4ZQOA

Crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the complex with imp and the inhibitor q67
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
375
structure length
354
Chain Sequence
b'DPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSGGLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Mycobacterium tuberculosis IMPDH in Complexes with Substrates, Products and Antitubercular Compounds.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 354
sequence length 375
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zqoA00
3FJ6A 3NQMA 4LUJA 1F76A 3KRUA 4BI6A 1TB3A 2ZFAA 4E2DA 2WJZA 3UNDA 3NQAA 1XBXA 4B5NA 1KFBA 3P67A 3W74A 4BF9A 4O10A 1EIXA 3F1QA 1ICPA 2VFHA 3NQCA 1R2RA 2AQWA 3W72A 1KFKA 3O6CA 5C54A 3UQNA 4OBTA 2B7QA 3R5EA 4BWLA 1DQXA 1NAL1 4GWEA 3S6DA 2V81A 3ABOA 4H3DA 2NLIA 1EB3A 4N9DA 1ZENA 4NT0A 1UJPA 3UXDA 4IMCA 1W56A 4LVDA 2QUUA 1JRCA 3GDKA 3WJZA 2A85A 1LLWA 5DBTA 4JIQA 5CPMA 3DXIA 2OT0A 3GDRA 1GVSA 4UFJA 4NU7A 3VFLA 1VCGA 3NQEA 3TW6A 1L6SA 5LSMA 1TRDA 3NPWA 3HPXA 2C6QA 4S2BA 1W5NA 1OX4B 2JGQA 1L2UA 1I2QA 5AHMA 2QCDB 4Z08A 3BO9A 3B03A 2E6DA 1H5YA 4N9BA 2KZHA 1AMKA 2X2GA 1ICQA 1XI3A 3E02A 3W87A 2R94A 3R2GA 1G4EA 1VYRA 3NXFA 3NG3A 3TC7A 4AH7A 2NWSA 2TSYA 3IGXA 4RX0A 5A5WA 4YCPA 3JR2A 5D33A 1SO4A 3W83A 3GNNA 2Y7FA 1FCQA 1C9DA 3WJSA 1ZFJA 4NJIA 4KKXA 4UTHA 2QKFA 5F4SA 3GXNA 1VJIA 5G2WA 4MZYA 4N6EA 4R34A 4MVAA 1ZY9A 4AHQA 1PS9A 3BPWA 3TJXA 4GUIA 3TROA 4GJ1A 3C61A 1XDMA 5I3JA 3H55A 5AHEA 1FCVA 1TMHA 1F2JA 2GPTA 3EX1A 4Q4KA 3TNOA 2QUVA 1GG1A 3NNTA 4LOCA 3MYOA 4JY9A 4ADSA 1A5BA 5K9XA 3W7RA 2NZLA 1YXYA 1TPEA 3LCIA 1G4PA 4LS2A 5K9CA 4UTWC 3LDVA 2I9EA 1IIGA 3PF3A 4FX7A 4M7SA 4MJMA 2E5DA 1LORA 1TCDA 2QCFA 3GDMA 1OX5A 1WOAA 2Z1BA 3P82A 2Z0IA 3LTSA 4JYDA 4Z1DA 4IMEA 3LCHA 1GEQA 1TQJA 2CLMA 4K6AA 3PAJA 2X16A 3T7VA 3S5OA 4Z0JA 2DJXA 2EGZA 4KFOA 3MMTA 4O53A 2C3ZA 2J9YA 1PE1A 3ZWSA 1A5AA 3THAA 3B0UX 4IPIA 1XM3A 3GKAA 4LNYA 5K3VA 4ZL1A 3GR8A 5LKYA 4FX6M 1H62A 4MUZA 1KA9F 4EVZA 2BTMA 2JK2A 3MHUA 1LRNA 2W6RA 1MO0A 5U7SA 1VHCA 4GE8A 3LCGA 5KZEA 1W1ZA 3TFCA 4ONVA 5AHLA 4UXDA 5HJLA 2YW4A 5D05A 4XWUA 3CIXA 4JTHA 3W86A 1QO5A 2RH9A 5CZJA 4O17A 4IGHA 4Y6GA 2BWGA 3W71A 1AW5A 1P0KA 2A2IA 4LS0A 3FKKA 4GNJA 4QJ1A 4UC5A 3G1AA 4FNSA 3CEPA 4JYFA 3RF9A 1OK4A 3N19B 5DCBA 3T4CA 3BVJA 3QW4B 1QOQA 4O52A 3W6YA 1AG1O 2C16A 1H51A 3VI2A 1OF8A 4I9AA 5D32A 3A22A 1SO3A 1LM1A 3DFTA 5KZDA 1HG3A 5IBXA 1JQVA 5C55A 1SU5A 4XKYA 1IXNA 5DN1A 1WOBA 2C18A 2OX1A 4NJGA 5EYWA 2Q3RA 3IRDA 4A22A 2CLOA 3BGGA 4O4WA 5DY2A 5KSWA 1KW1A 2H8XA 3DHDA 4R33A 3B4UA 1Q3NA 1UASA 5D2VA 3HIJA 1I45A 1OFOA 4C1KA 1KTNA 3KAOA 3N3MA 1G4SA 3NL2A 4EWND 4FNRA 4EF8A 1TO3A 1FDJA 4O15A 2A4AA 3QRHA 4AWUA 2Y61A 2WNZA 1UBSA 4JYEA 5I3IA 3BLIA 5AHIA 1ZNNA 1O60A 4JX6A 4MOZA 4K7VA 1KV8A 1VYSX 2A6NA 5CGQA 5AB3A 1T96A 1SZEA 1BKSA 3E9AA 1OG0A 1LZOA 1ZAJA 3CTLA 2VEMA 4OQVA 2TMDA 4K7YA 1Q45A 3T40A 2DZSA 2V2CA 3GZ3A 3LOTA 3LBCA 3GDLA 3VKJA 2CZ5A 1TV7A 1YDOA 2VEPA 1VC4A 3W7OA 3PG9A 1KFJA 4RR4A 3TE9A 4WY0A 4JNMA 3GVGA 4W9TA 1GWJA 4UFHA 2VEIA 4ZQMA 1JCYA 3LCXA 2QAPA 1H7NA 3JRKA 1H60A 3SECA 1TPWA 5BMXA 2OZ0A 3S5NA 4LVFA 3RMJA 1A5SA 4XKYB 1F05A 3UZJA 4O19A 4LW7A 1PL9A 5F4WA 3L0GA 4QM1A 2E5BA 1OYCA 1SUXA 3W9ZA 3TH6A 4JR5A 5D02A 1YLVA 3I65A 1XFBA 1TJPA 4CLMA 2H8ZA 5D2XA 2YFNA 3W1AA 2E68A 1TIMA 3HQ1A 4IMFA 3HB9A 1DHPA 1EP3A 2A7RA 1HTIA 3IVUA 3N34A 4ZQOA 5EY5A 1OFPA 3NQ2A 4JTJA 3N9SA 4QNWA 2QCLA 4IPJA 3SI9A 3HMJG 3HF3A 3PULA 4RJEA 3NQGA 4UCGA 4ADUA 2FPYA 1SSGA 3KVKA 5G1TA 5J5DA 5L6UA 1FXPA 3PBVA 1M6JA 4NNBA 1MEHA 1SFJA 3MWAA 2O7SA 2ZZ6A 1K8XA 2A7PA 1A50A 3H54A 2ATMA 5D37A 3UWYA 3M16A 4MFEA 4AF0A 2VEKA 3KOFA 2QCHA 3G0UA 4WY0B 3GNDA 3OVPA 4RKAA 5BOOA 5HR6A 3MI3A 3LHVA 3NL5A 3NVTA 3EWUA 3NYZA 3O16A 1Q6LA 4R53A 1QPOA 3PY2A 2CLEA 5LNRA 1W5PA 3C4UA 1GOXA 1L9WA 1KM2A 1GG0A 3R12A 3P5YA 5AHNA 1W0MA 3B05A 5DY3A 2FQIA 5BW6A 1X1ZA 1S5WA 5FEZA 3CEUA 4Y90A 3W1PA 2ZZ7A 5EKYA 1RQHA 3FFSA 5I3HA 2RHGA 2A1YA 4UFIA 3KRZA 3P61A 4RZ5A 3MP5A 4DEFA 1AW2A 1JCLA 1GPWA 2UV8G 3DFPA 3CM4A 3NQDA 5G4WA 3W2KA 1DORA 5DELA 4YCOA 4YL2A 1OHLA 1V7YA 5LZLA 1L6WA 3GAYA 3PWAA 4UTTA 1KFEA 3STFA 3G3MA 4J9JA 1H1ZA 2ZYFA 1QCWA 3G22A 4LY8A 3B0PA 3QFEA 1KTCA 1NFBA 4FB7A 2ZBTA 3V75A 2NUXA 2P1FA 1G7VA 2TRSA 3UWQA 4YXGA 1M7OA 1PVNA 4LVBA 3OIXA 4M6VA 4JXCA 4FIRA 1M7PA 1VR6A 1Z48A 2F7FA 3DU0A 1SW7A 2J6XA 1FBAA 3KFTA 3SGZA 3TSDA 4P61A 3WJXA 1DJQA 4ICNA 4AF0B 3TFXA 3A5FA 4M6PA 1OF6A 1R30A 3GDTA 4DPPA 3UPBA 1I2RA 1SR9A 4WJEA 2RDWA 3W1NA 4G1KA 2EPHA 5G4EA 5CPNA 1I2NA 3TIMA 3CWNA 4CCCA 3C2OA 5FEPA 5LNWA 3Q2DA 3FKRA 5HWNA 2JKEA 1SSDA 3CHVA 1MXSA 4IMGA 1FWNA 1KM5A 1QO2A 2RKXA 4HIBA 1W5QA 4MY8A 3PB2A 3W22A 2O7QA 1TREA 5EPDA 2JBMA 3GIYA 4LVAA 1QPRA 4O0KA 4XZ9A 2CLHA 3NZRA 3EKZA 4HNTA 1QPNA 1R2SA 1XBZA 2Y63A 5D03A 3S42A 2WNQA 6TIMA 1ME7A 2VFFA 3W7NA 3E49A 1W3NA 3VE9A 5L9FA 4TIMA 4RXFA 4IOTA 1YPIA 4X22A 3BG5A 4O54A 2HS6A 4X2RA 1AK5A 1YTDA 3B8DA 1JCNA 5CSSA 2ATSA 3VCRA 5CSRA 3DFOA 3NL3A 1OX4A 4DO5A 2QCDA 1ME9A 2YX0A 4BR1A 1IXQA 3PC0A 1OFBA 1I8JA 3SW6A 3W7LA 3C8FA 3YPIA 1BWLA 4WQ6A 5EBUA 3WFAA 2V82A 3P60A 1DBTA 4PA8A 5AC8A 1T0OA 1KM3A 2Z6IA 3B0VC 3FYOA 3GAKA 1EP1A 1F5ZA 2X1RA 1OK6A 3NGJA 3M44A 1TTIA 4N9CA 3QQ0A 3M6YA 3LERA 4UR7A 1ZAHA 3LLDA 3KVLA 1K02A 2J9ZA 2R91A 1FWSA 3P5ZA 3QC3A 5HINA 3STEA 5KTLA 3FS2A 4ZQPA 2AGKA 5K4ZA 2EHHA 2ZCGA 4POCA 3W73A 1JRBA 2FPVA 4RK8A 4FHAA 1A53A 4CCEA 1FQ0A 2FFCA 1Q6QA 1I2OA 4YMZA 4K36A 3DH7A 1NSJA 3P8IA 4L4MA 4MKNA 3EKLA 1RZMA 1RVGA 3KRSA 3W88A 3BGJA 5LNVA 2AAMA 4BWLC 2HTMA 1TRIA 4U4MA 2Y85A 2GUUA 5FEWA 4FNTA 5FF4A 1F6PA 3W7IA 1YTKA 2EKCA 1EUAA 3GK0A 2QCEA 3UXAA 1JUKA 4O28A 3EWXA 4QSHA 1DOSA 1M5WA 2VFIA 3LI0A 3NDOA 3ZR4A 4DXVA 2ISWA 3EX3A 4HHPA 3CU2A 2VOMA 1OX6A 4MYAA 4GRSA 1NF7A 3PG8A 1FWRA 3MBDA 1OYBA 3K30A 1B9BA 2WO5A 5KMYA 1LDCA 3PBWA 2YFOA 4AVFA 5G5IA 2Q8LA 4Z1AA 3N2MA 4LV4A 2CZEA 3AO0A 3HBLA 3OVQA 1JCXA 1P4CA 6ALDA 4IMDA 3GR7A 3P80A 4CNOA 3RLUA 3S1WA 3W07A 1JCJA 2BX7A 3IIVA 3EX6A 3DAQA 1UB3A 2E09A 3W7PA 5LHFA 3W2JA 1X6UA 3TAKA 4PH6A 4LC8A 3LRKA 3U6WA 2W0UA 3EX2A 3FA5A 2QJGA 4Z0SA 3WK2A 4KFPA 4YLWA 5TIMA 3C0JA 3WK3A 3M0ZA 1Q6RA 2E1DA 1KV5A 1GVOA 4OU1A 3TQVA 1DVJA 1H61A 4UTWA 1RV8A 1OFDA 3TC6A 1PV8A 4UTKA 1ME8A 2DORA 2X1SA 2F84A 4A3UA 2QCCA 1GYNA 7TIMA 2FB2A 3H53A 3TX9A 3TMQA 3LCFA 3LHWA 4MPQA 2DJLA 1W5OA 3EEGA 4DBDA 4UR8A 2OMAA 2X1UA 3AJXA 2V30A 1YXCA 3CLMA 3NM3A 4ZQCA 1G69A 4QITA 1JUBA 2VELA 4UTIA 5C5YA 3DFQA 4H4IA 4LS1A 2QAFA 4JGDA 3QSTA 5F2IA 2YYTA 3QMRA 5BRBA 3C6CA 1LCOA 4NZFA 1O94A 3UWZA 5K9DA 3T78A 1Z44A 3UY7A 4PTNA 1HO1A 4A29A 5C2XA 1KLYA 1K8ZA 4NVTA 3C2EA 2R8WA 3N9RA 5CZSA 5D2WA 3UWWA 3S5ZA 2J88A 3TAOA 2FTPA 4I7UA 2CU0A 3V1PA 4XBKA 2BSLA 1VPXA 3TA6A 3NOEA 4IQLA 3NEVA 4AEOA 3PSWA 2JKAA 2OJPA 2Y6ZA 5U4NA 4LT9A 4X9SA 2CZFA 3QPYA 2DP3A 3W84A 1JQXA 1LRTA 3STGA 3LGEA 3W7GA 1WBHA 4NZJA 5LGZA 2ZZ1A 4PL2A 5DXYA 3MP4A 4O16A 3O6YX 1F74A 3KHJA 4N6FA 2Y7DA 3LV6A 1C29A 1ALDA 1LBMA 5H91A 4ZZ9A 1X8FA 1KBJA 2FPTA 3RFAA 3F03K 4ZVJA 1EA0A 5GVJA 1I2PA 1KM1A 3T55A 2FDSA 3WJWA 1TPUA 4QIUA 1YTEA 2CLLA 3LCLA 3LTYA 3OEXA 3W2MA 3IIPA 3LXCA 5D04C 1Z41A 3IIZA 2QDGA 3L5AA 3A5VA 5FF2A 1IF2A 2I1OA 3MJYA 1SZFA 2PE4A 3W7QA 3JS3A 3BLEA 3NQVA 4JN6A 2H3DA 2NX9A 1EP2A 2I14A 2Y89A 5BMWA 2WOQA 3A21A 1TPDA 2PRMA 3G8RA 2QJIA 1L6YA 2BLEA 3W75A 3TXVA 1PIIA 2PC4A 1O5KA 3IIXA 4YWIA 1SZNA 1QNVA 4ORMA 4N4PA 3ELFA 1Z42A 2PCQA 2LLEA 1JCMP 3L21A 1P5BA 1QAPA 1LOSA 4GUFA 2QF7A 1LBFA 4MFDA 4XBSA 5D09A 3IGSA 1IXPA 2HSAA 2WSQA 4AXKA 1QPQA 4Y8FA 1J2WA 1K8YA 1KFCA 4Z1BA 2Q3OA 4CNPA 1QMLA 3L66A 4AWTA 4N4QA 2YR1A 1W5MA 3O6DA 3M7WA 1W8SA 1E51A 3LI1A 1YXDA 2B7NA 3S9YA 5DBUA 3FYPA 5C6MA 1W31A 4IJBA 5CZ0A 4K8EA 2VXNA 2YCEA 2OCZA 2XFWA 1RQBA 1VHNA 3MBFA 1TQXA 3O15A 2VFEA 2OT1A 4UFLA 3O63A 1HL2A 3TJLA 3USBA 2ZQ0A 4FXRA 3KVJA 4S2CA 2DZPA 3EWYA 1WBJA 1LBLA 4QAIA 1SZGA 3R8RA 4UFKA 1VYPX 2GQAA 3MP3A 4HPJA 4ORIA 2NXGA 5AHFA 4EF9A 4NNAA 3ABSA 2QCNA 2ISSA 1G6CA 5HWMA 3FOKA 3MI2A 4HT3A 2C1HA 3G1YA 1QWGA 3UWVA 3RU6A 2QEZA 2ABBA 4O14A 3QM3A 4MLRA 4IXHA 3TK7A 4AHPA 3INPA 3C56A 1H50A 4JTUA 3G1HA 3O07A 4PODA 1QFEA 1UUOA 4JX5A 1WQ5A 4LU0A 2ZZ4A 3HGSA 4UIOA 1K7EA 5G2IA 4JTTA 3CPRA 2NV1A 4OT7A 3PS7A 1WXJA 4PL1A 3L5LA 3M43A 4DBEA 1TPFA 1LLZA 3B04A 3L65A 1OFAA 2ZA1A 4O1CA 1SFLA 3S0CA 3G24A 4FX8A 3SZ8A 1K7FA 3C52A 1HUVA 3S1UA 2FIQA 3NR0A 3BW4A 4UTMA 3WK1A 1N55A 1IGSA 3KXQA 4GXMA 3NQ8A 3TSMA 1AW1A 4ML9A 3NZ1A 4UMBA 3DKJA 4LWWA 5TQLA 4DPQA 1W3IA 3HG4A 3O8AA 4DO6A 1YDVA 2DZWA 4LTSA 4UNKA 4JTFA 1W54A 3IV3A 3QYQA 5AFDA 3TUUA 4R7JA 2Y7GA 1XC4A 4P2VA 3QQ1A 1KM6A 3QZEA 1EEPA 2XN2A 4BK9A 4HNVA 3KVMA 5HMSA 1KM4A 2YYUA 2V9DA 1YYAA 2WQPA 1VGAA 3UYCA 1Q6OA 4M7TA 1KBIA 3HGOA 4JY8A 2H6RA 4UTTC 4GUJA 4O57A 3W85A 3TW7A 1FY6A 3W1MA 4QQ3A 4UNLA 4OV9A 5FF7A 3SFKA 3GXTA 2HS8A 3KX6A 1V5XA 2Z6JA 4NJJA 3W3OA 1VCVA 4L4LA 3DI1A 3PUDA 1OFEA 4N02A 4JDBA 3U8GA 3WK0A 2YXGA 5KINA 1EX5A 4AB4A 2DZUA 4WXZA 4MY9A 3PR2A 1H1YA 1FDYA 2WKJA 3W76A 4ALDA 5FF3A 5FI8A 4TO8A 3QMTA 1LYXA 2G95A 1WDWA 3PVFA 3TDFA 2YDAA 4CQ8A 3N73A 1R2TA 5HUPA 2ZTKA 1QOPA 1DKWA 2D73A 3QJAA 4C1LA 3ABRA 5TBOA 2DZXA 4NQ1A 1EWDA 3OVRA 1PCKA 1GYLA 5EA9A 3ATYA 3LXAA 2X30A 2C15A 2ZTJA 4TMCA 3EB2A 1RD5A 4M19A 3VNDA 4PCFA 3I6RA 4RZ6A 5K4XA 4E38A 4MY1A 2VKZG 5HULA 3GYEA 4DQWA 3TXZA 2ZRZA 1ZAIA 2ZA2A 1K03A 1JR1A 4UTUA 4WOZA 2GVGA 3MYPA 1H7WA 3DKLA 2CWNA 3PSVA 1OJXA 3CQ0A 1XUUA 1GZGA 2IQTA 1CI1A 2E6YA 1ZCOA 1GVQA 1O4UA 5D30A 3W1LA 2ZRYA 4M6QA 1SQ7A 1VS1A 2G5WA 3I68A 4O1AA 4BI5A 3BARA 4DF0A 2NUYA 2PRLA 3BV4A 4AHOA 2ZZ5A 3PBYA 4RCXA 4HN4A 3L67A 1PHQA 2GVLA 1T8XA 1TPVA 4PEKA 3IIOA 4TMBA 3NQ6A 1B4EA 2VFDA 3NO5A 2QDHA 1LROA 3L68A 5EMUA 5HNRA 1A5CA 1BTMA 1LOQA 3DBPA 1YPFA 3HOJA 3S5YA 1NEYA 1OABA 4HKPA 5KITA 3EWZA 2FJKA 1DJNA 5D38A 4MYXA 4RZ4A 1TTPA 3P84A 1FWWA 4WX2A 2EAWA 4XTDA 4XQ6A 8TIMA 1G7UA 1GQNA 4Y96A 3CT7A 3DGRA 4IUOA 3DFNA 5I3KA 2GQ8A 4DO4A 1FUYA 2ZRUA 4Y9AA 2B0MA 3I7QA 1XBVA 2V5BA 3PB0A 5HR7A 3ABQA 3LTPA 3W7JA 1VLIA 3HGJA 1SW0A 3WJYA 4K38A 4K37A 3U2OA 3Q58A 3LHUA 4CQ9A 1VQTA 1D3HA 4HNNA 2A21A 4N9EA 4PC8A 4FEZA 1Y0EA 3RLVA 2VENA 3LXBA 4IWWA 4IX0A 3HPZA 1S5TA 3HGRA 2TYSA 1DV7A 3M47A 3W2NA 3PUEA 3W7MA 4NJKA 4A2SA 1HFBA 3ATZA 2NXIA 2WSRA 2ISVA 3LRMA 3G1FA 3NL6A 1J4EA 4UMAA 4WUIA 1THFD 1F73A 4K8HA 5F1VA 2QUTA 4O1DA 2YSWA 2A0NA 3W7CA 2QR6A 3GXPA 3P8JA 5I3FA 1S5VA 4HPXA 1ZALA 4WY0F 3G1SA 4WD0A 3EWBX 3E12A 2ZA3A 3SGUA 1W37A 2ABAA 4O1BA 1OFRA 1KFLA 5KZMA 3MHGA 3OA3A 4JTGA 2WNNA 3L0KA 2B7OA 3E96A 3GX9A 1SW3A 3QF0A 2YGYA 3W1RA 1JJKA 3TMLA 4FNPA 3CIWA 2B7PA 2V5LA 1IIHA 5D2TA 5HQEA 3I7RA 1QR7A 3QH2A 3UY8A 3F4NA 4ADTA 1EPXA 1LP6A 4JDYA 3TR2A 3PBUA 4WZHA 1WYIA 1D9EA 2CZDA 3LRLA 3TSBA 2W79A 3W7DA 2GOUA 3EXRA 3UD6A 2PURA 1PCWA 2GJNA 3DFSA 2ZZ3A 1TV8A 4I7VA 4I7WA 2Z2UA 5LNUA 1GJPA 4BFAA 2YZRA 5AC7A 2R14A 3LHYA 3EXSA 2H90A 1XL9A 3NAVA 2XN1A 3BK0A 3S1VA 3SR7A 2GJLA 1R46A 2HMCA 4JEQA 3NA8A 2ZRVA 4H6KA 3QW3A 4TX9A 1SO5A 1K7XA 2BXVA 1VLWA 5AYYA 3TQ0A 2J9XA 1TJRA 2RDTA 4FF7A 4WXYA 5EL1A 4S1FA 5AOUA 5FF0A 5DLCA 3W1QA 1YDNA 3L5MA 4UMCA 1VCFA 1H7PA 1XBYA 1FCBA 3A9IA 2P0OA 4UFMA 5CPLA 5A8GA 3CC1A 5IBXC 3N2XA 4N2YA 1ADOA 1VRDA 4JTEA 3LLFA 4TR9A 3QSRA 2C14A 3BW2A 2V2HA 2VC6A 4HNUA 1RPXA 3FJLA 1EWEA 1NF0A 4HSNA 4DF1A 1GTEA 1TPC1 3LM7A 2Y88A 1XDLA 1H7RA 4JTLA 3MO7A 4FO4A 3A23A 3RNDA 3TU9A 1AL8A 3M5VA 3R13A 1H63A 3M5ZA 1J5TA 1I4NA 1FDZA 4UTLA 3UPWA 1F7BA 3NM1A 1TTJA 3MI6A 3M1ZA 4DF2A 2V0TA 4OHQA 2PRHA 1JUEA 3W7HA 1TYGA 3MUXA 4Q32A 5HWJA 1C8VA 3W1TA 2FLIA 1R47A 1BWKA 3M5XA 1WV2A 3FLUA 4UUIA 1FWTA 4OGZA 3BLFA 4MZ8A 2ALDA 3LHTA 3SJ3A 4KWWA 3LB0A 4HSOA 2E5CA 4QISA 1ZHAA 4OV4A 5CPOA 1DL3A 1ONRA 2JKPA 1MEIA 5DCEA 5MHBA 3W2LA 2ZRXA 3B06A 3NPVA 3P7YA 1X1OA 4AWSA 2GVJA 3W1UA 5E1QA 3QPZA 4O8RA 4OE7A 2QJHA 4O13A 3STCA 3W7EA 5D2YA 2Q8ZA 3HPSA 3ANYA 1WAUA 3IGUA 1VH7A 5LHEA 1KM0A 5F2MA 1GTHA 4A21A 1B4KA 1F6KA 2B4GA 5F1UA 5AC6A 2CLKA 4JS3A 3W23A 5SWUA 4A2RA 3NPUA 3C2FA 1O95A 1UCWA 2DZVA 3HG3A 3MHFA 3Q37A 3QMSA 2Y7EA 3ZFHA 3DZ1A 4KFNA 3G1VA 1XXXA 4IXXA 4LC6A 4LUIA 2QCMA 2WSYA 2ZRWA 4BI7A 2NV2A 3C2VA 2CFFA 5G1YA 2NX3A 4NUWA 1G4TA 3TKFA 2CLIA 3SIZA 1CX9A 1D3GA 4AAJA 1SPQA 4MZ1A 3S1XA 2C19A 1B57A 1FXQA 3TQKA 3EX4A 3G1XA 4IX2A 4GFSA 2QCGA 3W7KA 4PFMA 1JVNA 3PM6A 5DCDA 4GUGA 3QEZA 3G18A 4ZMGA 1N8FA 1OVDA 1XKYA 2H3BA 1JULA 2J24A 5DXXA 3G8EA 5E0KA 3S8HA 1YADA 4JTSA 4MLJA 3ZS4A 4CCDA 3C2RA 3G3DA 4FIQA 2C13A 1B3OA 3OBKA 3MW7A 1ML1A 2YPIA 1T99A 4NXKA 3M41A 1ZJIA 4D2JA 4JTIA 4CNNA 4LRSA 1CW2A 2BZNA 4Q33A 1P1XA 4DELA 1ICSA 2NX1A 2A5HA 3P62A 1TTQA 1KTBA 4UTJA 4OWGA 3HO8A 1O5XA 3LCWA 3DENA 1WX0A 2XN0A 3R89A 5CZTA 3O05A 4JTKA 4O11A 1FCUA 2G96A 5F4XA 5FESA 2VFGA 1GVRA 3VE7A 1TV5A 4FXSA 1G67A 1VZWA 4O50A 2JGYA 3E0IA 4CQAA 1U5JA 3LHZA 3UWUA 1H7XA 2RFGA 5F2GA 1AL7A 5FEXA 1FX6A 2TPSA 5K7JA 1EUNA 1P0NA 2E6AA 3G0SA 4FNUA 2P10A 1RQEA 2NWRA 4NX5A 3DHFA 1MSSA 1OYAA 4XUGA 5HUOA 4M5PA 3ZWTA 1W3TA 2ZDRA 2C0AA 4GC4A 4JICA 3O1NA 1XCFA 4LRTA 1DQWA 1BEUA 2V2DA 3BW3A 3CB8A 4NNCA 2FB3A 3W2UA 4O18A 3THQA 5F2LA 3N14A 5AYXA 4QNEA 3GKFA 4JIPA 3T44A 1WA3A 4NXSA 1MZHA 3BG3A 2X1TA 4E0CA 4O4VA 1LOLA 2YW3A 3G1DA 4RV8A 3CWOX 3NQ7A 4MJZA 5CG7A 4U28A 5H2ZA 2V8ZA 4EOUA 2GQ9A 3GLCA 3NQFA 5I3GA 4E2BA 2DU2A 2A6LA 1H7OA 1QDSA 1TSIA 1KLZA 1NVMA 5LGXA 5J5RA 3DI0A 3FIGA 3L9CA 2CW6A 2NUWA 4FNQA 1N7KA 4RLIA 5AN7A 3W1XA 1X7FA 3M5YA 3M9YA 1PHWA 4EIVA 4X3ZA 1K3UA 3HJZA 2CLFA 5IM51 3L0NA 3HG2A 3SY5A 3I7SA 2DZTA 3Q94A 2E6FA 2Y70A 4JX4A 4ZQRA 4NJHA 2NXHA 3UZ5A 3TV8A 3P74A 2G97A 1U83A 4Z1CA 4NX0A 1TPB1 3LV5A 2RDUA 1LTDA 2Y62A 5CKSA 4K39A 3C3NA 3RK8A 1OFQA 5E93A 3LBMA 3EXTA 3L2IA 1IXOA 2E77A 5T26A 1SO6A 1GT8A 4GBUA 4AMAA 2WV8A 2EF9A 3BG9A 2A7NA 1S3HA 4RXGA 4JD4A 3P81A 1HO4A 3GB6A 2WPBA 3IVTA 4WOQA 3TCEA 4KWVA 1LRQA 5ABTA 3PUOA 3O06A 3OHIA 4O0ZA 1GVFA 3HG5A 2ZZ2A 4LV9A 5AYZA 4O12A 4XTIA 1MEWA 2J27A 3D0CA 5BNKA 3SSJA 3LX9A 3W70A 3IVSA 1TPH1 4GUHA 3G0XA 1RR2A 4MIMA 5K2ZA 3NPXA 1XUZA 4LVGA 3EWWA 5G2HA 3A24A 3F4WA 4ZQNA 5LNSA 3IEBA 3FEMA 1UUMA 4TU1A 3OG3A
chains in the Genus database with same CATH superfamily
3QHOA 3AU6A 3NQMA 4GQRA 3KRUA 4Y7EA 2WPGA 2WCGA 3UNDA 3EMCA 3JVAA 2V63A 4C6BA 3W74A 1CXFA 1YNPA 1E9YB 3GNRA 7ENLA 2WBKA 1EIXA 4KGLA 4BY3A 3FVDA 1YBQB 3ES8A 1CGWA 2X7WA 2DV0A 4X0VA 3DX5A 3R8GA 3R5EA 1NAL1 4N9DA 1WDRA 2YL6A 3GDKA 2A85A 1CPUA 2IS7A 4HJWA 1LLWA 5DBTA 4JIQA 3DXIA 4PGLA 1AQHA 3WLLA 1VCGA 3NQEA 3TW6A 5D9PA 1L6SA 3NPWA 1XRVA 1CB7B 2C6QA 4S2BA 2JGQA 5AHMA 4MM1A 1Q2SA 2J79A 3E2VA 4I8YA 4Z2KA 4F48A 1EBHA 3L4VA 3W87A 3MKVA 4QRNA 3L2LA 3NXFA 2ZWZA 3RM4A 3IGXA 3KP1A 4J28A 4QEHA 3BUVA 2DT0A 5FAJA 1C8XA 3IRSA 1PZ2A 5D33A 3U48A 2C1IA 1GONA 4CEXC 3BAYA 4NAEA 1VJZA 1ZFJA 1OADA 2PWFA 5F4SA 3GXNA 4JQAA 1VJIA 5G2WA 2DT1A 3SCOA 4N6EA 3KW3A 3H2AA 4MVAA 4W93A 3PTDA 4AHQA 5A6KA 1R3RA 3BPWA 3TROA 4GJ1A 1JZ2A 1BYBA 1PWLA 4QLJA 4H8HA 1GG1A 3HFYA 3MYOA 3RN6A 5K9XA 3VGHA 2E7FA 1R3TA 3CASA 2NZLA 3LCIA 3PK7A 5K9CA 5AY7A 3PF3A 4UQBA 1R86A 1DP0A 4M7SA 4MJMA 2QCFA 4KERA 4IM4A 1TWDA 4YWSA 1RY0A 1HXJA 1RK5A 4JYDA 4J3SA 3P2VA 3RPDA 3LCHA 4HPHA 1GEQA 1TQJA 2CLMA 1TJ2A 1WO2A 3S5OA 3XISA 3IARA 1A5KC 4EP8C 1JGMA 5I23A 4IPIA 2Z7GA 3GKAA 4AIOA 4W86A 3TTEA 5E70A 4ZL1A 2OEJA 1Z69A 2QGHA 4MUZA 4S3KA 1KA9F 3MS8A 2JK2A 4ATWA 3MHUA 4C6QA 3WLIA 1W17A 3BJTA 2I57A 4NAEB 3OA5A 3PTQA 2XH4A 2W6RA 4B3ZA 4F79A 5KZEA 1GHSA 4NSBA 3MPGA 4C6IA 3BAXA 5CZJA 4MNLA 2BWGA 1AW5A 1P0KA 1X38A 3FKKA 4QJ1A 4MG4A 2WCSA 3CEPA 4NIRA 4TVCA 4Q4SA 1OK4A 2IXUA 4EPBC 1F8MA 2VDGA 3T4CA 4GLEA 1S2UA 2X0SA 4O52A 4HYVA 4I9AA 3A22A 4EAYA 3CPUA 5CJNA 3AZSA 3PPGA 1P0EA 3VIMA 4H2HA 5CJ5A 4AY7A 2OX1A 3H7VA 4NJGA 3MSDA 4MADA 1PYFA 2ZUTA 2V3GA 4GO9A 1ZRQA 5DY2A 1MVYA 2WJEA 4AUBA 4R85A 2CYGA 4R33A 4HCHA 2VT0A 1OFOA 1O12A 3KAOA 2ANUA 2C0HA 4M24A 1B30A 2C71A 3QRHA 3I6EA 2NQ9A 4JYEA 5I3IA 1JNDA 3H70A 1IV8A 3MWCA 1TCMA 4NKCA 3LPPA 1JAEA 1T96A 4GZEA 4D1IA 6XIAA 1BKSA 3QHNA 2X2YA 4NASA 2VEMA 1XKJA 2PLKA 4GX9A 1NIUA 2FVMA 3T8QA 2DZSA 2V2CA 5BWFA 3RCYA 3NZQA 4HZ7A 5LA0A 1HW6A 4RR4A 3TE9A 2VGIA 4GY7A 3N4FA 3Q65A 4WY0A 2VEIA 4I6VA 3NO1A 5BOFA 3JRKA 1LWHA 5B7YA 3S5NA 1J0HA 4CD5A 4JFUA 3UZJA 3BLPX 1DJYA 4K1WA 3TYBA 1PL9A 1D8CA 2VZVA 5A6SA 1GOKA 3RIKA 2E5BA 2BNJA 3ARZA 1YIXA 3NDYA 5D02A 1YLVA 5AYBA 4DRSA 5E09A 3WQ4A 1P43A 2YFNA 2J8GA 8RUCA 3WLTA 4KQNA 1TIMA 3GC2A 4IMFA 2VX4A 3HB9A 3IVUA 3N34A 3GIQA 1OFPA 5M1TA 4QNWA 4R3UA 3HF3A 4WDTA 3PTMA 3PULA 3LLXA 4PZVA 5FJJA 4UCGA 4ADUA 3OTRA 5L6UA 1EGVA 1SFJA 2Z28A 3MWAA 4AZHA 4LNCA 2WMIA 1CECA 1A50A 1PBGA 2R1KA 3KBMA 3M16A 3VMNA 2GWNA 3AS1A 4ZTXA 1HNYA 3CL7A 3KOFA 3G0UA 1XJBA 4WY0B 4HA0A 4KEUA 5BOOA 5HR6A 3NL5A 3NVTA 4WLCA 3EWUA 3NYZA 4IZGA 3BJFA 1Q6LA 1W3KA 4R53A 1HKVA 5AZ1A 3RILA 2HK0A 3H2MA 2Q02A 3W00A 4W7UA 2Z1SA 4U33A 4IQJA 2FQIA 3U4AA 3VIIA 2UZ9A 2PDYA 1S5WA 5FEZA 2CPUA 1FWIC 3J7HA 3VPLA 5MF5A 2A1YA 2RHGA 3P61A 1MNSA 4TOQA 1AW2A 4FI4A 4FSAA 4JIEA 4DM1A 4NYUA 2Y8VA 2YXXA 1KFEA 1MDLA 3PZVA 2QJMA 4OVXA 3IK2A 1H1ZA 4FB7A 2NUXA 4LEFA 4FIRA 1M7PA 1VR6A 2F7FA 4HQVA 3DU0A 5I7GA 4CN4A 2WMIB 3LY0A 3TSDA 7XIMA 4P61A 3WJXA 3UG5A 4I9TA 5H6HA 4INFA 3POHA 1OF6A 4M6PA 1W9VA 1KRBC 1ISXA 4G1KA 2EPHA 2Z1XA 3TYCA 4F4RA 3EDEA 2PFHA 3BURA 3CAQA 2VQTA 1R6WA 4QTGA 4IMGA 1KM5A 1BYAA 3PN8A 3BZJA 4MY8A 2O7QA 5I3DA 5EPDA 5ABFA 3GIYA 1WB0A 5A6TC 3NZRA 5M5DA 4H9MA 1XIGA 1ME7A 2PTDA 4B90A 5L9FA 4IOTA 1YPIA 3BG5A 5LIYX 4X2RA 4W8AA 2NQZA 3VO0A 4XISA 1J2BA 5CSSA 3UA3A 3DFOA 3U2ZA 5BROA 3A13A 3PC0A 5CSUA 3W7LA 1LWJA 4WQ6A 3AZRA 3WFAA 3P60A 4NHVA 1DBTA 4PA8A 4J1OA 1UD4A 1KM3A 3FYOA 1EP1A 1O1ZA 1F5ZA 2OTDA 3ZT6A 3WQEA 3NGJA 4LUTA 3IJIA 3QQ0A 3M6YA 2V38A 3LLDA 1HJWA 5CSYA 2IKIA 1Y65A 2R91A 1FWSA 3P5ZA 4FZIA 3STEA 2AGKA 3VIGA 4POCA 2OZ8A 2XWEA 3K1GA 1PIGA 1TZZA 2OU4A 1S3TC 4MB4A 2G4FA 3OQ8A 1MQQA 4YMZA 3VA8A 5ABFB 4K36A 3DH7A 5LIKX 1CXLA 4B5WA 3AHXA 3QOMA 3FK4A 3WFLA 2Y85A 5FEWA 3B8WA 4GPNA 3SCWA 1AMYA 4GGBA 1GJWA 4PSPA 1AUSL 3MU7A 1VFOA 3OBAA 3WDPP 2PTYA 1JUKA 3EWXA 3LI0A 2F2HA 4DXVA 4HHPA 3WUFA 1W9BM 3L4ZA 2RUSA 3PG8A 3D3AA 2WO5A 4NZ5A 4OTKA 5KMYA 4LUTB 2PI6A 2XFFA 2YFOA 4AVFA 3HURA 2BY0A 4Q4QA 4LV4A 3AO0A 1EJVC 3OVQA 2QV4A 3KOXA 3QV6A 4QJ4B 4HVXA 3P80A 1Q7ZA 1V08A 3N2TA 3RLUA 3UG3A 3IIVA 4CEUC 3SCUA 1VENA 3QXBA 5JMUA 3LRKA 3PNZA 3LS9A 3FA5A 2FHFA 4Z0SA 1VAHA 4YLWA 3B9OA 2ZXBA 5BXRA 2E1DA 3KDOA 2OOGA 4PSRA 3GVWA 1GVOA 1DVJA 5GJNA 4LJ3A 4RPPA 1F3WA 4MWAA 2DORA 3UR7A 2QCCA 3H53A 2I17A 9CGTA 3VDBA 4MPKA 3LCFA 3LHWA 4F0HA 3E3HA 4GKLA 1G69A 2W5FA 1JUBA 3DYOA 4OFCA 4LY4A 2VJXA 2QAFA 1IWBA 4JGDA 4L6DA 1E0VA 5F2IA 3KWXA 2YYTA 9RUBA 3DCPA 4L56A 3M46A 3SM0A 4LSBA 3W28A 2J47A 1Z44A 3VKAA 2XZ7A 4A29A 1B2YA 2D0FA 1KLYA 3C2EA 3UWWA 2J88A 2Z24A 3UERA 2FTPA 4I7UA 3V1PA 4XBKA 1VPXA 2MNRA 3WDJA 4GY0A 1TKKA 4DYEA 2JIWA 4P7RA 1TE1A 4MGGA 3PSWA 2Y6ZA 2V3FA 5U4NA 2FZDA 4LT9A 2CZFA 3QPYA 2DP3A 3W84A 1JQXA 1VD6A 4GACA 3OZPA 3LGEA 1XYFA 4LGXA 3WLJA 4PL2A 3R43A 4N0RA 4JBRA 3MP4A 4O16A 3OZOA 1BF2A 1F74A 4N6FA 1WNOA 2DSZA 2DUXA 2Y7DA 3LV6A 1C29A 3UR8A 4ZZ9A 1ITXA 1KBJA 3CXOA 3T2QA 4XBJA 2VZOA 2FPTA 3F03K 1UC4A 1EA0A 2FDSA 3VC6A 3WJWA 1TPUA 4DIAA 2CBJA 3LCLA 4C6FA 3W2MA 1GNXA 1JYVA 2WYSA 3OO2A 4B5UA 1DWFM 4BEUA 5FF2A 3GRIA 4B92A 1RY8A 1W1PA 2PE4A 4D72A 2XSAA 2IQ0A 3H22A 3EB4A 4ZODA 3WD1A 2PRMA 3N1AA 3BC9A 6XIMA 5LXXA 1L6YA 5ECUA 2BLEA 3W75A 3TXVA 1RA0A 3QLLA 3RX2A 3IIXA 4YWIA 4ORMA 3V4BA 4N4PA 3QV7A 2PCQA 3L21A 1QAPA 4GUFA 1H1NA 4MFDA 1JD7A 1ZJHA 5CC3A 5T8GA 2Z25A 1IXPA 2HSAA 3AZTA 4I90A 3BE7A 4MKSA 4E4UA 1F61A 4N4QA 2YR1A 1OBAA 3KOYA 4OBRA 2QHAA 1W8SA 1E51A 3WMCA 4BZYA 2HJPA 3FYPA 4IJBA 1GGOA 1ISYA 3HN3A 4K8EA 1JZ4A 2V5CA 2BY3A 2OCZA 1RQBA 1TE6A 3ZT7A 2FMOA 2QQ6A 3MBFA 5FAGA 2VFEA 2PDLA 2OT1A 2OFJA 1V0KA 4BF7A 3USBA 4C1NA 3NZPA 2ZQ0A 4XG1A 3KVJA 4S2CA 2DZPA 3N4AA 2PU0A 1ADDA 4FLQA 4QAIA 3R8RA 2EPOA 4HPJA 2IXVA 4B4FA 2NXGA 2V3DA 3C3UA 4RDVA 3DC8A 4F0MA 2WKLA 3VGGA 2C1HA 1J11A 1UWTA 3E74A 4KBXA 3UWVA 2NT0A 3LQLA 3VD9A 4MLRA 4IXHA 4IP5A 3INPA 1TZ9A 4H83A 4A6GA 1NDYA 3G1HA 3O07A 1QFEA 1JDCA 4D8AA 1ECQA 2ZDSA 3CGTA 1K7EA 2CKRA 4OT7A 2XM1A 4NF7A 3O6AA 3ZLGA 3DIPA 3L65A 4O1CA 2NW0A 1SFLA 1I9CB 4H7ZA 4S39A 2V5DA 2J74A 1HUVA 3W82A 3MKCA 4MDPA 3BW4A 4UTMA 1XIJA 1N55A 4HMNA 3V3WA 1BSLA 5H1WA 1ELSA 1AW1A 3H4GA 1WP6A 1U1HA 5TQLA 3CT2A 5JQ9A 4LBRA 1YDVA 1Q13A 3T08A 3E1F1 1ENUA 3ME3A 4C1NB 3QYQA 1OT1A 3AYVA 2O9RA 4R7JA 1XC4A 4DNHA 3QQ1A 2DDXA 3M07A 3KVMA 3MVTA 3DFHA 2V9DA 2WQPA 2PDIA 4M7TA 2WZMA 4JY8A 1TFVA 4QS6A 1UR1A 3N9KA 4AIUA 5FJIA 4B2DD 3NQBA 3H2CA 3TW7A 4DHGA 2WB5A 2EPLX 5FF7A 2W67A 1B3VA 3FHQA 1HJVA 1A0CA 1F3XA 3I6TA 1CGYA 5A8OA 4L1GA 3URBA 3DI1A 4HNLA 3GQYA 3WF0A 2EBNA 3WK0A 4FR6A 4N7QA 4FOJA 4JQ2A 2DZUA 3N2OA 4MY9A 1ESWA 5FF3A 5FI8A 2W66A 5CPTA 1R3WA 3QMTA 1ITQA 1UZHA 1WDSA 2D2JA 1J12A 3FGCA 1JEZA 2C1GA 3TDFA 3WLHA 2ONEA 3N73A 5HUPA 1Q6GA 1DYSA 2P53A 5TBOA 2DZXA 2GL5A 1JAKA 1FKXA 4ZOCA 4HMDA 1GK8A 1QW8A 3M0VA 2W63A 3EB2A 1RD5A 4M19A 1V03A 3VNDA 1U5VA 4RZ6A 3HTWA 2VKZG 2PP3A 3AXHA 1J0IA 4JTDA 3TXZA 2ZRZA 3V5FA 2XYLA 5PTDA 2CHRA 4UTUA 2GVGA 2PGEA 3DKLA 1JPMA 2CWNA 1AQFA 1JDFA 2B81A 3CQ0A 1XUUA 2CNCA 2PP1A 3WQFA 4IT1A 1XLLA 2IQTA 1NELA 1CI1A 3AICA 1GVQA 1NTHA 5D30A 3W1LA 2XJ7A 4M6QA 3W24A 1NQ6A 4PULA 3DN5A 1VS1A 2ZX5A 2G5WA 3MQTA 2F61A 1TV4A 3APGA 1QW9A 1RALA 4KRTA 4Q8MA 1TPVA 3CMJA 1SM9A 4TMBA 3NVDA 1Z6KA 5FACA 3S9IA 3BAKA 5A1AA 1B4EA 3OQEA 1DIOA 3L68A 3RG6A 1OINA 2Q01A 1BTMA 1I1XA 2VUNA 5KETA 2J25A 3VKBA 3S5YA 4RL3A 1OABA 1OC5A 3EWZA 4V33A 2R1PA 4L61A 4L6HA 3T0CA 4RZ4A 4DUWA 1TTPA 3P84A 4RW5A 4XTDA 3TR9A 4XQ6A 1G7UA 1GQNA 3IJ8A 2OSYA 3DGRA 1CWYA 4JIRA 3ZVIA 3CMGA 3LUTA 3ITYA 2I5GA 3ES7A 5A95A 1FUYA 1RHCA 2V5BA 2ICSA 1TIWA 3HGJA 4UZUA 3NSNA 3WJYA 2OLAA 4A3QA 3T0DA 2VM8A 1KWGA 3LHUA 3EPMA 4CQ9A 5CC5A 3VIOA 2POZA 3WLNA 1T5AA 1Y0EA 4W84A 3LXBA 4PMJA 3QLDA 3ABZA 4IWWA 3BLOA 4IX0A 3UG4A 3CV6A 3HPZA 3KCLA 2ZVIA 3HFTA 4J7RA 2TYSA 3M47A 3W2NA 2PC8A 3R11A 2OQLA 2WSRA 3H23A 4C6DA 3LRMA 4UMAA 1UR0A 3T0BA 4NZ4A 1F73A 3N6JA 1QNOA 4TX8A 5F1VA 2G50A 4YN5A 2PEVA 4FA3A 2UY5A 4O1DA 1XCWA 3IJ6A 4BS0A 4TTUA 5I3FA 2PODA 4Y9OA 4WD0A 3KL3A 3BSHA 3GM8A 1V6XA 2ZA3A 3SGUA 1W37A 1Z3NA 3AS2A 3H7UA 3VIJA 4MB1A 3GX9A 3V16A 4Q7NA 4M1RA 3U4FA 1FWDC 3TMLA 1GZ1A 3MUIA 5HQEA 1QR7A 3I7RA 3QH2A 3UY8A 3F4NA 3TR2A 2WHMA 5DF0A 3OYZA 2GOUA 3Q67A 3VZXA 1PCWA 1XLKA 1BTCA 4IIGA 3DFSA 1LQAA 3PBGA 4I7WA 2Z2UA 3PBMA 1GJPA 2BHYA 3B40A 1R85A 2OEMA 3SQSA 3LPOA 1DJGA 3LHYA 1H0IA 2R1NA 2XSBA 2H90A 5CJMA 3GBEA 5FCZA 4OECA 3BK0A 4ATLA 4ZFMA 1Q4WA 4HJFA 2F2KA 1AH0A 2YBUA 2RDTA 1Q6FA 5EL1A 5CBIA 1MW0A 2BMBA 3GHUA 1S2VA 2FTYA 1FCBA 1UBPC 1S1PA 4IIDA 1NFGA 3JUGA 3N2XA 3WNOA 1ADOA 1VRDA 1DWIM 3FY1A 4V2XA 1XFCA 2OEKA 3W4RA 1XLDA 1PEZA 4DF1A 1EO5A 1EJXC 1H7RA 1OCNA 2ZOXA 4FO4A 3A23A 3RNDA 3WLMA 1H63A 3GWQA 4U10A 1R38A 3M5ZA 1I4NA 4HA4A 1XYMA 3NM1A 4H00A 1TTJA 1H11A 1TWWA 7PTDA 3OLDA 3C5QA 2MANA 4OHQA 2AKMA 2F6KA 4B3LA 3S9ZA 1BYDA 4IMAA 1BWKA 2GZXA 1WV2A 3FLUA 4ZB5A 1FWTA 4OGZA 4MZ8A 2IKHA 3SJ3A 4HSOA 2PDXA 3VUSA 4J4KA 4OV4A 3WUBA 2I56A 2JKPA 1ADSA 5DCEA 3PZ9A 1FTXA 1ISZA 2FZBA 4M80A 1X1OA 5CBJA 5DANA 1EFZA 4J2PA 1UG6A 4X60A 3KLLA 3S1GA 4MB5A 3QPZA 3MSYA 4KGJA 1VFFA 3STCA 3POCA 4GI8A 1JZ6A 3NURA 5D2YA 4LYPA 4GOAA 2WVUA 3ANYA 3ARPA 2IKJA 3FW6A 1VH7A 1HF6A 1XLBA 2VTFA 3KBJA 2WM0A 4S3AA 3W02A 2GGJA 1EZ2A 1NWSA 1BKHA 4GVFA 2HV5A 4JS3A 3F5LA 3NO3A 2VX6A 1O95A 2DZVA 3HG3A 1P7TA 1KCZA 4KFNA 1CXEA 4IXXA 3C0LA 1D7KA 3QHMA 4ML4A 1VEPA 3RYSA 1G4TA 1YMYA 2PAJA 2RJGA 3UR5A 2E4TA 5HQMA 3A4XA 3EA1A 1E71M 4MZ1A 2WC3A 1LWIA 3TQKA 3U7VA 4P8WA 4REQA 4DI8A 1UW9A 3W7KA 1JVNA 5FJUA 3G2GA 3QFWA 3G18A 1ZQ5A 4JIHA 3IJDA 2GGIA 1EOKA 1XKYA 2H3BA 2PPGA 5DRCA 3VIFA 3WQOA 2J24A 3S8HA 2REQA 4CCDA 2WJDA 1CT5A 3R8HA 4FIQA 2C13A 1B3OA 1KCLA 1ML1A 2YPIA 1KKRA 5HNNA 2P8CA 4NXKA 1JD9A 2XH7A 4D2JA 1CW2A 1ZCCA 1ICSA 3WQ5A 1KR1A 4UTJA 1ODUA 2BOFX 2XN0A 2Z1VA 1EQCA 3O05A 2QW5A 4O11A 2ZVRA 2G96A 5F4XA 3EKGA 2VFGA 1GVRA 2YOCA 1TV5A 4FXSA 1E1FA 3ENLA 1VZWA 4O50A 1U5JA 3NZGA 3UWUA 1H7XA 3U0HA 1P7TB 5E9XA 5K7JA 1P0NA 3G0SA 3CUJA 4WDXA 4AD5A 4CNUA 1RQEA 3QVQA 4C7GA 1BG4A 4M5PA 3ZWTA 1W3TA 2ZDRA 3ZJ7A 2DFAA 1V3LA 4GCAA 3O1NA 4GC4A 4LRTA 4GVIA 3FDKA 3N15A 2OPJA 3WBWA 3W2UA 2Y0FA 3N14A 4LX4A 3T44A 4PCNA 5F7UA 2Q6ZA 3ORWA 2W3ZA 2W62A 5BXPA 2INFA 1CTNA 7ODCA 5CG7A 5H2ZA 2REQB 4QSFA 4EOUA 3IUHA 2ADAA 3CQIA 4Z1YA 1QDSA 1TSIA 1EJ7L 1NVMA 3VOHA 3R7MA 3QN3A 3GTFA 2GUYA 3L9CA 2CW6A 3QV8A 2NUWA 1N7KA 1PYMA 2VEFA 4O0QA 3M9YA 5CLWA 1K3UA 3VZZA 3HJZA 2CLFA 4TTGA 3L0NA 2J7FA 2PDQA 2E6FA 2PDUA 3EOUA 4ZQRA 1FKWA 4NJHA 5CAHA 3UZ5A 4DYJA 3TV8A 3UXLA 3ZIZA 4Z1CA 4BQ3A 2RDUA 3AU2A 3K5XA 1BGAA 3B0XA 1KXVA 1MW3A 1CZ1A 1J0ZA 2Y4SA 2OGJA 1SO6A 4HBKA 3MMDA 2EG8A 4GBUA 2WV8A 2O9OA 3VGBA 1HO4A 4Q8NA 3GB6A 2VDIA 4F9JA 4WOQA 1VRXA 3VIPA 1BVNP 4QDWA 3OHIA 1XYAA 5AYZA 4AZ6A 1MFVA 3KBWA 1R8LA 4OUEA 1MEWA 4F9DA 1B0IA 4GUHA 1KNWA 4ZXOA 2POTA 4W85A 1XUZA 4LVGA 3EWWA 3ZJKA 1EC8A 4ZQNA 3IEBA 2CEQA 3TYAA 3UCCA 4E8GA 1F76A 1ZLPA 4NG3A 2ZFAA 5IHRA 2EPMX 3KBSA 3FNDA 2RGMA 2WJZA 3NQAA 1J79A 1PTGA 2VWTA 5M03A 4O10A 3RCMA 1JIBA 1TVLA 2VFHA 1R3SA 1H5VA 1GOMA 4HB7A 2VGFA 1R2RA 2FVLA 3W72A 3O6CA 3UQNA 4NZ1A 1RBAA 4R27A 5H8UA 1XS2A 2HXTA 3VUPA 2V81A 3ABOA 1VKFA 1JXKA 1ZENA 3NOYA 1NDWA 3T07A 2ZC1A 3ZT5A 3AMDA 4O1FA 4M3PA 2OT0A 4PTXA 4GA8A 4CVWA 4XAYA 4Z08A 1OX4B 1I2QA 2NVCA 2QCDB 3OU8A 3B03A 1Q6DA 1RUSA 3SEPA 4CKQA 3V5OA 2KZHA 2QF8A 1IZKA 1VBUA 1XI3A 5CAKA 1G4EA 1BG9A 3NG3A 2ACRA 3H8AA 5HANA 1TVNA 1LL4A 3STPA 1UWAA 5A5WA 5TF0A 5B7ZA 3C2YA 3D47A 4GABA 3W83A 2OKTA 1C9DA 3TP4A 4QFUA 3UZWA 1JI1A 2QKFA 4RNFA 5FJPA 3VCCA 4MZYA 1JF6A 4R34A 5D8WA 1XISA 3WX7A 4XZWA 4XVDA 3TJXA 2CETA 1KKOA 5I3JA 5AHEA 1F2JA 3K4DA 2TODA 3EX1A 5A6MA 1XRSA 3GVVA 3K1DA 4LOCA 3V35A 4ADSA 1S2CA 2YDQA 4RDZA 3JW7A 1TPEA 3WKZA 4P5UA 4AZCA 1UA3A 2J7EA 5BRPA 3SBFA 4AZBA 1LORA 4YTSA 3GDMA 3AMCA 4G8TA 1WOAA 3P82A 2Z0IA 4Z1DA 4PBGA 1D3CA 4LEQA 3PAJA 2A79A 2X16A 3NEHA 2DJXA 3MMTA 2C3ZA 4ZENA 1PE1A 2HE5A 1A5AA 2AL2B 3THAA 1GQIA 2HWGA 2IMRA 2PDHA 4LNYA 2D22A 4FX6M 1FWBC 4DM2A 3S2JA 4EVZA 4Z2JA 2BTMA 1QI4A 8CGTA 2H9AA 4HU3A 1LRNA 3OZYA 4M81A 1F3TA 2ZUWA 4GIYA 1VHCA 4GE8A 3LCGA 4ONVA 2OWWA 5HJLA 3CIXA 3NDZA 3S4TA 3W86A 1QO5A 2WK2A 2E8YA 4AD0A 3W71A 1YX1A 2IUZA 4LS0A 4C6MA 1NJJA 3G1AA 4D6IA 5HOSA 4JYFA 3WH9A 3QW4B 1XYBA 3E2SA 4IISA 1H51A 2JEQA 4AZCB 2XH2A 1OF8A 2BHZA 3VI2A 1TMLA 5D32A 1QATA 1A49A 1SO3A 5KZDA 3KS5A 3RRAA 5C55A 3R25A 1SU5A 1XLCA 4XKYA 1IXNA 5DN1A 1D7FA 2Q3RA 2BODX 3IRDA 3LNMA 2FKPA 3BGGA 3BSMA 3CZLA 3DHDA 3IWPA 2YBTA 4L4OA 4CU6A 1UASA 2FVKA 2DSWA 4A05A 1KTNA 2BASA 4GI9A 1UUQA 3ONBA 5ABEA 1P6BA 1TO3A 1W1IE 1FDJA 3SCQA 1HJUA 4JKLA 1VBRA 4D9PA 5BCAA 2A4AA 4AWUA 1UBSA 1O60A 3B4YA 1RK6A 1WZMA 4K7VA 3V0TA 1KV8A 6REQA 5CGQA 5AB3A 1F4AA 1SZEA 1OG0A 1XLEA 1J0KA 1OC7A 3L23A 2GUBA 2J7HA 4OQVA 4K7YA 4OBSA 3VIKA 3LOTA 1TV7A 1YDOA 3W7OA 4AZ5A 1IE7C 4JNMA 4PMVA 5HMEA 5CC7A 4ZQMA 1MMFA 3WY1A 1HKJA 4IPLA 1TPWA 1XSKA 4LVFA 1RPKA 4XKYB 1PKNA 3QQWA 1B90A 2BOEX 4LW7A 1B9ZA 4HMEA 4GQBA 1OB0A 1UH3A 1DE6A 1OYCA 1SUXA 3B9AA 4PMNA 3I65A 1E9ZB 4F0KA 2XIIA 1XFBA 4HCDA 1IR2A 4U31A 3KLKA 3W1AA 4GH1A 2E68A 1T41A 1C7SA 1K6WA 1XIHA 1SZRA 1EP3A 1TX2A 3NQ2A 4JTJA 1I6NA 3EOOA 1U5HA 1A5LC 3SI9A 4J3VA 4C6CA 5HBFA 6REQB 3NQGA 2EJAA 5J5DA 3PBVA 3WH7A 1M6JA 4I9MA 4NNBA 1MEHA 3TYDA 3XIMA 3SUVA 1MQPA 3R10A 4I5UA 3F2BA 3VNJA 4P8UA 4AF0A 4QE4A 2AQOA 2VEKA 2QCHA 1C3FA 3OVPA 1B31A 4Q8QA 3MI3A 4KWOA 4DZHA 1C8QA 2BY1A 4YU1A 3CZ8A 2WZHA 2FTWA 3N4EA 1KXHA 3O16A 4W89A 1QPOA 3E0FA 1RBOB 3CO4A 1KR0A 4LCSA 5AZ0A 1GOXA 1L9WA 2QZRA 1KM2A 3OOQA 2DSUA 1NDZA 5AHNA 1FOBA 1UWUA 5BW6A 1X1ZA 4DXKA 1OC6A 1Q2RA 3VDGA 4LYQA 3KRZA 3MP5A 3W01A 4LUYA 4DEFA 1CXKA 1GPWA 3W2KA 1DORA 3RDKA 5IDIA 1K9TA 2P5NA 5LZLA 1L6WA 1RLDA 5H8PA 3MB9A 3CAVA 1C8YA 1CGVA 4UB9A 5I07A 4JQ4A 1X97A 1E15A 1PPIA 2W4XA 4LY8A 3QFEA 1NFBA 9XIMA 1XLAA 1OIFA 1PVNA 2ZXDA 5AYIA 4NP7A 4M6VA 3PHAA 1GYMA 1Z48A 2VHLA 2E9BA 3L4UA 4CNSA 3SGZA 1R87A 1DJQA 3KTSA 4AF0B 3TFXA 4AG0A 3A5FA 1R30A 3GDTA 3BL3A 3UPBA 4WJEA 4CD4A 5G4EA 1I2NA 2PUZA 4CN6A 2XHYA 4H2CA 4CCCA 4L65A 5LNWA 3Q2DA 3PANA 3OVGA 5C71A 2PBGA 4ATDA 3G77A 3IJ7A 3CIVA 1QO2A 3PB2A 3W22A 1VBHA 5CZKA 1TREA 4PUEA 4HU4A 3RPMA 2JBMA 1EC7A 4XZ9A 1M68A 3TEVA 1QPNA 1R2SA 1XBZA 5D03A 2WNQA 1NOFA 2VFFA 3LSCA 1W3NA 4RXFA 4IFOA 3VNYA 4X22A 3A3XA 2HPMA 2PD9A 1AK5A 3B8DA 3EOEA 1JCNA 4IHCA 4BQ4A 2FZ8A 4F2TA 4KRZA 3AXKA 4DO5A 1IXQA 4EX4A 1OFBA 3SW6A 3FA3A 3FJ4A 4PMZA 2W9MA 3URQA 1CCWB 2XGIA 4GD0A 1FWEC 4AC1X 3GXDA 1E4LA 5BZAA 4N9CA 3LERA 5GQBA 3AUOA 1UKTA 1K6AA 4C6PA 5AC5A 3REQB 1QASA 3FVMA 2XPKA 4K8GA 1HX0A 2ZUNA 2FGZA 3GY1A 4ZQPA 1UR8A 1E4IA 3MKKA 1JRBA 4RK8A 3H26A 1KRMA 1MZRA 1VF8A 2WSKA 1LL7A 3L4WA 1XHGA 4MKNA 3W88A 4Q8WA 1CLKA 2HTMA 3GZAA 1RAKA 4U4MA 3RGTA 2GUUA 5FF4A 4BF5A 3WEOA 1YTKA 2EKCA 1EUAA 3DG3A 1ODZA 5BYWA 3BAJA 5BU9A 1XIFA 1W9XA 5C2CA 2VFIA 1X6NA 1YKWA 3CV2A 3NDOA 2ISWA 3EX3A 4DJEC 2VOMA 4QCEA 1JPIA 3LPGA 4GCXA 1NF7A 5DMLA 5LA1A 1OYBA 3K30A 3CAWA 4QHRA 3GS6A 1KBLA 1NY1A 9XIAA 4Z1AA 2CZEA 1F8IA 4GY1A 4RDYA 3MT1A 4UR9A 2G3NA 4RPQA 1G9HA 4CNOA 1EEXA 5DMMA 1XD0A 3OW1A 3GTNA 3W2JA 1X6UA 4DVOA 3U6WA 5GJMA 3VD3A 2ZADA 2TAAA 4WDUA 3WK2A 3WL0A 3KL0A 2QJNA 1XQKA 1BLIA 3M0ZA 4L4PA 1Q6RA 2PWHA 2XIOA 4QAWA 3C0QA 4WKAA 3GE7A 4OU1A 1TG7A 4UTWA 1RV8A 3WN6A 4C90A 1PV8A 1JDAA 2F84A 4A3UA 2BXYA 4LB4A 4F3HA 3TX9A 4MPQA 2DJLA 2BOGX 2WJFA 2V30A 1JDEA 4LAMA 4HPGA 3FYYA 5C5YA 1TJ0A 3AYTA 4LS1A 1UD3A 5LIWX 3RJXA 2FYMA 4FXFA 1Q66A 2CHNA 3WNMA 3KS6A 3QMRA 4B9YA 5BRBA 2OO0A 2PZNA 4NZFA 1PX3A 4JTQA 4ZOAA 3UY7A 4FMVA 3LMYA 1HO1A 1W9PA 2VCBA 3RX4A 3TCSA 1K8ZA 1NDVA 4IF2A 1UKSA 4ZR8A 3N9RA 4H9VA 4MJ2A 4MNMA 3CUZA 2GVEA 1XWYA 2CU0A 1BSIA 1EPVA 2VCCA 1K1DA 1PIFA 5T9CE 3ISIX 4IQLA 1E6RA 4AEOA 2OJPA 5EFDA 4JFTA 2WMJA 1J10A 3BDKA 3N2CA 4GYJA 5LGZA 1KB3A 1GVIA 4Y9NA 3DBNA 4MF4A 3ICJA 3O6YX 3EDFA 3KHJA 2Y2WA 1TJ1A 1X8FA 4ZGYA 1OD8A 1SVDA 3T55A 3IAPA 3PJWA 4ERIA 1YTEA 1XIBA 3OEXA 3EWDA 4GVGA 4IP4A 3MUAA 3L5AA 5C70A 3MJYA 1NFPA 1SZFA 4OKDA 2PA6A 2V6AA 1P6CA 2WOQA 4PBFA 5FSEC 3G8RA 4PMOA 2QJIA 1UR4A 1AJZA 3AJ7A 1QNVA 4DB7A 2OODA 1GOIA 2LLEA 3ARQA 1LBFA 4J2MA 1F4HA 1R9XA 4ICCX 5D09A 1KFWA 1SJCA 4UZSA 1QPQA 3FEQA 2PP0A 2HQAA 1R7OA 1W3HA 5TNVA 1K8YA 1KFCA 2QGYA 4QCFA 4PR4A 1QMLA 4WHBA 3UJSA 4AWTA 1QK0A 4E2VA 2J66A 3LU2A 3S9YA 3QGVA 5DBUA 5C6MA 1W31A 5CLTA 1V6UA 1A3HA 3CHFA 2XFWA 3A4WA 1VHNA 4GI6A 4G56A 3NUKA 1PZ1A 2EPNA 2WM1A 3O63A 3R94A 3TJLA 1IR1A 4FXRA 1BF6A 1Q6EA 1R3YA 4F66A 4AYSA 1S5NA 4UFKA 3GW0A 3T0TA 4EXAA 1OZMA 1VYPX 4V15A 5AHFA 1H0GA 2VRQA 2DH2A 2QCNA 4JCLA 3WSUA 5A3HA 2ISSA 1G6CA 5HWMA 1E9IA 3FOKA 3GO2A 3G1YA 1PZ3A 3ECQA 3F5JA 2ABBA 3S83A 3TK7A 3SRKA 3V0UA 1EYEA 2EO7A 1L8PA 4Q8OA 1H50A 4D6FA 3AIWA 4HGXA 1NOWA 3A9BA 4PODA 1UUOA 1XLGA 2DVUA 3AHZA 1ZGDA 2CITA 1U22A 1JPDX 3ZR5A 4JTTA 1KXQA 3CPRA 2NV1A 2Y5SA 3ZOAA 1CLXA 3PS7A 3L5LA 3UJFA 4DBEA 1TPFA 4MWAD 1HL8A 1OFAA 2ZA1A 3LK6A 3G24A 4FX8A 1GUVA 3UG8A 3C52A 4Y2WA 1VPQA 2I16A 1UP2A 1S2TA 1F3EA 3UGRA 1E0WA 4GXMA 4UMBA 4HMCA 4LWWA 4TVDA 2G3FA 2IPGA 3WCZA 2VZUA 4LTSA 4JTFA 4NAFA 1OGSA 2WW5A 3A64A 3UEQA 2WZIA 3QZEA 1EEPA 3THCA 3Q45A 2F6UA 3DESA 3GFYA 4PB4A 1UP3A 3AWNA 2DZAA 3UYCA 1VGAA 1Q6OA 1KBIA 1H49A 2H6RA 2PWDA 5XINA 2R9RA 4O57A 3Q4DA 3W85A 2WXDM 1TWSA 1P1MA 2PLMA 4UNLA 4OV9A 5REQA 3GXTA 2JEPA 2FHCA 3PJXA 1QHPA 1V5XA 3BCFA 1BWVA 4MSSA 4G7FA 4NJJA 3URAA 2X1IA 1ISWA 1VCVA 4L4LA 2HVOA 4AZ7A 2YCLB 4PB5A 4G2DA 1EX5A 3N13A 1J9YA 3PR2A 1CGUA 1FDYA 2Z4GA 3W76A 1HN1A 3VD5A 3CYVA 3PVFA 3SRHA 2QS8A 1XW8A 3PWGA 2C79A 2X42A 4ZSUA 2YDAA 5DQPA 2OYKA 1R2TA 2D73A 4C1LA 3QJAA 4B9ZA 1CGTA 1PCKA 3ATYA 1BVWA 2DVTA 3LXAA 4C6KA 3M0MA 5IRPA 1UQYA 4LYKA 1J0YA 4QS5A 5K4XA 4E38A 3BMVA 4ROQA 3GYEA 4DQWA 4PCSA 4FLRA 4Q3MA 4ZB0A 2WHKA 1H7WA 4J3ZA 1FFRA 3B3DA 3PZIA 3ABXA 4GGHA 4KWSA 4I5RA 5REQB 3OZMA 2HPIA 1ZCOA 2BV9A 5IFTA 1O4UA 2ZRYA 3BXWA 4G9PA 5XIAA 1R3QA 1DWJM 4HU8A 1JZ3A 3CHEA 3QPEA 3BARA 4DF0A 3C86A 3WEMA 4Z2LA 2ZZ5A 3PBYA 4RCXA 3VOJA 3RLGA 2R82A 1KCKA 3KEHA 1XC6A 1O68A 3D3FA 3WNNA 4IGNA 2QDHA 1LROA 3LPFA 1US2A 1UWQA 5EMUA 1XINA 3WF2A 1XYCA 2JE8A 4PUNA 3QKZA 3GTIA 3LN3A 3U2CA 3EZ4A 3BQ5A 4LFYA 1YQ2A 5KITA 1DJXA 3BOFA 4HP5A 4TUFA 1FWWA 1K77A 4B5VA 2EAWA 2YCJA 4Q4RA 3ARXA 4XIMA 4IUOA 1A80A 4F0LA 3VAVA 4I6KA 1GZJA 3N6QA 4IJRA 3TOYA 1XBVA 4F0SA 2YCIX 4Q8PA 3ABQA 3LTPA 3W7JA 1QU4A 3VMOA 4K37A 3N25A 4PC8A 3SY1A 2CBVA 3DEQA 1XX1A 3RLVA 5CQ1A 1V0MA 2WHLA 3RAOA 2E28A 3LQGA 3PUEA 1PB0A 1HIZA 1WCGA 3WEZA 1UHVA 2NXIA 2CIPA 1LL6A 1PAMA 2PWEA 1FHUA 4UQEA 1G1YA 3S2LA 2W91A 3JU2A 4IIBA 4LUSA 3MDUA 3VXGA 3UJEA 1WUEA 1RP8A 4UOZA 1O7AA 3CHDA 3AYRA 1XRTA 1BPLB 2DW7A 1CBGA 5KZMA 4U5KA 3VDCA 2BGNE 2QDDA 4BHYA 2VL4A 5HNTA 1EQPA 1GVEA 4H8UA 2I9UA 4CD8A 2YGYA 3VOCA 3VGEA 5I78A 4XZLX 5E6YA 4FNPA 3CIWA 2C91A 4EANA 2V5LA 4HU0A 4HTBA 3DYMA 5D2TA 3BANA 5AKQA 3U3HA 2GYIA 1LP6A 4JDYA 4HZ8A 4WZHA 1WYIA 1D9EA 1GOQA 2V5JA 3TSBA 3W7DA 3WELA 3T05A 1TV8A 2GSEA 4I7VA 3SRFA 4HSHA 4AD3A 4BFAA 2DUZA 3B8IA 4PMUA 3MVIA 3WMBA 4TVUA 4DAIA 3MCMA 1A0EA 4S3FA 3EXSA 3PFMA 4PYSA 1K9DA 2OYMA 3MSRA 6A3HA 2J7BA 1DJZA 3S1VA 3AIQA 3NA8A 4ZOEA 2GJXA 4TX9A 1SO5A 4CU8A 4US5A 1K7XA 4LUSB 5AYYA 3PUGA 4PE8A 1T40A 3MV11 4WXYA 5AOUA 3CL8A 1YDNA 4P7OA 3KDNA 3TN6A 5CPLA 1BRLA 4KIEA 5A8GA 4TQTA 4ZTYA 4FOUA 3CYJA 4PB3A 1YE4A 3LLFA 4C7FA 3QSRA 4EXQA 3GBDA 5D9NA 1T8QA 3KCOA 3BW2A 2UBPC 4HNUA 5DRIA 1RPXA 2YBVA 4HSNA 1NF0A 1QI3A 3FCPA 3CNYA 1VP5A 4QR6A 2KAUC 3TU9A 1FH7A 1AL8A 3R13A 4CU7A 2AOSA 1J5TA 4NYYA 1ZSXA 2YLAA 1FDZA 1RJPA 3G1RA 3CZEA 1XYZA 1RVKA 5C9RA 2PRHA 1JUEA 3WQ8A 3MUXA 3ZM8A 1B54A 1J5SA 3W1TA 3M5XA 2XTKA 5FIPA 4ZO7A 1ZUAX 4RNJA 1YPXA 1ISVA 3T4WA 2GJXB 1E5NA 4QISA 1ONWA 1MEIA 4HK5A 3M0IA 3U5UA 2NQLA 3GVQA 2ZRXA 4DJFC 3B06A 4AWSA 3W1UA 3EMQA 1UWRA 5JIWA 4FLSA 3S46A 1BRLB 2WSPA 3MC5A 3EMZA 1NH6A 4TXEA 3B9NA 3W7EA 3P0XA 3HPSA 2OYLA 1WAUA 1UD8A 1ZBKA 2JQXA 3GSMA 4K68A 1OWQA 3H12A 4OZOA 5F2MA 3SCSA 4IJCA 3AWOA 3WLQA 2RGLA 1B4KA 2B4GA 4RV3A 2CLKA 3W23A 4PUKA 5SWUA 5TD4A 3ARYA 2GGHA 3MZ2A 1WZKA 3QMSA 2Y7EA 2QXWA 3DZ1A 1M53A 3PZUA 4BI7A 2NV2A 5G1YA 4IPPA 4NUWA 3TKFA 2CLIA 3H4WA 3WDRA 4DBSA 1RCQA 1CX9A 1REQA 4AAJA 1SPQA 3AIEA 3GTHA 4I5XA 2C19A 1FXQA 1KRAC 3TYEA 2E1WA 4GK8A 4HZMA 3FDGA 4LXFA 1UIPA 1OVDA 4XAZA 1X1NA 1QT1A 5E0KA 1C90A 1YADA 3GNXA 3C8NA 3EYPA 3UWEA 4HYRA 2E40A 2BFGA 1XGDA 3MW7A 2VQUA 2RJHA 3FXGA 4JKKA 3GXMA 4CNNA 4LRSA 4A3HA 4LALA 4F2BA 2Y5EA 5I06A 5C7VA 4OWGA 3HO8A 1O5XA 5KEZA 3DENA 2Q71A 1W32A 4KEVA 1FCUA 5A8NA 4WIWA 1D8WA 3UBPC 3VE7A 4GZIA 1M04A 3GHRA 1A5UA 1G67A 3AHTA 4JHZA 1ZBCA 3RM8A 5F2GA 1OIMA 1FX6A 2TPSA 2FMNA 3ARSA 1G0CA 3WD4A 2P10A 1UQZA 1UZ1A 3IJQA 4NX5A 3DHFA 4JICA 1EO7A 1ITUA 4KCWA 4S3BA 1HGYA 3RUBL 5JUVA 3THQA 3PJUA 2J7CA 3VU2A 1UMYA 4JIPA 4JFSA 3G6MA 1MZHA 4BQ2A 3MZNA 2X1TA 4GJIA 5FSDC 5BOEA 1HL9A 4Z2GA 3NQ7A 4MJZA 3TTSA 1DTUA 4U28A 2V8ZA 3QR1A 4YTTA 4QROA 3GLCA 4E2BA 2A6LA 1H7OA 1KLZA 3UESA 3WD2A 5LGXA 1U2YA 3HMCA 3DI0A 3FIGA 2B31A 1PO9A 1JNEA 1D2KA 1PHWA 4EIVA 1P0DA 2IKGA 3HG2A 2E25A 1O66A 3DUGA 2DZTA 1XDJA 1V0LA 1VFUA 1KGWA 4FAMA 1G5AA 4XK2A 3P74A 3ZLFA 2Y5JA 1WXZA 4NY2A 4JAWA 3QR3A 3RPTA 4IIEA 1POKA 4K39A 3C3NA 4GNVA 3RK8A 1GQKA 3EXTA 1UPMB 2E77A 5T26A 3GNOA 2RDXA 4US6A 2EF9A 1L8NA 3BG9A 3VYLA 1S3HA 1J93A 2QLYA 3V1HA 1V79A 1H41A 5ABTA 2BVTA 1GVFA 3HG5A 1KGXA 2XWDA 4XTIA 1EHAA 5DMNA 4AMCA 1QK2A 1S2WA 1PXGA 2J27A 3D0CA 3TLLA 1ZP3A 2X8RA 3SSJA 3LX9A 3WBYA 4CD6A 1FH9A 1RR2A 1TA3A 1WDPA 4AWEA 4E3VA 4XKMA 3WUEA 3F7JA 3DC0A 3TA9A 4YHEA 2E0PA 2FHBA 2DY3A 3MJMA 1UR2A 3FJ6A 3M0YA 1EBGA 4LUJA 4A8RA 5DT5A 4NRSA 1TB3A 2Z26A 4E2DA 2ALRA 3A3WA 4HD5A 4XO6A 1AJ2A 1XBXA 5HQLA 3P67A 3F1QA 1ICPA 2BDQA 2D24A 4C91A 3NQCA 2VX7A 2AQWA 2VI0A 4ECLA 2CWXA 1TWZA 1NWUA 5C54A 4A3RA 3EPNA 2B7QA 1IQ8A 1LQ0A 2HE8A 1DQXA 4GWEA 1EB3A 3BCDA 3BOLA 1W56A 4LVDA 4CVUA 1JRCA 3WJZA 1Q5MA 4XAPA 5CPMA 2J8FA 4NU7A 1XG4A 3VFLA 3W0KA 2C8NA 3HPFA 3DOPA 4H9ZA 3HPXA 1Y8BA 1W5NA 2PWGA 1L2UA 3KBVA 3BO9A 4DJEA 4R7OA 2E6DA 4JL1A 2D2GA 1H5YA 4XD3A 4C6EA 1IZCA 1AMKA 1TELA 3R2GA 4GH3A 3TC7A 4AH7A 1IWPA 2O92A 2TSYA 3JZEA 3EOLA 4YCPA 3JR2A 5CC6A 2VRJA 1TMQA 2WHJA 2Y7FA 4YYFA 2YDSA 4NJIA 4UTHA 1E6SM 1Q65A 4M29A 1ZY9A 3FA4A 2PGRA 4GINA 3R4IA 3G6LA 3QTPA 3C61A 3H55A 4KIRA 1FCVA 1TMHA 3UA4A 4P8XA 1TV2A 2GPTA 4Q4KA 1KCXA 3TNOA 1V77A 2XGBA 1SFSA 3LBOA 4JY9A 1A5BA 3GH5A 3GDBA 1YXYA 3PZMA 4LS2A 3BAWA 4DY1A 3LDVA 2I9EA 4Q4OA 4FX7A 3V36A 2E5DA 1TCDA 1HP4A 2Z1BA 3LZ5A 2F9RA 3LTSA 2G8ZA 4CNTA 5HPOA 4K6AA 3B8TA 1B3XA 1W1TA 4KFOA 1W1VA 3VNIA 3A12A 2DGAA 3HJEA 1BAGA 4QXIA 3ZWSA 1L2QA 3B0UX 3ZSTA 4BA0A 3GR8A 1H62A 2RAGA 3WF4A 1LG1A 2WNWA 1GORA 1ZU8A 1MO0A 5U7SA 4JHOA 2X0HA 5AHLA 4UXDA 2YW4A 4QP0A 3VD4A 3K2GA 4JTHA 1QBAA 4GQGA 2YLLA 3QYSA 4PTWA 1X7IA 3HQPA 4ZSTA 2GGGA 4GNJA 4PMDA 5BRQA 4UC5A 3RF9A 5CG0A 3N19B 3BVJA 1QOQA 3M0JA 3W6YA 3OGRA 4QBXA 2C16A 5G1MA 2GJPA 1LM1A 1RCXB 1HG3A 2NSOA 5IBXA 1V0NA 2AQVA 4R9XA 3UCDA 4JQ3A 1WOBA 4G6CA 4JNZA 5EYWA 3K8KA 5AC4A 1PKMA 2CLOA 1XGEA 1JPHA 3PPFA 4MWAB 1AZ2A 4R9OA 1KW1A 3NJ3A 4GG9A 4JPGA 5I24A 1Q3NA 2R6OA 4U3AA 5D2VA 1UPPA 2BBFA 3HIJA 5ABGA 3TJ4A 3TTOA 3N3MA 1XLIA 1G4SA 3NL2A 4EWND 5DEZA 4EF8A 3VZYA 4O15A 3VX0A 5C0QA 1FHLA 1GKPA 4U5IA 5AHIA 1ZNNA 4JX6A 3CHCA 1XIEA 1VYSX 5JH2A 3E9AA 1JDDA 5MKGA 1ZAJA 4Z2IA 3A4AA 3CTLA 1MWOA 3GZ3A 5E9AA 2UWFA 3GDLA 2VEPA 1XSJA 1VBGA 3PG9A 2ZUSA 1M41A 4XX6A 4AISA 1JCYA 4LF2A 2EPKX 1H60A 1A5SA 4IIFA 3MO4A 4O19A 4JQ1A 2PWUA 3F5KA 5F4WA 2WVVA 1LUCA 3TH6A 4JR5A 1LF1A 4LQ1A 3FN9A 3ZZ1A 1U33A 4CLMA 5D2XA 4B3KA 1V02A 1BGGA 2VD8A 1MUWA 2YB1A 2CCRA 3HQ1A 1K4HA 4MB3A 1Z8AA 1DHPA 2A7RA 3O3RA 2IPJA 4ZQOA 5EY5A 5A2BA 3N9SA 4D6GA 4GISA 2QCLA 4IPJA 3CUHA 1E56A 3HMJG 3WLPA 4RJEA 2Q8XA 3P0WA 4QG9A 1SSGA 3KRBA 5G1TA 3II1A 4S23A 5MKGB 2YA1A 4GNKB 4RZBA 3H54A 1Q6CA 2PDNA 2XIMA 4K1GA 2XGZA 3T09A 4MFEA 2ZUUA 2GSJA 4YTRA 3HQNA 1EZWA 3GNDA 4RKAA 4D71A 4WSJA 1M01A 1EJWC 2P88A 3E2RA 4H9YA 4LBUA 1XQLA 4RE4A 3GR4A 1XP3A 3WZ0E 4L1XA 5LNRA 2ISDA 1W5PA 1BHGA 3R12A 1GG0A 2WVVB 1W0MA 2OLHA 4HPNA 1AQ0A 5DY3A 1P0BA 1QOXA 3W1PA 2ZZ7A 4G1NA 3FFSA 1NOUA 4RZ5A 3CM4A 5G4WA 3N29A 1E70M 5DELA 4YL2A 1OHLA 2O56A 4F0RA 3VABA 3PWAA 4ICMA 3STFA 3TN5A 1DQUA 3G3MA 1M1BA 3UJRA 2ZYFA 3M6DA 4H6QA 4X2PA 1QCWA 1E1EA 3G22A 4C5YA 3K8MA 4KCUA 1KTCA 2OO6A 4Y9PA 4E5TA 2ZBTA 3V75A 1R9ZA 2P1FA 1G7VA 3UWQA 4YXGA 4LVBA 5C7HA 3ZR6A 4JXCA 1AD4A 4H1ZA 4LAKA 2WAGA 2XDFA 4MDOA 4J3TA 3KFTA 1WZLA 3K4AA 4ICNA 1H4PA 4DPPA 4H04A 4QLKA 3W1NA 1KO0A 4ZO8A 5C8BB 5CPNA 3T2PA 3BGAA 2CBUA 4F2UA 3CWNA 3WDQA 4LH8A 1CDGA 3C2OA 5FEPA 3FKRA 1SSDA 2BS9A 1MXSA 1FWNA 2ZE3A 2RKXA 3VD7A 2PDCA 2WKGA 3H21A 2PDFA 1QPRA 4O0KA 3VKCA 1A3XA 3EKZA 1ONEA 5DX7A 3A47A 4PUWA 2Y63A 3S42A 6TIMA 4L9ZA 3W7NA 3E49A 3VE9A 4TIMA 4FP1A 2AL1A 3R0DA 4GIAA 4MJ4A 2FH8A 2VEGA 3NL3A 1UA7A 4BR1A 3KOWA 2YKKA 4LAZA 3WLSA 4PMQA 1V8EA 2P8BA 5EBUA 4WSKA 5BXTA 5AC8A 2PLCA 3BV7A 2EQDA 1AH4A 2INZA 4Q7IA 1MRQA 4KETA 5FD0A 1CEOA 3GAKA 1KBKA 1OQFA 6CGTA 2J62A 1IT8A 4P7LA 3BH4A 1V4YA 2X1RA 1OK6A 4PTDA 2PDJA 3WQVA 3FXYA 4UR7A 1ZAHA 2V5KA 4FS9A 1XPGA 3E38A 3KVLA 1K02A 2PS2A 1FWJC 3CUIA 4YJ5A 3AS0A 3QC3A 3FS2A 1XF0A 4GXWA 5JIPA 5K4ZA 1C91A 2EHHA 4HOWA 2FPVA 1WKYA 4DNMA 3FGCB 3U9IA 4FHAA 3KTXA 3VINA 4WKHA 1HKKA 5A8MA 4CCEA 2HEJA 3W27A 4DXXA 1B3ZA 4JFWA 1FQ0A 2FFCA 1Q6QA 3THDA 3KBNA 5KZ6A 3P8IA 1NSJA 2VVNA 2VD9A 3EKLA 1RZMA 1RVGA 3KRSA 3BGJA 4QLLA 2AAMA 3OLEA 4BWLC 3CUGA 1QTWA 4CQBA 3JZUA 2QPXA 1FP9A 1XGZA 3GK0A 3T1GA 2NSXA 1IEQA 3CWHA 2QCEA 3IPWA 2G41A 1M5WA 3VKDA 3VNLA 3KHDA 4GZ7A 3R58A 1OX6A 4FLOA 3SN0A 1HVQA 3CQHA 2WQDA 2R24A 4U2YA 3MUCA 1B9BA 4KW2A 4OOUA 1KC7A 3SUSA 4R5EA 5G5IA 2FZMA 3WLRA 1HKWA 4AZGA 4DX3A 1E6QM 4A4AA 3EGJA 4XV0A 2F6XA 5CEWA 1JCXA 1JGIA 1W2VA 1US3A 4IMDA 3GR7A 4ACYA 2ACSA 4DLMA 3W07A 1JCJA 3SCRA 5I00A 3DAQA 1UKQA 1DXFA 5CPQA 4A8LA 3QZ6A 4E4PA 4LF1A 5LHFA 4PUMA 5GNZA 3V18A 4LC8A 4B4HA 5I03A 2QJGA 2A3EA 3WDHA 3WK3A 1V3IA 1Q4NX 1ZJAA 1KV5A 3B8SA 5CGTA 1EJRC 1NWRA 2ZX7A 3TQVA 1H61A 8XIMA 1J96A 3TC6A 1ME8A 5FJOA 1GYNA 7TIMA 2FB2A 5A94A 3AIBA 3TMQA 4DZAA 1W5OA 3EEGA 1DTNA 4DBDA 4NILA 4UR8A 1UD6A 1KGUA 1QNSA 1YXCA 3QGKC 3NM3A 4ZQCA 3SN4A 4QITA 1S46A 2VELA 3M64A 3DFQA 3QSTA 3WQ6A 3H7RA 3KTCA 1I75A 3C6CA 1VEOA 4L7ZA 3ITGA 3T78A 4PTNA 1W1B1 5C2XA 2R8WA 5CZSA 5M17A 3S5ZA 3TAOA 1S2AA 2PGWA 1LQ2A 4LBSA 2BSLA 3TA6A 3SURA 2CHOA 3NOEA 1OEPA 3NEVA 3VNZA 2JKAA 3F4CA 2EJ1A 4X9SA 2WMKA 2YA0A 3UF9A 4NZ3A 4J35A 5DMYA 4HA1A 3TOPA 1LRTA 3STGA 3MA8A 3LGGA 3W7GA 3FV9A 4NZJA 4EAMA 4W8BA 1E43A 1FRBA 2ZZ1A 3COTA 1VFSA 1GQLA 2XIQA 4ZFCA 2GLKA 2ZXQA 5H91A 3VDHA 4ZVJA 1ZB5A 5GVJA 5LA2A 1O1HA 4QIUA 3MCOA 3SCNA 4KRUA 2P76A 4PTMA 2CLLA 3IIPA 2ZKMX 3S6TA 5D04C 1Z41A 3CH9A 3IIZA 2QDGA 4QQUA 1IF2A 5A2CA 1QBBA 4IQEA 4C6JA 1IYXA 1QHZA 4S3EA 3JS3A 3NQVA 4JN6A 2FJUB 2H3DA 2NX9A 4UTFA 1EP2A 2I14A 2Y89A 4XSLA 4TV5A