4ZQOA

Crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the complex with imp and the inhibitor q67
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
375
structure length
354
Chain Sequence
DPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSGGLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRGKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis IMPDH in Complexes with Substrates, Products and Antitubercular Compounds.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
total genus 109
structure length 354
sequence length 375
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zqoA00
5HMSA 3UZJA 3U8GA 2A21A 2PURA 1LBLA 4O4WA 5DLCA 5TBOA 5BNKA 1W56A 3EB2A 3S5YA 1Q6LA 1OF8A 1RZMA 2H3BA 3TDFA 5D37A 3W1PA 3GVGA 4FIRA 1TV7A 2FPTA 3IVTA 2GVGA 1LM1A 2DZVA 3DXIA 3V75A 1GYNA 3FS2A 1TPEA 4HIBA 2QUTA 1QPOA 3BO9A 1XC4A 3PSVA 1XM3A 3RU6A 3RLUA 5C55A 1OX6A 3NEVA 3YPIA 3R5EA 1TPH1 4MYAA 4NNCA 1V5XA 1LORA 4LVFA 3B04A 2NUWA 3NPXA 2DORA 4LW7A 1OX4A 3ELFA 5AHFA 3HIJA 1SR9A 1UB3A 4JY9A 3NAVA 4GUHA 4IMGA 4IUOA 2I14A 2ZCGA 3G1XA 3TMQA 4LU0A 5AB3A 1GOXA 3E96A 4O54A 1W3NA 3P84A 3TNOA 4RV8A 2E77A 5LHFA 2R14A 3MHGA 4DO5A 2V2CA 4QAIA 1F76A 5KTLA 5KZMA 1SFJA 2VC6A 4GRSA 4FX6M 4QITA 3BGGA 2QUVA 1R46A 1YDVA 3IRDA 3DFSA 2Y61A 4QM1A 5AHIA 2FQIA 3Q37A 4P2VA 1FDZA 2QDGA 4WXZA 4FIQA 4JTSA 3SJ3A 5D38A 4O12A 5EMUA 1KFCA 3KRSA 3S1XA 3G1AA 2C0AA 3GAYA 3L68A 3JR2A 1GVOA 1B3OA 1TJRA 3NM1A 4XTDA 4XKYA 3HF3A 3MW7A 4LS1A 1IXPA 4JTLA 4UTUA 5DN1A 1WOBA 4AHQA 3NQVA 4AHOA 3O6CA 1IXNA 2E5DA 3GDLA 4GNJA 4I9AA 1W37A 3C2RA 3CEUA 2OZ0A 2J9ZA 3GDTA 1XBYA 3UWZA 5DCEA 2P0OA 2VFIA 3QPZA 1L6YA 5EBUA 2QCLA 5CG7A 3HQ1A 3W1NA 2CLIA 3GLCA 4DQWA 3QEZA 5L6UA 3FKRA 4DBDA 5AYZA 3LHWA 4EVZA 3I7RA 1H62A 3G0SA 1KTCA 4K8EA 4ZL1A 3TC6A 3F03K 4AWTA 1SSDA 2V9DA 3W74A 3N2MA 2CLHA 2HS8A 2X1RA 3P5ZA 2WSQA 2GJNA 4UFHA 1KTBA 4UXDA 1OYCA 1TB3A 4IMFA 4JTIA 3PB0A 3EX6A 3NQ8A 3GB6A 5K7JA 3E0IA 3F4WA 3DHDA 5HUOA 3RF9A 3W7PA 1OK4A 3N14A 3PF3A 5GVJA 1TMHA 5LGZA 1ONRA 4P61A 1L2UA 2X16A 4FNTA 4Z1AA 4ZQNA 2TRSA 3AJXA 1XDMA 3O63A 3ABRA 1WYIA 3A24A 4YWIA 1OFPA 3TQVA 1IGSA 5E1QA 3N34A 1ALDA 1H63A 1QMLA 3L2IA 2EHHA 1G4SA 1Z42A 3JS3A 4TIMA 1KM4A 5KSWA 8TIMA 5EL1A 1TPDA 3TAOA 1TRIA 3W1QA 1HL2A 3OBKA 4PODA 3HGSA 3AO0A 4UFMA 3DI0A 1FXPA 3W7OA 3A22A 3ZWTA 1F7BA 3CLMA 4JYEA 4CLMA 2DJLA 1WQ5A 3PBVA 3BLFA 1U5JA 4XTIA 4QISA 5D2TA 3P67A 3BV4A 4GUIA 3LX9A 4JDBA 1RQEA 3QSTA 4Q4KA 5C6MA 3LXBA 3NZRA 1TO3A 1UUOA 3IVUA 5D04C 3M5YA 5H91A 3PY2A 1R30A 1GVQA 4ORIA 1YXDA 1HFBA 1XI3A 3P80A 4M19A 2NZLA 4YL2A 4JTHA 4FNRA 3L5AA 2C13A 1EIXA 2O7SA 4UNKA 4MFDA 1VYRA 4UR8A 5T26A 1JULA 1KM0A 2NXGA 3LHVA 1KV8A 1XBVA 4NNAA 1X1ZA 1RVGA 3CWOX 1UBSA 4KFPA 4MPQA 4U28A 1SZNA 5D02A 1EWDA 3QYQA 1OYBA 1ICPA 3DH7A 4GJ1A 4MLJA 4QSHA 1UCWA 4U4MA 4KFOA 1KM1A 3TJLA 3BPWA 2GUUA 2PC4A 1PVNA 4UFIA 3GX9A 3TV8A 3S6DA 2V81A 2A7PA 4JYFA 3WK0A 5FEWA 2FJKA 1ZAHA 3O6DA 3LCFA 1I45A 4I7WA 4N9EA 3WK1A 2GQ9A 1QR7A 3NQCA 3TXZA 3CC1A 2B0MA 4WZHA 1WV2A 4N4PA 2I1OA 3VE9A 1FWWA 2Y85A 1OFBA 5G1TA 3DKJA 3T44A 1NVMA 4O28A 1U83A 3LXCA 4IOTA 1D3HA 3UXAA 1KFBA 4WJEA 1FXQA 1TV5A 3EXTA 1FDJA 1TPB1 4O10A 2LLEA 4CQ9A 1JCJA 4BF9A 3KXQA 2HMCA 4O15A 3LB0A 4HNVA 2ISSA 4HSOA 4K39A 1O94A 4PL1A 2BWGA 1KV5A 3FJ6A 1H7PA 4DXVA 3NQ6A 5CSSA 1F5ZA 2EAWA 3PBUA 2XFWA 4CCCA 2ALDA 4LV4A 4JTJA 2QAFA 1V7YA 5K9CA 4FB7A 2JGYA 1SW7A 3IIPA 3BG5A 3LTPA 3W7QA 4Z1DA 2FIQA 4TMBA 5FEZA 3T78A 3TC7A 2QCGA 1IXQA 2V2DA 5U4NA 1VHNA 5AYXA 1A5CA 3TK7A 3R8RA 4RXGA 2WQPA 1EP1A 3HG4A 1XL9A 3HOJA 4AF0A 3W3OA 3C56A 2VELA 5HWJA 3O06A 1XXXA 2VFEA 4FNUA 3ATZA 3MHUA 3D0CA 3CIXA 3HG3A 3B03A 4NJHA 1TTQA 3W7MA 4O4VA 1SZFA 3GXTA 3G1DA 2YX0A 4MIMA 3R12A 2Y7DA 4IMDA 2DZXA 3THQA 3KVMA 3W70A 5H2ZA 1XFBA 3G18A 2FLIA 3QC3A 4JNMA 3OVRA 3TW7A 1FWTA 3WJSA 1GTEA 5L9FA 3NOEA 4UNLA 1DQXA 4MOZA 3QW3A 5LZLA 2VOMA 4RZ4A 4Y6GA 4LVAA 2B4GA 3CT7A 5CPNA 5D03A 2EGZA 1MEWA 3TR2A 4NX5A 1ML1A 4WXYA 3M7WA 3W07A 2J24A 1ZFJA 7TIMA 2KZHA 2YZRA 1QPQA 4LTSA 3EWZA 1LZOA 3P7YA 2E5BA 5BMXA 2ZTJA 4HPJA 2BTMA 1TTJA 3OIXA 4H3DA 4OBTA 3LRMA 3TUUA 3OVQA 5K4XA 2A1YA 4N9DA 1GVSA 1BEUA 4Q33A 1VJIA 4UTWC 5IM51 1OYAA 3P82A 2CLOA 1DOSA 1LRTA 4MJMA 5TIMA 1WDWA 1QOPA 1F6PA 1M7OA 4WY0B 1K7FA 3VFLA 1YTEA 3QRHA 5HQEA 3MBDA 3NM3A 4K6AA 1QWGA 3M41A 3WFAA 3NQ2A 1VLWA 3M5VA 1I2NA 1Q6RA 1SSGA 4EF9A 2QCFA 1AL8A 1YXCA 1K03A 3GXPA 2CZFA 1LTDA 3N9SA 4IQLA 3S9YA 3LTSA 4ZQRA 3CWNA 3LI1A 3PS7A 3FFSA 2B7QA 5KINA 4NXSA 3FEMA 1B9BA 5EYWA 2Z2UA 4LY8A 3L0NA 5AC6A 2FFCA 1SUXA 3W2LA 1DHPA 1G7UA 4O53A 2V5LA 1J4EA 4YCPA 3H53A 4IJBA 1JCYA 2A5HA 2EF9A 4FEZA 2JBMA 4D2JA 5HNRA 1DQWA 4MJZA 1DORA 1SO4A 2R8WA 3W9ZA 2OMAA 3HPZA 5D32A 1KA9F 3B0UX 2YGYA 2FPYA 1KBIA 3BK0A 3KRZA 1MSSA 5G2IA 4DPPA 4EF8A 5HR7A 3GR7A 4UR7A 1EPXA 3NG3A 2GVJA 3DFOA 3G24A 4L4MA 3W84A 3C3NA 2CLLA 1F74A 3G1VA 3C61A 1JRCA 1FCVA 1RR2A 2NXIA 3GNDA 3W7LA 4NUWA 3UD6A 2CLMA 1EB3A 3GAKA 4CNNA 2EKCA 4DF0A 5EA9A 1PS9A 3M47A 3SIZA 4DF2A 4N6FA 1ME7A 3ZWSA 2J27A 4JTKA 2X1TA 3EKLA 2BXVA 3N2XA 1XUZA 4Y90A 3GDRA 3A9IA 3QPYA 4ZVJA 3LRLA 1XCFA 2WKJA 5U7SA 3UWVA 3W1TA 3P8JA 2QCDA 1GTHA 4AB4A 1KLYA 3A23A 4I7VA 1LOSA 3C0JA 3LCWA 4RCXA 1I2OA 1J2WA 1GVRA 3G8EA 3TQ0A 4MY8A 1FCUA 3LGEA 4X9SA 2ZQ0A 2E5CA 1FWRA 1Q3NA 4YXGA 4QIUA 1UUMA 1DL3A 3NPUA 5DY2A 3MWAA 2DZPA 3LCXA 3PM6A 3EXSA 3BW3A 1KLZA 3NQFA 4RX0A 3K30A 1KFKA 3RFAA 3VI2A 1TSIA 1TRDA 3W2NA 3CTLA 3LXAA 1YYAA 3TU9A 1HG3A 4K38A 4M7SA 1ADOA 4UFKA 2QCDB 1YTDA 2X2GA 3VNDA 1JJKA 2RFGA 3NVTA 4WOQA 4O8RA 3WK3A 3LRKA 1I2QA 1ZAIA 2WSRA 3L5LA 3TQKA 1TIMA 2C19A 4ONVA 1G7VA 4E0CA 3W7JA 4AWUA 3TFXA 4Y8FA 5HJLA 3W88A 5FI8A 1IIHA 1H7RA 3G0UA 3IGXA 5C5YA 2V5BA 3PB2A 4GUJA 4AF0B 1VHCA 4O52A 3PUEA 2A85A 2RDTA 3LCHA 1FUYA 1PIIA 2C14A 3O16A 1TYGA 4NVTA 4PA8A 3W7KA 5D30A 1L6WA 4LVBA 1JVNA 5I3JA 3R89A 4DO6A 3H55A 4XBSA 4IX2A 5K4ZA 1GWJA 2G5WA 1JR1A 2YFOA 3M5ZA 3UWUA 1S5WA 4UMBA 3EX2A 3B05A 2HTMA 2A2IA 1A50A 1H60A 3FLUA 2J6XA 3PUOA 3C6CA 2V30A 3NL6A 4UC5A 5FF3A 2CLKA 2ZZ2A 5CPMA 1TTIA 1EWEA 1O4UA 3T55A 3W83A 3MO7A 5BMWA 1GPWA 3M0ZA 2DZSA 4C1KA 1K8XA 1MEIA 1G6CA 2E6AA 5C2XA 1KBJA 2PRLA 1KFLA 1ME8A 4N4QA 2FB3A 4UUIA 5A5WA 3IGSA 1GZGA 4YMZA 4Z0JA 3B8DA 3EX3A 1VYPX 1LLZA 4LV9A 4CQ8A 3KOFA 2NWRA 3HGRA 2P1FA 2Y7GA 5J5DA 4RLIA 5CZJA 3S1UA 1YPFA 5AN7A 3NDOA 1K8ZA 3L67A 2PRMA 5HUPA 4N02A 4RZ5A 5LNSA 1T0OA 3BG3A 3GKFA 4BK9A 3NPVA 4ZQOA 1C29A 4M6QA 2XN1A 3QH2A 5D05A 3ABSA 5D2WA 3TROA 1HO1A 2E6DA 3L21A 1VCFA 2B7PA 5DXXA 1NF7A 2BX7A 1A5AA 3NR0A 3KHJA 1W8SA 3LHYA 3A21A 4JS3A 2QJHA 3KAOA 4M5PA 4UTJA 1LROA 1SFLA 2ZZ4A 4CCEA 1WOAA 4BI5A 1XDLA 4EIVA 1QNVA 2AAMA 3HJZA 3NPWA 3CEPA 5TQLA 1VPXA 5MHBA 4K8HA 4MYXA 2C1HA 4IMEA 1ME9A 1Q6OA 1H7WA 4KFNA 1T8XA 4OV4A 3ZS4A 2ZZ5A 5D2VA 2C16A 3DI1A 5D09A 3VCRA 2VFDA 3M43A 3OHIA 3SZ8A 1SO3A 3NYZA 4JY8A 1WXJA 3NQEA 4Z1BA 4E2BA 5IBXA 4C1LA 3TIMA 1SU5A 2JKAA 4FNQA 2X30A 2GOUA 4Z0SA 2W6RA 4UTLA 1SW3A 3STCA 1FQ0A 1QAPA 2VEKA 4TO8A 3C4UA 3NZ1A 4L4LA 5G5IA 5AC7A 3S5OA 1NSJA 2F84A 1OVDA 2V0TA 3W7NA 2G95A 4NJIA 5IBXC 4UMCA 4AXKA 1HO4A 4MVAA 3I7QA 4N9CA 1ZNNA 1G4PA 1GVFA 1GEQA 4O1BA 4DEFA 3HGJA 4X2RA 1XKYA 3NA8A 4UTTC 1P0NA 3M16A 3L5MA 1MXSA 4UFJA 3TSMA 1FBAA 3WJWA 1W3IA 3Q2DA 2A7RA 2Q3OA 3W72A 5K2ZA 4MLRA 3SW6A 3FYOA 3W1XA 3O15A 5EY5A 5F4XA 1TQJA 2VENA 4HSNA 1MEHA 2E1DA 1Z48A 1VCVA 3NQMA 4IWWA 1QOQA 2ZZ3A 3TAKA 3W71A 3WK2A 3TX9A 3JRKA 3L0GA 3MP4A 2Y7FA 2A7NA 3NGJA 4JTUA 2NLIA 3QQ0A 3HB9A 3A5FA 3TCEA 2BSLA 5LKYA 4YLWA 3EWWA 2H8XA 5FF7A 2RDWA 3W2UA 1Q6QA 1IIGA 4JIPA 2Y7EA 4R53A 3PBYA 3QMRA 1CI1A 4O0ZA 4PL2A 5HWNA 2G96A 3GKAA 3LHUA 3PSWA 2GQ8A 4LNYA 3W1UA 1UJPA 2AGKA 4ICNA 4QNEA 1KFEA 1W5OA 1AW1A 5G4EA 3KX6A 3P60A 1JCLA 4O50A 1OFAA 4OU1A 2ZA3A 3A5VA 4DPQA 3O05A 2IQTA 3O6YX 2ZBTA 3G22A 2V2HA 3WJYA 5FF2A 1ZAJA 4LS0A 1L6SA 3WJZA 1SO5A 2VEIA 5EPDA 4HKPA 1VZWA 5G4WA 3T4CA 3W2JA 1W5NA 3IIVA 1P0KA 1TJPA 4OT7A 3TW6A 4AWSA 1LOLA 4LS2A 3W7DA 4ADUA 1LCOA 2CU0A 5F2GA 3EXRA 1EUNA 4JD4A 1O5KA 5DCBA 1H51A 1OFOA 1ZALA 4O13A 4NJKA 4ML9A 4PEKA 2ZFAA 3P61A 4A3UA 1IXOA 2RH9A 3B06A 2V8ZA 4S2CA 4WY0F 4N2YA 1YADA 1PV8A 5HWMA 4AAJA 1R47A 3KRUA 1PL9A 2YPIA 2OCZA 4O1AA 3W73A 3INPA 2YCEA 5CPOA 2C18A 1LDCA 2TYSA 2CFFA 3KVJA 1D9EA 3LOTA 3BLEA 3QM3A 3PULA 4MY1A 5AHEA 2HSAA 3HO8A 4RKAA 4B5NA 2BLEA 1Z41A 2GVLA 4FX8A 1P4CA 4AMAA 2XN0A 2V82A 5G1YA 4ADTA 3QSRA 3LCIA 1YDOA 3E9AA 1I4NA 4AVFA 3UNDA 2H3DA 3P5YA 3UY7A 4AEOA 4OWGA 3NO5A 5HINA 1GQNA 4LVGA 1FDYA 2YDAA 1KM6A 4LRSA 1RPXA 5C54A 1HTIA 1TPWA 4GUGA 3QMTA 5E93A 2CLFA 1EP2A 1B4EA 5FF4A 2WNNA 3OEXA 3UPWA 2DZWA 3BG9A 3S42A 1TREA 1G69A 3IIXA 3THAA 4DO4A 3TSDA 2VEMA 3DZ1A 1N8FA 4K7VA 1VRDA 3G1HA 1OK6A 4KKXA 3U6WA 3G1FA 4OHQA 3NL5A 4JICA 4OGZA 1PE1A 3W75A 4UIOA 3EX4A 4BWLA 1W1ZA 3QW4B 1QPRA 3TXVA 3R2GA 2WSYA 4BI6A 4HPXA 2W0UA 1M5WA 2E6YA 3SY5A 5FF0A 1THFD 2NV2A 4UMAA 2R94A 5F2MA 1GG1A 1EA0A 1LP6A 3TJXA 3P8IA 4LRTA 3DGRA 5CPLA 5KMYA 1K7EA 1T99A 5KZDA 1XBZA 5I3GA 4XBKA 3BARA 4MY9A 4GFSA 2GJLA 1H7XA 3EWYA 4WD0A 4BFAA 1CX9A 3KVLA 5K3VA 1W0MA 1ZHAA 1R2RA 1WA3A 1OG0A 3W76A 1X8FA 4JTGA 1C8VA 1VH7A 4O11A 2NWSA 1O5XA 4NX0A 1I8JA 3EWBX 3SFKA 3I6RA 5EKYA 2P10A 1RV8A 3O1NA 4FO4A 2R91A 3F4NA 3IEBA 3UWYA 4IPJA 4BR1A 1DVJA 2QUUA 3LV6A 2QCHA 5CKSA 5D33A 4XZ9A 3S8HA 4ALDA 4NJGA 3C2EA 4XQ6A 2QCNA 1KFJA 3QFEA 4O1CA 1JQXA 1AL7A 4CQAA 4M7TA 4LUJA 1KTNA 4NU7A 4RJEA 1LYXA 3LM7A 3LDVA 1LOQA 1OFQA 3LV5A 4PH6A 1EP3A 3W86A 3HPSA 1E51A 2Y62A 1C9DA 2DP3A 2NUXA 1ZCOA 4XKYB 2ZZ6A 1JUKA 2QEZA 2O7QA 1W31A 2ZRXA 5CZTA 4QQ3A 2ZZ1A 3NXFA 1OABA 4QNWA 3PG8A 4RZ6A 1PCWA 3M5XA 2Z0IA 2NX1A 3ABOA 4IPIA 3M44A 1IF2A 4S2BA 3DHFA 3HPXA 1GT8A 3QQ1A 1DJQA 4LUIA 4JYDA 4R7JA 3DU0A 3W2MA 3IVSA 3IGUA 1GJPA 4FF7A 1G4EA 4PC8A 3W85A 1Z44A 3NQ7A 3LBMA 5LNRA 4PFMA 3G0XA 2PCQA 3HG2A 1BTMA 4LOCA 1NAL1 2D73A 2FPVA 2Q8ZA 2C6QA 4JTFA 3S0CA 4ORMA 1PCKA 3ATYA 4MZ1A 2JK2A 3GZ3A 1L9WA 4HT3A 3LI0A 1F73A 2CZDA 1M6JA 3SGZA 2ZA2A 5DY3A 4IGHA 3W23A 2H6RA 1PHWA 2XN2A 4JR5A 2WNZA 4MZYA 2VXNA 3FJLA 4OE7A 1UASA 1TPFA 3CM4A 4QJ1A 3HGOA 3MUXA 3G8RA 4UTWA 2C15A 3C2VA 1B4KA 3N19B 3Q58A 2QAPA 3W1MA 1G4TA 1H7NA 2Z6JA 4UTIA 4N9BA 4CNPA 1ICQA 5K9DA 3LHZA 3BLIA 3NL2A 4GXMA 5BOOA 5I3HA 1H50A 2FDSA 2RKXA 3NL3A 3W2KA 3UXDA 1QPNA 2X1SA 2DU2A 2OT0A 3EWUA 2F7FA 4DF1A 4MFEA 2YW4A 2WOQA 4UFLA 5LGXA 2GQAA 4UCGA 1GG0A 4GWEA 2VKZG 1OJXA 1WBJA 2RDUA 4MKNA 3FYPA 5KITA 4NQ1A 4LWWA 1JQVA 1LRNA 2QCEA 4FX7A 5DCDA 1X1OA 2NX9A 2QDHA 2H90A 5SWUA 3C2OA 1MO0A 4GE8A 2Q3RA 1KW1A 5HULA 3PVFA 3UY8A 2DZTA 4NZJA 3UYCA 3W7GA 4GBUA 3PC0A 3DFQA 3R13A 3BW2A 4O18A 4WUIA 3S5NA 2ZYFA 3IIZA 2CZEA 4BI7A 3KVKA 4WQ6A 4Z1CA 1ZENA 4AHPA 2YSWA 2QR6A 1D3GA 1N7KA 3W7RA 3SI9A 2NXHA 4HN4A 4JXCA 1OF6A 2JKPA 3QF0A 4A21A 4FNSA 3E02A 2ZZ7A 2J9YA 3N9RA 2C3ZA 2Q8LA 1YPIA 1AMKA 3W22A 3MYOA 4Z08A 1W3TA 4HNTA 1ZJIA 1SQ7A 3PR2A 4IX0A 4X22A 4O16A 2DZUA 1JCNA 3LLDA 3GDMA 4M6PA 4A29A 2X1UA 3U2OA 1EEPA 5G2WA 4LC8A 2RHGA 1S3HA 4HNNA 4FXSA 2I9EA 2WV8A 1W54A 3PAJA 2ZTKA 1KM2A 5DBTA 4IMCA 1DBTA 1NF0A 1VLIA 1P5BA 1QO5A 1VGAA 2ZRWA 3NNTA 5AOUA 1JRBA 5E0KA 1A53A 3TFCA 3W7IA 2TPSA 4O1DA 5HR6A 2E09A 2CLEA 4K37A 1CW2A 2NX3A 4NZFA 3SR7A 2A6NA 5BRBA 2FB2A 3G3DA 1EX5A 5I3KA 4CCDA 1QFEA 2WNQA 1O95A 1OFRA 4UTTA 3MP3A 2Y63A 1TCDA 2NUYA 5F4WA 3M1ZA 2YYUA 4ZQPA 1RD5A 1SZGA 3F1QA 5DELA 1YTKA 1P1XA 1WX0A 1YDNA 3I65A 3NQAA 4TMCA 1HUVA 1T96A 3W1LA 5AFDA 4A2SA 4R33A 1F2JA 3PWAA 4JTTA 1SPQA 3GIYA 5LSMA 3DFNA 1B57A 2ISVA 1VR6A 3N3MA 1LRQA 4Q32A 1DJNA 1TQXA 1VYSX 3DENA 3TA6A 3UWWA 2CW6A 3PUDA 2A6LA 1MZHA 4HNUA 3FOKA 1EUAA 1XUUA 3MHFA 1SO6A 3LBCA 2BZNA 3T7VA 2JKEA 2OX1A 3IV3A 3LCLA 3UPBA 3RK8A 4TX9A 5LNUA 2E68A 1TPVA 3QMSA 1O60A 1WBHA 2VFHA 3UWQA 1H61A 1R2TA 3MP5A 3FA5A 1RQBA 4K7YA 3B0VC 1I2RA 3HMJG 5D2XA 1FCQA 1K7XA 2ATSA 3RLVA 3W87A 1SZEA 3C52A 3EX1A 4LT9A 4BWLC 3MI2A 1YXYA 3NQDA 4GC4A 1OFDA 1BKSA 5F1UA 5FEPA 3QZEA 3RMJA 3MBFA 3CU2A 3STFA 4JX6A 4JTEA 2ZRVA 2ZA1A 2NV1A 3TKFA 1TTPA 3DFPA 2UV8G 4JEQA 1JCMP 1J5TA 3CHVA 2ZDRA 4PTNA 3SGUA 3TE9A 3CQ0A 3TH6A 3GDKA 2B7NA 3FKKA 4LVDA 3VKJA 5CSRA 5CZ0A 1G67A 3OG3A 2YFNA 3RNDA 1VCGA 3STEA 1OFEA 3BW4A 4FNPA 3MI3A 3I68A 1K3UA 1JUEA 4DBEA 4WOZA 4MUZA 4HHPA 4XWUA 1W5QA 3G3MA 3LTYA 3N73A 2ATMA 1A5SA 1F6KA 1VC4A 3DKLA 2ABAA 2TMDA 1X7FA 3ANYA 3L65A 5AHLA 3TSBA 1TPUA 2PRHA 4NXKA 3H54A 1Y0EA 4KWVA 2Y88A 4OQVA 4FHAA 2VFGA 1PHQA 2YXGA 5D2YA 3TMLA 1FCBA 2QJIA 2YYTA 4NT0A 2B7OA 2ISWA 3EKZA 2AQWA 1TPC1 3Q94A 2TSYA 2CZ5A 2E6FA 4J9JA 4YCOA 3FIGA 4AH7A 1F05A 2QCCA 2VFFA 1ICSA 4G1KA 4TR9A 3UQNA 1VQTA 4A2RA 1OX4B 3G1YA 2JGQA 1DV7A 3HG5A 3L0KA 3MJYA 3LLFA 3P62A 3UZ5A 5BW6A 1FY6A 3I7SA 5KZEA 1FWNA 4CNOA 2A4AA 1H1ZA 1FX6A 4XUGA 4EOUA 5F2IA 2Z1BA 4O19A 2A0NA 4ADSA 3M9YA 4RXFA 4X3ZA 3USBA 4S1FA 3P74A 4JGDA 2Y70A 1QO2A 5I3FA 5AHMA 3O8AA 3STGA 1W5PA 2EPHA 2GPTA 3MI6A 4JX5A 5CZSA 4K36A 4NJJA 1QDSA 3C8FA 3B4UA 3QJAA 3S1WA 2H8ZA 1JUBA 1SW0A 2Y89A 3GXNA 4A22A 1KM5A 3KFTA 4O14A 1LBMA 4EWND 1BWKA 2QJGA 3OA3A 3SECA 3ABQA 4W9TA 3O07A 1I2PA 4MZ8A 5LNVA 4TU1A 4Y9AA 3B0PA 3P81A 3CIWA 6TIMA 3VE7A 4NNBA 3CB8A 2QKFA 2Y6ZA 4E38A 3IIOA 3MMTA 2VEPA 5F4SA 4JIQA 5A8GA 5LNWA 5I3IA 3LHTA 3E12A 2OJPA 1A5BA 3GYEA 1AK5A 1X6UA 5DBUA 1BWLA 4KWWA 1OX5A 4LC6A 1NEYA 1ZY9A 4OV9A 5F2LA 4WX2A 1AW5A 1H1YA 1LBFA 2DJXA 1TV8A 4RK8A 3M6YA 3WJXA 1GYLA 3GR8A 3NQGA 1W5MA 3HBLA 2ZRYA 5FESA 1DKWA 1RQHA 1YLVA 4E2DA 2QF7A 1Q45A 4FXRA 6ALDA 1FWSA 1N55A 1AW2A 4O0KA 3W6YA 2ABBA 4H6KA 4UTMA 5J5RA 4ZMGA 4O57A 4ZQMA 3T40A 1H5YA 5FEXA 4UTKA 1KM3A 3BVJA 4O17A 3GK0A 1QCWA 5K9XA 3W7CA 2FTPA 3S5ZA 3BGJA 4DELA 1S5TA 4PCFA 1H7OA 2Z6IA 3C2FA 4M6VA 4R34A 5ABTA 1LLWA 4RR4A 2YR1A 2J88A 3MYPA 3W7EA 2ZRZA 3W1RA 3OVPA 3DAQA 4POCA 4IXXA 4WY0A 1JCXA 4JDYA 3PBWA 2ZRUA 4Y96A 5DXYA 5CGQA 1XBXA 4JX4A 5F1VA 4UTHA 3DBPA 1NFBA 2WO5A 1AG1O 3L66A 2G97A 2WPBA 4I7UA 1R2SA 3EEGA 3L9CA 1K02A 3PG9A 3S1VA 3W1AA 2CWNA 2QCMA 4IXHA 5AHNA 4H4IA 3LCGA 2YW3A 1VS1A 3ZR4A 3GNNA 2HS6A 3G1SA 3CPRA 4JN6A 4N6EA 4ZZ9A 3EWXA 5G2HA 1S5VA 2J9XA 4ZQCA 3W7HA 4GUFA 3LERA 1M7PA 5AC8A 1OHLA 2WJZA 3ZFHA 5AYYA 3DFTA 5LHEA 2OT1A 2W79A 1K8YA 1WAUA 3V1PA 3E49A 2PE4A 3SSJA
chains in the Genus database with same CATH superfamily
3SRDA 1IT0A 2PURA 3LNPA 1JEZA 4CD7A 1LBLA 3NZQA 1W56A 3WIJA 1EJWC 3S5YA 2X40A 2C0HA 3NSNA 2H3BA 3TDFA 2WLYA 1JDCA 3KL0A 2OOGA 1UROA 4LBSA 4Q4OA 1T40A 2GVGA 1LM1A 3HU7A 2DZVA 1RCXB 1GYNA 3UEQA 1TPEA 2YCLA 1XC4A 3EAUA 1XLAA 5HBFA 4M8UA 1OX6A 2Y5EA 4CEUC 5ECUA 1V5XA 4Y9PA 3VIFA 3RX2A 4DWSC 2YXXA 3MU7A 4RL3A 1XFCA 3FXYA 1OX4A 4B3LA 5LA2A 2IKIA 5A8MA 5AHFA 5G1MA 3AHTA 3BOFA 3NAVA 4GUHA 3TZNA 4IUOA 4US5A 3BQ6A 3PZVA 2I14A 1NWTA 1Q8AA 5AB3A 1GOXA 3EB3A 1EYEA 2VQTA 4DO5A 1EZ2A 3I6EA 3M7SA 3KLKA 5KZMA 1HVQA 1C93A 2VC6A 3ALFA 4GRSA 2QUVA 2ZADA 1R9YA 4ILSA 3WMLA 2NSXA 1ADDA 3CXOA 3H12A 1KKRA 4NP7A 5DT7A 4LEFA 3ARUA 4JTSA 2NQJA 4O12A 2EPOA 3JR2A 2A3AA 3N4AA 2INFA 3E6EA 3WF0A 5A8OA 1I0BA 2CEQA 3MW7A 2CNCA 4LS1A 1RY0A 5EFFA 4KS0A 4D8ZA 5DN1A 1HVXA 4QXIA 1ZP3A 3WL1A 3IRSA 1PTDA 5FCZA 1IXNA 4Q4RA 2C7FA 2VR5A 2Z27A 4LNCA 1R86A 2J9ZA 1UWSA 5DCEA 3QY7A 3NZPA 5AVHA 1QI3A 4G7EA 1CLVA 5EBUA 1LF1A 5CG7A 5B7ZA 3W1NA 1VRXA 5I7GA 4G2DA 2RGLA 4DQWA 5L6UA 3CJPA 5FJPA 5AYZA 4KW2A 4EVZA 3I10A 1TVLA 1KTCA 4Q8PA 4ZL1A 2CHOA 3V4BA 4GIAA 1UWUA 2PU0A 5JQ9A 2GJNA 4YVXA 4AY7A 1Q7MA 1L0PA 1OYCA 7XIMA 3EX6A 5REQA 1DJWA 5K7JA 3E0IA 2WMKA 3W7PA 3MV11 3SCTA 4NASA 1ONRA 1M41A 2AQVA 1XDMA 1KGUA 1B9ZA 4DAFA 5BCAA 2VL4A 2QDEA 3CUXA 4XAGA 1G4SA 2Q71A 4DUOA 4YU1A 1I9CB 8TIMA 5EL1A 1TPDA 2BVYA 3TAOA 3U0HA 2RUSA 5AZ0A 1HL2A 1BYAA 3VILA 4E4UA 2WBGA 1NIUA 1F7BA 4JYEA 1WQ5A 2IUZA 1U5JA 4XTIA 4GG9A 3N4EA 3AMKA 4ZSUA 3ITTA 3OLGA 1RQEA 4Q4KA 3NZRA 4PEEA 4C6JA 1FH9A 5D04C 5H91A 5I07A 4P7LA 1R30A 1WPCA 4ORIA 1RUSA 2I5GA 2BDQA 2NZLA 1YHTA 4JTHA 3L5AA 2C13A 3V35A 1VYRA 3LHVA 2YDRA 1XBVA 3CWOX 1UBSA 4KFPA 3QYQA 6REQB 1OYBA 3H4XA 2GWGA 1HJUA 4GJ1A 1R3SA 4QSHA 1UCWA 2BBFA 2PC4A 4M3PA 3RCNA 2V81A 1ZSXA 2FJKA 3VMOA 3T05A 1E4IA 2VZSA 3OGSA 4JQ4A 3UJFA 4N9EA 3WK1A 2VOTA 4D1IA 1JGIA 3CC1A 4GZEA 1Z3NA 2WC4A 2I1OA 1FWWA 4A3HA 5GJPA 3SCNA 2CHRA 4L4PA 4B3ZA 1GOQA 5G1TA 3T2OA 1DHKA 1UKOA 1BGAA 4XD6A 1NVMA 1IE7C 4OVXA 3LXCA 1NJJA 1UOZA 2DQWA 4DZHA 3GHRA 4WJEA 1RY8A 3EGJA 1R87A 3ITGA 2PBGA 2HMCA 4E2VA 4TX6A 3II1A 3OZOA 1J9YA 5CBBA 2CYGA 4AWEA 3URNA 3TTSA 4DXVA 4XAYA 2ALRA 3TNBA 1F5ZA 4WDXA 1XCXA 4JHMA 3EA3A 4NI8A 4CCCA 2WVUA 3AYVA 2QAFA 1V7YA 5HNUA 5K9CA 4FB7A 2WMGA 3VDCA 5D9PA 4ZB5A 1MUMA 5BU6A 4ROPA 3TC7A 4HVXA 4B92A 1IXQA 4AEFA 1TA3B 1WKYA 1FWDC 3TK7A 3RPTA 2HV5A 3WBWA 5E9AA 3PZQA 3LPOA 1GHRA 3CZLA 4AF0A 2OLSA 4HPNA 3UESA 4BQ3A 1YDYA 2WCSA 4X0VA 1WKFA 1XXXA 5H1WA 1OCBA 3ATZA 2REQA 1MXDA 2O55A 4ACYA 1WKDA 3R79A 3CIXA 3C8NA 1SZFA 3B4YA 4H2CA 7CGTA 3KEHA 1LWIA 4NYYA 2JEQA 2Y7DA 4B16A 2W91A 3MKVA 3WF1A 3O9NA 4NRSA 4AZCA 1PKLA 1PZ3A 1E6RA 4JIRA 1KWKA 3QW3A 5LZLA 4LPCA 2VOMA 4JIEA 5D03A 1MW0A 3AYTA 2PDXA 4NX5A 3S3GA 2HQAA 4AZ6A 1XC6A 1CWYA 5RUBA 3GM8A 2YZRA 4K8GA 1QPQA 3IUDA 1P6WA 3L23A 5CEWA 3P7YA 1W1IE 2E5BA 4Q3MA 1XLEA 4H3DA 4HTBA 3B8TA 3TUUA 2GLKA 4JL1A 1E1EA 4J3UA 1GVSA 4ERIA 1X6NA 3W25A 1NELA 1CB7B 2OYLA 1GEHA 3FJNA 1XLGA 4JAWA 1NP0A 3QRHA 4PTMA 2WAGA 3M0IA 3BWWA 3TOPA 3UZWA 1J0HA 1SJBA 3T42A 2WC7A 3NIYA 3A4AA 3GVVA 1I2NA 3QY8A 1Q6RA 3VCCA 1D7KA 1SSGA 2WHLA 1YXCA 1SFSA 4IJCA 5M1TA 4Q4MA 3FV9A 3LTSA 4ZQRA 4IG2B 2B7QA 5D8WA 5CAKA 1B9BA 4Q7IA 2Z2UA 3VKKA 2FFCA 3POCA 3G1RA 3RMEA 3TOYA 1YKWA 4AZHA 1X97A 1RJPA 2Y0FA 1TJ0A 1CXEA 3H53A 2EF9A 4TV6A 4IF2A 1XD1A 1UC5A 1DORA 3OYXA 2R8WA 3HPZA 5D32A 1O7AA 2W67A 4L6OA 3GQYA 4EF8A 3SB0A 3URQA 4FR1A 2GVJA 3W84A 3C3NA 2CLLA 2NXIA 5JXQA 3UD6A 3DGBA 1XCWA 4DJEA 4GKLA 1XGDA 2EKCA 1KBLA 2XWEA 4BY3A 2OQLA 3M47A 3SIZA 4DF2A 1UW9A 2D69A 3OZMA 2PDNA 4JTKA 6TAAA 1WB0A 3EKLA 3N2XA 3GDRA 4H83A 3R11A 2YBVA 1XCFA 2WKJA 1XYAA 3ZSTA 3UGVA 3QVQA 3T2PA 5ABFA 4ZENA 1ONEA 1UOKA 2QCDA 1GTHA 1KLYA 1G01A 4IZGA 1ZP4A 3EBVA 1L6GA 1GVRA 3VVGA 1W1TA 5EBAA 2GGGA 2E0PA 3XISA 4YXGA 2HEJA 2WK2A 1UUMA 2CIPA 1DL3A 4JKMA 2DZPA 1PZ0A 3PM6A 1KLZA 3NQFA 1KFKA 1QWKA 4PSPA 3WLLA 1TRDA 4DIAA 3LZ3A 3TU9A 1TV2A 4M7SA 4UFKA 4FPSA 5H6HA 3WLJA 5I06A 2CKRA 3PZOA 4PUUA 3NOYA 3EDFA 3NUKA 4WSJA 1G7VA 4B91A 4QTGA 4Q22A 4IH3A 4L1XA 3VO0A 2E40A 3N9KA 1UWAA 4DBWA 3REQB 5C5YA 2V5BA 3PB2A 3PTMA 4GKTA 2A85A 2J75A 2Z24A 1PIIA 2C14A 1V0MA 3W7KA 1L6WA 4PMNA 4LVBA 5I3JA 1S46A 3H55A 3D46A 4XBSA 3GSMA 2R6OA 1J8VA 4XG1A 5K4ZA 4OZOA 1IV8A 2G3NA 3UWUA 1S5WA 3EX2A 3GUWA 2A2IA 4KWSA 3AIWA 2ON3A 3WQPA 3UBPC 1IWBA 2J6XA 4ZO7A 2GUBA 2V30A 3WMBA 5DX7A 2CLKA 2FTYA 2ZZ2A 5CPMA 1O4UA 5HOSA 3W83A 1EJTC 1VBHA 3DESA 1UMLA 4JCLA 3MO7A 1R7AA 1GPWA 4B2DA 1EJVC 1MEIA 2E6AA 3UNTA 3F2DA 4OBRA 3H7UA 4C6LA 2WVSA 4XO7A 3CZEA 4WDUA 3CBWA 3E0VA 2OTDA 3RDKA 2W5FA 4LYQA 5CPTA 1S39A 4L56A 3S1UA 4J40A 3AIUA 4N02A 1K77A 4HMDA 3KZSA 1BWVA 3IV8A 2OZTA 4JQAA 3NPVA 4ZQOA 1CDGA 1VFTA 3TROA 5LIXX 1JZ4A 3L21A 5KEZA 2W4XA 1A5AA 4X0NA 3KHJA 3GXFA 2HROA 1NTHA 3P0XA 1XLBA 4IGMA 3WQDA 4W87A 1EXPA 1JYXA 2I56A 3LLXA 4UTJA 4Y9OA 3T8QA 3RILA 4IJRA 1GK8A 2HCVA 4E8CA 2AAMA 2WMFA 4OIFA 3NPWA 1UR9A 4K8HA 1Z7AA 3TYZA 1TUXA 4KFNA 1MWOA 1T8XA 3W00A 3GH5A 5D09A 2CZVA 3VCRA 2VFDA 4ZSTA 1W17A 3LMZA 1VD6A 3NYZA 4JY8A 4H9UA 4Z1BA 3W82A 1SU5A 4JNZA 3PTDA 3MQTA 2X30A 2GOUA 4LF1A 3WNKA 4Z0SA 4G5DA 1JD9A 2ACUA 3STCA 4S38A 1FQ0A 3TYCA 2VEKA 2VD8A 3CK5A 5HMEA 4WEVX 1LQ0A 1ZTVA 1UWTA 1UD6A 2YOCA 5G5IA 2ZUUA 2F84A 5IBXC 3TVAA 1EOKA 3BLDA 4MVAA 3I7QA 4DEFA 1EL3A 1F3XA 1OT2A 4UTTC 1UD3A 1AQHA 4YWSA 1W3IA 1R0MA 1ZGDA 3W1XA 1R3RA 5FA5A 1TQJA 2PTYA 4C90A 1VCVA 3L2MA 1Z89A 4IWWA 3BV7A 4BA0A 1VPYA 3R8HA 2HPIA 4JTUA 1Q6CA 3QQ0A 4PMQA 3EPNA 5LKYA 3BMVA 1VP5A 4XBJA 2H8XA 3UZZA 2RDWA 4J35A 1Q6QA 2D0FA 1W9XA 1IT8A 3RM9A 4O0ZA 3AIEA 3S2CA 4PL2A 5HWNA 5FD0A 3PSWA 3KDOA 3UXLA 4M1BA 1TWWA 4B4FA 1PX4A 3CASA 1M53A 1E70M 5D8ZA 4WK9A 1S38A 4H8VA 4DPQA 3O05A 2IQTA 3O6YX 3VIGA 2UY4A 4LUSA 3G22A 4Z1YA 1ZAJA 3WJZA 2VEIA 2VMFA 5G4WA 1W6TA 3IIVA 1TJPA 3AOFA 3ZLGA 4LS2A 4ADUA 1LCOA 3EXRA 1L8PA 4W85A 1EUNA 3SUVA 1O5KA 5DCBA 3GR4A 2X0YA 4AZGA 5FAGA 5CPQA 4OUIA 4REQA 2PA6A 3L4YA 3P61A 4Q8TA 5ECVA 1IXOA 3B06A 4WY0F 1YADA 3I3BA 1PV8A 5HWMA 1PL9A 1V03A 1XIDA 3HV8A 5CPOA 4JKKA 3WH8A 1A5MC 2HVMA 3UG8A 1GGOA 3QM3A 1VFSA 2DH3A 2XIJA 2QUNA 1PWLA 3IJQA 1XIIA 3ES8A 4AMAA 2XN0A 3P6LA 1XW8A 3BJFA 3NDZA 3STPA 1W1B1 1A3XA 1I4NA 4QS6A 1WDPA 2H3DA 4AEOA 1TE1A 5HINA 1BTCA 3SN4A 1GQNA 1UMYA 1W1PA 1RLCL 3QGVA 1FDYA 1RPXA 5C54A 4H8UA 5A6AA 4YVVA 4DYKA 2CLFA 1Y8BA 4EXBA 3OEXA 4DZIA 1G5AA 3UPWA 2DZWA 3BG9A 4EPKA 1UR2A 4AQLA 4EPEC 2QGYA 3ARSA 3L7RA 3ENLA 4K7VA 3RCYA 1E71M 2OSXA 3LEPA 4BS0A 1HP5A 1S1PA 1JZ2A 3HURA 1QI0A 1W1ZA 2FFIA 3AISA 1E9IA 3TXVA 3R2GA 3U5YA 2GK1B 1M5WA 2E6YA 3Q67A 3E0FA 4MB3A 3EMQA 1SVDA 2FVMA 2ZX7A 3OQ8A 4UQEA 1EA0A 1LP6A 3DGRA 3LD5A 4K3ZA 5I3GA 2WMJA 1JPIA 4XBKA 1H7XA 1XWYA 1K9EA 3EWYA 4M56A 5K3VA 3KVLA 1W0MA 3W76A 3B9OA 1C8VA 4O11A 3MCNA 2ISFA 4NX0A 3SFKA 3I6RA 2P10A 3GTIA 4LANA 2XYLA 5AZ1A 5LYRA 2HNHA 2AKMA 2E28A 5FOOA 2QUUA 3LV6A 1B2YA 2PTXA 3VYLA 2CLPA 4HOWA 3QFEA 1AL7A 4CQAA 3PZ9A 2P0IA 1CXKA 2W9MA 4NU7A 3T6CA 3LM7A 1IWPA 3ARVA 1I6NA 1HN1A 3B40A 3LDVA 4S3FA 4R7WA 4ZCWA 1EP3A 3UJSA 2FMNA 2OOFA 2XSAA 3HPSA 1E51A 2H9AB 3FK4A 2DP3A 1E0XA 4GIRA 2V3DA 2NUXA 4C7FA 1YMYA 1DJGA 2X8RA 3DIPA 4XKYB 2ZZ6A 4EK7A 1JUKA 4HOZA 2QEZA 2O7QA 1SJCA 1OABA 3T0AA 2D2HA 3ZR5A 3ABOA 1TV3A 3CPUA 3M44A 3V0TA 4KBXA 3ZIZA 1F61A 4ZO6A 4V15A 1GJPA 2XZ7A 3CZGA 4HGXA 5LNRA 4W5UA 3QZ6A 4YTSA 5MF5A 2D73A 4ZOEA 4JTFA 2QVNA 4HOXA 1K8CA 4MZ1A 4H9MA 3HA1A 4DJDC 4ZGYA 1PYMA 1F73A 4NZ5A 3QHMA 5DY3A 1PHWA 3ZVIA 4OE7A 1J6OA 1TPFA 2ZC8A 3HGOA 3MUXA 3WLKX 1B4KA 3FDKA 2QAPA 3WLMA 4N9BA 3NL2A 4GXMA 4TVUA 5BOOA 5I3HA 4DUXA 4IPPA 4GFIA 2W63A 2FDSA 3GYCA 1XHGA 1ZBKA 3UXDA 3CHFA 3R6IA 3FA4A 2WOQA 1XRTA 2GQAA 2DY3A 3CO8A 4D71A 3TQPA 4BKNA 4UZUA 2WJFA 2PMQA 3WEMA 4TXEA 1K1DA 3PFRA 5DCDA 1X1OA 2IKJA 1UIPA 3MVTA 5SWUA 2Q3RA 3RIKA 3UY8A 1Q7ZA 2DZTA 4ZBCA 3DFQA 4PR4A 1PO9A 4C1NB 1GJUA 3QV9A 2CZEA 1AD1A 1V0LA 4TUFA 2I17A 4WQ6A 1ZENA 3QLDA 3VIMA 3W7RA 3SI9A 2NVAA 2NXHA 4JXCA 3T09A 1OF6A 2HXTA 2ZZ7A 3PTQA 3CL6A 1R3TA 2C3ZA 2I57A 1UPMB 2VYOA 3SIMA 4C6CA 5HMDA 3PUGA 1W3TA 1KXTA 3PWGA 1SQ7A 4WKFA 4IX0A 4PULA 3G5EA 1FH7A 4O16A 3JU2A 3LLDA 3JUGA 2G4FA 1CGUA 1R9ZA 4LEQA 4LC8A 2WZMA 4W5ZA 4C7DA 4FXSA 1W2VA 2I9EA 2WV8A 4P8UA 1EJ7L 1KM2A 5T8GA 1P48A 3KBJA 4GYJA 1P5BA 3NNTA 2FYMA 4BJHA 4XD4A 5TNVA 4C6BA 1HXJA 1A53A 1NP2A 3SY8A 2GDQA 2PWUA 5DANA 4HD5A 4GQRA 2VTFA 1CW2A 2D0GA 4FOKA 2BHYA 1F4AA 1OGSA 3G3DA 1AZ1A 3WDPP 1EX5A 1S2UA 4E2OA 3GG8A 3MVIA 3AS2A 2XHYA 4GINA 2NUYA 5F4WA 1RD5A 5J04A 2ZKMX 1P1XA 3DOPA 1YDNA 4Q4QA 3C2YA 4HHHA 1VEMA 5AFDA 2WW5A 4FXJA 1F2JA 4RW5A 1CEOA 1LRQA 4Q32A 3CYVA 3TA6A 2J7HA 3PUDA 4MNLA 7REQA 4PMUA 4D6EA 3MHFA 3T7VA 5IDZA 3D47A 3KZPA 2OX1A 2ZUSA 3IV3A 3UPBA 2DSKA 2E68A 4Q8MA 1TPVA 3QN3A 3QMSA 1WBHA 2VFHA 1R2TA 1RQBA 4K7YA 3W26A 3B0VC 1S2TA 5D2XA 2EEXA 1B3XA 2D24A 2PCEA 2ATSA 4XKMA 3C52A 4AYSA 4BWLC 3MI2A 1E6NA 5FEPA 3QZEA 3MBFA 5CJMA 2EPKX 3UXIA 3STFA 3LS9A 3TP4A 1TWSA 1AFSA 2ZA1A 2ZRVA 4FOJA 2X7VA 2UV8G 1EHAA 3SGUA 4V28A 2HE5A 3NTYA 3GDKA 3PZIA 4GY0A 3VX1A 5CSRA 3VOFA 3EOSA 4NIRA 3RNDA 4ZODA 3BW4A 4KEVA 2IQDA 1JUEA 3I68A 2VWSA 1J0ZA 4EXQA 1W5QA 1UR8A 1HJVA 3FSTA 1AQ0A 2ZX6A 3GIPA 3ANYA 3G6MA 1TPUA 3GWQA 1UC4A 3P2VA 5FAJA 5HJYA 2J79A 3OGRA 4WDWA 4NT0A 2B7OA 5IHSA 4X9YA 4UCFA 1CBGA 2E6FA 4J9JA 4AW7A 4K1GA 2QCCA 2VFFA 1HJQA 4U10A 1ICSA 1DYSA 4A2RA 3HG5A 1XKJA 3MJYA 3L12A 3LLFA 5KZEA 4HN8A 1RBOB 1H1ZA 1JZ7A 4EOUA 5HXMA 2GSHA 1EDGA 1Z32X 4ADSA 5HQLA 3HMCA 1LL7A 3ALGA 4PUNA 1P6BA 1OIFA 3O8AA 1GOKA 3F5JA 2ZVRA 1JFHA 4GK8A 1P7TB 3C8FA 1NFGA 3ME3A 2FDMA 3S1WA 3OYZA 1VFLA 1E9YB 2Y89A 4A22A 4RPPA 1RSCA 3KFTA 3Q4DA 4O14A 1X8CA 3N3TA 4HZ6A 4FZIA 3B8WA 4JTAA 2XUCA 3ABQA 3ZMRA 3O07A 3W28A 1FHDA 4MNMA 4TU1A 4B3KA 3B0PA 3P81A 3CIWA 2TAAA 1JF6A 3ZLHA 2QKFA 1CLXA 1TG7A 3L4UA 4E38A 3IIOA 4PUMA 4TVDA 2BGSA 3MMTA 4FF5A 2G37A 5F4SA 4XK2A 1QNQA 1Z8AA 1B90A 2OJPA 3S47A 3U7BA 1ZBCA 1X6UA 4EACA 4HPGA 4KWWA 3E5PA 1UZ4A 1YX1A 8XIMA 4TV5A 1JYVA 2OLAA 3ZJ8A 4WX2A 1H1YA 2IKGA 3EOUA 5FESA 2P50A 1GHSA 1RQHA 1CT5A 4H1ZA 4IGSA 1C9WA 4FK9A 4FXRA 1FWSA 4O0KA 3EMZA 2VCAA 5J5RA 4LCSA 3BAXA 3O3RA 1H5YA 2BMBA 4Y2WA 5FEXA 4UTKA 1E6ZA 5K9XA 2HWGA 2VZOA 4Y9NA 3BGJA 1H09A 3M0JA 1LLWA 4LB3A 2J88A 3W7EA 2ZRZA 2OSWA 3OVPA 3DAQA 1GQLA 3K1GA 3U9IA 1OT1A 4M24A 1XBXA 3DBPA 4LBUA 5PTDA 3SQSA 1R2SA 2XSBA 4DUWA 3NQBA 4B90A 3BAJA 1KXQA 1PYFA 3FW6A 3W1AA 2HBXA 3AMLA 4H4IA 2YW3A 1J12A 4KIEA 3VNMA 4MM1A 1WZAA 4LF2A 5G2HA 2J9XA 2YCIX 4IL2A 3FA3A 3FEQA 5AYYA 4W4QA 1WAUA 4AZ7A 1E4NA 2PE4A 4WR3A 3SSJA 2QT3A 4QG9A 4O4WA 5DLCA 1ESWA 5CGTA 3EB2A 5CLTA 2J77A 2PZNA 3MJMA 4HA1A 1OF8A 1RZMA 3W1PA 2AOSA 5I77A 4DB7A 1TV7A 3TYUA 2FPTA 2XZ9A 4YYCA 2QJNA 3FS2A 4L9YA 2NQHA 4HIBA 3BO9A 1XM3A 5CQ1A 3RLUA 2PLCA 5C55A 4HU0A 3NEVA 1GZJA 1WDRA 1OEPA 3KCLA 2NUWA 3BCJA 3IUIA 3DEQA 4PUJA 4B2DD 2QDDA 1PZ1A 4XV0A 4MADA 3OZYA 1UB3A 3GNPA 4IMGA 2GUYA 4Z42C 2AMXA 2ZCGA 4LU0A 1W1VA 4O54A 5EFDA 1R7OA 1AD4A 1TE6A 2VUNA 3A4JA 3P84A 2E77A 1ZBVA 3AI0A 2R14A 2YA2A 1XX1A 4DJDA 2V2CA 4AD3A 3SRHA 3SSZA 1TMQA 2E9LA 1O1HA 2GSJA 3BGGA 2X0HA 3VDGA 1EJRC 5A2BA 3PZMA 2HISA 4CQBA 1R5YA 4KT2A 1YDVA 4RZBA 1IEIA 2DQXA 3DFSA 1PBGA 5AHIA 2FQIA 1RCOB 4CQDA 4BQ2A 1F9CA 3Q37A 4GACA 1FDZA 4FIQA 1ENUA 5D38A 3H26A 3ZJ6A 2Y5SA 3G1AA 3RJYA 1GVOA 1TJRA 1ITCA 4XTDA 2RJGA 3CAQA 3PANA 1AH4A 2XM1A 3WNPA 3BSHA 3HF3A 1SZRA 2HRWA 4US6A 1IXPA 3S4TA 4JTLA 4UTUA 1WOBA 4AHQA 3GDLA 4AC1X 5FJJA 4I9AA 1M1BA 3MUZ1 3CEUA 2OZ0A 2D1ZA 3UWZA 5A2CA 2QCLA 3HQ1A 2BODX 3GLCA 2QYGA 3WD1A 4FLOA 4KERA 3SCOA 2VVNA 4DBDA 4NILA 2OZ8A 3I7RA 4K8EA 3TC6A 3F03K 1WKEA 4AWTA 1VIZA 3N2MA 3VGHA 2CLHA 4LAOA 3VZZA 1KTBA 3ZT6A 4UXDA 3BZGA 3ARXA 4IMFA 3RN6A 4K68A 3GB6A 2YL5A 3NWRA 5HPOA 1WZKA 1CGTA 1L2UA 4C6EA 1UKTA 2X16A 4H9ZA 4ZQNA 2TRSA 4WHBA 3ABRA 4JFWA 3A24A 4P5UA 4YWIA 4A3RA 1EX1A 3N34A 1H63A 3GHSA 1Z42A 3VGDA 1CXIA 1KM4A 4TIMA 5KSWA 3AO0A 1XH1A 3IACA 3ZQ9A 1PZ2A 3M0HA 4J2MA 4MUPA 3A22A 3IPWA 4ES4A 4G1NA 3CLMA 4YS1A 4DZAA 4DNHA 5D2TA 2HVOA 3LX9A 4WCJA 2PDLA 4PMJA 3CUJA 3ONBA 1NU5A 2GOKA 3S46A 3P80A 1HFBA 1OADA 4M19A 2YZ5A 2XIMA 3AMDA 3BUVA 5IHRA 2O7SA 3IAPA 3VOIA 1KV8A 2J66A 5A2AA 1DWAM 3O0FA 1RVGA 3BH4A 3K4AA 4KESA 1SZNA 5EMJA 1ICPA 1EDTA 3ZO9A 1A80A 1UBPC 2V5KA 4MLJA 3MCMA 1LUCA 2OX4A 4PE8A 1CNVA 4KFOA 1KM1A 3FGCB 2GUUA 3DN5A 3TV8A 2CKSA 3S6DA 2A7PA 1GOOA 3ARRA 3PBGA 4Q8QA 3W6MA 2UY3A 1MW1A 3PPGA 1I45A 4P7RA 4I7WA 2GQ9A 3NQCA 2IW0A 4Q8OA 1ECEA 3QV8A 4N4PA 4GCAA 2Y85A 4JTCA 3DKJA 1U83A 3NYDA 5BWAA 4IOTA 2A3HA 4U5KA 2XH7A 1UP0A 1TV5A 1EYWA 2F9RA 4O10A 4DJED 3AS0A 3KXQA 1DQUA 3LB0A 3LY0A 1JL8A 2HZGA 2ISSA 2V38A 2BWGA 4PCTA 1TX2A 1H7PA 1TWZA 5CSSA 1NH6A 1ZL1A 3V5OA 2CCRA 4H9XA 4JTJA 1B5TA 3ITLA 2DT0A 4H6EA 4Z1DA 1XLMA 2FIQA 4TMBA 2FGZA 3NVDA 4J7RA 2V2DA 1VHNA 5AYXA 4BHYA 3AUOA 3C56A 3VAVA 1QVBA 3MY9A 5HWJA 2Q09A 3O06A 4GQQA 4ASTA 4FNUA 2EG6A 3CPGA 3D0CA 3B03A 4O4VA 3VD3A 1NWUA 3GXTA 3SN0A 3F2CA 3G1DA 1OM0A 2EPLX 4C65A 1W3KA 3GVRA 2YX0A 4MIMA 1ZZMA 3R12A 3GTHA 2A3BA 1Q6FA 2A3EA 4E6MA 2ONEA 1HKKA 4A8RA 3ABZA 5I0DA 2FLIA 3WJSA 5L9FA 4H7ZA 4UNLA 2PD5A 4Y6GA 5A8QA 4LVAA 2B4GA 2REQB 3CT7A 5CPNA 3LNMA 2EGZA 3BCFA 4XVDA 4JHZA 2FZBA 1ZJHA 3W07A 2XGZA 2B31A 2J24A 7TIMA 3ECQA 9XIMA 1LZOA 3SURA 2XTKA 1EIBA 3OIXA 3LRMA 2VR2A 4L61A 2R1MA 3DX5A 4N9DA 3MUIA 3AIRA 1VJIA 4NY2A 3ZXWA 1OQFA 4UTWC 5IM51 3FAXA 3GH7A 1BYCA 1DE6A 2CLOA 3UG3A 1QOPA 4TOQA 1K7FA 3WG6A 1E6QM 3VFLA 4Y8EA 2XVPA 3GXMA 5JMUA 5HQEA 3MSGA 1MNZA 4NHVA 1W9PA 3M41A 1JZ8A 1C8QA 3L4XA 5EU9A 3HV9A 3R7MA 1TUFA 2ISDA 2QCFA 2BY3A 4FLSA 1AL8A 4HYRA 2P88A 1LTDA 4IQLA 1NOWA 4MKSA 1EC8A 1WAWA 3OW1A 4MWAA 1XR2A 1MUCA 3KCOA 3ARTA 3NXLA 3S9IA 1W3HA 1SUXA 1BVWA 1FFQA 4HMEA 3W2LA 1Y5XA 4L5ZA 1JPHA 4XSLA 1G7UA 4RV3A 2J8FA 1J4EA 4YCPA 4AC7C 4FEZA 4D2JA 4AZBA 4MJZA 2FVLA 2NQ5A 4H8NA 2OMAA 2OODA 3GC5A 2GDVA 1A5NC 3B0UX 2FPYA 4GCXA 4DPPA 4S3DA 5HR7A 1EPXA 3UJEA 3ZYZA 3QXBA 2EO7A 1FCVA 1RA5A 4NUWA 3BAIA 3FXGA 4MSSA 4XZNX 2EXOA 4JFUA 3BQ5A 3KOWA 3VDBA 7ENLA 1KRBC 4N6FA 1ME7A 3VIJA 3ZWSA 3SQMA 2J27A 1XUZA 1CZ1A 4Y90A 5DO8A 4KIRA 5EMMA 3EYPA 3UWVA 1ZB5A 3P8JA 3EOOA 5FIPA 4I7VA 3NSMA 3LCWA 4DJFD 1I2OA 4GI8A 1J2WA 3TQ0A 1V6VA 4AVNA 3TN3A 3E0WA 3ID7A 4ML4A 3H2OA 3UZXA 1JPMA 4ZFMA 6A3HA 1EBGA 1OD0A 3NSXA 4RX0A 4GVHA 1QATA 4Q4SA 3CTLA 3LXAA 5C9UA 4KEMA 4PMVA 2BASA 1HG3A 3GY1A 4AEEA 1ADOA 4Q8UA 1XIEA 1YTDA 1IYXA 2X41A 1JJKA 3WK3A 3W29A 2GL5A 1EBHA 4IFKA 1XGZA 3TYDA 3SCQA 4GISA 1V8EA 1PIFA 3DUGA 1Q6EA 2UY5A 4ONVA 3BLLA 1S3TC 3W7JA 3OOQA 5A6BA 1DIDA 1PDZA 3VPLA 1IIHA 3IGXA 2XPKA 1GQKA 1IT7A 4AF0B 4HK7A 3PUEA 4FLRA 2RDTA 1FUYA 1CB2A 3VUPA 2VURA 1TYGA 2ZICA 4NVTA 3USZA 1Q13A 3HPFA 3POHA 1JVNA 1IZJA 1RCQA 3IJIA 1QJWA 1F8MA 2EJ1A 1MZRA 4QFUA 4CNUA 2FZ9A 3HZ3A 3SUTA 3WQFA 2GWNA 3B05A 4CNSA 2CITA 3OBEA 1A50A 3FLUA 4H9VA 1JNEA 1MXGA 2MNRA 1RH9A 4UC5A 1TTIA 3ZSSA 3RU8X 1G9HA 4IGNA 4C91A 1BRLB 2DZSA 4W8BA 4H8HA 5HAOA 5HMFA 3CZKA 2Z1VA 3OB8A 5C2XA 2PRLA 1KFLA 1X1NA 1ME8A 1A0DA 2QF8A 1BG4A 2FB3A 7TAAA 3WX7A 4HJWA 2J8GA 2VEGA 3GVWA 1GZGA 3B8DA 3EX3A 1E73M 5A6MA 3CUHA 1XDJA 2XWDA 1Q6GA 5BRPA 4IPNB 2QW5A 4U3AA 2I16A 5CAHA 5J5DA 3TW9A 5CZJA 2EG7A 5DF0A 1YPFA 5AN7A 4GZJA 3KOXA 3O7UA 2XVLA 3E2QA 3WMCA 1K8ZA 1XLCA 5C0QA 1QW8A 4GH1A 5HUPA 5LNSA 3EWCA 1UPPA 1Q4NX 1RBAA 2BHZA 4RNIA 2XG9A 3WBAA 4BF7A 4BK9A 4F40A 1C29A 4M6QA 4XD3A 3M07A 1HO1A 1VCFA 4Q7BA 4AVOA 4I3GA 1JIBA 3GU2A 2BX7A 2UY2A 3ITCA 3A21A 2CBIA 2J7BA 2R1LA 4JS3A 2QJHA 4CN4A 4ERAA 3IJLA 3VOHA 4M5PA 4ENLA 4HYWA 3AHXA 1SFLA 4WVXA 1O66A 1XDLA 4EIVA 3CEPA 5TQLA 8A3HA 4PGLA 1B30A 1ZCCA 2C1HA 2JALA 1Q85A 1ME9A 2HK0A 5D2VA 2E9BA 2C16A 4BZYA 3DI1A 4Q7NA 1UUQA 2ZIDA 1SO3A 3QV6A 4R27A 1WXJA 1P0EA 4KGJA 1OCJA 3TIMA 4L1GA 3QR1A 1X7IA 2VRJA 2W6RA 1OB0A 4UTLA 4ATLA 3RRAA 4PUKA 1BPLB 3T0DA 1QAPA 1QOXA 1B31A 3QR0A 4TO8A 3SY1A 4L4OA 3NZ1A 4L4LA 3UPMA 1E4MM 5AC7A 3S5OA 3FVMA 4CD5A 1OVDA 3W7NA 3BSGA 4NJIA 3O0KA 4UMCA 2ZX5A 4AXKA 5DT5A 4N9CA 1G4PA 1GEQA 3HGJA 1CIUA 4YIWA 1K6WA 3L5MA 4UFJA 3WJWA 4KCWA 3Q2DA 2Q3OA 5K2ZA 3SW6A 3FYOA 4S3GA 5EY5A 1OIMA 1FHUA 2VENA 4HSNA 1MEHA 3BJTA 4C6DA 1Z48A 1T41A 2ZZ3A 1POJA 3TX9A 3JRKA 4J27A 3UJ2A 5EMKA 2A7NA 3NGJA 1F3TA 3HB9A 3A5FA 4ERGA 1REQB 3EWWA 2C79A 3W2UA 2AL1A 3S9ZA 1IIGA 1ONXA 4JIPA 2Y7EA 2X09A 5FSDC 3QMRA 4H41A 3RX3A 5C9ZA 1CI1A 4HHMA 3LHUA 3QKEA 2GQ8A 4UQ9A 3W1UA 3PPCA 3AWOA 3GFYA 4WRHA 1W5OA 3GRIA 3KX6A 1JCLA 4DLMA 5BZAA 4OU1A 2YL8A 3A5VA 5A3HA 1VKFA 2BVWA 1OCNA 3WJYA 5FF2A 2WSPA 4RNHA 2ZE3A 4GLEA 1VZWA 3W2JA 3VFCA 3EB4A 1POKA 2EKGA 4OT7A 3T0TA 4NZCA 3TW6A 4AWSA 2PLMA 1JZ5A 2Q8XA 3A3HA 1GOWA 1BAGA 1SJAA 2X42A 3VNKA 4JD4A 4TX8A 1XLFA 1O5QA 2B81A 3BE7A 1CGVA 3DECA 2WCGA 1V6UA 4AAJA 1R47A 3KRUA 2YPIA 4O1AA 4FAMA 3CLWA 3INPA 2YCEA 2C18A 3KVJA 1OZQA 2XM2A 4GVGA 3LOTA 2DV0A 4DWSA 3UFYA 3K4DA 2WM1A 3FHQA 1RAKA 3LUTA 3NO1A 4IQEA 3PULA 1EA9C 1XIBA 5AHEA 2HSAA 1GQJA 2D22A 3R0UA 1YBQA 1F8IA 2YCLB 4FX8A 1P4CA 1QUMA 2V82A 1B3VA 4XZBA 1XYFA 3AZSA 4RDYA 3UY7A 1UWIA 3P5YA 3NO5A 3MCOA 1NQ6A 2YDAA 3KHDA 2V67A 1QK0A 5JIPA 3BSMA 3QC0A 4K2SA 3FCPA 3KOYA 1EP2A 4R88A 1B4EA 2WNNA 3R43A 3S2JA 1VFMA 3WUEA 3TSDA 4F0HA 1KO0A 2YDSA 5GQBA 1VRDA 4HA4A 1OK6A 4KKXA 3U6WA 1S5MA 3D3AA 3BICA 1PE1A 4UQBA 3EX4A 4H6RA 3KL3A 1QPRA 4BI6A 3R94A 2YA1A 3IJDA 3APYA 4F2TA 3XIMA 4UMAA 3TJXA 3AFBA 1K7EA 1XBZA 3QHNA 3BARA 4MY9A 2GJLA 4L6HA 3PZTA 4I5RA 1HGYA 4BFAA 1CX9A 3VGBA 1WP6A 1WA3A 3T0BA 3AS1A 1UR1A 2VC5A 2AL2B 5CC7A 2JE8A 1VH7A 1YEYA 2WMIB 3HM7A 3VIHA 5EKYA 2NSOA 1W9VA 3O1NA 1XRSA 2NVDA 2R91A 5A6TC 1ITXA 3UWYA 4IPJA 4BR1A 5TF0A 3HQNA 1A47A 1DIKA 2QCHA 1US2A 4ALDA 5FJRA 3C2EA 1B54A 2V3GA 1OGGA 5IFPA 1C8XA 1TVPA 4KEUA 1QBAA 4DM2A 1LYXA 1VFHA 3M64A 1LOQA 5ENLA 3LV5A 1T8QA 5LA1A 5I24A 4PH6A 3W86A 1AH3A 4D6IA 6XIMA 1BHGA 2W92A 2Y62A 3IS4A 4KQNA 1DJYA 4RNJA 2P5NA 4MG4A 3EWDA 1KNWA 2G3JA 1XLLA 2DIJA 2ZXDA 4RZ6A 6ENLA 3QV7A 3OVGA 1H11A 3CO4A 2OR2A 4S2BA 4IPIA 1IF2A 3B8VA 2BVTA 3GFXA 4GQBA 5I2UA 4DM1A 4R7JA 4LGXA 3DU0A 4KPLA 2NLYA 2J62A 4PC8A 3W85A 1OD8A 1LL4A 4AIBA 3MV01 4D6CA 1V3HA 4UZSA 1PXGA 1MUWA 4PFMA 3HG2A 4LOCA 2OEJA 5C7HA 1NAL1 2O9TA 2C6QA 4ORMA 1PCKA 1W3LA 4A8IA 1U33A 2Z2BA 4LB4A 3IJ6A 5LIKX 1WO2A 3SGZA 3GNOA 2DPEA 4QLLA 3W23A 4XIAA 3VNIA 3PK7A 2VQUA 3CIVA 4MZYA 4AD0A 2VXNA 3FJLA 3DYOA 3IK2A 3G8RA 1JDEA 2C15A 3C2VA 3Q58A 1H7NA 4CNPA 4LAUA 4D72A 5K9DA 3AUJA 3VM7A 2PU1A 2ZUNA 3VIPA 3U3HA 1H50A 2PF0A 2RKXA 4PRRA 3W2KA 3GG0A 4WLCA 1QPNA 3WD0A 3WYZA 4P7NA 3EWUA 1QW9A 4Q6JA 4M80A 2YW4A 3CTTA 1Q5MA 5LGXA 2QJJA 3AMCA 4UCGA 1H49A 3VM5A 2D3NA 2ESCA 1PUDA 3WQOA 2VKZG 1LWHA 1IEQA 3FYPA 4C5YA 5ABEA 4JIHA 4NQ1A 4HMCA 1NDWA 1LRNA 5FL0A 4ZE4A 1RLDA 4M81A 5B80A 4XD5A 2QDHA 4QE1A 1HL8A 2VGFA 4B5UA 3RXZA 1KW1A 2NQZA 1E0TA 4NZJA 3CZ8A 3H2EA 3N6JA 4GBUA 3ZVHA 3PC0A 3N17A 3R13A 1J0JA 4O18A 3N25A 4DWDA 1QHZA 3KTXA 1ISWA 3CV7A 2PC8A 4UOJA 3OLIA 3ZR6A 3QF0A 1NQKA 1HKIA 4FNSA 4B5SA 3K5XA 4LXFA 5JUVA 1TZ9A 1AMKA 3IAQA 4HNTA 3EPOA 3KBWA 3W01A 4PMZA 3CV1A 3PR2A 4X22A 5C9RA 4NZ1A 3CUZA 1JCNA 3GDMA 4M6PA 4NF7A 2NQLA 4M51A 3WEZA 1HX0A 3BZJA 1S3HA 1ITQA 4HNNA 1W54A 4IMAA 5DBTA 3Q45A 1DBTA 3NCOA 1VLIA 1PSCA 4P8WA 3ARYA 3SJNA 2Z00A 2JIEA 5E6ZA 1JRBA 3VNLA 5E0KA 4G7FA 3BAKA 2HJPA 2TPSA 4O1DA 3L4VA 3VMNA 3SCPA 4QLJA 1E1FA 3B97A 4B9YA 4NZFA 1LG2A 2A6NA 4LUSB 3EPMA 1OFRA 4UOZA 3MP3A 3WQEA 3M6DA 1TCDA 3CNYA 2YYUA 3GTXA 1SZGA 3F1QA 3ZT7A 2YL9A 5EMYA 2AKZA 2V5DA 3NQAA 1HUVA 2D0HA 1BG9A 4AG0A 2ZUVA 4R33A 4JTTA 1SPQA 4GNKB 3QQWA 2XVGA 6REQA 2ISVA 1VR6A 2JQXA 3DHPA 3U2EA 1TQXA 4QG6A 2P8BA 1VYSX 4ZB2A 4HZ8A 4HBKA 3FOKA 2INZA 2VC7A 4ZB0A 2BZNA 5IRPA 3APTA 2BB0A 2HBVA 4DWSD 1S1RA 2V3EA 4CVUA 3CQHA 5LNUA 1MDRA 1T6MA 3U5UA 4V33A 1O60A 4F48A 3MP5A 4JZ5A 3FA5A 3HMJG 1FCQA 1QK2A 1SZEA 4C6KA 1H1NA 3WLQA 2VRKA 3CGTA 3RMJA 1TWDA 4MNJA 3ANVA 1F3EA 4IICA 2F6XA 1E1CB 2O4QA 1A5LC 2IPJA 1V51A 2POZA 1US3A 3WD4A 1Q63A 3SAZA 2QVHA 3VKJA 1AJZA 2GJXB 2QS8A 4H2HA 2WQDA 2GGIA 1KQYA 2Y2WA 4FNPA 2XU2A 1K3UA 1RP8A 1V3KA 4MUZA 4E8DA 4XWUA 3B8SA 1V02E 3FY1A 1XS2A 4JEJA 5JH1A 4FMVA 3VU2A 2ATMA 2PFHA 1YRRA 2GVYA 2CBJA 2Q02A 3OZPA 3TN5A 5DRIA 3TTYA 3UR5A 4FXFA 3HPAA 3WBXA 1JI1A 3L65A 4HYVA 3TSBA 2PRHA 3P0WA 4NXKA 2VZTA 4HJFA 1KCKA 4E3VA 1PHQA 4QQUA 2YYTA 3OTRA 3EKZA 3WBYA 2AQWA 2DSVA 3Q94A 2QZRA 1GVYA 3FIGA 1F05A 1PKNA 4TR9A 1M9HA 3UQNA 1OX4B 3VOJA 1DV7A 4QR6A 2QJMA 4CNOA 1FX6A 3WMSA 3I4KA 4XUGA 1SM9A 1L6FA 2HXUA 1AQFA 2CBUA 2O92A 1ECQA 4O19A 4GA8A 1TZ7A 4A4AA 2JEPA 3M9YA 5IDIA 3H4WA 3KTSA 3SDOA 3L4WA 4S1FA 3ORWA 3S5SA 3MO4A 4CN1A 4W8AA 3TN4A 5AHMA 4KH2A 4GGBA 3LSBA 2UZ9A 3MI6A 3KLLA 1K4GA 4K36A 4PCSA 4UOQA 3QJAA 3PHAA 2H8ZA 1SW0A 4GX8A 1VBUA 1RBLA 1XINA 4GBDA 4EWND 1T5AA 1BWKA 1HKJA 2V5CA 3OJGA 3OA3A 3SECA 1EZWA 2VGGA 5DMMA 1A0CA 4RE0A 4W84A 1XYCA 3EDJA 1DJXA 3MZNA 4Y9AA 5A6SA 2XH4A 3UVAA 3CB8A 2Y6ZA 3EEZA 4DNMA 3CHEA 1U1UA 2VEPA 4PUWA 3DYMA 1JG9A 3S83A 5LNWA 5C9XA 3VABA 1FVPA 1QRQA 7PTDA 1QPKA 4QX4A 3TTQA 1BWLA 1NEYA 2OO0A 2VD9A 1ZY9A 1GQIA 5ABGA 1AW5A 4AZ5A 2DJXA 4RK8A 1GKRA 1U1HA 1KKOA 3GR8A 3BCDA 1EO5A 1XLKA 3WLSA 3KP1A 1Q45A 6ALDA 1N55A 1AW2A 2ABBA 4H6KA 4UTMA 4GPNA 3NO3A 3KL5A 4H9YA 2FHBA 4HNOA 4O17A 3QTGA 3K1DA 2WZHA 2PGWA 3W7CA 3E38A 2IS7A 4L80A 4F3HA 2Z6IA 4R34A 5ABTA 2MANA 3H8AA 4RR4A 4BEUA 2I5IA 3MSDA 3H22A 1YPXA 1R38A 3W1RA 1PKYA 5TAOA 5XIAA 5HQMA 4JDYA 4RE3A 2ZRUA 7ODCA 4Y96A 4UTHA 4F66A 2G97A 5IXEA 4I7UA 1UZHA 3N2CA 3S1VA 2CWNA 1VS1A 1YBQB 1GUVA 3G1SA 3IK4A 2E7FA 4ZZ9A 3EWXA 1S5VA 3DG7A 4C1NA 3W7HA 6CGTA 1OHLA 2WJZA 4Z2KA 3KM8A 2OT1A 4B4HA 5A6BD 3MKKA 4KMQA 4WGXA 1DP0A 5HMSA 3UZJA 5BNKA 3HFYA 5CSUA 3GVGA 1O6IA 5XIMA 1TR1A 5BYWA 1PPIA 3DXIA 1JF5A 3V75A 1XLIA 4MGGA 4F4RA 1IEXA 3LQGA 1KGWA 4J3ZA 3AYRA 3TYBA 3YPIA 2H9AA 3R5EA 4M29A 4MYAA 4NNCA 2CXGA 1LORA 3LM3A 4LVFA 2QHAA 4DY1A 4RDZA 3FX4A 1J10A 1UA3A 4LW7A 3ELFA 1JFXA 3HIJA 1BF2A 1SR9A 4C5ZA 5M3WA 2BNJA 1JAKA 1GZ1A 3WSUA 4F0KA 2OGYA 3G1XA 1K9FA 4R7OA 5I78A 4LX4A 5LHFA 3OIHA 5A69A 4UQDA 4FX6M 3HQOA 4HZ7A 2PTDA 1R46A 3WH9A 5BWFA 2Y61A 3SCSA 3TTOA 1D3CA 4WXZA 4ZFCA 3CMFA 4M6UA 1KFCA 3KRSA 3GU9A 3VOGA 2C0AA 3GAYA 3L68A 3NM1A 3KS5A 4E3TA 2DT1A 4XKYA 5C2CA 4DWSB 3BAYA 5AC4A 1R9XA 3PTKA 3NQVA 3O6CA 3M0KA 1Q66A 1W37A 3C2RA 4PTWA 4ROQA 3GDTA 2P0OA 3OBAA 2VFIA 2RGMA 1L6YA 1UKPA 3IJ7A 2CLIA 4GMEA 4W7WA 2PDIA 2VWTA 4CKQA 3GBDA 4KWUA 1H62A 2QPSA 2VT0A 1UZ1A 4O8AA 2WKGA 4GHRA 9CGTA 1SSDA 4OKDA 1Q2SA 1UH4A 2HS8A 3SBFA 3P5ZA 3B0XA 4UFHA 3FNDA 2WPGA 1TB3A 3FVDA 4JTIA 3PB0A 4S3BA 1MDLA 3DG6A 3SFWA 3W6LA 2Z28A 3DHDA 5HUOA 3RF9A 1OK4A 2C71A 5CH9A 5GVJA 3F5KA 1V0KA 5LGZA 4P61A 4CU6A 3CS2A 3AJXA 3O63A 2PDHA 1EJSC 3PWIA 1OFPA 3TQVA 3KDNA 1FKWA 5E1QA 1ALDA 1QMLA 3L2IA 3KBVA 2WWDA 4DBUA 1ZS2A 5E09A 3WL0A 3SEPA 4GC3A 4XZIA 4QDWA 1TRIA 1V77A 3V7PA 3W1QA 1E0UA 3VNYA 1WUEA 2OYMA 3DI0A 1FXPA 1GKQA 2HVNA 2YCJA 1PKMA 1VEOA 4CLMA 2DJLA 3PBVA 1QXLA 1O68A 4QISA 3M0MA 3P67A 3M46A 2AL2A 4KRUA 4NAFB 4H01A 4H04A 5C6MA 3LXBA 4IT1A 1TO3A 4DHGA 1DJIA 3AHZA 3WELA 1GVQA 2OB3A 1XI3A 2BS9A 1DEDA 1ONWA 1J5SA 2P8CA 2OEKA 4J3WA 4DBSA 2IPWA 4KRTA 1EIXA 4MFDA 2RDXA 1JULA 3MWCA 1N8WA 1IZCA 2IPGA 4MPQA 4U28A 4U2ZA 1EWDA 2EQDA 1UD8A 4GIYA 1TCMA 1U30A 2DVTA 2HNEA 2PWGA 2ZWYA 4GZ7A 3BPWA 3APGA 5M17A 1PVNA 3MSRA 4ZEPA 1TKKA 1OBAA 5FEWA 4NYUA 3LCFA 1OGBA 1GKPA 1DIEA 2VX6A 2A3CA 2WKLA 4WZHA 1WV2A 5CZKA 1JNDA 1V02A 4BEQA 3CL7A 1HJWA 2GYIA 1LWJA 1R6WA 1KFBA 4XZMX 2PF8A 1KRAC 3UCDA 1FDJA 1TPB1 4UNIA 2LLEA 4CQ9A 1JCJA 4BF9A 3MUY1 1BKHA 3N4FA 4AMCA 4O15A 2ZC1A 5I02A 4MTVA 1TJ1A 3WFLA 2Z29A 3WFZA 1PDYA 4K39A 1O94A 4ICCX 1KV5A 4QROA 2NW0A 1S2AA 5E0CA 2J7CA 4CU8A 4FA3A 1V4YA 3PBUA 3DDMA 2XFWA 4URIA 4LV4A 3CZJA 1J2BA 5I23A 1XPGA 2BOGX 1SW7A 3BG5A 3W7QA 2J8TA 4HP5A 5FEZA 1TV4A 2QCGA 5U4NA 1UR4A 1A5CA 4ATWA 4GYPC 2WQPA 3HOJA 3L4TA 1AJ2A 3W3OA 1KCXA 2VELA 1KXHA 2VFEA 4AIEA 1NOFA 3HG3A 4NJHA 4P7OA 1TTQA 3W7MA 4GY7A 2OQHA 2PAJA 3MSYA 3WY1A 1EEXA 3RGTA 4V1YA 4ZA0A 4IMDA 1VJZA 2DZXA 1P0DA 1C7SA 3THQA 2ADAA 3KVMA 2FGBA 3GHUA 1CXLA 3QC3A 4IQDA 4JNMA 3OVRA 3TW7A 1GTEA 4MOZA 2OPJA 2Y5JA 4RZ4A 3V5CA 3N11A 3SUWA 1FA2A 1TMLA 4AU0A 3ZM8A 1MEWA 3TR2A 4QGCA 4GJJA 2XJ7A 4WXYA 2Z1SA 1NARA 1RP9A 4S3AA 3DYPA 4ZOAA 1ZFJA 2KZHA 2OLHA 2VCBA 4LTSA 2GJXA 4MF4A 1M7XA 4KETA 5BMXA 2ZTJA 4HPJA 2BTMA 3U57A 1TTJA 3A12A 3UVIA 3N12A 4CVWA 1RHCA 2VRQA 5AKQA 1BEUA 3LA4A 4Q33A 4PYSA 1OYAA 3P82A 1DOSA 1LRTA 3A4XA 3WO8A 5TIMA 1WDWA 2XFFA 5BU9A 1F6PA 2PB1A 4NSBA 1YTEA 1WZLA 2YBUA 3V18A 1QU4A 2OWXA 1UJQA 4K6AA 1QWGA 4EXAA 2F2KA 3NQ2A 3GTNA 3M5VA 4KGLA 3RCMA 1FH8A 2GDUA 3GBEA 4DAIA 3WDRA 1E5NA 4AD4A 3IGHX 3S9YA 5LXEA 3LI1A 3PS7A 4R9XA 2WLZA 3FFSA 2OWCA 4NXSA 3VNJA 5EYWA 3EDDA 5DRCA 4LY8A 3VTRA 4NL1A 3T1GA 1DHPA 1DWHM 3QGAC 2V5LA 2A5HA 4B5TA 2P53A 3F4CA 4E4PA 2VHLA 5GPRA 2JBMA 1EGZA 5HNRA 4WDTA 1CXHA 4KWOA 3SO7A 1V3JA 1OZMA 2QGHA 1E55A 3BMWA 4MPKA 5C8BB 1KBIA 3KRZA 5G2IA 2DZBA 3GR7A 3N6HA 3NG3A 3PJUA 3G24A 4QJ5B 4L4MA 1JDAA 1CTNA 1EC7A 4ZR8A 1EKOA 4DO7A 3W7LA 3ZLFA 4G8TA 2CLMA 1M03A 1HZYA 2QULA 3GAKA 3HN3A 4I5XA 4CNNA 3PBMA 3BANA 4RE4A 2BHUA 2W27A 4DF0A 1V0NA 3WUBA 1ISVA 1UYQA 3PNZA 4NZ3A 2X1TA 4XB3A 3E3HA 2WJEA 2F61A 4U5IA 3QPYA 3LRLA 4C6IA 1NWSA 5U7SA 1BVNP 2YDQA 1EQPA 2UWFA 4AB4A 1QNPA 4K1WA 4V1XA 4RCXA 3T07A 1BLIA 3ZT5A 4MY8A 3WLIA 3LGEA 4A3YA 4ZE5A 2E5CA 1FWRA 4HA3A 1Q3NA 4YVPA 4QIUA 3CHDA 1DJHA 2PP1A 2VR4A 2WVVA 3U2CA 4IG2A 4O1EA 3MWAA 3LCXA 1FP8A 3EXSA 2XIIA 3K30A 2GGHA 3RFAA 1TSIA 4RDVA 1YYAA 1VIWA 2XDFA 4EKJA 4PBEA 4K38A 4S3CA 4UB9A 5CJ5A 2QCDB 2X2GA 2RFGA 2PDUA 4WOQA 4O8RA 2HDJA 2F6KA 2WSRA 5I3DA 2C19A 1QNOA 1S2VA 5HJLA 4DI9A 4X2PA 2OSYA 3W88A 5FI8A 2XIOA 4MWAC 2NV9A 2Z7GA 4GUJA 4CD8A 5CBJA 3LCHA 3M0VA 4QHRA 1JCTA 3EA1A 4Q4PA 5BXPA 4IX2A 2ODOA 4I90A 2O9PA 5E70A 4HHLA 2HTMA 2L5HA 3VGFA 5ABFB 4CD4A 2WC3A 3PZUA 1H60A 1X98A 1CGWA 3AIBA 3PUOA 2D3LA 2FH6A 3O2LA 3C6CA 2E3ZA 4QRNA 3NL6A 3SCVA 5FF3A 3T55A 1EWEA 2ZVIA 1OC5A 4TQTA 4NAEA 4D6HA 3M0ZA 1ISZA 2P3EA 4C1KA 1K8XA 4XZLX 1Q4WA 1QI4A 2ZXQA 3B3DA 3C5QA 2V69A 1KBJA 1GOIA 5D9MA 4N4QA 4P8VA 4HQVA 4UUIA 2VO5A 3N13A 5A5WA 4F0RA 4YMZA 3E74A 4Z0JA 4FALA 1VYPX 1LLZA 3WNLA 1A49A 4L6DA 3EMCA 3OLDA 3KOFA 3UJRA 1IGWA 1YW1A 4F9JA 4LBRA 5FJOA 2VI0A 4DLFA 4RLIA 4AY1A 3M0LA 3NURA 4OUEA 3AHYA 5CC3A 2YKKA 3L67A 2PRMA 1EH9A 2PDGA 1W32A 4WJ8A 4F79A 1PIGA 5A8NA 4IUGA 1A3HA 4GQ0A 4LQ1A 4JN7A 1DTUA 2INEA 2XN1A 3RO6A 3QH2A 3ABSA 1XSKA 4MWAB 2YA0A 3BLKA 4ICMA 2XGIA 4AD1A 4WF7A 1KCLA 2J6VA 3M0YA 4P8XA 4HK5A 5C9WA 2X2YA 5DXXA 2FHCA 2X0SA 3B0YA 1ZPTA 3GXDA 4JBRA 1WZMA 3MDUA 3VDHA 5C2GA 1LROA 4CCEA 1WOAA 4BI5A 3T4WA 4JL2A 1PEZA 1QNVA 3KBNA 2P3ZA 1UWRA 3RM8A 5MHBA 3GHTA 3V36A 4MYXA 1V7AA 3PJWA 3RO8A 1HNYA 1H7WA 4OV4A 3ZS4A 1RK6A 4D8AA 1AH0A 1E4LA 3WF3A 2DT2A 4E2BA 2JKAA 4FNQA 2V63A 4QEHA 3N29A 2JF6A 2PDFA 1SMDA 1SW3A 3GW3A 5A1AA 1TVNA 1A5OC 4C6FA 1EXBA 3S2MA 1NSJA 3C3UA 2I9UA 2G95A 4L9ZA 4YJ5A 1HO4A 1ZNNA