4ZQOA

Crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the complex with imp and the inhibitor q67
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
375
structure length
354
Chain Sequence
DPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSGGLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Mycobacterium tuberculosis IMPDH in Complexes with Substrates, Products and Antitubercular Compounds.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 354
sequence length 375
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zqoA00
4U28A 5A8GA 2A85A 3KRUA 2PURA 3NQMA 1TV5A 3H54A 5AHFA 5DCDA 5K9CA 3KOFA 2ZZ2A 3LLDA 4ML9A 3GAKA 1IGSA 3L5MA 3S9YA 2X1SA 2ZA3A 2CLEA 5G5IA 4MLJA 2IQTA 1VLWA 4PODA 1JRBA 1LOQA 3TDFA 1TJRA 1WDWA 2QKFA 2VC6A 1JCNA 2X1TA 4IUOA 3SZ8A 4CNNA 3BO9A 1MSSA 3EKZA 3LERA 3KVKA 1UJPA 1NSJA 1QAPA 1I2OA 1Q3NA 2Y88A 1SSGA 5IBXC 3THQA 2G96A 3I65A 1KFKA 1JUKA 5I3FA 1DQWA 3W86A 4IWWA 4NXKA 1AMKA 3EXRA 1KTNA 1VYPX 3RNDA 1H7OA 2V5LA 2A7RA 3HMJG 1TCDA 5EY5A 3W7CA 4FIRA 1B57A 3G1FA 5FF0A 4N02A 3V75A 3L65A 5AYZA 2R94A 8TIMA 4NNBA 2WJZA 3NQDA 4BI6A 1KM5A 4XBKA 1I2NA 4UTUA 2X1RA 3M5ZA 4JIQA 1G67A 4GRSA 3GXPA 2VKZG 3W7IA 3N2MA 3PS7A 1SZGA 4N9BA 3MBFA 1XI3A 4HNUA 5AHLA 2PCQA 3ELFA 5HQEA 1SO5A 2X1UA 3AJXA 3W3OA 2J88A 1UBSA 4AAJA 3FKKA 1KBIA 5D2VA 1PHQA 4ZQPA 3TAKA 1B4EA 5K7JA 1FX6A 1I8JA 3HPXA 4RR4A 1YTKA 4BI5A 2ZZ3A 4AB4A 5LNSA 4TIMA 4QM1A 1DBTA 4LVBA 2I9EA 2B7OA 4BWLC 1FCBA 1HG3A 3MJYA 5C54A 1FWWA 4I9AA 2JGYA 4Y9AA 1S5VA 2QF7A 3MI2A 4BF9A 5HR7A 3IGUA 3NQ2A 3W7PA 2V2CA 2Z6IA 1GVRA 4EF8A 5K4ZA 1OYAA 3HIJA 3QZEA 4Y96A 3EEGA 3LCLA 2RH9A 4WUIA 4XBSA 2CFFA 1LBLA 5KZEA 1JCLA 4LS0A 3TJXA 1NFBA 5CZTA 1BWKA 4LC6A 2DP3A 1HFBA 2VENA 2E1DA 4N9EA 3SR7A 4O1CA 2QCHA 3Q94A 1H1YA 3DFSA 4Z1AA 1NF0A 3W22A 4H3DA 2XN0A 1K8XA 3MYPA 3GDRA 1IXQA 2Y7GA 5F1UA 3MI6A 1LDCA 3CIXA 4FO4A 3FFSA 2WV8A 1JQVA 2CZEA 2PRLA 3LHTA 1QMLA 4IMDA 5HR6A 2C13A 1YXDA 3VE7A 1T8XA 4FNRA 4NU7A 1YADA 1M6JA 2TRSA 3S5OA 4ZQOA 1NF7A 3CWOX 3PBWA 1JCXA 2ZA2A 4AVFA 4OQVA 1LOLA 2QJHA 4GWEA 1W5MA 4HT3A 3E0IA 4NX5A 3UY7A 2QCCA 2NV1A 1W3TA 1V5XA 3NM1A 4KFPA 3F1QA 4M19A 3EX2A 4A29A 3GNNA 1G6CA 1FWNA 4Z0JA 3A24A 4D2JA 1MEIA 2ZDRA 3G0XA 3ZS4A 1QNVA 2ZZ1A 4AWUA 4C1KA 2V0TA 4MKNA 5D33A 4WOQA 1Q45A 3LLFA 4O52A 1F73A 2A1YA 2V82A 1OFBA 4H4IA 1WXJA 4O18A 1SR9A 5DY3A 1RD5A 4RCXA 1NVMA 1TB3A 1X7FA 3N14A 3W7NA 4RXGA 5U7SA 5J5RA 3NQGA 2V5BA 2FB3A 4UNLA 2W79A 1N8FA 2A21A 1OK6A 2VOMA 3MHUA 4KKXA 4XWUA 3LGEA 3R89A 1IF2A 4X2RA 5MHBA 2C6QA 4H6KA 4I7UA 2GJNA 1KBJA 2DZUA 3UXAA 3F4NA 1E51A 1LTDA 2NUWA 4CNOA 1QPNA 4MJMA 3QFEA 3IVUA 1IXPA 2CLHA 1SO3A 1YXCA 4CCCA 3L0GA 3BG9A 5D09A 2DU2A 4FIQA 2H3DA 1LORA 3L0KA 3GR8A 4K6AA 4IXHA 3UNDA 2NUXA 2NV2A 1LP6A 3E02A 1YTEA 4NJHA 3HF3A 3LHWA 3P80A 1ME7A 3R12A 1X1OA 5KINA 3T7VA 1FXPA 4GUJA 3PWAA 5D2XA 1O94A 2DZPA 4N9DA 3QMSA 4C1LA 5LKYA 3GDLA 5EBUA 2VXNA 1F7BA 1SO4A 1GTHA 3FJ6A 5LHFA 2YFOA 3ZWTA 3LRLA 3BW3A 3VE9A 4Q4KA 4JTUA 1TPUA 1OFOA 1UASA 1EPXA 4RX0A 5I3HA 4TR9A 1H7NA 3QMRA 5FESA 1KLYA 4TX9A 4ADTA 1LLWA 4JEQA 1TQXA 4O11A 5CGQA 1SFJA 3C61A 3EWWA 1G4PA 1VRDA 4MUZA 3RMJA 4TMBA 3LCFA 2FJKA 5GVJA 3QQ1A 4JN6A 3IVSA 4O15A 3PUEA 1FCVA 3UWUA 1PIIA 1W8SA 3CTLA 2QUVA 2HMCA 1JCYA 1TREA 3HO8A 3EWBX 1ALDA 3OVQA 3EXSA 5LNRA 3EWYA 3W88A 2VEKA 3S42A 5I3KA 2R8WA 1H7PA 3PB0A 2BXVA 4QITA 5FEWA 1FWTA 2WSRA 4WXZA 2QCDB 4WX2A 5D04C 2F7FA 1SZFA 1KM1A 4DF2A 1TSIA 1SW7A 3LB0A 2BLEA 3NOEA 1ZALA 3OHIA 1ONRA 1IXNA 2ISVA 3HQ1A 3I7QA 3OVPA 4UTHA 4UTWC 4RV8A 3TC7A 2B0MA 4N4QA 1TTIA 3LCXA 4JTEA 1TQJA 3LV6A 1WX0A 3NPVA 5AB3A 3PBUA 3OVRA 4NX0A 5G2WA 1R2SA 1HTIA 2G95A 3M5XA 1AW5A 3P84A 1PHWA 3LRKA 4PTNA 1P4CA 4UFMA 4FX6M 5KZDA 3BVJA 1XUUA 4LVFA 1IIHA 3I7SA 4DF0A 2ZZ7A 3SY5A 3S1UA 1SQ7A 2XFWA 3BV4A 1O60A 3MP5A 5E1QA 3CIWA 4JYEA 4DQWA 3RLVA 4WZHA 3UWWA 3CLMA 1DJQA 1W1ZA 5CSSA 4A3UA 3GZ3A 3NGJA 1T99A 1VCGA 3T40A 1DKWA 3E12A 1XBXA 3WJWA 1JCJA 3DZ1A 3UWVA 3IIOA 1OFDA 4NJIA 2VEPA 3HGSA 1MEWA 4WQ6A 3GDTA 4Z1CA 1KM6A 4K36A 2JKPA 5D37A 5D30A 1OX4A 5FF7A 3P74A 1KA9F 3DBPA 1L6WA 2QCDA 3P7YA 3B06A 3LOTA 3DENA 4HIBA 2NX9A 1TV8A 2B4GA 5LGXA 4HSOA 3KRZA 4HPJA 4AH7A 3FKRA 2HS6A 3G1AA 2GVGA 1Z44A 1LLZA 2ZCGA 4MLRA 3U8GA 3UD6A 4HHPA 3C56A 5D2TA 4O54A 2G97A 1RV8A 1Z41A 3L9CA 3R2GA 2ZZ6A 5LNWA 1AK5A 2C1HA 3EWXA 1Z48A 4WJEA 1EUAA 4AHQA 3NQ6A 3STGA 2BWGA 3LTYA 3WFAA 3W1LA 3BG5A 2CWNA 4WY0B 4O1DA 2O7QA 5LSMA 2KZHA 3DGRA 4N2YA 4O19A 3BLIA 1YXYA 4R7JA 3PAJA 3PSVA 5FEXA 3D0CA 3M7WA 2YZRA 4YCOA 4FNQA 1H60A 1AG1O 2FTPA 1RQEA 4RZ5A 3UPWA 5K4XA 3Q58A 2Y89A 1CW2A 1X6UA 3LI1A 4K7VA 4X3ZA 4S2BA 3HG3A 3W7QA 3H53A 2GQ8A 5KMYA 3GAYA 1N55A 1T96A 1WQ5A 1YPFA 4JY9A 5EPDA 2A0NA 2E68A 3G24A 3PULA 3TXVA 5KSWA 4FEZA 3QF0A 2NWRA 1HUVA 1LBMA 4LVDA 3UY8A 3W1XA 1VYSX 3BGJA 4IQLA 4JIPA 2QR6A 1AW2A 3C2OA 1H51A 1KM2A 1I2RA 3B05A 2A7PA 2C14A 1U5JA 3NG3A 5G4EA 2QDHA 3B4UA 3B04A 3P82A 1DJNA 3MP3A 3IGXA 1I45A 3O6DA 4XZ9A 2VEIA 3TXZA 4WY0F 5C55A 3KVLA 3KHJA 3LM7A 4WD0A 3NQEA 3EX3A 1F2JA 1VCVA 4JTKA 2FPVA 5CZ0A 3UYCA 3GIYA 1PE1A 1FXQA 3CWNA 4LWWA 3HG5A 1SSDA 2DORA 2QUTA 1FBAA 3BW4A 2NX1A 3CT7A 4YWIA 3W1QA 3W1RA 5TIMA 2WNNA 3L68A 4AWTA 1Q6OA 4UTKA 2JGQA 4LS1A 1ICSA 3E9AA 1I2PA 4FX7A 4UUIA 4DEFA 4PL1A 2ZRYA 3LX9A 1LM1A 5D2YA 3Q37A 4ADSA 1JJKA 3NYZA 3E49A 1JUEA 2QEZA 5BMXA 1ZFJA 3TSBA 4Y6GA 1SO6A 1CI1A 2WNQA 1WAUA 3T4CA 3W7EA 5LZLA 5F2IA 5HINA 4WY0A 3KVMA 4UTIA 2YW4A 4YL2A 3OA3A 5D32A 1W5QA 4Z1BA 3NNTA 1UUOA 1PCKA 2WSYA 3LCIA 2ZBTA 3CEPA 1LRQA 3QH2A 4CNPA 2YCEA 1A5AA 1GYNA 3LXAA 2WKJA 1OHLA 2JKAA 3EXTA 1KFCA 1TIMA 2C0AA 3TQ0A 3B0VC 3BARA 5DCBA 5I3GA 1W31A 4OWGA 2GJLA 2WNZA 5CKSA 5K9DA 4MIMA 1WV2A 4UNKA 4QAIA 4HSNA 4AXKA 2J9XA 4FXSA 3GK0A 4ORMA 4IMGA 4WXYA 3GDKA 4MFDA 4M5PA 4JNMA 5AYYA 2E5DA 4O0KA 5I3JA 4JTHA 1UB3A 5FEZA 3QSRA 4JX4A 3W76A 3W7KA 1VHCA 4M7TA 2F84A 1PL9A 3N73A 3M6YA 3M5YA 2AAMA 1JQXA 2YXGA 1MXSA 5D38A 4EOUA 4RZ6A 2YPIA 3TC6A 4A2SA 1ZCOA 3A23A 1S3HA 4O0ZA 5FF2A 1FCUA 1R2RA 3MWAA 5CPLA 4XKYA 3CPRA 2VFEA 5G1YA 1H5YA 3GB6A 3CHVA 2GOUA 4KWWA 5C6MA 3STCA 5LGZA 2LLEA 1YDOA 2DZTA 3TUUA 3W7MA 3K30A 2P0OA 1OX6A 4O12A 4R33A 4RKAA 3IIZA 3T78A 5I3IA 5AYXA 1X8FA 2RHGA 2WPBA 3DH7A 3NQ8A 3GNDA 2RFGA 4GC4A 5DXYA 2RDWA 1KM4A 4O1BA 4KFOA 3YPIA 3TV8A 4LVGA 3DXIA 3T55A 1UCWA 3A21A 3M41A 4LRTA 3RK8A 2ALDA 1QPQA 1P0KA 3QJAA 2J9YA 2NXIA 4LV4A 1LOSA 1WYIA 1YYAA 2QCFA 2A7NA 5H91A 2TPSA 4ONVA 4HNVA 3QM3A 1KTBA 2EHHA 4I7WA 3EWUA 3CU2A 3G0UA 3NEVA 2QAPA 4Z1DA 5CPOA 3DHFA 1Z42A 1TPVA 5F4XA 1VCFA 1EWDA 4OV9A 1YDNA 2C16A 3TX9A 4EF9A 3DI1A 4MOZA 4O16A 3GKFA 1R30A 4CCDA 5D02A 1OJXA 1TPEA 1FQ0A 4Q32A 3U2OA 3B0UX 1ZY9A 4DO5A 4NNCA 3ABSA 3M1ZA 4CCEA 2AGKA 5C5YA 3TQVA 3S1WA 3W87A 2PC4A 1O5KA 2DZSA 5L9FA 1DHPA 3PUOA 3GXTA 1SZNA 4IMCA 3RF9A 1FY6A 1EIXA 4OGZA 1VR6A 3BLEA 2B7NA 1AW1A 1LRTA 5TBOA 5C2XA 1TO3A 1KFJA 2NUYA 1FDZA 3W1AA 1HL2A 2QCMA 3NAVA 3G1YA 1MZHA 4LU0A 2H8XA 1QO2A 1TPC1 4GBUA 4QQ3A 3IGSA 3N34A 1QCWA 2D73A 4LVAA 5FEPA 1BWLA 1EA0A 1GQNA 2CLKA 1OYBA 4OE7A 2NXHA 4NNAA 5D03A 3RU6A 1P0NA 5CPMA 4UTJA 1H1ZA 1ICPA 5LNUA 1LROA 1GWJA 2A6LA 4N6FA 5AC6A 3KVJA 4IPJA 3ABRA 3G8RA 1R46A 4BK9A 4DBDA 3W1PA 2GVJA 2GQ9A 2VFIA 1NAL1 2YR1A 2GVLA 4K38A 4JYDA 5AHNA 2I14A 2VFDA 1J5TA 1LCOA 1SZEA 2CZFA 3SGZA 5CZSA 5F2MA 1KTCA 1XDMA 3G1VA 3M44A 1XKYA 4I7VA 3W73A 1QOPA 1SPQA 4HNNA 5G2IA 2P1FA 2OZ0A 2CLFA 3O6YX 3W74A 3LDVA 2QJGA 4O28A 2DJXA 3O8AA 4UXDA 4MY1A 1GVOA 3F4WA 4W9TA 2TYSA 1GYLA 5H2ZA 1K8YA 2Q8ZA 1XM3A 1M7PA 3LCGA 3H55A 2E6FA 3O16A 3TMLA 1IXOA 4UTTA 1D9EA 1YDVA 3CEUA 3L2IA 1GVSA 3STEA 1K3UA 4YLWA 4OBTA 7TIMA 4BI7A 2E6AA 3TW6A 3P81A 3JRKA 1FWSA 2YFNA 1RR2A 2Q3OA 4E38A 1OFQA 5AN7A 2A2IA 3GYEA 3LXCA 2QAFA 5G4WA 1OF8A 3N9SA 3CC1A 2OX1A 4JY8A 5TQLA 3ZFHA 2QUUA 3UZJA 2R14A 3RLUA 1K03A 3O07A 1GPWA 1OX4B 1EWEA 4FXRA 4AF0B 3DFOA 3EKLA 4QSHA 5U4NA 4LRSA 4PC8A 3L0NA 2H8ZA 3HG4A 3GDMA 1WOBA 1Y0EA 3TMQA 3KRSA 4L4LA 3TE9A 3W7GA 3P62A 1O5XA 3DFPA 2Z6JA 4JICA 3OBKA 3A5FA 3TU9A 1D3GA 3HBLA 1QPOA 3EX1A 1A5CA 1GVFA 3VCRA 3QSTA 4PH6A 6ALDA 3W72A 2Y85A 5HUPA 4HNTA 1KM3A 3I6RA 2PRHA 3G3MA 3DFNA 1FCQA 3P5YA 2I1OA 3NM3A 3R8RA 2CLOA 2FPYA 4L4MA 4LTSA 4P61A 1Q6QA 1S5WA 3GKAA 1IIGA 1QWGA 2CW6A 3BG3A 1HO1A 5AHEA 3S5ZA 4AEOA 3MHFA 3LTSA 4JGDA 3QQ0A 4E2DA 2Y7DA 2CLMA 3TK7A 4UC5A 1V7YA 5EL1A 4BFAA 1RQBA 3P5ZA 3NZRA 1GG1A 4ZQMA 1TTJA 4PL2A 3R5EA 3IIPA 1GZGA 2EKCA 1GVQA 2EPHA 5L6UA 5LHEA 5CG7A 1QDSA 3NDOA 3KX6A 2BTMA 4UFKA 2FLIA 4X22A 3KFTA 4UTTC 4O50A 2ZTKA 3ZWSA 4MY8A 4UFIA 4IGHA 1LBFA 1W3NA 3W7LA 3W23A 3LV5A 4CQ9A 2TSYA 2B7PA 3NL2A 3TJLA 1I2QA 1W3IA 2E5BA 1JRCA 1D3HA 1B4KA 1F5ZA 3M0ZA 3UXDA 3W2KA 2Z2UA 3PUDA 3CQ0A 1AL7A 2FB2A 1EP3A 5D05A 4AF0A 1G7VA 1I4NA 1G4TA 2V2DA 1C29A 3LHVA 3NQFA 2VFHA 1DOSA 4LV9A 3ABOA 3SFKA 1H62A 4IXXA 4LOCA 3WK0A 1SW0A 3WJXA 3IEBA 3L5LA 1W5PA 2YGYA 5F2LA 3QPZA 3BPWA 5HUOA 3USBA 4NZJA 1G7UA 4LC8A 1ZENA 2W0UA 3MHGA 5F4SA 4Z0SA 4UR8A 3DKLA 4MFEA 3GVGA 3IRDA 4JTIA 3G1HA 1NEYA 2E6YA 3HG2A 1ZHAA 3S1XA 3W2UA 1FDJA 2X16A 4AHOA 5BMWA 1VPXA 3TR2A 4M6PA 3VFLA 2XN1A 5BNKA 3HGJA 4HPXA 5K3VA 2Z1BA 4ORIA 1GTEA 4DPQA 3THAA 3LHUA 1H7WA 1DV7A 3G1XA 4DPPA 4O10A 4OT7A 3W1TA 3WK2A 4LS2A 1KLZA 5E0KA 4PA8A 3C4UA 1GEQA 2EAWA 1K8ZA 3SI9A 4UMBA 3PR2A 4ZVJA 4JS3A 2DZVA 3MUXA 3NA8A 3W1MA 4AHPA 2V8ZA 3P60A 3PSWA 4LT9A 3W7JA 2B7QA 3NQVA 1GJPA 3UWZA 1XCFA 1PS9A 1OF6A 4FNTA 4UMCA 2FIQA 4FHAA 2YDAA 2P10A 2J27A 1TTPA 3LCWA 1VYRA 3UWYA 1K7EA 5SWUA 3G1DA 4IMEA 4IJBA 2CZDA 1VC4A 4O17A 4ZMGA 1L6SA 1K7FA 2Y7FA 1VZWA 1A50A 4XKYB 3W83A 2ZZ5A 1R2TA 3WJZA 3NPWA 1G4EA 1PCWA 1L2UA 3WJYA 4X9SA 2CLLA 1KM0A 1KFLA 3HJZA 4MZ1A 4NT0A 2Y62A 1F76A 4MVAA 3N2XA 4B5NA 2ZRUA 2A4AA 1A5SA 4GUIA 1AL8A 5J5DA 5EKYA 4DELA 1GG0A 4UTLA 1EB3A 2ATMA 2ZTJA 4JTJA 5HULA 4EVZA 3SIZA 4UR7A 3FEMA 4ADUA 4TMCA 4MZ8A 1VJIA 4IMFA 4QNEA 3GR7A 4HN4A 4JTLA 4BR1A 5HNRA 2OMAA 2GQAA 3RFAA 4GUGA 3TSDA 3L67A 4JXCA 3EB2A 4POCA 3TKFA 3CM4A 1ZAIA 2VEMA 4XQ6A 3TIMA 1M7OA 2A5HA 1TPH1 5DBUA 1H7RA 5HMSA 3W6YA 3PF3A 1SFLA 3DI0A 3F03K 4IX0A 4A21A 2Y70A 3I7RA 3UWQA 3O6CA 4MJZA 4UCGA 5KITA 4LUJA 1QOQA 3ABQA 2NX3A 5DCEA 3PB2A 4NUWA 5T26A 3SJ3A 3W2MA 3OIXA 2H3BA 3STFA 3LI0A 5DELA 3NO5A 1DL3A 2GUUA 1SW3A 5D2WA 3B8DA 1QFEA 1OK4A 4K39A 1G4SA 2X2GA 3W84A 3FYPA 4O13A 4O1AA 4R53A 4ZL1A 3NVTA 3M5VA 3LTPA 4GUHA 4NVTA 3JS3A 2TMDA 1W5OA 1XDLA 3VI2A 3W1NA 3NL3A 2PRMA 1F74A 3NQ7A 4WOZA 1OG0A 1TV7A 4A22A 5EMUA 2ISWA 4M6VA 3TNOA 3N3MA 4YXGA 1WA3A 3W85A 3G8EA 3T44A 3LBCA 3WJSA 3AO0A 5CPNA 3P61A 3S8HA 4JX5A 4E2BA 5G2HA 1KFBA 4O8RA 3MW7A 2E09A 4JDBA 3W2LA 4ZZ9A 1H7XA 3TA6A 3P8JA 3VNDA 2UV8G 4O53A 3ATYA 4M6QA 3O63A 4JYFA 3WK3A 3C3NA 2WSQA 4O4VA 1KFEA 3INPA 1B3OA 3MMTA 3QPYA 2FDSA 3HPZA 4UIOA 2WOQA 2ZYFA 4NJJA 3OEXA 2VFFA 4N6EA 3UPBA 1SU5A 2NXGA 1KW1A 3IV3A 4K8HA 2WO5A 1ML1A 5AC7A 2YSWA 1W37A 3QC3A 1ZJIA 1GT8A 4TU1A 1FUYA 2NZLA 3FJLA 4PEKA 3PVFA 3W2NA 4TO8A 3G1SA 2V81A 4JTTA 3A5VA 1XBZA 4J9JA 3C0JA 3HGOA 3O1NA 1JULA 4XTIA 3Q2DA 1PVNA 4DXVA 1OVDA 2C15A 4JD4A 2JK2A 1F05A 1VS1A 1VLIA 4NJKA 1P5BA 1O4UA 2WQPA 3S5YA 3I68A 5AOUA 1PV8A 2QCGA 4U4MA 5E93A 1U83A 3DKJA 3C2EA 3QRHA 1YPIA 1TYGA 5HWJA 1F6KA 4UMAA 2Y63A 4G1KA 5F1VA 3NL5A 1OX5A 1WBJA 2DZWA 3SW6A 1JVNA 1OFAA 4RJEA 1BTMA 4QIUA 1XFBA 3W7OA 4Y8FA 4RLIA 1K7XA 5LNVA 1VQTA 3PM6A 5HJLA 3W7RA 4XTDA 1RZMA 3W9ZA 1H63A 4FX8A 1TMHA 4UFJA 2Q8LA 2Y6ZA 2XN2A 3MI3A 1HO4A 2QDGA 3NPUA 4QNWA 1EP2A 3NQAA 2ZRZA 3PBYA 1KV5A 3B03A 2HS8A 4YCPA 3NR0A 3MO7A 2QCLA 4FF7A 4IOTA 5BOOA 5CZJA 1OFRA 4NJGA 1B9BA 1ZNNA 2BX7A 5HWMA 2A6NA 3G18A 1XXXA 4RXFA 3N19B 3P67A 3QMTA 1SUXA 3G3DA 1O95A 4K7YA 4FNSA 3FYOA 1Q6LA 4UTWA 3JR2A 4M7SA 1G69A 2Q3RA 1MO0A 5DLCA 3N9RA 3C8FA 1T0OA 4AMAA 3C2VA 2J24A 2ZRWA 4LW7A 4JDYA 3HOJA 3SECA 4R34A 3O06A 1TPDA 1LZOA 2O7SA 3W75A 3FA5A 1MEHA 2C19A 1TPB1 4NQ1A 4P2VA 2V2HA 4GUFA 5K9XA 4ZQNA 1W5NA 4N4PA 3HGRA 1A53A 1XBYA 2CU0A 3C2FA 2DJLA 3M9YA 2R91A 5KTLA 1J4EA 3M16A 1ADOA 5FI8A 3FIGA 1C8VA 3TAOA 3KAOA 2AQWA 4DF1A 1GOXA 4FB7A 3L21A 4KWVA 2CZ5A 1LYXA 2H6RA 3W70A 3S6DA 3NL6A 5F2GA 2ZFAA 5HWNA 1TRDA 1J2WA 2HSAA 2ZRVA 1JCMP 3FS2A 3GLCA 3ANYA 3G22A 2ABBA 3W1UA 1LRNA 1FDYA 3PG9A 1TTQA 2ZQ0A 4GXMA 4JTFA 2E5CA 3HPSA 4HKPA 1EEPA 1YLVA 4JR5A 3S1VA 1FWRA 3SSJA 4O14A 3B0PA 1DORA 3L5AA 2PE4A 3IVTA 5AHMA 3R13A 4IX2A 1ME8A 4UFLA 4FNUA 4DO4A 5AC8A 1H61A 4OU1A 2OJPA 3TH6A 3DU0A 4XUGA 4CLMA 4K8EA 2VELA 3MP4A 1S5TA 1P1XA 3PBVA 5A5WA 3TQKA 1C9DA 3TSMA 2G5WA 3LXBA 4LY8A 1OABA 1CX9A 2RDUA 4O57A 3IIVA 3PC0A 5DBTA 1W56A 4Q33A 4Y90A 2FPTA 2FFCA 3V1PA 3S0CA 2FQIA 3SGUA 2QCNA 4CQ8A 4MPQA 1DQXA 2DZXA 4EWND 5EA9A 2Y61A 4ALDA 4DO6A 2GPTA 3EX6A 3KXQA 5AHIA 5BRBA 2ABAA 1L9WA 3W07A 3TROA 5ABTA 3LRMA 1OFPA 4MYXA 3U6WA 3P8IA 4EIVA 1M5WA 4RZ4A 4MY9A 3NPXA 2X30A 3W7DA 3DFTA 3L66A 1RQHA 1THFD 3EX4A 4A2RA 1BEUA 2OT0A 1BKSA 2ATSA 3C6CA 3LHZA 2E6DA 3W71A 2C18A 3LBMA 4GFSA 2QJIA 2EF9A 3W7HA 5DY2A 3TFXA 4RK8A 2CLIA 3NXFA 1N7KA 1ZAJA 1UUMA 4ICNA 6TIMA 2C3ZA 4K37A 3MBDA 1ME9A 2OT1A 1K02A 3HB9A 1R47A 3A22A 4IPIA 3BLFA 1JUBA 1EUNA 1W0MA 2OCZA 2E77A 5DXXA 3ATZA 1XL9A 3O05A 1X1ZA 2YW3A 4PCFA 4Z08A 1EP1A 3PY2A 3CB8A 2RKXA 3O15A 4ZQCA 4AWSA 2W6RA 2Z0IA 3PG8A 1QO5A 4E0CA 3NZ1A 1KV8A 4UFHA 4GJ1A 1TPWA 3QEZA 2JBMA 4O4WA 2BSLA 4MZYA 4JTGA 4NZFA 2JKEA 4LUIA 2Y7EA 2RDTA 3FOKA 3W2JA 3C52A 1VHNA 1TRIA 2VFGA 3DHDA 4NXSA 3E96A 1OYCA 2ZA1A 3GX9A 5G1TA 4JTSA 3BW2A 2YYUA 3FLUA 5IBXA 1WBHA 1TJPA 3TW7A 4GNJA 5FF4A 4LNYA 1JR1A 2J9ZA 2V9DA 1ZAHA 4S2CA 1L6YA 2J6XA 2QCEA 3QW3A 4OV4A 1DVJA 3TCEA 4QJ1A 5K2ZA 3MYOA 3C2RA 3S5NA 3OG3A 4N9CA 1QR7A 5EYWA 3DFQA 1YTDA 3WK1A 1RVGA 3QW4B 4S1FA 1W54A 1VH7A 2ZZ4A 4JX6A 1TPFA 2H90A 3BK0A 3GXNA 3NQCA 3G0SA 2YX0A 1VGAA 3LHYA 5FF3A 3TFCA 1F6PA 5F4WA 4FNPA 2V30A 1H50A 2NLIA 1RPXA 3A9IA 5IM51 4KFNA 4PFMA 2YYTA 3QYQA 5AFDA 1ICQA 1QPRA 3M43A 1Q6RA 2HTMA 3UZ5A 2ZRXA 1WOAA 2BZNA 2ISSA 3DAQA 2EGZA 5DN1A 1A5BA 5CSRA 5KZMA 1OFEA 4YMZA 3M47A 4DBEA 4QISA 4CQAA 2NWSA 4OHQA 4UTMA 4MYAA 3UQNA 1XC4A 3ZR4A 4ZQRA 1XBVA 4BWLA 5BW6A 4GE8A 3LCHA 3IIXA 3VKJA 3EWZA 1EX5A 3BGGA 1XUZA
chains in the Genus database with same CATH superfamily
4HB7A 4MDPA 2OXNA 3WDQA 2UY2A 4HSHA 5DCDA 3A12A 4FAMA 3DIPA 3I3DA 2E9BA 4F0SA 1EL3A 1CGWA 2ZA3A 4MLJA 2IQTA 3GTFA 1JRBA 1WDWA 4KT2A 1LL4A 4IUOA 2PTYA 3BO9A 2E0PA 3EKZA 3AIUA 1UWSA 1UJPA 4TX8A 1NSJA 1WDDA 3ZT6A 5MKGA 1KFKA 4FF5A 5E5CA 1DQWA 2I57A 4AZ7A 1I60A 4Q4PA 1AMKA 3LLXA 4J3XA 3EXRA 2VHLA 1KTNA 3KOXA 4DJDD 3RNDA 3IARA 3RPMA 1DWHM 4PUNA 1W1IE 1WXYA 3L4XA 5FF0A 4N02A 3IJ7A 4GH3A 5AYZA 1NELA 3N4EA 2E67A 2W9MA 3FSUA 3VIMA 2X1RA 6XIMA 1PZ0A 3N2MA 4XB3A 4F9JA 3MBFA 1RCQA 3F7JA 4MF4A 1XI3A 2Q8XA 4HNUA 1MDRA 3ELFA 2X1UA 4WSKA 1UD2A 2HK1A 4ZQPA 4RW5A 3WDHA 3TAKA 4E5TA 2PLKA 4NAFB 1I8JA 4RR4A 4BI5A 3WH5A 2ZZ3A 2JE8A 3BAIA 2XIIA 4TIMA 4QM1A 4FMVA 1DBTA 4LVBA 3GC4A 1FCBA 3RO8A 5C54A 3RU8X 2FHBA 1S5VA 4IQDA 3UP8A 1C7SA 3WH8A 1GVRA 4JEJA 1OYAA 2Y2WA 3HIJA 4XAFA 1V77A 1IYXA 3TYZA 5KZEA 4HYRA 4LS0A 1B54A 4CGTA 3VTRA 3TJXA 2QJMA 1QNOA 4LC6A 1RJPA 2VENA 1QXLA 5M3WA 1OD0A 1WDRA 4HU0A 2GGEA 4JPGA 3HV8A 5CC6A 3POCA 1R3RA 4H3DA 2XN0A 1UWAA 2Y7GA 2VEFA 3CQKA 1GOKA 4AZBA 3FFSA 3WF3A 3SRKA 4LSBA 4RV3A 1PYMA 3CHFA 4AX6A 3KWXA 1SFSA 2OYLA 3XISA 1WKEA 3SQMA 1XLLA 2TRSA 1JZ2A 4UQCA 3QTGA 1JCXA 1D3CA 1LOLA 3KL3A 4GWEA 2R24A 2TAAA 3MZNA 1FOBA 4HT3A 2QW5A 3AIQA 3E0IA 3GNOA 4NX5A 2QCCA 2NV1A 2JF7A 1W3TA 2XM2A 3TYAA 3PZQA 2Z4GA 3KE0A 2Q71A 4J3WA 1J79A 1TR9A 3FDGA 2FZMA 1JAKA 3WENA 4J3SA 2BP1A 3CTTA 4B5TA 2W66A 2ZZ1A 4C6JA 4AWUA 4NZ4A 4Q4RA 4F0KA 5D33A 1Q45A 4A3YA 2A1YA 3NEHA 4M24A 1H49A 4O18A 1OT2A 1GCYA 1NVMA 1X7FA 3N14A 4RXGA 3WBAA 2YOCA 3V36A 3UBPC 2PCEA 2W79A 2A21A 3MHUA 4JHZA 4Y9PA 2P3ZA 1IF2A 1HKMA 4C6IA 4X2RA 4ZO9A 3VILA 2YB4A 3UXAA 3SCTA 1W17A 4B5WA 3KDOA 1ENUA 1LTDA 4CNOA 2X8RA 4LYPA 1DEDA 4MJMA 1E70M 4UCFA 4JKKA 1MRQA 3ZT7A 5EFDA 1WUEA 1IXPA 1SO3A 5EMJA 5D09A 2OX4A 2DU2A 3MS8A 3DERA 4OZOA 4K6AA 2NUXA 1LP6A 4S3KA 3GW3A 3PAOA 3LHWA 1GVEA 2ZVRA 3MCMA 4C1LA 2DZPA 3GDLA 5EBUA 1F7BA 2E28A 1FWHC 5LHFA 1BYAA 3G77A 1T5AA 1TPUA 1HZYA 5I3HA 4TR9A 2FFIA 3KCLA 4F2TA 4TX9A 1LLWA 4O11A 3EWWA 1VRDA 4W5UA 3CUJA 2FJKA 1CYGA 1O6IA 2R1MA 5I5RA 1ZPTA 5GVJA 4GH1A 1PIIA 1REQA 4EP8C 2NQZA 4PMDA 3EXSA 4DVOA 3H2FA 3N13A 4Z2KA 2F2HA 2VP8A 3I6TA 3PB0A 2BXVA 3GTIA 2WSRA 1W1B1 4U5KA 4WX2A 1XIFA 3V0UA 2F7FA 2FMOA 3CH9A 5I23A 4LBRA 4Q4MA 3NOEA 1ONRA 1ELSA 4RV8A 2YDQA 1XRTA 4N4QA 3PWGA 5KZ6A 3SRDA 5IFPA 2GVEA 1OGSA 4JTEA 5EU9A 3LV6A 1MUMA 3RLHA 3NPVA 5AB3A 3GU2A 5FIPA 1UIOA 3ANUA 4MWAE 1XIBA 5CG0A 3BSMA 4DB7A 1PHWA 4FI4A 4LB3A 4Q8TA 1P4CA 5I79A 1B90A 4KWSA 1UP0A 1RXOB 3IACA 2VD9A 1B1YA 4I8DA 4DF0A 1UR4A 1GK8A 3MP5A 1MW1A 4B4HA 5E1QA 3MMUA 4TXEA 2VRJA 4Q4SA 5C2CA 2ZXDA 4H1ZA 2EBNA 3CLMA 1DJQA 3STPA 1DKWA 3S2NA 4Y2WA 3WJWA 2PD5A 4NJIA 2VEPA 4J28A 1KM6A 1GOIA 1PX4A 1XQLA 1OX4A 3P74A 1JPMA 3DBPA 2Z7GA 1L6WA 1JZ8A 3B06A 2B4GA 2HCVA 3VKAA 2WMHA 4HPJA 3SY8A 4AH7A 1JDCA 4HA3A 1DXFA 1Z44A 3UD6A 4L9YA 3PTMA 5AZ0A 2XG9A 1Z41A 5B7ZA 1PKLA 3VD5A 3R2GA 1DJZA 5LNWA 3EWXA 1BD0A 3PFRA 3T05A 5AC5A 1G1YA 5ECUA 3PPCA 2BWGA 4QDPA 3BG5A 3HV9A 2CWNA 5C0QA 2QXWA 3T9PA 3PJWA 5LSMA 2KZHA 3QXBA 4Y8EA 4AD4A 1DIOA 2HRWA 1H1NA 1H60A 1F61A 4R5EA 1XYAA 3SUUA 2FVLA 1VFMA 4X3ZA 3F4DA 2GQ8A 5KMYA 2HNHA 1WQ5A 1T96A 1RH9A 2A0NA 1J0JA 2VVSA 4H83A 3L4TA 2OG9A 2GGGA 5CPTA 3AAMA 1HUVA 3UY8A 1HP5A 1VYSX 1XS2A 8CGTA 3BGJA 1VAHA 2OU4A 2QULA 1U5JA 3NG3A 2QDHA 3B4UA 1ECQA 1G01A 2VDGA 1DJNA 1FP8A 5REQA 2XWDA 3KBNA 1UZ4A 4XZ9A 2VD8A 4C7FA 4WY0F 3UGVA 3KHJA 3LM7A 3EX3A 3R0KA 1VCVA 2X2YA 2FPVA 5EMKA 4HD5A 4LNCA 3M0XA 1YMYA 4L5ZA 2PBOA 2QUTA 1FBAA 4R9OA 3W1QA 3L68A 4UTKA 4JFSA 3EOEA 4WKHA 1I2PA 4DEFA 7CGTA 4PL1A 1QASA 2OWXA 5D2YA 3KLLA 2IPJA 3ARWA 3E49A 3BLLA 1ZFJA 4Y6GA 3W7EA 5CPQA 4I5XA 5LZLA 3EGJA 3AIVA 4J27A 4IHCA 3S3GA 4YL2A 5D32A 4J3VA 4GI4A 3UZYA 2HVNA 3NNTA 1VBJA 2QDDA 1TUXA 3MT1A 3LCIA 3CEPA 4Q8QA 4CNPA 1A5AA 1VPQA 1GYNA 1O7AA 1OHLA 2C0AA 1KFCA 3EXTA 3TQ0A 3BARA 4Q6XA 1SJDA 1UC5A 1AQFA 2CIPA 4MIMA 1Z9AA 5JBDA 2PF0A 2XIQA 4GISA 2XH0A 4ORMA 1AD4A 4X2PA 4JNMA 4B92A 4O0KA 2E5DA 3NYDA 5I3JA 1WP6A 3W76A 3SQLA 3UCCA 3ZZ1A 4C6CA 2ONEA 3M5YA 1RY0A 3R7MA 5JIPA 3DFYA 2JFEX 3UFYA 3A3HA 5M17A 3IUDA 4EOUA 4YVPA 5EB8A 3TC6A 3A23A 1GZJA 4O0ZA 1FCUA 1S5MA 3MWAA 3IV8A 2ON3A 3UERA 4QEEA 4OOUA 1H5YA 1ZP3A 4GI6A 5C6MA 4H01A 2DZTA 3BCJA 4EKJA 1IEVA 1OX6A 2WXDM 4QAWA 1VFSA 5I7GA 3NQ8A 3WQFA 2RFGA 2PU0A 1E9YB 3PN8A 5DXYA 4PB3A 1KM4A 1Q63A 4KFOA 3AQUA 3TV8A 3CL7A 4JN7A 3K46A 5I24A 4LRTA 4QJ5B 2ZE3A 5M5DA 1MNSA 3SEPA 3AMDA 4LV4A 1B3WA 2PDYA 1LL6A 4PMYA 1YYAA 2A7NA 3EKGA 3FJ4A 1IT7A 4Q8VA 3PK7A 1GQIA 5FSDC 3VD3A 1A0CA 3G0UA 3NEVA 2OTDA 1W9UA 2R6OA 3PTKA 3V5OA 1OZMA 4NAEA 1VCFA 1EWDA 5A8QA 1YDNA 3FK4A 1UR2A 4UOQA 1MQPA 3CO8A 3GKFA 1ODZA 5D02A 1TPEA 1PIFA 3FN9A 3B0UX 1ZY9A 4NNCA 5CBJA 1ZL1A 4MGGA 4FK9A 1KRAC 2PC4A 5DMYA 1O5KA 4AFYA 2DZSA 1WO2A 1I1XA 1KRBC 3A4AA 4C6EA 3GXTA 1QHOA 1VJZA 4OJYA 1UC4A 1AJZA 1FY6A 1EIXA 1VR6A 1RVKA 2GSEA 3BLEA 1AW1A 1HVXA 5A2CA 5C2XA 1FWJC 1TO3A 4HHLA 4ZXOA 2RJGA 8RUCA 3ZM8A 2ZE0A 4GBUA 1H5VA 1C7TA 3N34A 1GOMA 1YEYA 2D73A 3KP1A 5F7UA 1V0KA 1GQNA 4Y7EA 4Z1YA 4OE7A 1KD0A 1FWCC 3RU6A 1P0NA 1ZP4A 5XINA 5BWFA 1H1ZA 1ICPA 3BJTA 5LNUA 1LROA 1GWJA 2DUZA 3THUA 2D0HA 1NFGA 4I90A 5AC6A 3G8RA 4Z42C 1R46A 2ZIDA 4KGJA 4J7RA 2GVJA 2NQHA 4UQ9A 3W1PA 1FHVA 2YR1A 2GVLA 2MANA 5A6AA 1DHKA 3SUVA 4FR1A 2VFDA 1LCOA 1SZEA 3SGZA 5CZSA 4P7OA 2XUCA 1DIEA 3ARYA 1UWRA 2WCGA 2QJGA 4UXDA 5A69A 4MY1A 3F4WA 4IM4A 2JEQA 2H9AA 1K6AA 3H55A 4DIAA 4UTTA 1VPYA 3S6OA 1Q5MA 3L2IA 4QRNA 2PDKA 3WLOA 4CEXC 5C7HA 2VGGA 1O66A 4OBTA 3CHDA 4BI7A 3TW6A 1T41A 2YA2A 3WDJA 2A2IA 2PDCA 1OF8A 2GLKA 3CC1A 1EYWA 3W26A 2C8NA 3RLUA 3AZTA 3O07A 2ACRA 1Q4WA 2A3CA 1U5HA 1WAWA 3EKLA 4GQGA 4JN8A 4MB3A 3L0NA 3MQTA 3H2CA 4UQAA 4B3LA 1XX1A 2X41A 3HG4A 5XIAA 3GDMA 1WOBA 1Y0EA 1CXHA 3KRSA 1JXJA 4NZ5A 3RR1A 1O5XA 3P14A 1D3GA 3IANA 1BSLA 2CCRA 3EX1A 3SADA 3IUHA 2AGTA 1GOWA 4RZBA 1KM3A 3I6RA 1Q2RA 2ZXBA 4QLKA 1NP2A 3EOSA 4L4MA 2VGIA 1IIGA 3AIEA 1ZJHA 1S5NA 4JKMA 3PWIA 3BG3A 2XU2A 3OHMB 3OZMA 1P0DA 3GSMA 4H00A 4IG2B 4GIEA 2CLMA 3AFBA 1I75A 4BFAA 3SCUA 4PSPA 1DE6A 1GG1A 1DXEA 1TTJA 4WGHA 2FMNA 1GZGA 3PP7A 1GVQA 2VDIA 3UZWA 1WXZA 3D5HA 3NDOA 3MV01 4UFKA 2Z29A 4X22A 2PU1A 2DH3A 3TJIA 1AFSA 3Q65A 4O50A 1LBFA 2B7PA 3NL2A 2DDXA 1KXQA 3S2CA 1QWKA 3CQJA 3W2KA 1OGBA 1UROA 1R38A 1XLGA 3PUDA 1E40A 1M41A 3CQ0A 4GABA 3QY8A 2WM0A 1R0MA 2C71A 2C1GA 1KBBA 3K1GA 2GWGA 4XUYA 3E38A 3ABOA 3LENA 3FX4A 1H62A 1XKJA 3EZ4A 3WJXA 1A5LC 4FP1A 3IJQA 3QPZA 2A3HA 3USBA 4LC8A 1ISYA 3MHGA 2W0UA 4MAZA 3ARTA 4UR8A 2R82A 3B0YA 2CBUA 4QQUA 1NEYA 1XW8A 2E6YA 1YRRA 2EKGA 1ZHAA 3OTRA 3S1XA 2X16A 1UPPA 3WLPA 1CT5A 4AHOA 5BMWA 1SR0A 4E8CA 4HMCA 4R3UA 1HJUA 4IFKB 5BNKA 1UH3A 1KR1A 3MDWA 2BY1A 4DPPA 3ZR5A 4JNYA 4O10A 1G5AA 3GC5A 4H9ZA 3NWRA 1HL9A 1GEQA 2EAWA 1K8ZA 1ONXA 4HK7A 3PR2A 4FOKA 3BH4A 4GZEA 4BQ5A 3P60A 1CBGA 2PFHA 4TVUA 4GFIA 3UEQA 2G3IA 2WJFA 3NQVA 4OOZA 4FHAA 3WQOA 2YDAA 4NP7A 1A0DA 3GVVA 1KXTA 2J27A 3CUGA 2ZWYA 4CQDA 3UWYA 1CTNA 5SWUA 1WDSA 5G4HC 4ZMGA 2Y7FA 2BGQA 4J5NA 2G4FA 2C91A 5HPOA 4LB4A 5CBIA 3E2RA 1R2TA 3WJZA 3SURA 1G4EA 4PUEA 1L2UA 2XIJA 2CBVA 1KM0A 3M46A 3ZLFA 1YNQA 1HKKA 3QOMA 1F76A 3N2XA 2NVAA 5EBAA 1MW2A 4GUIA 4XSMA 1V08A 1AL8A 5J5DA 3APYA 3K5XA 3T2OA 5HULA 4EVZA 3W6MA 5AYIA 1VJIA 3U2CA 3GR7A 4BR1A 1CDGA 4XZIA 5HMDA 3L67A 4LUSB 2F2KA 4DZ5A 4HPHA 3EOOA 4AC7C 1M7OA 3W6YA 2C7FA 3DI0A 4IX0A 1E6ZA 3I7RA 3UWQA 4MJZA 4UCGA 3S4TA 1VB9A 3S2LA 5KITA 2WBGA 4UOZA 1PZ3A 1KO0A 1D2KA 1E1FA 2NX3A 5DCEA 1VFUA 7XIMA 3PB2A 4NUWA 3LMZA 3W2MA 1J93A 1A80A 1FKWA 2XVLA 4GQ0A 3B8DA 4YU1A 1RLCL 4ZSTA 3FYPA 1QI5A 4LF1A 3WH9A 1M53A 2YKKA 3EOUA 4LUTB 3LTPA 3WCZA 1XC6A 2PDJA 1DWGM 4K2SA 4ZGYA 1XWYA 1E0TA 4ZTXA 3W1NA 1BXBA 4WOZA 4WDTA 3URNA 4A22A 1IEXA 4M6VA 4HBKA 4YXGA 1WA3A 3S8HA 3P3BA 4J35A 3H21A 1RJRA 1X39A 2E09A 1F3XA 2CBJA 4O53A 3M0MA 4M6QA 5HJXA 7ODCA 4PRRA 2WVSA 4ZCWA 4GD0A 4UIOA 4NJJA 3UPBA 2DGAA 3CHCA 1KW1A 1LJYA 4AWEA 1Z8AA 3BCFA 4K8HA 1P7TB 2WO5A 4FOJA 4L4PA 2PP3A 4TU1A 2NZLA 3FJLA 4F0HA 1Y65A 2YA1A 3PVFA 4REQB 4TO8A 4IFRA 4IIFA 3VVGA 4JNZA 3WG6A 3O1NA 3GG1A 3Q2DA 4RUBA 2NSXA 1B30A 2ICSA 2OODA 4JD4A 4NJKA 1EJTC 3TTSA 5BZAA 4XX6A 3I68A 4L1GA 5IDIA 3PBMA 3ITVA 3QRHA 3ORWA 3EA3A 1M01A 3VOHA 2Y63A 2GQ3A 4NASA 4AEEA 2OSXA 3FGCB 2C0HA 3AXHA 1JVNA 1KGUA 1BTMA 4NAFA 1XR2A 2XYLA 5I06A 1XFBA 4O1FA 2E9LA 3CAQA 3MVIA 5LNVA 3Q45A 3PM6A 3EPMA 4XTDA 2XWEA 3W9ZA 2XFYA 3RM4A 5I78A 1RLDA 4QNWA 1B9ZA 2ZRZA 1YIXA 3I4KA 2HS8A 4B91A 4LY4A 2GFTA 2PDFA 5BOOA 4HU4A 4HZ8A 4NILA 2Z1VA 1H0GA 3QBUA 4ZOAA 4JFVA 4UNIA 1XSIA 3K8LA 3CV6A 4F48A 1V0NA 4RXFA 4YVXA 4B9YA 3REQA 1X1NA 1SUXA 2OWWA 3FYOA 1Q6LA 1RK6A 1UD3A 3EA1A 1JDDA 3WIJA 2WMJA 5H6HA 3N9RA 2Z7KA 4LW7A 3UYIA 4JDYA 2GDQA 1JDAA 3HOJA 3W24A 3PZGA 1TPDA 1LZOA 2O7SA 2J8TA 3A3XA 3FA5A 2BVWA 3BLOA 4P2VA 2V2HA 4GUFA 2WLYA 4BHYA 1VBRA 1W5NA 1A53A 2NLYA 4KCWA 2D24A 2DVXA 4S38A 3U4AA 3M16A 4X61A 2FVKA 1UMYA 4WSHA 3R6IA 4HQVA 2CZ5A 1LYXA 2H6RA 6XIAA 3BWWA 2ZRVA 3CB3A 1JCMP 3GLCA 1XLHA 3VD9A 3G22A 3MSYA 2ABBA 1FDYA 4XBJA 1TTQA 3CO4A 3BCDA 4HKPA 3UPMA 4JR5A 3ZOAA 1IZKA 3SSJA 3EDKA 1TIWA 1TZ7A 2W91A 3LA4A 4YVVA 5JBEA 3IVTA 3WNMA 1U2YA 1DP0A 3EMCA 2PDGA 2BG5A 3AUJA 4UFLA 4DO4A 5AC8A 4GJIA 2WC3A 3E2QA 3DU0A 3GO2A 2VELA 3VIJA 1S2CA 5DT7A 5A5WA 1C9DA 3COTA 5DO8A 5DBTA 2FPTA 2FFCA 2FQIA 1J96A 3KXQA 3AHTA 4E3VA 2RJHA 4JTDA 5ABTA 2OZTA 3KCJA 4PBGA 4RZ4A 4GIRA 4HYWA 5CJ5A 1E0VA 1TVPA 4H9VA 4GKLA 4Q3MA 3EX4A 1YKWA 1BEUA 1QW8A 2OT0A 3EDJA 4KRTA 1JL8A 5H1WA 2CYGA 4MNMA 4QG6A 2ATSA 4FS9A 3N25A 1AQ0A 4DUXA 3W71A 1E4MM 2QJIA 3VIFA 4KH2A 3ZLHA 2CLIA 3NXFA 3HZ3A 4WLCA 2C3ZA 1UZHA 4W8LA 4RNHA 3BXWA 1K02A 1R47A 4GC3A 3ITXA 5IRPA 1JUBA 1TA3B 4IIDA 1EUNA 1ZJBA 5HK4A 2HISA 3RPDA 3CB8A 4MB4A 1M3UA 4FSAA 1VFLA 3EMZA 3QLDA 4ZQCA 4JQ1A 1HNYA 3NZ1A 2Z1KA 4ERAA 4PYSA 3VZZA 2EG8A 4MZYA 2YJQA 3M0JA 5A8OA 4LUIA 2HROA 4LF2A 1XSJA 1M7XA 4JIEA 4XAZA 4C6KA 2QLYA 3M0VA 1UR9A 1BGAA 4C6NA 1TJPA 2PLMA 3MCOA 4LNYA 1JR1A 2HBXA 2YB1A 4IP7A 2F6XA 3DYOA 1AQHA 2QCEA 2HDJA 1DVJA 4CEUC 2V3FA 4GIAA 3S5NA 3U4FA 4N9CA 5EYWA 3DFQA 1HGWA 1YTDA 1RVGA 2ZZ4A 1UR1A 1TPFA 3BK0A 3VABA 3UJ2A 1LL7A 3FCPA 1VGAA 3LHYA 2Z00A 5TAOA 4OBSA 2YCKX 3TOPA 5AFDA 1ICQA 1PKMA 3VIKA 5I6SA 1ZLPA 1QPRA 3GVWA 1J2BA 2HTMA 1FWIC 2BZNA 2ISSA 1NJJA 2EPNA 5DN1A 5CSRA 4QE4A 5KZMA 5C8BB 1MMFA 5TF0A 4UTMA 4MYAA 1VENA 3UQNA 2CETA 2D0GA 4D9PA 4HYVA 4JFWA 4M8UA 4BWLA 3LCHA 3EWZA 4WKFA 1GKPA 4QR6A 3AALA 1WKDA 3H54A 3AWOA 2ANUA 1S2AA 5K9CA 3KOFA 4FOUA 5H8UA 1ZBVA 2ZZ2A 4ML9A 1IGSA 3L5MA 2X1SA 5G5IA 4PEEA 5C9UA 3TDFA 1TJRA 2QKFA 1JCNA 2PWGA 3OO2A 4CN1A 3LERA 4IT1A 1W32A 1DJWA 4GVGA 2Y88A 3VM7A 4MM1A 4E2VA 4LYRA 1O5QA 2G96A 3F2DA 1JUKA 3SN1A 4AZIA 1X96A 1KXVA 2GL5A 1GKRA 1OCQA 1Z69A 3IAPA 4ZE4A 3OLEA 4RNJA 4PZVA 2VO5A 4NZ1A 3CV2A 4U2ZA 4OTKA 2V5LA 2A7RA 2YLAA 2J13A 3HA1A 1XHGA 4M3PA 4FIRA 4DYKA 3G1FA 3TTYA 1KFWA 2FH6A 4E4PA 3LSBA 4MB1A 3WQVA 1K77A 1I2NA 5CGMA 1IR2A 3M5ZA 4JIQA 3SCQA 2VKZG 3IWPA 3PS7A 1SZGA 4N9BA 1CGUA 2YDSA 1QPKA 2PCQA 3W3OA 4QDMA 2J88A 2GUYA 2IQDA 2E1WA 3ARQA 4AAJA 1KBIA 4Q22A 1ZCCA 5LA2A 3NOYA 2POTA 4DJFA 5IFTA 4X63A 2DUXA 3HPXA 4TVCA 1L6GA 3C2YA 4H9XA 4LX4A 3KL0A 2I9EA 2B7OA 4AIEA 2GWNA 3WUFA 1HG3A 2OYMA 3MJYA 3QV9A 4H6QA 1FWWA 2JGYA 2QF7A 3LM3A 4N0RA 3WLNA 4BF9A 2ZX9A 2Q01A 3FHQA 3F4VA 1KKRA 4AG0A 3QTPA 2CESA 5E6YA 3QZEA 2RH9A 3N3TA 3TTOA 2ZUNA 3KBWA 4A3HA 1LQ0A 3KOZA 4D72A 1J11A 1JCLA 1F3EA 1NFBA 1BWKA 1F6YA 4N9EA 2QCHA 3MUAA 3OZOA 1H1YA 2HK0A 4S3BA 2WANA 4EX4A 2DFAA 5KEZA 4YNGA 3W22A 1XG3A 5BOEA 3MYPA 3IK2A 1IXQA 3M64A 5D9PA 5F1UA 1YE4A 2ACQA 1UH4A 3CIXA 2WV8A 3VOJA 1JQVA 2XVKA 4NIRA 3LHTA 4FPSA 3KOWA 1QMLA 2E3ZA 1PO9A 1YXDA 4FNRA 4XD3A 4DJED 4NU7A 1F3TA 3MWCA 4ZQOA 1NF7A 3CWOX 4FLOA 3SN0A 2ZA2A 1AODA 4C6DA 1BGGA 2GJPA 4JHMA 4ML4A 4F79A 5CQ1A 3VX1A 2VCBA 2VL4A 4KFPA 2EPKX 1N8WA 3A24A 1K6WA 3NSNA 3KM8A 5C9RA 3G0XA 4IL2A 1A49A 4G7FA 4JQAA 5LIYX 4PBEA 3RRAA 1MUCA 2V0TA 4ZO8A 4DBUA 4WF7A 4ZEPA 1UWQA 5DY3A 1TMQA 2X05A 3T0BA 1FVPA 3USZA 3SUSA 4UNLA 1CGVA 2GGIA 1N8FA 3TWAA 3T2QA 3UXLA 3VMPA 1JYNA 4XWUA 3LGEA 3R89A 1XPGA 4H6KA 4XO7A 1D8WA 2F61A 1KBJA 4I3GA 3E2SA 3F4NA 1KWGA 4PUKA 2Y0FA 4HPGA 3LZ3A 2ZUTA 2CHOA 2GDUA 3CNYA 4XZBA 4KF1A 3QFEA 3HM7A 1PKYA 5A6MA 3IVUA 2CLHA 1NQKA 3BG9A 1EGMA 4JCLA 2F6UA 2VURA 3XIMA 5BU6A 2H3DA 3TYDA 2VZVA 1LORA 3L4YA 4IXHA 2PLJA 5FJIA 4MHBA 1ME7A 5KINA 1U22A 3R8HA 4N9DA 3PBGA 4TX6A 2VXNA 3B8UA 1EOMA 3O9NA 3I10A 1R9YA 2YFOA 3B9AA 1KRCC 3ZWTA 3LRLA 3BW3A 4Q4KA 4JTUA 3ZJ7A 1OFOA 1UASA 1EPXA 4RX0A 5HDRA 1PTDA 4YS1A 4ATWA 2ADAA 4QJ4B 4K1WA 5CGQA 5FACA 1SFJA 3C61A 4MUZA 1C3FA 1BF6A 4TMBA 3RMJA 3LCFA 1V79A 2I56A 3PPHA 3DUGA 3CT2A 3QQ1A 1DTUA 3UWUA 3CTLA 2QUVA 2HMCA 4L65A 1JCYA 3A4XA 5M1TA 1TREA 1NOFA 1V3HA 3HO8A 3EWBX 2I5QA 1AVAA 3BQ6A 3W88A 2F38A 4ZE5A 1ZBWA 5I3KA 2G0WA 2P76A 4QITA 4TV6A 1QUMA 2Z2BA 3MO4A 3TN4A 1FWTA 2Z2AA 4ZENA 3EWDA 3EEZA 1OBAA 1LT8A 1RJQA 1SZFA 3RM9A 3ZSSA 2VOTA 3LB0A 1HT6A 1ZALA 3VOIA 1FH9A 4Z2IA 4GZ7A 2WC7A 2B0MA 3B97A 3N18A 3QR0A 1YPXA 1ISWA 3DHUA 3DC8A 1TQJA 3QY6A 3C3UA 3G6LA 3WBWA 3UG5A 3OVRA 3OW1A 2G95A 3P84A 5I02A 3LRKA 4QS6A 2DSVA 2IQ0A 4FX6M 1I0BA 5KZDA 3BVJA 4JZ5A 3RX2A 1Z32X 4W7UA 5E70A 1JYWA 1BQGA 2ZZ7A 2BY3A 3L12A 3SY5A 3S1UA 2XFWA 4EACA 2IW0A 4JYEA 1W2VA 2PUZA 1Z7AA 1IEQA 1US0A 3RLVA 4WZHA 3UWWA 1OCBA 1W1ZA 5CSSA 4A3UA 5LXXA 4F8XA 1VCGA 1JZ4A 3T40A 1XLEA 3E12A 4LFYA 3HN3A 1JCJA 1S1RA 3HGSA 4WQ6A 5REQB 2BXYA 3PZIA 4GYFA 2D2HA 3VD4A 4CD7A 2E9MA 3GRIA 4BQ2A 5D37A 2Y5JA 4DAFA 4A4AA 4M0XA 1KA9F 2VZOA 4QGCA 3H23A 2O92A 3BC9A 3U7VA 2HS6A 7A3HA 3G1AA 3NDYA 4DZHA 3RGTA 3WFZA 3VCNA 1FWEC 1AK5A 2C1HA 1HIZA 2V3EA 4AHQA 3NQ6A 1E3ZA 3OVGA 3WF2A 1GEHA 1RP8A 3U3HA 3WFAA 3W1LA 2QZRA 3CQIA 3OA5A 4BKNA 4GBDA 4QX4A 4P7QA 3DGRA 1RBOB 3KL5A 4MJ4A 1YXYA 4R7JA 4QFUA 4IG2A 4FALA 2O9TA 4FNQA 4HOXA 1SM9A 3Q58A 2V3DA 1X6UA 1CEOA 1PX3A 4GX8A 1EHAA 1N55A 4JY9A 1YPFA 1XF0A 1MDLA 5EPDA 2NSOA 1U1HA 3PULA 3LPGA 4QSFA 1U1UA 5KSWA 1CXLA 3DX5A 3G1RA 2HWGA 1LBMA 4LVDA 3W1XA 3SB0A 3LPFA 4IQLA 1AW2A 3IJLA 1H51A 1KM2A 3A3WA 1I2RA 4QROA 5CC3A 3CH0A 5G4EA 4XVDA 3MB9A 3B8VA 1PWLA 4B2DD 2AL1A 2P8BA 1Q7ZA 2VEIA 5IDZA 4KQNA 3WEMA 3TXZA 2F9RA 4WD0A 1PJ9A 3BAKA 3GD6A 2WWCA 2DT2A 2J7CA 4XG1A 4F2BA 2PSNA 5CPSA 2VQTA 3GIYA 3VX0A 3ZSTA 3THCA 3HG5A 4RNFA 2GGJA 2OPJA 3LEPA 4YWIA 4CD8A 1J0KA 4AWTA 4YTTA 2G50A 4LS1A 3E9AA 2ZRYA 2Q02A 1JUEA 1C92A 1MVYA 2WNQA 1CI1A 3T4CA 4GQBA 1XYLA 3EDEA 5HINA 4WY0A 1FTXA 4DWSD 3KVMA 1E9ZB 4V2XA 1W5QA 4Z1BA 2PI6A 2X7VA 2WSYA 4QG9A 1ITUA 1XH2A 3NUKA 2ZBTA 4IFKA 4A35A 1W9BM 4H9MA 2WKJA 3AHZA 2JKAA 3TLLA 2YLLA 1E15A 5DCBA 8XIMA 3VO0A 4NAEB 4PCNA 3TONA 3K8KA 4OWGA 2WNZA 5K9DA 2VVNA 1WV2A 3URBA 4UNKA 4DO7A 1M65A 3NXLA 4D6FA 4FXSA 4LCSA 3O0KA 4H41A 4WXYA 4MFDA 1XD1A 4MWAD 3D46A 3EBVA 4JTHA 3EDDA 5FEZA 3QKZA 4JX4A 5JU6A 1VHCA 1KCXA 3NZPA 1BVWA 4IIEA 3WMCA 1AZ1A 1JQXA 1MXSA 4NHVA 1ZB5A 1TZZA 4XD6A 2YPIA 2XINA 2Y4SA 4A2SA 1S3HA 1XYCA 1E5JA 4V28A 5FF2A 3ITGA 4CU6A 5CPLA 2VFEA 3CHVA 4KWWA 5LGZA 2LLEA 1YDOA 4UWMA 1OC6A 2P0OA 4O12A 2PTXA 4YN5A 5B80A 1X8FA 3NZQA 2RHGA 2WPBA 3DH7A 1E72M 4JL2A 3GNDA 2JF6A 2PGEA 4GCXA 4O1BA 2NQ9A 1I1WA 1EGZA 5CAKA 3YPIA 1ZTVA 3WLQA 3T55A 1UCWA 3A21A 5FJJA 2R9RA 2ALDA 4KS0A 4R27A 3AS2A 1AUSL 1QPQA 3DOPA 4DNMA 4JIIX 4XO6A 3UU0A 4ZOCA 4GINA 4MADA 1LOSA 2E8ZA 5H91A 1HKVA 2TPSA 4HNVA 3QM3A 4YYCA 3RG6A 3EWUA 1E1EA 2QAPA 2PDBA 4H7VA 1TPVA 5F4XA 4OV9A 4EF9A 3DI1A 1QRQA 1R30A 1V0LA 3WZ0E 4H19A 4Q32A 3WQWA 3U2OA 4HJFA 1R8LA 3GUGA 1Q6EA 1Z89A 3ABSA 4CCEA 2AGKA 2OLSA 5C5YA 4DJFC 2CHRA 3H2AA 1DHPA 2XIOA 4LAOA 1JD7A 3WELA 3MZ2A 4OECA 3RM8A 1S46A 5LIXX 3RF9A 1E6SM 3MV11 4LUTA 2OOFA 3CZGA 4V15A 3F2CA 3ABXA 3E3HA 1X8CA 2B7NA 3E0WA 1GPFA 1LRTA 4Q8WA 1DJIA 4GXPA 5TBOA 1UKQA 1K4HA 1EZ2A 3EOLA 3D47A 1MZHA 1MXGA 4GO8A 1QO2A 1C8QA 4W4QA 3IGSA 2PMQA 3T2PA 4S3DA 4LVAA 3EMQA 4O8AA 1BWLA 3MVTA 4PTVA 3ZIZA 4IJRA 4GY0A 4JFUA 4A3RA 4N42A 1ZU8A 1WZAA 3KVJA 3JU2A 1T7LA 4FLRA 4S3AA 5BYWA 1OB0A 1O1HA 2WVUA 4DBDA 3QHOA 1NAL1 2VFIA 1JI2A 4L61A 4DYJA 1L2QA 1PTGA 4V33A 1HKIA 3VNYA 4QDWA 2RDXA 2RGLA 1GQLA 2CZFA 3T81A 2NQLA 3AUOA 2BDQA 5F2MA 3CHEA 1HXJA 3M44A 2I7GA 4XZMX 2OZ3A 4HNNA 2CLFA 3LDVA 3MMWA 4O28A 1DJGA 2PODA 2TYSA 3VGGA 2Q8ZA 3K13A 4LUYA 1XM3A 1K9FA 1M7PA 2GJXA 4I9TA 3WQ6A 3R10A 1HJSA 4MAVA 4JQ2A 3ITCA 1V6YA 3STEA 3FGCA 1N82A 1NTHA 4PTXA 3GG8A 3T0AA 2HEJA 4YLWA 3ARPA 1V6UA 2ODOA 1XP3A 4W86A 1FWGC 2BVTA 3JRKA 1RR2A 2Q3OA 3K2GA 1OFQA 4GJJA 4GK8A 4M81A 3N9SA 4F2UA 1GUVA 2GSJA 4RE0A 3ZFHA 5TQLA 2QUUA 3MKKA 2ZX5A 1K03A 2WMKA 2QNEA 3QPEA 1UJQA 2PA6A 2YA0A 3HTWA 4LRSA 3MANA 4WRHA 4PMQA 3AU6A 1JZ7A 1QNQA 2XISA 5HQLA 4JICA 3A5FA 5A95A 3TU9A 4D6DA 1GVFA 3CPGA 3VCRA 4PH6A 6ALDA 3MCNA 4HNCA 1E71M 3G3MA 2I1OA 3NM3A 2CLOA 2FPYA 2WZHA 2YXXA 4EAYA 2Y8UA 1DJXA 1Q6QA 2O9RA 1FP9A 4DRSA 3LU2A 4RE2A 2BXZA 1GJWA 1HJQA 2CXEA 1GHSA 1MFVA 3NCOA 1QWGA 2CW6A 1HO1A 3S5ZA 4AEOA 4NZCA 1BQCA 4JGDA 3CZJA 3PZVA 3N2OA 2DIEA 2I5GA 3TK7A 4EPKA 3UESA 1W2PA 1QW9A 1RQBA 3NZRA 1DWIM 5T9BG 2J7GA 3UGRA 1ISZA 2EKCA 3V5FA 2EPHA 3UW6A 5CG7A 4G7EA 2BTMA 2EQDA 1MXDA 3KFTA 1V0MA 4HHHA 3ZWSA 2BASA 4IGHA 3FSTA 4FR6A 3RX3A 2X40A 4C6QA 1JRCA 2B81A 5T9CE 3S46A 2DEPA 3KDNA 1B4KA 3M0ZA 3CWHA 3UXDA 1TE6A 2VNCA 1H2JA 4AF0A 1CCWB 5I09A 3R43A 2G3NA 4L7ZA 1UWUA 3LPOA 3SFKA 1SW0A 3N9KA 5A8PA 1FWFC 3IEBA 3P6LA 3CMFA 4LYQA 3W29A 4CVWA 3UETA 4IQEA 2ZUUA 2J8FA 9XIMA 3GIPA 5F4SA 1KKOA 4FXFA 4JTIA 3G1HA 4UZSA 1KQZA 1B3YA 4KERA 3HG2A 4ATDA 1FDJA 3KTSA 4I5UA 4M6PA 1DWAM 2GK1B 2XN1A 2CITA 4EAMA 2Z1BA 4R88A 4INFA 1DV7A 2BNJA 3G1XA 3W1TA 4OFCA 1HF6A 3KOYA 5E0KA 1FHDA 2VX6A 3SI9A 3DG7A 4ZVJA 1JPIA 3VINA 2OQHA 3MUXA 2GUBA 3H26A 1S2WA 4MTVA 2B7QA 4CQBA 1UKPA 3UWZA 1XCFA 4FNTA 1Q6DA 4ENLA 4Z2JA 4UMCA 3WNKA 4H9YA 3AMGA 2X0SA 4D6GA 4YTRA 3NTYA 2WSPA 3ARVA 3N6HA 5EMYA 3TN6A 1VKFA 2BOFX 3PZUA 1VC4A 2PDPA 5A6BD 1L6SA 4HPNA 2XZ9A 1GORA 3S2MA 1VZWA 3JVAA 5JVLA 3AYRA 2FZ9A 3I4EA 3WJYA 4X9SA 5T91A 3PJXA 2OYKA 1KFLA 3HJZA 4C65A 2PWUA 2WMFA 1Y5XA 2A4AA 3ONCA 1KCLA 2JALA 1QNRA 2PDXA 4UTLA 1EB3A 1S1PA 3WD1A 4QG8A 3SIZA 3WQGA 2WC4A 4UR7A 2WK2A 2AAAA 3AHVA 1UD6A 2OEMA 3L23A 4LALA 5HNRA 2OMAA 1W1YA 3BJFA 3RFAA 3U9IA 2V3GA 2WMIB 5BCAA 1OEPA 3CM4A 3C0LA 3WNNA 1ZAIA 2WNWA 4XQ6A 1TPH1 5DBUA 1UMLA 5HMSA 1V02A 3F03K 2Y70A 3NDZA 3AROA 4LUJA 3ABQA 3BOLA 3LGDA 1XLBA 3SJ3A 3OGSA 3PJTA 3DBNA 3LI0A 5DELA 4X0NA 3NO5A 3WLMA 4GVHA 1SW3A 1YNPA 1OK4A 2X2GA 4O13A 4O1AA 2NQ5A 1WB0A 1E73M 3QC0A 4R85A 2PWVA 3SGGA 1OADA 3AHYA 4NVTA 1IEWA 2TMDA 1QHPA 5A8MA 1UYQA 1KR0A 1JFHA 2WWDA 4IF2A 3NL3A 2CPUA 3VIGA 1P6WA 1W9XA 5EMUA 1OM0A 4DLMA 3AO0A 4JX5A 2CXGA 4B3KA 5RUBA 5DT5A 5GJPA 1R7AA 1C91A 1TR1A 4JDBA 4ZZ9A 3VNZA 1H7XA 3VNDA 2W92A 1HVQA 1XLCA 4JYFA 3C3NA 2WSQA 4S3CA 3S9ZA 2Z27A 1MYRA 3MMTA 3LY0A 4IJCA 2WOQA 3OEXA 4ZSUA 5A8NA 3REQB 6REQB 3IV3A 1NWTA 1LUCB 3VIHA 3CUFA 4NI3A 2IKIA 1GKQA 2YSWA 1JAEA 2Y8KA 2EJ1A 1EJSC 1ZJIA 4M82A 4PEKA 5HANA 1BYCA 3W2NA 2R1KA 2XSAA 4JCMA 2PTZA 1BF2A 4J9JA 1UZ1A 2W62A 3C0JA 4W85A 4KCUA 2VUNA 5JXQA 1JULA 1X6NA 1OVDA 2C15A 3ZYZA 5JH2A 1F05A 1VS1A 1S38A 3UXKA 2Y5EA 1P5BA 1O4UA 3S5YA 3OU8A 1PV8A 4ACZA 4US5A 3DKJA 7ENLA 1YE6A 3GXMA 5AECA 2ASHA 1F6KA 1GNXA 4AY7A 3H2OA 5F1VA 1E4NA 4CD5A 2VZUA 4G8TA 3UR2A 4IUGA 2XVNA 1E1CB 4W84A 1E6RA 3SRHA 1K7XA 3WBEA 5HJLA 1CLVA 3ID7A 1S2UA 1RALA 3LUTA 4OKDA 3MI3A 1HO4A 3C0QA 1X98A 1EP2A 3NQAA 1BXNA 3PBYA 1XLDA 3A9BA 1E6PA 4YCPA 3RXZA 4H8UA 1OFRA 3AISA 1NU5A 2IS7A 5HWMA 4IMAA 5GNXA 2A6NA 3G18A 1XV8A 3N19B 1P6CA 4BEQA 4Q8OA 1O95A 4F4RA 3W37A 4UTWA 4DBSA 3JR2A 1U5VA 4M7SA 2EO7A 1MO0A 4GNKB 5DANA 3OYXA 1KRMA 1T0OA 3WNPA 1XCWA 3WQ8A 4GHRA 1EO5A 1W3LA 1XIDA 3C86A 3W75A 3GXDA 2C19A 1TPB1 3P0WA 1BRLA 3GZAA 2YCLA 1NDZA 2QVNA 3K8MA 5K9XA 3VIIA 4N4PA 4B2DA 1CIUA 1XBYA 3J7HA 3V1HA 3CMGA 5KTLA 1UZDA 5FI8A 2GDVA 3SFWA 4Q7BA 3ZMRA 4W7VA 3L21A 4U5IA 4YPJA 1UIPA 4L6DA 4PTDA 3T4WA 1R9XA 2ZFAA 5HWNA 1MRAA 1A5NC 2HSAA 1W3HA 3QZAA 3PPFA 3QZ6A 4MJ2A 3U57A 3PG9A 2C1IA 3HPSA 4DXKA 2D2GA 1XIMA 1RUSA 5DEZA 3S1VA 2Z24A 4O14A 3SN4A 1DWFM 2PAJA 3L5AA 2PE4A 4DWSA 5AHMA 4D1JA 4JHOA 1DWJM 1J0IA 3E0FA 4IGNA 3UCQA 3LGGA 4OU1A 1QI0A 1ZZMA 4K8EA 4B4FA 2BGSA 1P1XA 3PBVA 4LCRA 3TQKA 1OG6A 3LXBA 1E0UA 1OABA 4HZ7A 1IGWA 1W56A 1J9YA 1NFPA 3S0CA 3BICA 3GG0A 3H8AA 4XSLA 1QBAA 5C70A 1DQXA 3JZUA 3WYZA 2W63A 1GOQA 4ALDA 2XJ7A 3N4FA 3EX6A 5AHIA 4MWAA 3CZLA 5BRBA 1TELA 3KZPA 1D7FA 4JQ4A 4PSRA 3CXOA 1B3VA 3VZYA 1HQTA 1M5WA 3N6QA 2BV9A 3DFTA 4G1NA 1RQHA 1THFD 2EXOA 2IKJA 1BKSA 4J2PA 4MKSA 4AW7A 1QI3A 1UKSA 3LHZA 4DUWA 2F8QA 3LBMA 2EF9A 5DY2A 3TLQA 3HMCA 1DPMA 4MSSA 4PMUA 3V5CA 1ZAJA 3B9EA 1UUMA 6TIMA 5DFAA 1OT1A 3GDBA 1V6WA 3ARXA 2OO6A 1Y5VA 4BS0A 4RDZA 2OGYA 3ATZA 4MUPA 3AIWA 1DYSA 5D9MA 2XFRA 1TG7A 4PCFA 3S1GA 3H2EA 5M2FX 3UNTA 3U48A 2D2OA 1PTAA 2Z0IA 1AMYA 3PG8A 3GTXA 4E0CA 4O4WA 3H4WA 5FJRA 2J7DA 1KXHA 2Y7EA 3GFZA 3FOKA 2VFGA 3T09A 3DHDA 3QV8A 1UP2A 3E96A 1OYCA 3SJNA 3GX9A 2Z1XA 5G1TA 3ZJ6A 2QPUA 4ERIA 3GH5A 1W3JA 3W53A 3UJEA 3SCRA 2J9ZA 4HA0A 1V3LA 1FWAC 1C93A 4PR4A 5K2ZA 3MYOA 5LA1A 3C2RA 2XGBA 3PTDA 3OG3A 1QR7A 3WK1A 4S1FA 4GI8A 4KETA 1VH7A 4JX6A 2H90A 6ENLA 4LAUA 2YL6A 4XD5A 3SO7A 3PZNA 4FNPA 4EANA 2EG7A 2NLIA 3A9IA 1GYMA 1OGGA 1QJWA 2YYTA 3QYQA 1PPIA 1X38A 6PTDA 4AUBA 4WKAA 1BWVA 1RAKA 1ODUA 4LPCA 2OLAA 5FAGA 3OQ8A 4CQAA 2NWSA 1EDQA 4OHQA 4IQJA 3WKZA 3F4CA 1XBVA 3CQHA 2HZGA 3VKJA 1XUZA 3NURA 4U28A 4ZBCA 2A85A 3CAVA 1EH9A 2PURA 1RPKA 4ZODA 1NIUA 1Z6KA 4X60A 1RCXB 3GAKA 3CIVA 2VJXA 3E6EA 3OPSA 1BKHA 1VLWA 4PODA 3BE7A 2PTWA 1PKNA 1H09A 2J7BA 3T07A 1VBGA 1R9ZA 2X1TA 4XZHA 2AKZA 2YBVA 3WEOA 1RCOB 4WDWA 3KVKA 4P5UA 4UR9A 2YBUA 1IWAA 1I2OA 1Q3NA 1SSGA 1KQYA 5IBXC 3I65A 3MSGA 5I3FA 4F0LA 4NXKA 3P93A 1CNVA 3BURA 1SMAA 1T40A 4GACA 4AZCA 1VYPX 3ZO9A 4PMXA 2TODA 3DHPA 3DG3A 2IPGA 5EY5A 3W7CA 2MUCA 3V75A 3WLLA 1A4LA 3W81A 3L65A 8TIMA 4NNBA 1YW1A 2INEA 3NQDA 3BAWA 4XBKA 4UTUA 3GXPA 3CK5A 3W7IA 3ES8A 2VC7A 3KBVA 4JTCA 2HBVA 2QQ6A 1OSEA 1FX6A 3OBEA 3GWQA 1YTKA 5LIWX 4AU0A 3O3RA 5LNSA 1V7AA 3VYLA 2WKLA 5CJNA 1NOWA 4MG4A 4I9AA 5A94A 3MI2A 5FSEC 3NQ2A 2Z25A 2VX4A 3GBEA 2QDEA 2NVDA 4EF8A 1SJBA 1AZ2A 2VDHA 2ACSA 4Y96A 1QNSA 3EEGA 3GHUA 3LCLA 1JPDX 4XBSA 2CFFA 1AA1B 4LBSA 5CZTA 1IWPA 1F3WA 2DP3A 3HFTA 4HCDA 2E1DA 3SUTA 2OVLA 3TN5A 1R3QA 4Z1AA 3MUY1 3IJ8A 3I6EA 4Q4QA 4XIAA 1NF0A 3KS6A 1CB7B 4URIA 2YDRA 3OB8A 1K8XA 3VNLA 5EFFA 1TWDA 4C60A 1OCJA 1TWWA 1JYXA 1OD8A 4FO4A 1GGOA 1NP0A 2CZEA 2R1PA 1MFUA 3ANVA 3LNPA 2C13A 3SIMA 1EO7A 1YADA 1M6JA 3LG3A 2J7HA 3S5OA 4ZFCA 2XSBA 4P8UA 1K1DA 2Y1HA 1V3JA 2UBPC 4PUUA 4W87A 1UOKA 2CKSA 5M03A 3SCWA 1W5MA 9RUBA 1HKJA 1MUWA 2BB0A 2HV5A 3HPFA 3ERPA 4L6HA 3UY7A 3N2CA 1A3WA 3W27A 4KEZA 3F1QA 4M19A 3T8LA 4A29A 1G6CA 4DBWA 4Z0JA 1JZ5A 2CEQA 1MEIA 3V0SA 5BROA 1QNVA 4UZUA 2VMFA 1ZSXA 4MKNA 1LWJA 4WOQA 4RW3A 4XD4A 1F73A 1XYFA 2VR5A 1WXJA 4H4IA 2WZMA 1SR9A 4RCXA 1TB3A 5U7SA 1H0IA 5J5RA 5E0CA 1M9HA 3NQGA 2V5BA 1V93A 2FB3A 3GHRA 1OK6A 4A3QA 4Y9MA 4KKXA 1X7IA 2E8YA 4FZIA 1GVYA 5DMLA 4NKCA 4NG3A 5MHBA 4I7UA 1Y8BA 4IL0A 2DZUA 1HW6A 1ZS2A 3WH7A 2X42A 5CH9A 1ITXA 1E51A 2WCAA 3AU2A 2NUWA 1QPNA 4RPQA 4E8GA 3WMLA 3MC5A 5D8WA 1YXCA 4O1EA 3V7PA 2EPOA 3TC3A 1E3XA 3TP4A 3ARSA 4FIQA 3CZEA 4H6EA 3L0KA 3WLSA 5GPRA 3BJSA 3UNDA 5IHRA 2NV2A 1XRSA 1YTEA 1ZGDA 4NJHA 2P5NA 4A05A 3R12A 1X1OA 3T7VA 3PWAA 4YTSA 3SRFA 5LKYA 3QMSA 3CUHA 2OSWA 1CENA 1PIGA 1SO4A 4YJ5A 1GTHA 3VFCA 4LGXA 4L4OA 5BXTA 1EC7A 3PJUA 4GYKA 1GQJA 2FJUB 3PZTA 3VE9A 3DYMA 4DLFA 5BU9A 2UWFA 1VEOA 3EAUA 6CGTA 3GNXA 5FESA 1KLYA 4JEQA 4QCFA 4HP5A 1G4PA 3E1F1 4F9DA 3MSDA 3SCOA 3IVSA 4O15A 3VGHA 1FCVA 1W8SA 3W02A 1Q6FA 4WK9A 1QATA 1FH8A 3H7VA 1ALDA 4IGMA 4GZJA 5LNRA 1O68A 3EWYA 2VEKA 4S3GA 4IH3A 4PGLA 3WD2A 1GW1A 1KB3A 4DJDA 1H7PA 1A4MA 5HAOA 4C1NA 4HOZA 2J7EA 1J6PA 4WXZA 3WFLA 4JOMA 1JZ6A 4DF2A 3A64A 5CSYA 1TSIA 1SW7A 3QHMA 1J12A 1JGIA 2WYSA 4Z17A 4ZR8A 3OHIA 3FNDA 1IXNA 2ISVA 3HQ1A 4UTWC 3TC7A 3WN6A 3C5QA 4PRTA 2QMJA 1XLFA 1UKOA 1IT8A 4CVUA 1PUDA 1UUQA 1VF8A 3JZEA 5G2WA 1FRBA 1R2SA 1HTIA 3M5XA 1AW5A 4UFMA 4HA4A 2OO0A 2WSKA 2PEVA 5HMEA 3PHAA 1XUUA 1CXEA 2XGZA 7PTDA 1IIHA 1N2VA 5C9WA 2UY3A 2CC0A 3BV4A 2XGIA 3BZGA 4X0VA 1L8NA 2XIBA 2PLCA 1HL8A 3VPLA 3MU7A 4Z2HA 2WBKA 3GZ3A 4PCTA 3NGJA 1T99A 1N8IA 1BVZA 1ONWA 1ECEA 4KWUA 3IIOA 2QPSA 1NARA 3G2GA 1OFDA 1MEWA 3GDTA 1I6NA 4Z1CA 1J0YA 4WVXA 4IPNB 4K36A 3RCMA 2JKPA 3QVQA 3VK5A 1C90A 5D30A 3CPUA 1QU4A 5FF7A 1W3KA 4HNLA 1E55A 4H7CA 2QCDA 3P7YA 4IICA 4HIBA 2NX9A 5GNZA 1TV8A 5LGXA 4DHGA 4HSOA 3CAWA 4U3CA 5BXSA 1EIBA 2GVGA 4U10A 5KETA 5D2TA 4O54A 2G97A 1RV8A 3VC6A 4L1XA 2ZZ6A 1XLMA 2QV4A 1P43A 4DNHA 4AVNA 4WJEA 2IKGA 3VKKA 3AYSA 3AXIA 3STGA 3POHA 1FFQA 4WY0B 2WQDA 4O1DA 4XAYA 1E0XA 2W3ZA 4J4KA 1E9IA 4D8LA 5HPCA 2PDNA 3WD3A 4GVIA 1XH1A 4AIBA 3D0CA 1K9EA 3M7WA 3DN5A 2PF8A 1AG1O 1RQEA 4RZ5A 3UPWA 1CW2A 1KBKA 3LI1A 4K7VA 1CB2A 3HG3A 4S2BA 3H53A 3GAYA 3CMJA 4H2CA 1JPKA 4H2HA 4XIMA 2OEJA 1B5TA 3TXVA 4F3HA 2AKMA 1IEIA 5AYBA 3WUBA 2QR6A 3C2OA 3B05A 2C14A 1PXGA 5AZ1A 1EZWA 2OB3A 3B04A 3P82A 4DXXA 3QFWA 1PZ2A 2FHCA 3MP3A 3O6DA 3QYSA 2DT0A 4GOAA 2ZX6A 1Q7QA 4ES4A 2PC8A 5FA5A 3NQEA 4CN4A 3KWSA 3R11A 1F2JA 4JTKA 1ISVA 4PMRA 4GKTA 5DRIA 2EPLX 2QIWA 3LS9A 5CZ0A 2WJDA 3WF4A 1PE1A 2PWHA 1CZ1A 2EEXA 3HU7A 3CWNA 4LWWA 1K4GA 1SSDA 4NY2A 2QV5A 2RGMA 3H4XA 4UOJA 2NX1A 3CT7A 2ZVIA 4V1YA 4ZFMA 5TIMA 2WNNA 3M07A 4BQ3A 1Q6OA 3RITA 2JGQA 4FX7A 1UA3A 2WM1A 2E25A 1EJRC 2PWDA 1LM1A 5EMMA 4P8VA 3NYZA 3WLRA 4XZNX 1A5UA 2QEZA 4F0RA 4S23A 1SO6A 1WAUA 3VKDA 5F2IA 4QE1A 3WMBA 3BSHA 2BOGX 4KEMA 4UTIA 4R9XA 4EPDC 3CASA 4TOQA 1UUOA 1PCKA 1LRQA 2GK1A 2D3NA 3QH2A 3BANA 1Q66A 3LXAA 1TIMA 4DYEA 1UW9A 1V02E 1W31A 2GJLA 5CKSA 4QAIA 3OLGA 2J47A 4AXKA 2XZ7A 3GK0A 4IMGA 3T0CA 3K4AA 3GDKA 3U5UA 3M0IA 3A4WA 5AYYA 3AYTA 4KIRA 1C9WA 1UB3A 1XISA 3QSRA 3W7KA 4EXAA 2F84A 1PL9A 1ZJAA 3N73A 5FL1A 2AAMA 1VIZA 3TZFA 2YXGA 5ABEA 4H8HA 5D38A 1CLXA 1B2YA 1J01A 3VCCA 1ZCOA 3GXFA 1YDYA 1WCGA 3WLJA 1UWTA 1PBGA 1AH4A 1W1PA 4OBRA 3CPRA 1YQ2A 1QBBA 2BODX 1CXFA 4MB5A 1GVIA 3AC0A 4D6IA 2J4GA 2WVVB 3HURA 3STCA 1L6FA 4AIOA 1VP5A 5I3DA 3W7MA 3K30A 4CN6A 4R33A 4RKAA 3T78A 5AYXA 4MNLA 2FH8A 2VT0A 3L2MA 3KTXA 4G2DA 1WDPA 2VWSA 4GC4A 4C6OA 3RPTA 3LNMA 4GQRA 4QXIA 3DXIA 1TWIA 4IP5A 4QEHA 1AQMA 1P0KA 5G1MA 2FGBA 5J04A 3D3AA 2QCFA 5DMNA 3OP2A 3SCNA 4QE5A 1KTBA 2EHHA 5JBFA 2WMIA 3CU2A 2OSYA 4MNJA 5CPOA 1PAMA 3UJFA 2PDIA 1WKYA 1TUFA 3ZVIA 3S6TA 3KS5A 2C16A 3B8WA 3TX9A 3H7UA 5LXEA 3CL6A 4PUJA 4QTGA 1FQ0A 2OFJA 3GTHA 4ILSA 3OLIA 4DO5A 3T0DA 2GJXB 3M1ZA 1POKA 3TQVA 4C91A 5I2UA 1V6TA 1W9DM 3S1WA 3K4WA 1TJ1A 3W87A 3WNOA 3P0XA 5L9FA 2O55A 4IMCA 4C5YA 1KGXA 3G5EA 3RUBL 4AX7A 4KRUA 4OVXA 2QYGA 3WNLA 2WKGA 1KFJA 2NUYA 1FDZA 4KRZA 1Q2SA 3NAVA 3G1YA 3KLKA 4LU0A 3OGRA 3NFUA 4QQ3A 4L9ZA 1TVLA 4HNOA 2CLKA 1OYBA 4ZXLA 2NXHA