4C60A 5F1VA 2NXGA 1EDTA 2Q8ZA 2ZVRA 3ABZA 3U7VA 3GTXA 4MWAC 1HVXA 4M6PA 5LXXA 4PFHA 1YNQA 3WQCA 3BARA 3PBVA 1OADA 4K7VA 4KCTA 3ZJ8A 4ERGA 2QCCA 4QSHA 1P6BA 2OSWA 3PTMA 3LPPA 3B40A 2XIIA 3ARXA 1C9WA 3M0ZA 1V93A 3GQYA 2Z6IA 4H9MA 3NYDA 3NG3A 1H09A 1JPHA 1SMAA 4WGHA 3B8IA 3W2NA 1ZP3A 4DO4A 4LS1A 3RITA 4GD0A 2XVPA 4LJ3A 2XFYA 2EJAA 5LYRA 1Q6FA 3GAYA 3R43A 2OLHA 3TKFA 4PUKA 4JGDA 1MW0A 3L12A 7A3HA 3SECA 2FTPA 1E6NA 3CL8A 4L4MA 3BOLA 1DBTA 1DWAM 4IIFA 2ZVIA 1PX8A 3FA5A 1TIMA 3H2MA 3A9IA 3MHUA 5EA9A 2D22A 4KESA 3B03A 4QFUA 3ITVA 4W8BA 3LNMA 1MEWA 3T81A 2G8ZA 1VCFA 4LEFA 2RDWA 4PUUA 3U57A 1QASA 4ADSA 1CLXA 3POCA 4JYFA 1DE5A 1TA3B 1H0GA 3I7RA 1CXHA 3F4WA 2Z7GA 1TPH1 4UTWA 2WSRA 5ABGA 5T26A 3WFZA 1WCGA 1PWLA 5BXTA 3M5VA 3NXFA 3B9OA 1CXIA 1Q4NX 3LHWA 4DJDD 1Q2SA 1XDMA 1QO2A 1RH9A 4OWGA 1JR1A 5CBJA 5LNUA 4MADA 3CJPA 3PWGA 3VI2A 4GJJA 4RE2A 4N9EA 3FJ6A 1VFOA 4DNHA 2DT3A 3VGBA 1CPUA 5K4XA 1JVNA 2VVSA 5A6KA 2OX4A 4LVFA 4PL2A 6PTDA 6REQA 4XO7A 2QV5A 1BYCA 1ZRQA 1KRCC 1ME8A 2WV8A 3EA1A 3TWAA 2ZZ5A 3IAPA 4JQ3A 3UWQA 1ZU8A 3EXTA 1V0KA 3IANA 3M0JA 5HPCA 3UCCA 3M6DA 4ZQPA 2NSOA 3L7RA 4ZODA 1FDZA 3M4HA 3TXZA 3BJSA 2CLOA 1TPEA 4GLEA 1OIMA 1ISYA 3M41A 2HXTA 1P4CA 3QC3A 4GMEA 4LV9A 5FA5A 4V15A 1DJZA 4HU3A 3VILA 4DF1A 4WJXA 3WH5A 2QUUA 3MT1A 3D0CA 2GJPA 2Z00A 2ZRZA 3N12A 1R30A 1WYIA 4PYSA 3S1GA 1FP8A 5ABHA 1UPMB 2AMXA 3TMLA 2A2IA 2ZZ4A 2V38A 2OLAA 3TFXA 1HVQA 1D7KA 4GUJA 2YFOA 1YYAA 5A6BA 1BSIA 3IVUA 5HJLA 1H5YA 2V5LA 1I60A 5AFDA 3HGRA 1UHVA 2X1SA 3UP8A 1P1XA 1QK2A 4UIOA 4EE9A 3UESA 3VKAA 1JCJA 4J40A 4A29A 4JTSA 3UETA 3K4DA 1ONRA 3BV4A 1G69A 1R5YA 4OGZA 1IXOA 1L2UA 1X39A 4NAEB 2V67A 3WL1A 1J96A 1QCWA 4V28A 3R10A 3RCYA 3MWCA 2VZTA 3F5JA 4LX4A 1I1XA 4M6QA 2V2DA 1SFJA 4JX4A 4XUYA 5A94A 4OBSA 3FVDA 4N4PA 5LIWX 1XIMA 5D30A 3LHUA 1VBHA 2JIWA 5JBDA 3G2GA 4GISA 3K13A 4JQ4A 2GLKA 2VC7A 4M29A 2WSPA 3VE7A 4CNSA 4O14A 2ZX8A 2TSYA 2WANA 3NSXA 2YDRA 4JTGA 4R27A 4XSMA 4ALDA 3MKCA 3B0UX 3E6EA 1E0WA 3MANA 3C56A 1VJIA 4US5D 3UYCA 3PZGA 5EPDA 3VIPA 5I3FA 2BASA 1CNVA 1EPVA 3EYPA 4POCA 4PE8A 1MNSA 4M0XA 3G0SA 1TWIA 3HO8A 3ZOAA 3AMKA 3BQ6A 2GDVA 1OQFA 2C1IA 1XBZA 4IHCA 4U2ZA 1GORA 3GDTA 3BJFA 2J7BA 4CD4A 4REQB 2H90A 4E3VA 5AOUA 3ZSTA 4I9AA 5TBOA 3H2AA 6TAAA 1PBGA 2V3DA 4J35A 3NZ1A 4ONVA 1EBHA 3UXAA 3AROA 1F6YA 4MJ2A 5M5DA 2FDSA 1Q6LA 3CXOA 3D3AA 1SFSA 2WMGA 4F66A 2VL4A 2C13A 4FOKA 2CLLA 3W22A 2ZRVA 1GJPA 2ZUWA 3NDOA 1QHOA 5CPTA 5JMUA 4CEXC 4AIUA 2YBTA 1HKIA 1OX6A 2XH2A 1RD6A 1S2UA 1JZ5A 3AYSA 3ES7A 2VDGA 5LIXX 1FHDA 3QR0A 4M1BA 3A23A 1AL7A 3T6CA 1H4PA 3L5AA 1DEDA 5CG7A 3W37A 4EIVA 3UEQA 4E6MA 4C6IA 2WKLA 1DHPA 4S3CA 1QOPA 1VBUA 1N8IA 1NY1A 4DRSA 4DWSD 3TW9A 3QZ6A 5HXMA 1UIOA 3NO5A 4I7UA 4Y9PA 1PX4A 2OEJA 2VCCA 4Q7NA 4CQ9A 2ATSA 4EAYA 4OBRA 1PKYA 1QFEA 5ABEA 5TIMA 1SR9A 4I6KA 3ICJA 5C9ZA 2Q6ZA 4J4KA 3F4DA 4BF5A 2P10A 4NJIA 3MBDA 4GCXA 2QUTA 3BZJA 1UD6A 1OC5A 3U7BA 1P6WA 5FJPA 1XLJA 4A2RA 2GK1A 1WKYA 3QY6A 4J3XA 1RK6A 3LXCA 2PU0A 3WDPP 3UR5A 4EXAA 1UQYA 3WDHA 1HKWA 3K1DA 4IPNB 3MP5A 3H8AA 2IKIA 4Q4KA 4KEUA 1NJJA 4FK9A 4CNTA 1TTQA 3UT0A 2P88A 4O10A 1HO1A 2ZDRA 1V77A 4MYAA 5CPQA 4CQAA 2DQWA 1CTNA 2CIPA 2WNNA 5FJIA 1UD4A 4NZ4A 4CCEA 4DM2A 4E4FA 3ORWA 2ANUA 3P8IA 1DJIA 1JFXA 3THQA 2OSYA 5C9WA 3JR2A 1W9DM 5F2MA 2ABBA 3RRXA 4ZO6A 4IWWA 1XLFA 4BQ2A 2YB4A 4EANA 4RPQA 1BRLA 2C71A 3TW7A 5ABTA 3EPNA 3KBSA 3EB4A 1OCQA 1EC8A 5M3WA 2HQAA 5CSUA 1DTUA 2W91A 1M7OA 5XIAA 1JYWA 2Y1HA 4OV4A 1I2PA 1W3IA 5D9MA 4DYKA 2VR4A 1RBAA 2FKPA 1K7EA 1SSDA 2E7FA 3CB3A 3SCOA 2BSLA 3N6QA 5LNSA 1RR2A 2CXGA 2G3NA 1EUAA 4CQBA 2CW6A 4QSFA 1PVNA 4H01A 5CPNA 2C18A 3IGUA 2XISA 3CAQA 1J10A 1VP5A 3GWQA 2PWVA 3S0CA 4FXRA 2PTXA 3J7HA 5K7JA 1PPIA 3EB3A 5JH1A 3WLOA 3VMNA 4LRTA 4I8YA 3EDFA 4GGBA 1NVMA 2PB1A 3R12A 5K4ZA 3CZKA 1P0EA 1XC4A 3VD4A 4OECA 4L1WA 2PD5A 2ZE0A 3VCCA 1Z7AA 3V36A 3OIHA 2QULA 1RXOB 1XIHA 3FY1A 1UD5A 4DI8A 3N9SA 4H00A 2WB5A 2O4QA 3EKZA 1XI3A 4AWEA 3S2NA 5BWFA 1TSIA 1AJ2A 3O6DA 3TCEA 1LWIA 4DPQA 4D8AA 3QPZA 3W7GA 4HPNA 1YQ2A 2VGGA 3W7IA 5KEZA 2QCDB 4QE1A 5HDRA 4IFKB 4A2SA 4Y6GA 1EYWA 4ZO9A 3V0TA 1B9ZA 4CN1A 1JF5A 4KW2A 3CHFA 1DHKA 3S1UA 4LEQA 1IEXA 2QCFA 3DI0A 1GQJA 3HQOA 4K1WA 3AIVA 1U1JA 5JU6A 1WDSA 1B1YA 4IPPA 1AMKA 1UH4A 1RSCA 1BGAA 5FAGA 4H8NA 1JQVA 3CHVA 1G4EA 3WK2A 1IYXA 2WNWA 3WMBA 4DY1A 2AL2A 4E4PA 2WSYA 1CIUA 4PB5A 1W1PA 4XG1A 4O13A 4MF4A 1ITQA 2CHOA 5BOEA 2JEPA 3OQ8A 2X0YA 3LK6A 2XIBA 4K38A 4F9JA 1E9YB 4Y2WA 3HB9A 4NAFB 2VC5A 4IQDA 1W1TA 3OHIA 2RDTA 1HN1A 4CNNA 5BMWA 4PCPA 1DWFM 3EXSA 2QF7A 3BZGA 3AS0A 5CZTA 1W5NA 2GQ9A 1TKKA 4D6JA 3NM1A 4PTXA 1UP2A 3IUDA 2NX3A 3QOKA 1RVGA 3AZTA 5M03A 1V3MA 8A3HA 3PPFA 4Q4QA 1TQXA 4NKCA 3WELA 4DF2A 4WDXA 4ZZ9A 2ZTJA 4HA0A 3RO8A 3ME3A 3QTGA 2HWGA 1E6XM 3LCXA 1LL4A 2FGZA 2GUBA 2Y62A 3H12A 4C90A 3GXMA 3AIBA 4Y90A 3PC0A 1XBYA 3BH4A 4JD4A 1EJWC 1DJHA 4DWDA 1QI2A 3NDZA 3TJ4A 1P48A 4H8VA 4O1DA 3EBVA 2QIIA 2VCBA 5D2XA 3PZ9A 1F6PA 2ZUTA 2RAGA 5XIMA 1KM0A 3BPWA 4HBKA 5LA1A 1Q6GA 3DFQA 4XZNX 4DJEA 4V1YA 2QCNA 1ADDA 1NWUA 1PKLA 3L4YA 2DORA 5HATA 4TXEA 1XS2A 3DUGA 4JL1A 5AVNA 1XIGA 4US6A 1T8XA 5L6UA 4GIEA 2GVEA 5I2UA 4RXFA 2PDYA 2ZYFA 3S9ZA 1MVYA 3DHDA 4GI6A 2J6XA 1M01A 4C1LA 4QXIA 3MUZ1 3LI0A 3ERPA 1CWYA 4S2BA 2DUXA 1BWVA 4S3FA 3OG2A 2KX9A 4J2PA 3TH6A 3M7WA 3GFYA 2BHYA 3WEOA 3FXYA 3OB8A 1W5PA 4KRZA 3RMJA 1XBVA 2PP3A 5LXEA 4RZBA 4GNVA 3BCFA 2O55A 1S5TA