4ZQPA

Crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the complex with imp and the inhibitor mad1
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
376
structure length
354
Chain Sequence
DPVPTGGDDPHKVAMLGLTFDDVLLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSGGLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAMRKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEVLQQAQFVRITPAGLKESHPHDVAMTVEAPNYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosph
publication title Mycobacterium tuberculosis IMPDH in Complexes with Substrates, Products and Antitubercular Compounds.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 111
structure length 354
sequence length 376
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2015-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4zqpA00
1UUMA 3UPBA 3LTSA 4N4QA 1UBSA 1XDMA 3AO0A 4JX5A 5K7JA 2C3ZA 1XXXA 4DO6A 3U6WA 1OX4B 5G1YA 4UMAA 3HF3A 2ZZ7A 2ZRWA 3EX4A 4RZ5A 3SGZA 2JBMA 1O95A 1YADA 3LXBA 4HSNA 5F1UA 1XL9A 1B57A 3MUXA 2ABBA 2QKFA 1VYPX 2JKPA 3W2UA 5D2WA 1ZAIA 2GJNA 3TE9A 4A2SA 3MYPA 1OK6A 3FKKA 4A3UA 2HS6A 1ZALA 2VELA 2V0TA 5F4XA 4MYXA 3GVGA 2WNQA 5CKSA 2DZTA 1TQJA 5AB3A 3KHJA 2QJHA 2JGQA 3SECA 4O1CA 3IVUA 4LRSA 2GQAA 4MFEA 3W1PA 3IGUA 1QAPA 4DF2A 1LBFA 1OFOA 3NG3A 2AQWA 4A29A 3DAQA 4FNPA 1ICSA 4AWSA 2Y62A 1SFJA 2QUTA 1GJPA 4MZYA 4RXFA 3S1VA 3C2OA 2H8XA 4UTHA 3GKAA 5L9FA 3GYEA 4QNEA 5FF0A 3TROA 3P67A 4OWGA 3M5XA 3QQ1A 1R46A 4XBSA 1FWNA 1H7OA 1P0NA 3EX1A 3QJAA 5SWUA 3W83A 3V75A 5DXYA 1FX6A 4RV8A 1OVDA 2HSAA 1W5MA 3VNDA 3W7IA 1R47A 1B4KA 3BG5A 4UMCA 2HMCA 4FXRA 1F05A 3O16A 4LY8A 1GVSA 4NJKA 4N9BA 3E96A 3G1XA 3GDMA 1G4SA 7TIMA 2Y63A 2YYTA 4LOCA 3W3OA 2ISSA 4UTLA 5D02A 3DHFA 1TTQA 1FWTA 3EX3A 1LYXA 3DFNA 3RFAA 4JIPA 3VCRA 1LORA 3IIXA 3PBYA 3T78A 3NQDA 4JX6A 3P61A 1SO4A 1P0KA 5KSWA 2Y7GA 2C16A 3TXZA 3UY7A 5CZJA 3LHVA 4ZL1A 3I7QA 3MP3A 2ISWA 1JCXA 4ZQCA 1O5KA 1RPXA 3W2NA 2J6XA 2VEKA 3NPUA 3QSRA 1MEIA 1EP3A 2J9ZA 3W74A 1VLIA 3EWWA 1VLWA 2NXHA 1IXNA 3R2GA 4H4IA 3IIZA 4NNBA 4L4LA 4A2RA 1VGAA 1J4EA 2C13A 1FCVA 3UWUA 4OV9A 4ZQNA 4FNTA 3T55A 4DELA 1TTIA 3DFQA 4JIQA 5DCDA 5H91A 4MOZA 2C0AA 3G1SA 2FPYA 1ICPA 4O13A 3S1WA 2NV1A 3PB2A 3A22A 4W9TA 1K7XA 3ABSA 2CWNA 2ZTKA 4GUGA 1I8JA 4MJZA 4AHOA 3RMJA 1KFEA 1K8XA 3QW4B 4OQVA 4GUFA 2B4GA 4OGZA 5KINA 2WNNA 4O52A 2TMDA 1LBMA 1KTBA 3UWYA 3LHTA 4HNVA 3HGOA 3IIPA 3LV5A 1V7YA 2QJGA 4IWWA 2Q8LA 2NV2A 4LVAA 2NXIA 3NQGA 1A5AA 4Y9AA 2WKJA 3B8DA 1JRCA 1OHLA 2DJXA 3M44A 3PWAA 4IXXA 4M6PA 5DCEA 1MZHA 4YL2A 4H6KA 4LVFA 2HTMA 5DXXA 5H2ZA 1SSGA 1LOLA 2OZ0A 2VEPA 1Q3NA 2GQ8A 2NUYA 3PM6A 2G97A 5D30A 4KFOA 3W7KA 2TPSA 4UC5A 3B0UX 3WJXA 4UTUA 1GG0A 5HQEA 3GZ3A 3W7OA 3LRMA 4XKYB 3TFXA 3G1YA 3F1QA 2A1YA 3O1NA 4GWEA 4P61A 4GRSA 4BI7A 1Q6RA 4FB7A 4ZVJA 2R91A 4O12A 2WJZA 3QM3A 5IBXC 5CPLA 1OK4A 1G7VA 2YR1A 2CLHA 2A4AA 1U5JA 3H55A 4PC8A 2V81A 1NF0A 1HG3A 1TQXA 5I3JA 3S0CA 1PS9A 3MJYA 3C6CA 4K37A 2X1TA 4ONVA 5K4XA 3P74A 2R94A 3STCA 3KVMA 2ALDA 4O1AA 3O15A 3EWBX 4N4PA 1FXPA 3LTYA 5L6UA 4UR8A 2CU0A 3I7RA 3P82A 4UXDA 2EAWA 3IIVA 1LCOA 4UTWA 3P5YA 3TW7A 1VJIA 4PODA 1B3OA 4HN4A 1QOQA 1K7EA 4WOZA 5HR7A 4Y90A 1SSDA 2R8WA 4JTLA 1W56A 1WAUA 2E77A 3NL6A 2FB2A 3DH7A 3A21A 4DO4A 1D3HA 3P62A 3I68A 2DZXA 1OYBA 3UZ5A 1KM6A 1VHNA 5F2LA 3KOFA 4L4MA 1YXYA 2F7FA 4IGHA 3GR8A 2GVLA 1ZNNA 2RDTA 3OHIA 4LC8A 5F1VA 2J88A 5LNVA 4U4MA 5LZLA 2A5HA 4QAIA 2AAMA 4N9DA 1I2PA 3UWWA 3PS7A 3W7EA 4ALDA 2G5WA 3HGSA 3EWXA 4FX6M 1YXCA 2E5CA 4Q32A 1U83A 4JN6A 3STEA 3DFPA 1O60A 4S2BA 1EUAA 3BO9A 1H7RA 3C2EA 4IJBA 2WSRA 4YCPA 2ZA2A 1H63A 1OJXA 4OT7A 5C6MA 3CPRA 4O54A 4MYAA 2GQ9A 3BLIA 1DQWA 2FLIA 1RZMA 3GXNA 3T7VA 1R2RA 3Q58A 1WA3A 4S1FA 1JUBA 4FEZA 3WFAA 5C55A 3UD6A 5HWMA 1J2WA 1ZENA 2C19A 2I9EA 5EBUA 3W2JA 3TNOA 5A5WA 1A5BA 2Y7EA 1NAL1 1VR6A 5C54A 4FNRA 4ML9A 4NJHA 3SGUA 2WSQA 2ATSA 3S42A 5I3HA 4K7YA 2NX1A 4WY0B 1VYSX 3HJZA 4O11A 3TSMA 3C56A 3W86A 3OVPA 1FQ0A 3F4NA 3IGXA 1TJPA 2DP3A 4UFKA 3EWZA 3IGSA 1YDVA 3LCHA 2QCDB 1GOXA 4N2YA 4Z0JA 3LERA 3P84A 1H1ZA 2G95A 3CU2A 1P1XA 3TIMA 1GWJA 1FCBA 3HPXA 5DN1A 4HNUA 3DKLA 4Q4KA 3FFSA 2CLLA 4LV9A 2CLMA 2G96A 5BW6A 5HWNA 5LGZA 1KM3A 3JR2A 2OJPA 1JUEA 4D2JA 4OV4A 4UNLA 2P1FA 1A5SA 1NFBA 5BNKA 1GVFA 5LHFA 4X3ZA 2CZDA 3W7LA 4UTTC 2C15A 1XBXA 5HUPA 1EUNA 3PY2A 1G69A 1TSIA 3O63A 4IUOA 3C2RA 1FDJA 3BG3A 3LRKA 1TV8A 2RHGA 1KFJA 2NX3A 2IQTA 1H5YA 4JTGA 2NX9A 4JTUA 1A5CA 5F2GA 2Z1BA 3CTLA 1WDWA 3FYOA 4LVBA 2ZZ4A 3IIOA 4WXZA 3R8RA 3TV8A 5I3FA 3TAOA 4E38A 4XUGA 1KFBA 4CNNA 1EWDA 1R2TA 4LUJA 2WOQA 1TTPA 1VH7A 3T40A 3FS2A 3B0PA 4CCCA 1KTCA 3NPVA 4NJGA 1TPVA 1T8XA 3G1FA 4NVTA 4O0ZA 5CSRA 2VENA 3N73A 2R14A 1QPNA 4JXCA 2Q3RA 1TYGA 1ZFJA 1ICQA 1ZAHA 3FYPA 1MXSA 4UIOA 1WQ5A 5HUOA 1VC4A 4TO8A 3C2FA 1IGSA 1JCJA 3B06A 4MLJA 4HKPA 1W54A 4Y6GA 3NQMA 3PB0A 4OBTA 3HG4A 4KWVA 4K7VA 1TPC1 3Q37A 3A5FA 4O10A 2VFDA 5FF7A 1QR7A 1GT8A 1FDYA 3IEBA 3A24A 1T0OA 1TPH1 1EX5A 4GUJA 2DZUA 4PA8A 1R2SA 3TMLA 1LP6A 4KFNA 2C6QA 3W72A 3L2IA 3PUDA 3G0SA 3TCEA 3MHGA 4WQ6A 1DORA 3S5NA 1WOAA 1DBTA 1P4CA 4Y8FA 3O6CA 5CSSA 4Z1BA 1OFQA 1SUXA 5E1QA 3EEGA 3CIWA 3HIJA 3GIYA 1QMLA 1QFEA 5KZDA 4MVAA 4AB4A 1BKSA 1TMHA 4R7JA 3VE7A 3M5ZA 4MIMA 4AAJA 4O16A 1OG0A 4X22A 5AHEA 3HBLA 1FBAA 4FNQA 4QISA 8TIMA 1Q6LA 3LB0A 5CPMA 2B7NA 3W7CA 3W7RA 3ZS4A 4IMGA 2X1RA 4KKXA 2QCHA 4BWLC 1L6SA 2E09A 1H62A 3LGEA 4N6EA 3SJ3A 3TDFA 4MPQA 3NM3A 1OFDA 1XCFA 3I6RA 2EHHA 1KV8A 4LC6A 3GDKA 4KWWA 3S6DA 1X8FA 1W5QA 3D0CA 2H3DA 4QSHA 5F4WA 1KFCA 2DORA 3CT7A 4DPPA 4EF9A 2Q8ZA 3OIXA 4IMFA 4O1DA 4GBUA 1XBZA 1EB3A 1RQBA 5FEZA 1BTMA 4HPJA 5D2VA 1PIIA 5FESA 4OE7A 1VQTA 1Z42A 5E93A 3S5OA 5DBUA 1OFAA 1Q6OA 3QYQA 5F2IA 3WK1A 3DI0A 2GJLA 1SR9A 3W23A 3LXAA 4HSOA 1BWKA 4YWIA 2ZRUA 2EPHA 1NVMA 2ZFAA 3GKFA 3QEZA 2Y7FA 4JTSA 1YTEA 1TTJA 3N34A 1S3HA 1JJKA 2ZRYA 1VRDA 4A22A 3SIZA 1OFBA 4PL1A 1JQVA 2NUXA 3FEMA 3O07A 1J5TA 5K4ZA 4C1KA 3I65A 5KMYA 4AXKA 1JR1A 3INPA 3ELFA 4AWTA 1DHPA 3W2MA 4UTIA 1L6YA 3W1AA 5FF4A 3B03A 5DCBA 3TC6A 1YXDA 2WO5A 3CEUA 4MY8A 3GNDA 4NXSA 4NZJA 2PRLA 4UUIA 4B5NA 1DL3A 1T96A 5HINA 2I14A 4MJMA 4MKNA 3W1TA 5KZEA 5J5DA 4HPXA 4E0CA 1YLVA 4CQ8A 1I4NA 3NM1A 2QCEA 3O06A 4K39A 4LWWA 1X1ZA 3TA6A 1W5NA 1L6WA 3QW3A 3HO8A 2JKAA 3LLFA 4FF7A 2E1DA 3C3NA 1W1ZA 4LS2A 1F5ZA 3W2KA 1ML1A 3CWNA 2YCEA 3PUOA 3G24A 3IVTA 5AYZA 3SR7A 2YYUA 4O57A 4XKYA 3UY8A 3EXSA 1RR2A 3UZJA 3GR7A 2A6LA 2RDWA 1K8YA 3TC7A 2FFCA 1XUZA 2EGZA 2OT0A 3G22A 3LRLA 4UNKA 2V8ZA 1QO5A 4GJ1A 4MZ1A 1GQNA 4JDBA 1QO2A 2TRSA 5FF2A 3KXQA 1HL2A 3FIGA 1ZJIA 4GFSA 1IXOA 3NVTA 4NXKA 5ABTA 2FPVA 1D3GA 4NJJA 4AWUA 5IBXA 4JDYA 3RLUA 2BWGA 3W87A 2Z6JA 4O19A 1IXQA 3GDRA 1AL8A 5DLCA 3EXRA 3R89A 4K8HA 1VYRA 2CW6A 3L67A 3NGJA 1HO4A 1ZCOA 4WY0F 4O4WA 5BOOA 5HR6A 1Z48A 2Z0IA 1GTEA 3OEXA 2B7OA 2GVGA 5D33A 1QNVA 2A21A 2VFGA 3PF3A 1SW3A 1G4PA 5FEXA 3M16A 5AYYA 3P80A 3NQVA 3L0NA 5LNSA 4UFJA 4PEKA 2Q3OA 2OT1A 5AHNA 1TV7A 3WJWA 1OF8A 2X1SA 5D2TA 1WXJA 3K30A 3W2LA 5TQLA 2V82A 3IRDA 3DGRA 1FXQA 4PFMA 4IQLA 3W88A 3HPSA 3VI2A 3M47A 1N8FA 1KLYA 3GB6A 3OVQA 2H8ZA 4FNUA 3BLEA 5C5YA 4ADTA 3TAKA 3TQ0A 4EF8A 1Z41A 2ISVA 1HO1A 1A50A 2QDGA 2ZRXA 4X9SA 3GAYA 3UPWA 3QMTA 1W0MA 2A6NA 4ICNA 2JKEA 5FI8A 5I3IA 2A85A 1SO3A 5HJLA 2VOMA 1KBIA 1TPWA 1K3UA 5K3VA 4JYEA 2RKXA 3G8RA 4UCGA 3PBUA 4Z1DA 4J9JA 1PHQA 1TPDA 1PE1A 4N9EA 4JR5A 3N9SA 5HULA 3EX2A 1AMKA 3B04A 3VE9A 3G3MA 4FXSA 1UJPA 2FTPA 1HUVA 2XN1A 4RR4A 1AW1A 1Q45A 1SO5A 4PL2A 4TU1A 4UFLA 4EIVA 4PTNA 1TIMA 1T99A 3TJXA 3OG3A 3KVKA 4LTSA 4CLMA 2X2GA 3DU0A 1JVNA 4K6AA 4N02A 3SY5A 2Y89A 2A7RA 1UB3A 2VFIA 3NQ6A 4XZ9A 3FOKA 3KVJA 3B0VC 2ZDRA 2FJKA 2YZRA 5GVJA 1GVOA 1TB3A 4K36A 4UMBA 1ZY9A 3W1UA 2J9XA 1JCNA 3PBVA 2A0NA 1RVGA 1K03A 2QAPA 3TH6A 1HFBA 3VFLA 1EEPA 4BI6A 1WYIA 2PRMA 3LHZA 3LCWA 5CZSA 1TPEA 4WY0A 3W1RA 2X30A 1BEUA 1TJRA 2Y85A 3LHWA 5D04C 1NSJA 1K7FA 3M9YA 1F7BA 5G4WA 4QJ1A 1S5VA 5EMUA 1B9BA 3TSDA 3WK3A 2RH9A 3GDTA 4JS3A 3MP5A 4O50A 3OA3A 5AOUA 1H61A 2BSLA 2QCDA 2QCMA 2AGKA 3L0GA 3MBDA 1IF2A 1O4UA 3MWAA 3NO5A 4Z08A 1F73A 4TMCA 1GYNA 3QSTA 1M7PA 3G0XA 3HG3A 2FIQA 1WV2A 1OX5A 5AHLA 2TYSA 1TO3A 4NX5A 1H50A 4JYDA 3N2MA 4JD4A 3BGGA 3OVRA 3NPXA 2ZYFA 3C52A 5CG7A 5D03A 2XN0A 3NEVA 5IM51 3O05A 4PH6A 1OF6A 3BW3A 1GTHA 4FX7A 3STGA 1TPFA 2HS8A 4K8EA 1YDOA 2V2HA 1F76A 1GZGA 5LNWA 4DF1A 1SW7A 4RKAA 1PVNA 3ABOA 1QPOA 3UNDA 3ZR4A 3TJLA 3NA8A 1P5BA 4RJEA 2ZZ1A 5AN7A 1JRBA 3E9AA 3UXDA 4DF0A 4LS0A 4BR1A 3NR0A 3G1DA 3LCLA 3NQCA 4G1KA 3W7JA 3S1XA 3C8FA 4WD0A 2QR6A 4JY9A 3W7MA 4DBDA 1G4TA 2Y88A 3DENA 1C9DA 2WV8A 4HNTA 3P8JA 4WX2A 3UWZA 1ONRA 4YMZA 4CNOA 3NPWA 2QCCA 1FDZA 2Z6IA 4UTWC 4WXYA 1OYAA 3DI1A 3B05A 2YGYA 3KX6A 1KM5A 3HQ1A 3CEPA 3A5VA 3NQEA 4R53A 4DEFA 3KRZA 3PULA 3C61A 3S9YA 3MHUA 2ZTJA 1JCYA 1H7WA 1W31A 3LCFA 1I2OA 3YPIA 4S2CA 1OX6A 3L5LA 1GVRA 4JTTA 4QQ3A 3BPWA 5KITA 2V30A 3LBMA 2ZZ3A 5T26A 3W7PA 4R33A 1ME9A 2ZZ5A 5I3KA 3NYZA 1VCGA 4UTKA 1X1OA 5G1TA 1OABA 3R13A 1LLZA 2BXVA 4TMBA 4GUIA 3S8HA 3W1XA 3BVJA 3EX6A 1KBJA 1NF7A 2BLEA 3EKZA 4ORMA 3UWQA 2YFNA 1DOSA 3BARA 4M6QA 4TX9A 4AF0B 3UQNA 3SFKA 1G6CA 5MHBA 1SO6A 2OMAA 1V5XA 1LRNA 1AW2A 5HMSA 2Y6ZA 3KRSA 2JK2A 4RXGA 3U2OA 3FJ6A 5HNRA 4RZ4A 3MI3A 1XC4A 4YXGA 3DHDA 5CZTA 4BI5A 4O18A 3TR2A 3KVLA 1W37A 2OCZA 4FHAA 2ZRZA 5CZ0A 4ADUA 1RQHA 2GPTA 3HOJA 3L65A 3C2VA 4E2BA 4HHPA 3H54A 2YW4A 3RNDA 3PUEA 2GVJA 1JCLA 4RZ6A 2E68A 3QZEA 5E0KA 1TREA 1CX9A 3ABRA 2GOUA 2V9DA 2CLEA 2WNZA 5DY3A 1KA9F 2YPIA 3LCXA 3PC0A 4LS1A 2DZVA 2VEMA 1VCFA 3LCGA 1X6UA 1W8SA 3TUUA 1F2JA 3M6YA 4JY8A 1FWWA 4DXVA 3UXAA 1D9EA 3L5MA 2V2DA 5AHFA 1W3IA 2ZBTA 3IVSA 4I7WA 2E6AA 4QITA 1N55A 2ZA1A 3MYOA 3HMJG 2Z2UA 3F4WA 4CQ9A 4LNYA 3PSVA 1LRTA 3LDVA 1VZWA 1TCDA 4XQ6A 1I45A 1EWEA 2H3BA 2J27A 2FB3A 1YTDA 1EIXA 2WSYA 1PCWA 1UASA 4IMDA 3MMTA 1QOPA 3DXIA 3JRKA 2X1UA 4GXMA 1IIHA 3LCIA 4ZQMA 3ZWSA 1H60A 2PRHA 1G7UA 3AJXA 2J9YA 3BW2A 4LV4A 4CNPA 1M7OA 2O7SA 4JTHA 1KV5A 3EB2A 1AG1O 4JTFA 3HG2A 2E5BA 1I2NA 3THQA 1IIGA 1L9WA 1YPFA 1C8VA 2VXNA 1VHCA 3O6YX 4LT9A 2H6RA 3NQFA 3LXCA 3NQ7A 3TX9A 3M0ZA 3CWOX 2RFGA 4JYFA 4JTKA 2E6DA 3G1HA 4YLWA 3LTPA 3WJYA 3RK8A 1PL9A 1RQEA 1KM2A 1K8ZA 1XUUA 1LM1A 5D38A 1YTKA 3PG9A 4U28A 2VC6A 3TXVA 3P8IA 4E2DA 4XWUA 3GNNA 4UFHA 2TSYA 2A2IA 3TQKA 1JULA 2DZPA 4AHQA 1MSSA 4FX8A 4IXHA 1H7NA 3PR2A 2NWRA 2YFOA 3DFSA 5CPNA 3W9ZA 2KZHA 1LROA 5TBOA 5TIMA 2YXGA 5LNRA 4TR9A 4HNNA 3T4CA 1GG1A 3STFA 3FJLA 3KAOA 1EA0A 3A9IA 3U8GA 1FY6A 2W0UA 1SZGA 1S5TA 3QC3A 4UTJA 3M1ZA 1QCWA 3EXTA 1QPQA 3C0JA 3L21A 4LUIA 4GNJA 4BFAA 3M41A 2CLKA 1EP2A 2ZA3A 1QDSA 1W3NA 3CIXA 3PG8A 2V2CA 5D05A 1L2UA 3MI2A 4ADSA 3MHFA 2Y70A 1O5XA 4M19A 3W70A 3THAA 1ADOA 3LV6A 1MEHA 3NL3A 3NQ8A 1GPWA 4JICA 1OYCA 3TFCA 2QUUA 3E02A 3TU9A 2YSWA 4NUWA 1A53A 4ZZ9A 2P0OA 2ABAA 3W7DA 3EKLA 3P81A 2RDUA 3GXTA 1XFBA 3TQVA 4JTIA 3G3DA 2C1HA 3PAJA 2ZRVA 5CPOA 2VKZG 3DZ1A 3M43A 4LVDA 2CZEA 3VKJA 3NQAA 1JQXA 3NNTA 1I2QA 3S5YA 3W22A 5D32A 2CLFA 4O8RA 1ME8A 3W7NA 1VCVA 3LX9A 3LBCA 3P5ZA 4H3DA 4N6FA 2OX1A 2V5LA 1KFKA 3L5AA 4IPIA 2XN2A 3NZ1A 2CLIA 2XFWA 3N2XA 5K9DA 3A23A 2QCNA 3S5ZA 3I7SA 5DY2A 5F2MA 3LLDA 4O15A 1R30A 4Z0SA 5F4SA 4FNSA 4ZQRA 2W79A 2A7PA 2ZQ0A 1W3TA 4MFDA 3TSBA 5LSMA 2EKCA 4WZHA 4HIBA 1PCKA 3SW6A 1XM3A 2DU2A 3G1VA 1O94A 3O6DA 5AHIA 1OFPA 3T44A 5I3GA 3CB8A 1B4EA 3LI0A 1DV7A 4NNCA 4ZQOA 2EF9A 4FIRA 5AC8A 1XBVA 3GAKA 3QMRA 4FIQA 4IOTA 1MEWA 3FKRA 5LKYA 4O28A 1KW1A 3NXFA 4I7UA 2LLEA 1WX0A 4IX2A 1XI3A 4IPJA 3V1PA 4JTEA 1GYLA 1UUOA 1TRDA 3TMQA 5C2XA 3BGJA 4JEQA 1H51A 4EWND 3NZRA 4QNWA 4DO5A 1JUKA 1SU5A 3W76A 3W7GA 2O7QA 3BG9A 3DBPA 3Q94A 5J5RA 2QEZA 3W1LA 1LZOA 2V5BA 3W85A 2CFFA 5CGQA 1H1YA 4PCFA 1W5PA 1LOQA 2QDHA 3G18A 1TRIA 4QM1A 2QCGA 3CHVA 1TPUA 6TIMA 3PVFA 1KFLA 4O53A 2PCQA 3NAVA 4N9CA 1Q6QA 3W1NA 2F84A 2WPBA 4UTMA 1LBLA 4P2VA 5K2ZA 1ALDA 3R12A 3QPYA 3ATZA 2UV8G 3W75A 4C1LA 2NXGA 2QF7A 3SSJA 3QH2A 2BX7A 4NZFA 4I7VA 4NNAA 3W7HA 5HWJA 4O14A 1RD5A 3TKFA 3W6YA 2ZZ6A 2YW3A 3ABQA 1NEYA 3SZ8A 2B7PA 1HTIA 1LRQA 4OHQA 1YPIA 5KZMA 1DQXA 4ZMGA 1AW5A 1OFEA 1KTNA 3CC1A 4NJIA 3N9RA 4CCDA 3KFTA 3BLFA 2QJIA 2ZCGA 3RLVA 3ANYA 1JCMP 4CCEA 2VEIA 3Q2DA 5AFDA 5AYXA 4YCOA 1FCUA 1K02A 2PURA 2PE4A 3L66A 4UFIA 1QWGA 4XBKA 3HGRA 1SW0A 3W1MA 3W07A 5EY5A 1DVJA 1ME7A 3CM4A 3PBWA 3NDOA 5LGXA 3L0KA 2CLOA 4IX0A 1PV8A 1BWLA 1SZFA 4KFPA 4Z1CA 2P10A 4K38A 3QFEA 4Q33A 3B4UA 3DFOA 3BK0A 4RLIA 4UTTA 4A21A 2Y61A 2VFHA 2Y7DA 2YX0A 5G2WA 5K9XA 3MBFA 2QCFA 3MO7A 3W84A 3RF9A 1MO0A 4LVGA 4AF0A 4NU7A 3W1QA 1F74A 3KRUA 5BMWA 5KTLA 3CLMA 3LHYA 3MI6A 2YDAA 1F6PA 1VPXA 4BF9A 6ALDA 3W73A 1GVQA 3TW6A 3NQ2A 5LHEA 1RV8A 2PC4A 3P60A 4ORIA 5EPDA 3E49A 4Y96A 1LOSA 2A7NA 3RU6A 2WQPA 1W5OA 4Z1AA 3O8AA 3GK0A 1WBJA 5FF3A 3QRHA 2BZNA 4IMEA 2E6FA 4IMCA 3GX9A 2I1OA 2NUWA 3FLUA 1THFD 2NZLA 3MW7A 3G1AA 1Y0EA 4QIUA 2E5DA 5U7SA 2D73A 4LW7A 3TK7A 1N7KA 4O17A 5D2YA 5EL1A 4ZQPA 1DKWA 1VS1A 4JX4A 4RK8A 5G4EA 2QUVA 3H53A 3GDLA 2J24A 3ZFHA 3WK0A 4BK9A 3JS3A 3N19B 3L9CA 3C4UA 3LHUA 2ZZ2A 2QAFA 4JGDA 3HB9A 2H90A 1S5WA 3WK2A 3QQ0A 3UWVA 3M7WA 1XDLA 1LLWA 5G2IA 1FCQA 3FA5A 1KM1A 1SPQA 4XTIA 4NX0A 4AMAA 2BTMA 3G8EA 4DQWA 1XKYA 3F03K 5D2XA 5D09A 4XTDA 4O0KA 3QF0A 3BW4A 1DJNA 1QPRA 4O4VA 3ZWTA 2VFFA 1SFLA 2FDSA 3LM7A 4DPQA 1EP1A 4DBEA 3R5EA 1G4EA 4AH7A 4X2RA 4JNMA 4WJEA 3WJZA 4RX0A 5AC6A 1TV5A 2DZSA 1M6JA 4EOUA 1AK5A 4GUHA 1CI1A 1KLZA 4JTJA 1FWRA 1SZEA 1LDCA 3SI9A 1C29A 4MLRA 4UR7A 3S1UA 2ATMA 5DELA 5FEWA 1M5WA 4O1BA 3EWYA 5G5IA 5G2HA 3UYCA 1YYAA 5AHMA 3W7QA 2GUUA 1F6KA 4MY9A 3LI1A 1H7PA 2NWSA 2B0MA 5D37A 1YDNA 4LU0A 3CQ0A 4M5PA 5EYWA 4MUZA 3N14A 5A8GA 2VFEA 4EVZA 1ZAJA 1OX4A 4BWLA 4M6VA 1ZHAA 5BMXA 3LOTA 4NT0A 1DJQA 4RCXA 2B7QA 4MZ8A 4AEOA 2CZFA 2FQIA 2C18A 4FO4A 1I2RA 1FUYA 4WOQA 3HGJA 1GEQA 3NL2A 3E0IA 1Z44A 3WJSA 1IXPA 4AVFA 4TIMA 1H7XA 3BV4A 2DJLA 3QMSA 3ATYA 4LRTA 4WUIA 1X7FA 3HPZA 3MP4A 1UCWA 3GLCA 4GC4A 3NL5A 4M7TA 4AHPA 1WBHA 4R34A 3W71A 3M5VA 1SZNA 3G0UA 4OU1A 3DFTA 1WOBA 2C14A 2DZWA 5AC7A 1CW2A 4M7SA 4POCA 3E12A 4UFMA 3GXPA 1KM0A 3L68A 3QPZA 5FEPA 5U4NA 5LNUA 2NLIA 1EPXA 3PSWA 1XBYA 1G67A 2X16A 3OBKA 4CQAA 1FWSA 2E6YA 5DBTA 3IV3A 4I9AA 2FPTA 1E51A 5EA9A 5EKYA 2CZ5A 3NOEA 5K9CA 3M5YA 4NQ1A 1SQ7A 2W6RA 1TPB1 1KM4A 1AL7A 3P7YA 3USBA 1PHWA 1LTDA 1OFRA 2JGYA 4MY1A 3DKJA 4GE8A 2QCLA 3HG5A 4HT3A 3N3MA 5BRBA 3EWUA
chains in the Genus database with same CATH superfamily
4C6MA 2PU1A 1GYMA 3ONBA 1UUMA 1UBSA 4IQDA 3T08A 1V7AA 2GUBA 3HF3A 5JBDA 4HHLA 3REQA 4UQCA 3COTA 3GC4A 1BLIA 2Z26A 2C79A 1DJWA 1H09A 5IFTA 3OP2A 3AWOA 3WBXA 2GJNA 3MYPA 1OK6A 4XBJA 1JFHA 2ZVRA 3S47A 2I57A 2HS6A 4A3UA 2V0TA 3H24A 3ZJ8A 3S6TA 1X8CA 1A0EA 2PF8A 3EAUA 4ICMA 4UBPC 4V1XA 3CAWA 2GDUA 3QHMA 2JGQA 3PZVA 4LRSA 4B15A 2G3MA 4DZIA 4ACZA 1PJ9A 2P3ZA 2VGGA 3GYCA 1OFOA 4C90A 2G4JA 3DAQA 1ICSA 4MWAC 1QT1A 4MZYA 1VFFA 5A6KA 3CHDA 5FF0A 3M5XA 1FWNA 1H7OA 3EDJA 4G5DA 5DXYA 3WBWA 1ODZA 4LYKA 4PZVA 1GOIA 2OWCA 1F05A 4NJKA 4N9BA 2BV9A 3G1XA 3K4WA 1CYGA 3GTHA 2HNHA 5ECVA 3KOWA 4LOCA 3N12A 3W3OA 1E1CA 4ZR8A 3RFAA 3VCRA 1NDYA 4HTBA 3PBYA 3T78A 4GIRA 2VDHA 1P0KA 2Y7GA 3GIQA 1W9BM 2C16A 5BU6A 3TXZA 1XLCA 3T6CA 5AKQA 3I7QA 4JQ1A 3BGAA 4ZQCA 3W2NA 1RPXA 3GNOA 2J9ZA 3C0SA 4Q8VA 4ZB2A 4WGXA 1QW8A 4L4LA 1GJUA 2MUCA 3IUIA 2C13A 4KCVA 3M0LA 3UWUA 3A4XA 4ZQNA 4FNTA 4JIQA 3GTXA 4ZA0A 3G1SA 1ICPA 3OZMA 3PB2A 1AQMA 1R86A 2XM1A 1RA5A 4JHMA 1ISVA 1QJWA 1S2CA 3AXIA 2OYKA 4WJXA 3AALA 3N17A 3QW4B 4CN6A 3WO8A 2JIEA 4O52A 1LBMA 3GHUA 4HNVA 4M82A 4GX9A 2QJGA 2Q8LA 4LVAA 4RW3A 2YCKX 4PTMA 2PWUA 3NQGA 4Y9AA 2VJXA 2WKJA 4NY2A 2DJXA 3TP4A 3M44A 4M6PA 2WC3A 3B8WA 2PI6A 2HTMA 1R3SA 3RHGA 2XZ9A 3PAOA 2GQ8A 3AMGA 3WLTA 1EBHA 1Z89A 4J27A 3IWPA 5D30A 4KFOA 1BQGA 3PJTA 3LMZA 1UROA 4PUWA 1EZ2A 4UTUA 3WENA 3C86A 5HQEA 1IEXA 3W7OA 3MCNA 5GJPA 1PZ3A 2CPUA 2POTA 1GOQA 1US3A 2IKIA 4GRSA 1Q6RA 1DPMA 2ZUTA 3U2CA 1WXYA 4PMDA 5CPLA 2HZGA 4UQBA 4U2ZA 4O8AA 2XG9A 1NF0A 4AZGA 1HG3A 3VIHA 1EKOA 1TQXA 3S0CA 1JEZA 4FK9A 4ONVA 4AY1A 3P74A 3T9PA 4G8TA 3T42A 4IHCA 1NP0A 4O1AA 1FHUA 3URQA 4QAWA 4N4PA 5L6UA 4UR8A 1XIBA 3PN8A 3VDCA 4PBGA 2PDFA 4UXDA 4GI6A 1PX8A 3IIVA 4QJ4B 3MS8A 5C2CA 4RZBA 1KQZA 1WO2A 1D7KA 1QOQA 4YU1A 3L12A 1W56A 1UJQA 3R11A 3NL6A 4D8LA 5EB8A 1D3HA 2ZUVA 3P62A 1KGWA 3KTSA 2ANUA 1VHNA 3LZ5A 3T09A 1CBGA 5LNVA 4U4MA 1Q6DA 1ZQ5A 1E55A 5LZLA 3QV9A 2AAMA 3UETA 1I2PA 3W7EA 4ALDA 2G5WA 1AH4A 4AD0A 4QS6A 5HMDA 4QE5A 4CEUC 3AMLA 2PFHA 3DFPA 3KOXA 1OC7A 3C2EA 1WDQA 1QHZA 2WSRA 1AH0A 3WLRA 1OJXA 4EPDC 4GINA 4MYAA 4PCNA 1B3VA 2DW7A 1RZMA 4U3AA 1LG2A 4S1FA 4B5WA 3U2ZA 4AD4A 1ZENA 1RJRA 2C19A 2I9EA 4OUEA 5FD0A 5A5WA 4ZODA 1NAL1 3WH8A 5C54A 4NJHA 3SCTA 1GUVA 4K7YA 3B9NA 3NZGA 3THDA 4F9JA 1EC9A 1PDYA 3AS2A 3OVPA 3UNTA 1TVLA 5HK4A 3VFCA 3G6LA 3IGXA 2DW6A 4P7OA 1FKWA 4PUNA 4DWSB 1UZDA 2QCDB 1GOXA 1TZZA 2ZWZA 3R58A 1NFGA 4H6QA 1VEPA 1OT2A 2EKGA 2J79A 2PODA 4OTKA 2VRQA 3FSTA 3GUWA 2G96A 5BW6A 2OJPA 2V3GA 2X1IA 1A5SA 3W38A 1Y7VA 4X3ZA 2C15A 1XBXA 4HU3A 1K4GA 4DAIA 2NV9A 1G69A 1TV2A 2DT0A 4IUOA 1QI3A 7A3HA 4MDOA 3C2RA 1MFVA 3TZNA 2IQTA 1H5YA 4JTGA 2X0YA 4JTUA 1V0KA 2G3NA 1A5LC 1SJBA 1X96A 2VD9A 5I3FA 3TAOA 1VPYA 1JXJA 1CT5A 1KFBA 4B4HA 2WOQA 4O1FA 4DNHA 4PUEA 1V6UA 3B0PA 4CCCA 1PYFA 1C7SA 4NJGA 5H8UA 1XIJA 1TPVA 2GDQA 4E8DA 1T8XA 3MMUA 1SFSA 4JQ3A 3VCCA 4NVTA 2VENA 4MM1A 1V3IA 2R14A 1QPNA 3WF3A 2W3ZA 4JXCA 1BQCA 1TYGA 1ZAHA 3FYPA 5D9OA 4UIOA 1VC4A 2P8BA 3C2FA 3B06A 4B4FA 3PB0A 3KS5A 3HG4A 3WEMA 3W0KA 1X6LA 1TPC1 2FVMA 2HISA 2VFDA 5FF7A 4GUJA 2DZUA 4F4RA 1R2SA 1EYWA 4AU0A 4F79A 2FKPA 1XPYA 3PUDA 4FOJA 1XSKA 1KB3A 3M0JA 4BCEA 3S5NA 1KXTA 4GZJA 3QOMA 3C3UA 3K4DA 4Y8FA 1IEQA 3AIRA 3FAWA 4Z1BA 1K9TA 3WLLA 2J8FA 3GIYA 4B5VA 1PEZA 1F3WA 1QFEA 4MVAA 1BKSA 3ZR6A 1NQ6A 1Y8BA 4B5SA 2WMHA 3PBGA 4O16A 4CU8A 5E9AA 1Q6LA 3W7CA 3ZS4A 2POZA 1FKXA 4IMGA 3UJSA 4QP0A 3MC5A 1Q4WA 2FZDA 3H2FA 1PYMA 5DMYA 4K3ZA 5TNVA 3SJ3A 4X9YA 1EQCA 3PWGA 4MPQA 3U0HA 3N04A 1OFDA 1YNQA 1X8FA 2PLKA 2H3DA 3WSUA 5CLTA 4JTDA 4MGGA 2Q8ZA 4FSAA 1OCQA 2WZMA 3PTDA 4O1DA 3S2NA 2RJHA 1BTMA 1IZJA 2R24A 1DJGA 4K1WA 3E2SA 1QI2A 3QYQA 5F2IA 2Y0FA 3WK1A 3W23A 2GJLA 3B8VA 4NZ3A 1BWKA 1IHIA 3PZGA 2EPMX 2EPHA 1NVMA 3GRIA 4JN8A 3GKFA 4H6EA 3GTNA 2Y7FA 1TTJA 4GH3A 1S3HA 4GPNA 3IK2A 1JG9A 1KXHA 5EMLA 3VPLA 1OFBA 2I9UA 3DERA 5GNYA 1DJHA 3R7MA 3M7SA 5KMYA 4GH1A 2QPSA 5C70A 3ZSSA 2GFTA 1E0UA 5FF4A 3B03A 1YXDA 3GNDA 4NXSA 4NZJA 4S3GA 3FJNA 5HINA 3DX5A 3WY1A 5KZEA 4W8LA 2XWEA 3FW6A 2PDUA 2V68A 1BFNA 1HGYA 4L9ZA 3WLSA 3WUEA 4ROQA 1W5NA 3QW3A 3N2TA 4HMEA 2JKAA 3VIPA 3UR8A 3M4HA 4UNIA 2ZX6A 3CWNA 2HVMA 3IVTA 3LY0A 2YYUA 4O57A 3EXSA 1ZZMA 1OADA 1RSCA 3JZEA 3WDRA 3EB3A 1XUZA 2BHZA 2EGZA 4YTRA 2V8ZA 4GJ1A 4AYSA 1MNZA 1A3WA 1K8CA 3FIGA 1ZJIA 1IXOA 4DX3A 1VRXA 1UOZA 3NVTA 4AWEA 5ABTA 4XIMA 1WPCA 5LIUX 2JF6A 2D0HA 3EMCA 1E40A 1AL8A 5EGRA 3TNBA 3R89A 4S23A 1E3ZA 1ZCOA 4J28A 3QZAA 5BOOA 1LL7A 2Z0IA 3IJ7A 1GTEA 1TA3B 3WD4A 3OEXA 3QTPA 1NJJA 2VFGA 5FEXA 1JCTA 2VX5A 2YXXA 4W86A 3GFZA 3IRSA 5LNSA 4UFJA 4PEKA 1XC6A 3A13A 2OT1A 4MADA 1N8WA 3E74A 4UR9A 4JL1A 1OF8A 2X1SA 5D2TA 2J8TA 2PTYA 1X39A 3CUZA 4RPQA 5TQLA 1A80A 1I60A 3DGRA 3EZ4A 4PFMA 4IQLA 4MWAE 5JBFA 4H9VA 3GB6A 2G4FA 2GJXB 3OVQA 4FNUA 4DXKA 5C5YA 4HNCA 3N6JA 3VIFA 1A50A 3T8LA 4X9SA 3UPWA 1M41A 4GCAA 1W0MA 1M68A 4QROA 4EPKA 4D6FA 1KBIA 1MW0A 4QLKA 3B9DA 1NH6A 2RKXA 3AS0A 2VX6A 4GOAA 1PE1A 1V3JA 1HVQA 2DT3A 4JR5A 3N9SA 3ZVHB 4C6BA 4FXSA 1UJPA 2WMKA 2PDKA 2ZOXA 4WIWA 1SO5A 4Z2KA 4EIVA 5A8PA 1TIMA 3BWWA 3KVKA 1JVNA 3CAQA 4K6AA 1KCKA 3GHTA 3AC0A 4HCLA 2PS2A 1JAEA 1UB3A 1EGZA 4IUGA 3T1GA 4HMNA 4GHRA 3QVQA 3RR4A 2XVPA 2WZIA 1VF8A 1CGTA 4J5NA 1VFLA 3KL5A 3TH6A 1HFBA 3NO1A 2PTXA 4I90A 5AZ0A 1XIHA 1OC5A 2Q8XA 3ITTA 2OWWA 1IZCA 3M9YA 1F7BA 3POHA 1B9BA 3OB8A 1GGOA 4QRNA 3OA3A 4DHGA 4DWSA 2QCDA 3OVGA 3AXMA 4KEZA 3MBDA 4I5UA 3L2LA 4HNLA 1CGWA 2VDGA 1P0BA 3H23A 5C7HA 2D22A 4S38A 5DEZA 3P93A 3PZNA 3F5LA 1WNOA 2W5FA 4LUTA 3G0XA 3EGJA 2FIQA 1HJWA 4C6FA 2CHRA 4RW5A 3WLNA 3ARSA 1H50A 3BGGA 3RLGA 1VPQA 4ERAA 3PZMA 1J10A 3NEVA 4AZIA 2WVTA 1X7IA 2BFGA 3JU2A 1ZRQA 1OF6A 2QULA 3N6QA 4K8EA 4J3WA 4P8WA 1W3KA 1H1NA 5LNWA 3W6LA 1SW7A 3C2YA 3ZR4A 5E09A 3NA8A 3URAA 1P5BA 2YLAA 1XG4A 5AN7A 4NZ5A 4OVXA 4LS0A 3L4WA 1IQ8A 3BURA 3G1DA 3NQCA 2Y8KA 4CGTA 2EG8A 1ONRA 1FWEC 2CWXA 2QCCA 5HAOA 2VTFA 4JFTA 3CASA 3CBWA 4WXYA 1OYAA 3DI1A 3ZLHA 2WKGA 4W5ZA 4C6LA 1KM5A 3W24A 2PGEA 2HROA 1HL9A 4DJFA 4TTGA 4R53A 1UUQA 5A6LA 3S9YA 3WBYA 4W84A 4GZEA 2ZTJA 2FHFA 3LCFA 1UH2A 4DZ5A 2KAUC 4F2BA 3KOZA 3L5LA 2BNJA 5KITA 1ME9A 2J4GA 5DFAA 1AJZA 1XR2A 3BSHA 2YA2A 3GBEA 2PDIA 5G1TA 1OABA 4MTVA 3TCSA 1TWZA 3DYPA 1NF7A 4NG3A 1OZQA 1XCXA 4GXPA 2PSNA 1JI1A 2YFNA 1C8XA 1MUCA 1XIGA 5MHBA 2XGZA 1R3RA 4U10A 4L5ZA 3KRSA 1LLOA 1V8EA 2V5JA 3U9IA 4Y8EA 3MI3A 5CZTA 4BI5A 4O18A 1TVNA 3JW7A 1V6VA 5IHRA 3GY1A 3V7PA 4RE2A 5CZ0A 1D3CA 4U5IA 4ADUA 3IUHA 4QE1A 5DO8A 2HRWA 4LUSB 1EQPA 3H54A 3GTFA 3RNDA 4AZ5A 1FWGC 3AIEA 3Q65A 1J0JA 1ZLPA 1QHOA 2E68A 3BAKA 1TREA 1SM9A 2GOUA 3AYVA 2V9DA 4FZIA 3RM8A 3VABA 2WNZA 4KWSA 3LCXA 1UIOA 5BXTA 2DZVA 4HPHA 2VEMA 3VNJA 3MDUA 1VCFA 1V03A 4C6DA 1DJYA 3EPMA 1ZBWA 3M6YA 3BOFA 4JY8A 1FWWA 4DXVA 2V6AA 4F2UA 3L5MA 1A5NC 1XLIA 3L23A 2E6AA 1N55A 2ZA1A 3MYOA 3HMJG 2Z2UA 1P6WA 1FP8A 3U5YA 3WQDA 2PDPA 4XQ6A 5CLWA 2V5CA 2XH4A 4B5XA 2W63A 1I45A 2PLJA 3UWEA 1V0NA 3CTTA 1QOPA 3JRKA 1M53A 3LCIA 4LALA 3ZWSA 4Z2JA 1R3YA 4C6EA 1IR1A 2O56A 4IFRA 4XX6A 1LL4A 4Z2GA 2V69A 2FH6A 2E5BA 2QDEA 3AU6A 5XIMA 4LYPA 4AVNA 3LXCA 2DH3A 2DZAA 3CWOX 2RFGA 2J7GA 3FVDA 3T0AA 1TWWA 4YLWA 4GVFA 4QHRA 5GNXA 1MW2A 1XD1A 4LAUA 3WJYA 3RK8A 3RPDA 1PL9A 1RQEA 5D38A 4H01A 3TXVA 3P8IA 1US0A 3GNNA 3WDHA 4HCDA 5JIPA 1JULA 2DZPA 2IPWA 1EO7A 3WQWA 4D8ZA 1VD6A 3ISIX 3DFSA 3W9ZA 3TA9A 2KZHA 3IPWA 4PB5A 3R8GA 3MU7A 2VCAA 5T91A 4TR9A 2YDSA 2XFRA 3WF4A 3WLQA 3ANUA 1DTUA 2F2HA 1FWBC 1TA3A 3KAOA 3U2EA 4V15A 2WK2A 3U8GA 2PWHA 3M1ZA 3EXTA 3L21A 5GJMA 2CLKA 3VKDA 2WMJA 4GQQA 1QDSA 1W3NA 3PG8A 1L2UA 3MHFA 4QDPA 3MCMA 1O5XA 4M19A 4M8UA 3NL3A 1OYCA 1E4LA 3TFCA 2GJXA 1VBRA 1FFQA 5CC6A 5FJPA 1Y5VA 1CXFA 2ABAA 1MRAA 5LIYX 5M2FX 3WQ4A 2Y24A 3G3DA 4Q4RA 4LCRA 2CBUA 2ZRVA 4HYVA 3DZ1A 4I8DA 4PCPA 1I2QA 3EDKA 4P8XA 3ZVHA 4DLMA 4LANA 3LNMA 4O8RA 3W7NA 1TX2A 3AISA 4H3DA 4N6FA 4L80A 3IJDA 1NU5A 1W8GA 1CXLA 2XIOA 1LT7A 2XN2A 2ADAA 3NZ1A 4ZENA 2DIJA 4JAWA 1R8LA 3PPCA 1T40A 5CPQA 3S5ZA 4L4PA 2TODA 4PBFA 1ZBCA 4FNSA 4ZQRA 2ODOA 1QNSA 5CAHA 4MFDA 3N2CA 2EKCA 4WZHA 1AUSL 3SW6A 2WHMA 3SUSA 3OO2A 3AUOA 1B4EA 3UG3A 3PP7A 4B90A 4ZQOA 3VTRA 3GDBA 3SRKA 2GK1A 5AC8A 3QMRA 2PGFA 2OZ3A 4IOTA 1TR1A 1WDRA 3AIQA 1XGDA 3E38A 3FKRA 4FOUA 4O28A 5GNZA 3DEQA 1B54A 2DVTA 4HA3A 1ZUAX 1FWHC 2O4MA 4IPJA 3T8QA 1E4MM 3V1PA 2WBKA 1S46A 3TMQA 3S2MA 5C2XA 4U2YA 2XJ7A 1ISYA 2VOTA 1HKWA 5I23A 4QNWA 3W7GA 2O7QA 3BG9A 2E40A 4ILSA 5J5RA 1EHAA 3W85A 4DJEA 1V77A 1W5PA 2QDHA 3TYCA 3RYSA 5CZKA 2VR5A 1Q7ZA 1Q6QA 4PFHA 3WFZA 1LBLA 3R12A 4CN1A 3DECA 3SDOA 3ATZA 5ENLA 5TF0A 3W75A 4C1LA 2FTYA 2NVCA 2QF7A 2OLSA 1Q65A 3QH2A 1G94A 4I7VA 4NZFA 3IJ8A 3E2RA 3FXGA 2ZZ6A 1XICA 4P5UA 1NEYA 3SZ8A 3N29A 1LRQA 4OHQA 1YPIA 1JDCA 1HP5A 3VM7A 2HPMA 3N1AA 5KZMA 4S3CA 3WL1A 4EX4A 1XWYA 3E0VA 4LYRA 1WB0A 3V0SA 4KQNA 1YHTA 4CCDA 1LG1A 1P0EA 4CCEA 1E3XA 1CGVA 5AYXA 4YCOA 2PURA 5G1MA 2PE4A 2FJUB 3HGRA 2VI0A 4ZO6A 1N2VA 1CLKA 4MJ2A 4AIBA 1DVJA 5H6HA 4ZCWA 3CM4A 1S2UA 3L0KA 1ZSXA 3AIWA 4GLEA 1V08A 4XAZA 1PV8A 1BWLA 7CGTA 7ODCA 4K38A 2OLAA 1E56A 4UTTA 4MDPA 4RLIA 2Y7DA 1BSLA 1RD6A 4QQUA 4H83A 4PTVA 3W1QA 3CLMA 2YDAA 2CBIA 3H2AA 1GVQA 3TW6A 3NQ2A 3TJ4A 3P60A 3NGFA 4Y96A 2YCJA 3RU6A 2VRKA 1LQ2A 1UWTA 3GK0A 1WBJA 2EJAA 5FF3A 2BZNA 1SJCA 1ADDA 2D20A 3FLUA 2NZLA 4A4AA 3E1F1 4HOWA 4LUSA 4YWSA 5C9WA 1N7KA 2OQYA 1O7AA 1LL6A 2J24A 3N15A 1UKPA 3LQLA 2YLLA 3HB9A 3N25A 2PCEA 3WK2A 3UWVA 3NQBA 3M7WA 1XDLA 1FCQA 3OYZA 3VOHA 1UH3A 1PX3A 4W93A 4K1GA 2W92A 4XTIA 4PULA 1L8NA 2BTMA 3G8EA 4DWSC 3CNYA 4DQWA 5PTDA 1OIFA 3IGHX 1DJNA 4HVXA 3WKZA 1IR2A 2VFFA 1SFLA 2FDSA 3KLLA 3NDZA 1EP1A 1G4EA 4GIYA 1EIBA 3WJZA 4RX0A 3QV6A 5AC6A 1MI3A 1W17A 1AK5A 1LDCA 4XD4A 3WQEA 4J3UA 2ATMA 3SQLA 2R9RA 4O1BA 1P6CA 3IAQA 1E71M 2GUUA 1H7PA 4J3TA 4LU0A 3VGHA 5I2UA 3MVTA 4S3JA 3T05A 4M5PA 4Y9PA 2VFEA 3JUGA 1K6WA 1ZHAA 2PDLA 3LOTA 3E2QA 4NT0A 2B7QA 5BU9A 4AEOA 2CZFA 1ZBVA 3DCPA 1FUYA 4GZIA 1JZ6A 2WMIB 3HGJA 4AX6A 4TOQA 2REQB 1HT6A 3WJSA 1IXPA 1POJA 1CB2A 3M07A 2SFPA 2DJLA 4RE4A 3KOYA 3QMSA 4LRTA 3V35A 4MNLA 1X7FA 1XRVA 3GLCA 2E7FA 2O9RA 4KCTA 4E5TA 2IPJA 6PTDA 4YIWA 2I5GA 3S4TA 2J6VA 4R34A 3M5VA 1SZNA 1AMYA 4OU1A 2B81A 2DZWA 1OB0A 2Z00A 3QLDA 5FJTA 1CW2A 2OQHA 3RM9A 1WDDA 5U4NA 4RE3A 3PSWA 3VKCA 1WZAA 2E6YA 3IV3A 2FPTA 1E51A 3ABZA 3E0FA 3VOGA 3MZ2A 3WYZA 4AIOA 2W6RA 3BQ5A 3AIBA 1Q8AA 3AAMA 3M46A 1LTDA 1OFRA 4GE8A 1FH9A 4HT3A 1XLBA 1XH0A 5D4YA 3BOLA 3GO2A 1KGUA 1HP4A 1GORA 1UP0A 3T2OA 3SFWA 3U6WA 1OX4B 5G1YA 4UMAA 2ZZ7A 2ZRWA 2JBMA 1YADA 3LXBA 4E4PA 3VKBA 1XYZA 2Y1HA 5GJNA 5DQPA 2QKFA 4CKQA 3W2UA 5D2WA 3MSRA 1W1IE 3TE9A 4A2SA 4ATWA 1L6FA 1MDLA 3FKKA 1K70A 1ZALA 4MYXA 3BZJA 1TQJA 4O1CA 3IVUA 2GQAA 3VZYA 3DG6A 1LBFA 4M3PA 5IOBA 2A79A 3NG3A 2AQWA 4FNPA 3A3WA 2QUTA 3S1VA 1ITQA 3GQYA 4DXXA 3ZJ7A 1VJSA 3M0KA 3PZQA 3TROA 3QQ1A 1YQ2A 1M65A 1P0NA 3HA1A 5SWUA 1UQYA 1J8VA 4RV8A 1OVDA 1W5MA 4IM4A 4HQVA 2HMCA 4LY8A 3SCVA 2INEA 4H2HA 4FA3A 4W8AA 3GDMA 7TIMA 2YYTA 2IUZA 4IGNA 4UTLA 3L7RA 1AA1B 4E2OA 1FWTA 3EX3A 3DFNA 4JIPA 1O12A 3MT1A 4BQ2A 5AC4A 3IUDA 1Q4NX 1SGJA 5KSWA 1QW9A 5CZJA 3WH5A 2J6XA 4ERIA 3QSRA 1GOMA 4NAFA 1NWSA 1MEIA 3QZ6A 4QR6A 1VLIA 2PBGA 1U33A 3DGBA 2NXHA 4JBRA 1IXNA 1FVPA 3IIZA 2F9RA 4XD5A 3CUHA 4A2RA 4WKFA 1VGAA 1J4EA 3ITLA 3ZLGA 1FOBA 1RVKA 4H1ZA 4DELA 4R88A 1CTNA 1DWJM 5H91A 1DE6A 1R3VA 4HCHA 2C0AA 2FPYA 3LPGA 3PFMA 5CGTA 3OPSA 2CIPA 4X61A 4W9TA 2CWNA 3CL7A 1RJPA 4GUGA 4MJZA 4M80A 4Q4QA 1RCOB 3A47A 3U7VA 4OQVA 4E4UA 3MWCA 1IWPA 1R9YA 3B8SA 4M24A 1F3XA 1OCNA 1KTBA 3ZSTA 1TZ7A 1E1FA 2WCSA 4IWWA 2NV2A 4HMCA 2VC5A 4P8VA 1W9UA 1HJQA 1ENUA 5A95A 1UR3M 3B8DA 1OHLA 3FK4A 1XLHA 4LB3A 4IXXA 1NWUA 3UPMA 1MZHA 3MUAA 1XINA 4YL2A 1S1RA 3QLLA 1SVDA 2DV0A 3FHQA 3ZT5A 4LGXA 3ITGA 3KDNA 3PM6A 2G97A 3W7KA 3B0UX 1Q6GA 3HZ3A 3WJXA 2FGLA 4GQRA 2IKHA 1KBLA 3LRMA 2XU2A 1AJ0A 2OEJA 3GU1A 4P61A 2VHLA 4GWEA 4BI7A 4B91A 4LSBA 4YJ5A 4DUXA 5IBXC 3SCQA 1YE6A 2ALRA 1VB9A 2CLHA 2V81A 2YCLB 4GKTA 2J7FA 2OX4A 1H3GA 2X1TA 3CIVA 3POCA 1A5KC 4H9TA 2R94A 3K5XA 3STCA 4C6PA 2ALDA 4QGCA 3VD4A 3NUKA 2GDVA 4AIEA 1ISWA 1DWIM 3I7RA 4ZXOA 3OW1A 1TUFA 4PODA 2VGFA 1WDSA 1V0MA 3CAVA 1BXBA 4YVPA 4ZOEA 3M0HA 1K7EA 3S9ZA 5HR7A 2OGYA 4JTLA 2E77A 3GC5A 7PTDA 4E3VA 4MAZA 1DIDA 4DO4A 3CUFA 4AY7A 5H8PA 1I0BA 4M6UA 2DZXA 1OYBA 3PUGA 1J96A 2D3LA 3KOFA 4L4MA 1RPKA 1DHKA 1YXYA 2F7FA 4IGHA 1XD0A 2GVLA 1A5MC 1JI2A 1ZNNA 2XYLA 3APTA 3OHIA 4MAVA 2J88A 2A5HA 1WKYA 4N9DA 2VYOA 2XVNA 3SRHA 1YXCA 2ZXBA 1U83A 1V6XA 3EDEA 4M51A 3K8MA 3NSMA 7ENLA 4G7FA 4L64A 5BROA 5DT7A 3V4BA 4QLLA 4IJBA 4H7ZA 1EPVA 4JIHA 4YCPA 5A8NA 2ZA2A 5M1TA 2BGSA 1H63A 4OT7A 3VC6A 5FJUA 4CNUA 4O54A 4YHGA 4J4KA 1DQWA 1XIDA 4GD0A 1VBGA 2QVHA 1R2RA 3M0XA 1WA3A 4HNOA 2WZEA 3WFAA 5C55A 3UA3A 4ZO7A 4L61A 4GX8A 3WD1A 5CC3A 3ARWA 2REQA 6ENLA 4ERGA 3TNOA 1EJUC 1A5BA 4J3VA 3RCMA 4FMVA 1BRLB 1WDPA 3SGUA 3GE7A 3CMFA 3S42A 3QTGA 5I3HA 1VYSX 4QLJA 1ZL1A 1VFHA 3N2OA 3DC0A 4JTQA 1JZ7A 3W86A 1NTHA 1FQ0A 2XVKA 3CZKA 3ES7A 1QNPA 4F3HA 1TJPA 3EWZA 3ZZ1A 3IGSA 4CQBA 3LCHA 5XIAA 4WSHA 4W85A 4H9MA 1H1ZA 3TIMA 5C0QA 1GWJA 1FCBA 3H8AA 3R0UA 6CGTA 3NOYA 3SM0A 4UNLA 3SN0A 1NFBA 5BNKA 2E67A 4UTTC 4AIUA 4Q4OA 1PKLA 2YOCA 3O63A 2E1WA 1MW1A 4BKNA 1TKKA 1KFJA 2NX3A 1M3UA 3AXHA 3ZMRA 2ASHA 3NVDA 3LUTA 1ZJHA 3GH4A 3FYOA 3P0WA 4UZSA 4QXIA 3IIOA 1HJUA 3R8RA 2VUYA 4XUGA 5MKGA 4JL2A 4CNNA 1R2TA 2HVOA 1TTPA 1YE4A 2VC9A 4HB7A 2BOFX 3VUSA 4F66A 2OKOA 3SBFA 2R1MA 5CSRA 3V0TA 2GJPA 2Q3RA 3GXMA 2QPXA 4L6DA 5EFFA 3S5SA 2PBOA 2OFJA 3AHVA 1FA2A 4IF2A 5A6BA 4HKPA 3NQMA 4OBTA 4H19A 5EFDA 1JPHA 3Q37A 3A5FA 3WCZA 3IEBA 3A24A 1TPH1 3MJMA 1HKVA 3TMLA 3KUMA 5I5RA 1FWIC 1Z6KA 8XIAA 1V02A 2CITA 4R5EA 3G0SA 2RDXA 4A8NA 4MWAA 4WQ6A 1WOAA 1P4CA 4DYEA 3O6CA 3TYDA 5CSSA 3URBA 3BTNA 3K8LA 1W9XA 4QG8A 1OFQA 5EMMA 1XGEA 3WBAA 1P48A 5E5CA 1TMHA 3CQIA 1UPMB 4MIMA 4AAJA 3PTQA 1OG0A 3GW3A 5AHEA 4JFUA 2PDMA 2G3JA 2B7NA 3W7RA 2BP1A 2QCHA 3T2PA 3TZFA 1L6SA 3GH5A 4N6EA 3TDFA 3VUPA 3AI0A 4NAEB 1XCFA 1XIMA 3DHPA 4LC6A 5LXEA 1ZTVA 3PJXA 1W5QA 4GKLA 2VEFA 5F4WA 4L9YA 1KFCA 4PMQA 2DORA 4I5RA 3WF1A 1GW9A 3OIXA 1EB3A 3GVRA 1QWKA 4HPJA 5D2VA 5CH9A 4OE7A 4RPPA 4RL3A 4A6GA 1SR9A 3UXIA 3PANA 4HSOA 5C2GA 2HXTA 4DWDA 1SMDA 4PRTA 2PD9A 2ZFAA 3UCDA 3I10A 2ZRYA 4F0HA 5I02A 1E70M 1JPMA 2NUXA 3LYEA 3RMEA 4C1KA 4AFYA 4PEEA 4KGLA 3W1AA 1ZJAA 2Z1XA 1MUWA 4UUIA 2W27A 3GHRA 4RNJA 4B5NA 1T96A 1SJAA 2I14A 3GM8A 4MKNA 1EJRC 3W1TA 1UMYA 3EOLA 1XLEA 2EBNA 1BVNP 1DWFM 4E0CA 3GIPA 1R5YA 2CKRA 4GYPA 1I4NA 1BTCA 4I6KA 2PLMA 4I6VA 5C7VA 3O06A 3ONCA 3W02A 1VEMA 3TA6A 1L6WA 3J7HA 3SUWA 2V5DA 1PKNA 4AD1A 1EJVC 3WQPA 4LS2A 3W2KA 3WNMA 1UKSA 3FAXA 3PJWA 3PUOA 5AYZA 3OYXA 5F7UA 3WEZA 4A8IA 3MCOA 5EBAA 3CV2A 1RR2A 3UZJA 2RDWA 1K8YA 4YVVA 2FFCA 2OT0A 3LRLA 1K4HA 4UNKA 1MUMA 2Z25A 3BQ6A 4MZ1A 4JDBA 6XIAA 1GZJA 1QO2A 3BAXA 2TRSA 1X1NA 3CWHA 1UD2A 3KXQA 4AZBA 3TTOA 1F4HA 4NJJA 2WKLA 3ITVA 3K4AA 4IZGA 5J04A 2QV5A 4XZMX 2PDQA 2YCLA 4AWUA 4JDYA 1HKJA 3AS3A 4KIRA 3A12A 3A4WA 4B9YA 1KCLA 2Z6JA 5CAKA 3GDRA 3GG0A 4REQB 3VD5A 3EXRA 4PSRA 4K8HA 3L67A 3NGJA 1PBGA 5B7YA 1V6TA 2PWFA 3QN3A 2HV5A 5HR6A 2WBGA 1QNVA 3PF3A 3M16A 5AYYA 2Z1WA 4YS1A 5E0CA 4FR1A 2J7HA 1UWSA 2AL2B 1TV7A 5DMNA 4FXFA 4WKHA 4XSLA 3BJFA 2J47A 4LAZA 1JZ3A 1GNXA 4IJRA 4KEMA 1KRCC 3IRDA 4G6CA 3RX2A 1OQFA 3W88A 3VI2A 4CQCA 2CHNA 3B9AA 4EF8A 4GZ7A 4IFKA 2A6NA 5FI8A 3EBVA 1NDWA 4G2DA 1XSJA 3T07A 5C9RA 5K3VA 4JYEA 2O9PA 3PZOA 3EEZA 4Z1DA 5CEWA 1TPDA 1C91A 1Q13A 2PDGA 4LEFA 2DPEA 2VUNA 2A3EA 1OINA 1JF5A 1AMKA 4CCZA 3B04A 4F0LA 3G3MA 4R27A 2FTPA 5M03A 4Q22A 4PL2A 2WCAA 4PTNA 3TJXA 4B2DA 1JYVA 2EG6A 4B16A 4AEEA 3A9BA 4CLMA 3PTKA 2PGRA 2X2YA 1MZRA 1V3KA 2A7RA 1UBPC 3OGSA 3TWAA 3ZT6A 3KVJA 3NCOA 3KEHA 2ZDRA 3TW9A 3USZA 2XTKA 1XQKA 3KCOA 5GVJA 3WH9A 2J9XA 4IP7A 1BRLA 3PBVA 1CWYA 1K03A 1AQHA 3LGDA 5CCZA 1AZ2A 2J75A 3W1RA 4EE9A 1TJRA 2Y85A 3EMZA 1NSJA 2VZUA 4L65A 2QMKA 4QX4A 2Y5EA 3TSDA 3WK3A 3GDTA 3CZJA 4O50A 4W7WA 4HA1A 2WMGA 5BZAA 3FV9A 3L0GA 4OZOA 3CQHA 5I7GA 1RHCA 2JEQA 1IF2A 2TAAA 3OZOA 2PDNA 1O4UA 3MWAA 1EDQA 4P7RA 3WL0A 1F73A 1GYNA 5C9UA 1B3ZA 2F8QA 3HG3A 1YW1A 3ENLA 4PUKA 4AMCA 1BD0A 3NJ3A 3R25A 5AC5A 1Y65A 3N2MA 1GQIA 1H4PA 3C52A 3P6LA 5IM51 1QK2A 3C0LA 4PH6A 1XLMA 4XZBA 3WQGA 1MFUA 1CB7B 2DT2A 1TPFA 2V2HA 2FZ8A 3VZXA 3ABOA 3D3FA 3TJLA 2Z24A 3E9AA 1J6OA 1J9YA 3K2GA 3NR0A 1IWBA 4G1KA 3S1XA 4WD0A 4TVUA 3NFUA 3DENA 3WNPA 4Z2IA 1U5HA 1Z3NA 2BOGX 4H8UA 4DZHA 4PUMA 3F2DA 4L1XA 4W7VA 2Z6IA 3L4ZA 3VYLA 4MF4A 1RP8A 3B05A 3TONA 4IG2B 3HQ1A 4WVXA 4PB3A 3A5VA 1O5QA 2FVLA 3KRZA 4E3TA 5TD4A 2BMBA 2RGMA 1W31A 3UP8A 4XZWA 4EPBC 2XVLA 2WJFA 3YPIA 2ZX9A 4S2CA 4JTCA 3BPWA 3LBMA 2ZZ3A 4PMRA 1AVAA 1UD8A 3ARQA 4MB4A 2ACUA 3DIPA 1BWVA 3I6EA 5ECUA 2XGBA 2BXVA 1NARA 4TMBA 2G0WA 2OWXA 3W82A 1C7TA 4A3QA 1HGWA 5T8GA 4ORMA 3IJQA 4Y9MA 1DOSA 3SFKA 1MDRA 1G6CA 5A2AA 1SO6A 2OMAA 4DN1A 1LRNA 3C8NA 2Y6ZA 3A3HA 3FJ6A 2YL9A 4RZ4A 1XDJA 5HJXA 3BLDA 1J0ZA 2CESA 1HXJA 2DVUA 3TR2A 3KVLA 4KRZA 1W37A 5HXMA 4KEVA 4GFIA 4BQ4A 3BLKA 1EGVA 4MSSA 3AZTA 3PTMA 1WKDA 1W32A 4QTGA 5E9XA 3GH7A 4E2BA 1KXQA 5A69A 4HA0A 5A8MA 3URNA 4XZLX 1JCLA 4RZ6A 4XD6A 3ABRA 1LT8A 5ABFA 2CLEA 5DY3A 1S2AA 2YPIA 3PC0A 4LS1A 3L4VA 4US5D 3ANVA 1BG9A 1E43A 3P0XA 1X6UA 2V3DA 3BICA 3T81A 3M6DA 3TUUA 2A3BA 3BV7A 4GJIA 3UXAA 4Q6JA 1D9EA 2ZBTA 2E0PA 2VCCA 4EK7A 2BHUA 1VFOA 1QUMA 4W8BA 3ITCA 3MANA 4LNYA 5DX7A 2INZA 4LAOA 1LRTA 3LDVA 1VZWA 1TCDA 4C6KA 1LWJA 3L4YA 4XB3A 8XIMA 6REQB 3MTWA 2J27A 3KL3A 4GI4A 1QRQA 4EKJA 1EIXA 1PCWA 1QK0A 1D8CA 3SY8A 1UASA 3I3EA 4Q7NA 1IIHA 2Z2AA 3H2CA 2PRHA 4HU4A 4GCXA 3VOFA 3VKKA 2J9YA 3SCUA 4C7FA 3CQKA 3EB2A 5HPOA 4IGMA 3HG2A 1R7AA 2HCVA 4GBDA 1IIGA 1RK6A 3R0KA 1VHCA 2PDYA 3O6YX 3M64A 2H6RA 1XYMA 1XRSA 3NQ7A 3VIKA 5B80A 4DRSA 1XYCA 2XFYA 3U48A 4JTKA 2VDIA 3GUGA 5HQMA 3AZRA 1LM1A 2VC6A 1QU4A 4IP5A 4XWUA 1XH1A 4UFHA 3KS6A 3KTXA 2A2IA 4LPCA 1MSSA 4FX8A 4IXHA 1BHGA 4ZOAA 2VEGA 4I9TA 1H5VA 3P3BA 4Z17A 2NWRA 5M5DA 4REQA 4A8RA 2OVLA 5TIMA 3XINA 5LNRA 3PZ9A 2ISDA 2XIQA 2YXOA 3LSCA 3EYPA 3VMNA 1K1DA 3ZQ9A 4FP1A 1IWAA 5BWFA 1W1YA 3QC3A 3C0JA 1NOFA 3T0BA 4LUIA 4RDZA 3UERA 1XSIA 3GTIA 2AL2A 4JHOA 4MPKA 4BFAA 4QS5A 1EP2A 4MG4A 3CIXA 1T41A 3LSBA 2V2CA 3MI2A 4ADSA 2Y70A 1HL8A 3ARVA 3R0DA 2V67A 2J7BA 3I4EA 1MEHA 1GPWA 2R6OA 4JICA 2QUUA 1ADSA 4F0MA 1W1VA 2WJDA 2YSWA 1XIEA 2P0OA 5I6SA 2IPGA 3H4WA 4S3AA 1V93A 3UYIA 4ML4A 3KP1A 2NT0A 3S3GA 3F5JA 3HN3A 4RUBA 3RILA 2B31A 4HJFA 5CPOA 3MZNA 3M43A 1UZHA 4J3XA 5BRQA 3W37A 2PD5A 3S5YA 2J7DA 2CLFA 1ME8A 3ZO9A 3LX9A 1UP3A 1KR0A 4LBSA 3B40A 4AZ7A 2P76A 3KDOA 2E25A 4TVDA 1TWDA 5A6MA 3W25A 1UYQA 2WWDA 3GD6A 3QY6A 2Y8VA 1R30A 1U1UA 1PSCA 1D2KA 2ACQA 2NT1A 1E0TA 1W3TA 3VOJA 1PCKA 1HNYA 5LXXA 3LG3A 1UR8A 3U5UA 1XM3A 4GI9A 1O94A 3O6DA 5I3GA 3CB3A 1DV7A 3QR3A 3AYTA 2HE8A 4D6CA 5FCZA 3HV8A 4P7LA 1DWHM 1E6QM 4FIQA 4GYPC 1QHPA 3GHSA 1MXGA 1MEWA 3WF2A 3NXFA 4WHBA 2LLEA 1WX0A 3N2BA 2D1ZA 4LF2A 5AYBA 3IAPA 2V3EA 2BDQA 3BGJA 3IANA 4JEQA 4EWND 1R87A 1SU5A 3W76A 3OQEA 3RX3A 1HVXA 3T2QA 5CQ1A 4GGBA 3Q94A 4L56A 1UA7A 2QEZA 3W1LA 2CFFA 3E2VA 4CUCA 3QGKC 4BS0A 5CGQA 3WNNA 1LOQA 3G18A 4QM1A 3CHVA 2P88A 1XP3A 2QNEA 4O53A 2PCQA 3BMVA 3IV8A 1KQYA 4MNJA 5A3HA 3BJSA 3QPYA 1TE6A 1T8QA 2DEPA 2IXUA 4J7RA 1UR0A 4C5ZA 3HQOA 4V33A 2DUAA 4ATLA 3WDQA 2GVYA 2OSYA 4O14A 3TKFA 4HP5A 1IEVA 2HEJA 3ECQA 1D7FA 3CMJA 3ABQA 4IT1A 3LBOA 2PWGA 3WDIA 4E4FA 1DQXA 4IG2A 4LBUA 1KTNA 3N9RA 5GQBA 4U5KA 2OG9A 2BASA 3ANYA 4XAFA 3Q2DA 5AFDA 4JKKA 1BF6A 5EMKA 4FS9A 8CGTA 2W67A 3GWQA 3W07A 4HOXA 1PUDA 3UR5A 2WLZA 4JCLA 5LGXA 3MUCA 3BCDA 3K1DA 4CQDA 4CU7A 1NM9A 4KFPA 4Z42C 3PZTA 2P10A 4AISA 3B4UA 4HZMA 2P8CA 2YX0A 1J0IA 2VFHA 5K9XA 2D24A 2PDJA 2VVSA 4LVGA 1AQ0A 3KCJA 3RPMA 3UU0A 3OQ8A 5FOOA 5DMMA 3LM3A 2QIIA 1TCMA 3KRUA 5KTLA 3LHYA 3OIHA 1F6PA 4BF9A 1S1PA 3W73A 4F0KA 3LPFA 1RV8A 4LYQA 1LOSA 2WQPA 4AUBA 1DIOA 4PMUA 3O8AA 1XYBA 3ICJA 4N0RA 1EZWA 2E6FA 3QY7A 1JZ8A 2I1OA 3MW7A 5I3DA 4QIUA 4X0NA 4AQLA 5U7SA 4LW7A 2PA6A 1V3HA 4YTSA 4O17A 1DXEA 3LS9A 4EACA 4JX4A 1J79A 3H53A 4H2CA 3C5QA 1E4IA 2J77A 4Q4MA 1DEDA 3C4UA 2PP1A 4DIAA 2FHCA 3MMDA 2H90A 4TX6A 3QQ0A 5HQLA 4A8LA 4L4OA 1SPQA 2FMNA 4X63A 5D09A 3TR9A 2QJMA 3AS1A 3CQJA 4XTDA 4O0KA 1J2BA 3W00A 4TVCA 4C6JA 2O9TA 3ZWTA 3MVIA 3VO0A 4GIEA 4DPQA 6REQA 3R5EA 1P6BA 4ZO9A 4AH7A 5JQ9A 3F2CA 2VZVA 5JXQA 1TV5A 3QGAC 1SZEA 1C29A 4D71A 5DELA 4QJ5B 1M5WA 3EWYA 4F0SA 5G2HA 3EA3A 1HKMA 1RUSA 3GVWA 3LI1A 2VX4A 2B0MA 3N14A 2ONEA 4Z2HA 3E5BA 1F4AA 4BQ3A 4KETA 1DJQA 5A2BA 4RCXA 2DSKA 3CMGA 2FQIA 1KFWA 3SADA 2QDDA 2ESCA 4JFSA 1Z44A 4AVFA 1H7XA 1XX1A 3ATYA 2QV4A 4WUIA 2HDJA 4UCFA 4KERA 3HPZA 3B9EA 4PGLA 3R4IA 3SCOA 3TYUA 3KBNA 5JMUA 2BG5A 1KD0A 2OGJA 3G0UA 2C14A 4IGSA 2YL8A 1UG6A 2Z27A 2JALA 3ES8A 5AC7A 4DO7A 3RDKA 2W91A 4POCA 1KM0A 2AMGA 3L68A 2GSEA 1EPXA 1XBYA 1G67A 1GK8A 2X16A 2ZIDA 2Q02A 5EA9A 5EKYA 2OELA 2BVDA 3FXYA 3M5YA 4NQ1A 1KM4A 1PX4A 2Z7GA 4LF1A 3E0WA 3PBMA 4A35A 3QHOA 5FIPA 3P7YA 2FGBA 3EOOA 3T0CA 3USBA 1QVBA 4JKMA 1BKHA 4A3HA 1V6YA 1PTGA 1E6ZA 4PTDA 2D2HA 4N4QA 1XDMA 3AO0A 2X0HA 2WHLA 5K7JA 2C3ZA 4DO6A 4Q8WA 4KH2A 3LN3A 2P50A 3EX4A 4RZ5A 1OZMA 2QXWA 1XL9A 4NYYA 2J13A 1B57A 2ABBA 2F2KA 2PMQA 3BAWA 2Z29A 4LFYA 4GA8A 5ABEA 8A3HA 4AZ6A 4WKAA 3W4RA 2ZE0A 3GVGA 2RUSA 2WNQA 1OT1A 5AB3A 3KHJA 1EFZA 2QJHA 2CC0A 2E8ZA 4MFEA 2WZTA 3RRXA 3IGUA 5FL0A 4D6HA 1QAPA 1A5UA 4DF2A 3AMKA 4GYJA 2EPKX 3O2LA 1HJSA 4LCSA 2OODA 1SFJA 4K68A 4RXFA 3C2OA 3N6HA 4UTHA 3GKAA 1NY1A 3GYEA 4OWGA 1LWIA 3VNYA 4XBSA 2CLPA 4ZTYA 2GSHA 5E70A 3W83A 4B3KA 1NFPA 2V5KA 4Q8QA 1CECA 2CEQA 5G4HC 4F9DA 1P7TB 2HSAA 1W1TA 1B2YA 2PWEA 1B4KA 3KW3A 3BG5A 4UMCA 4FXRA 4U3CA 4XKMA 5A6AA 2WJEA 3E96A 4PYSA 1KCZA 3PHAA 1WKFA 1BXCA 2ISSA 5D02A 1W1A1 1F9CA 1Q6EA 3KBMA 1LYXA 3RCYA 3NQDA 2D2OA 4JX6A 4R9OA 3P61A 4DBUA 3OGVA 4WK9A 4JIEA 3AICA 3LHVA 4ZL1A 3VNMA 1EOMA 4LXFA 3HFTA 2VEKA 3NPUA 3EDFA 2PP0A 1QW7A 3EWWA 2HXUA 1E6XM 2V63A 4ACZB 3JVAA 5AZ1A 2VZSA 1U30A 4KWOA 3BMXA 1CENA 1TTIA 3DFQA 2VNCA 2F6UA 4IMAA 1RBOB 4LQ1A 1J6PA 3WD3A 1B31A 4O13A 1BG4A 2DQWA 3S1WA 4UQDA 3N4AA 1K7XA 3ABSA 3WNLA 2ZTKA 1GKQA 3FSUA 4RNIA 3EOSA 4AHOA 3RMJA 4BEQA 1UWUA 3D3AA 3SGGA 3PJUA 4GUFA 9XIAA 4BF5A 5IDZA 2WNNA 2Y5SA 5KINA 4KEUA 1Q6FA 2TMDA 1XLAA 3LHTA 3IIPA 3LV5A 4CD7A 2NXIA 4UOQA 3O9NA 2VL4A 4MB1A 1CGXA 3I6TA 3WMBA 4H6KA 4LVFA 1V02E 1KWGA 1SSGA 1LOLA 4HYRA 2OZ0A 3FA3A 1MVYA 4B92A 1AD1A 2NUYA 3QQWA 3CZEA 1YEYA 4UC5A 1OSEA 4ZOCA 3KP0A 4HPNA 2XUCA 3GZ3A 1XHGA 1Z9AA 3N13A 3G1YA 3WH6A 4X60A 3O1NA 1AQFA 1NELA 2FZNA 4FB7A 4HK7A 2R91A 2WJZA 3AYRA 4L9XA 5BOFA 1OK4A 4KRTA 1G7VA 2A4AA 1U5JA 2Z2BA 2R1PA 3VX0A 4PC8A 3VIGA 5A6SA 4ZSUA 2XM2A 2NW0A 2XFFA 2FGZA 1PS9A 3MJYA 3C6CA 4K37A 1US2A 2IQ0A 1AH3A 1V3MA 3MV11 4YNGA 3O15A 4PMOA 1FXPA 3LTYA 2YA0A 2ZC8A 2CU0A 4IL2A 3BCFA 3NYDA 3P82A 1E0XA 2EAWA 1LCOA 2E28A 4UTWA 3WZ0E 1VJIA 4I9JA 4Q8MA 4DB7A 1EEXA 4D6EA 3IJIA 1UP2A 1B3OA 4WOZA 2OEKA 1SSDA 4J2PA 1H0IA 1YIXA 4H04A 3E3HA 4CU6A 1EXPA 1G0CA 1BYCA 2NQZA 3B8TA 5KZ6A 1U22A 1EJ7L 3RN6A 1KM6A 5F2LA 4C6IA 4X0VA 3RJYA 3GR8A 4NKCA 2RDTA 5AY7A 4LC8A 5F1VA 3WUFA 3F4VA 4QAIA 1I1XA 4AEFA 3UWWA 1PWLA 4B3ZA 3V5OA 1HQTA 3EWXA 2FVKA 3HGSA 3MKKA 2JE8A 4JN6A 3STEA 3QPEA 1O60A 5H1WA 1JD7A 2G3IA 3QY8A 4MJ4A 4J35A 3R10A 5CPSA 3F4DA 1OCJA 3RO6A 5C6MA 1KNWA 2FLIA 3KL0A 2E3ZA 3T7VA 1EOKA 4IPPA 3Q58A 3UD6A 3AHYA 1F8MA 2W62A 3FDKA 2DUZA 3ME3A 5EBUA 1HJXA 3W2JA 3CV7A 4ZFCA 2Y7EA 1VR6A 4BA0A 4B9ZA 1JIBA 4IPNB 3A4AA 2WSQA 1J0YA 2ATSA 1JZ4A 2NX1A 2PZNA 3QV7A 4DM2A 1PZ1A 1SMAA 3ZXWA 4DUWA 4FI4A 5CJNA 4AD5A 4N2YA 1B3WA 3WQOA 1W3JA 4H9UA 3P84A 5ABHA 2G95A 3CU2A 3TYEA 4DI8A 5DN1A 3ZOAA 3DKLA 4Q4KA 3FFSA 2CLLA 2CLMA 5HWNA 1M7XA 1KM3A 3B0XA 3EDDA 3UZYA 5LGZA 1GVFA 2CZDA 1EC7A 3W7LA 1EUNA 3AMCA 4W89A 3IJ9A 3K8KA 2P53A 4XD3A 1FDJA 2QJJA 3LRKA 4NI8A 3LK6A 1EO5A 2H9AB 4PMXA 3KLKA 2Z1BA 3CTLA 4JEJA 4LVBA 2VVNA 2ZZ4A 3VNZA 3TV8A 2CERA 4QG9A 4QBXA 3RJXA 2VZOA 1B1YA 3FCPA 3OLDA 2VGIA 3UZZA 4BZYA 4WCJA 2ZUSA 1NDZA 3GNPA 1ZFJA 3D5HA 1VIWA 4S39A 3MY9A 1WQ5A 1I1WA 4YTUA 4MLJA 1JCJA 1W54A 4ZOBA 3LNPA 4KWVA 3ARUA 2UY5A 4O10A 3WD2A 1QR7A 2OKTA 1GT8A 1MQPA 1FDYA 1EX5A 4ES4A 2GGEA 3PNUA 3PZIA 3MSYA 4MNMA 4KFNA 3W72A 3L2IA 1FP9A 5CPTA 4J3ZA 3M0MA 1V3LA 2L5HA 1DORA 2OO6A 3DFYA 5A8OA 3MSGA 5IDIA 3EEGA 1KC7A 2YL5A 3CIWA 4XK2A 3VIOA 5LIXX 4NSBA 1QMLA 5FKYA 4XZHA 5KZDA 4AB4A 3S1GA 4R7JA 3M5ZA 1V0LA 4C65A 2ACSA 4JQ2A 4AYGA 3RGTA 4GY7A 4X22A 4L1GA 3HBLA 4ZGYA 4MB3A 2X41A 1FBAA 4CVUA 4QISA 3LB0A 4UWMA 4GABA 2X1RA 4KKXA 3NZPA 1L8PA 4WRHA 2X42A 4KGJA 1H62A 5XINA 4LNCA 3NM3A 4MUPA 1J01A 5CSUA 4R9XA 2EHHA 1KV8A 1YNPA 4AVOA 1F3EA 3MO4A 3OLGA 3OODA 3H2OA 2C91A 4EF9A 1YNYA 3RXZA 3IK4A 5BXRA 1XBZA 1RQBA 2EG7A 5IHSA 2YBTA 4URIA 5FESA 5E93A 1VQTA 1Z42A 2QW5A 1OFAA 3AXXA 1E5NA 3LXAA 4YWIA 2ZX5A 2ZRUA 4Q8PA 3HV9A 3QEZA 1QBBA 4JTSA 1YTEA 3N34A 1C8QA 4ATDA 3TWBA 1UWRA 1UZ1A 4P8UA 3KTCA 1OGGA 3FEMA 3O07A 3I65A 4IPLA 1CLVA 2WANA 3DG3A 5JVLA 3INPA 1DHPA 5E6YA 3W2MA 1L6YA 5DCBA 4Q8UA 1W1B1 3CEUA 4KESA 4LEQA 4MY8A 4UZUA 3VD9A 2PRLA 3TYBA 1CCWB 5C9ZA 2PLCA 4C91A 2J8GA 2HK0A 2EEXA 4KMQA 4JHZA 2E9MA 4HPXA 1YLVA 4CQ8A 4TQTA 3NM1A 2WXDM 3CK5A 3SCWA 1X1ZA 1BYAA 1ITXA 3SN4A 1XYAA 1NWRA 3HO8A 1M7JA 3W81A 4NZ4A 4PUJA 1F5ZA 2W4XA 1ML1A 3CUJA 3H7VA 3VGDA 2YCEA 3G24A 2Z1KA 3SR7A 2NVAA 3K13A 3TC7A 2XSXA 1W1PA 1CPUA 1QO5A 4OBSA 1UKTA 1GQNA 2BODX 5AYIA 2G3FA 5FF2A 4GFSA 4TV5A 3I3DA 4IL0A 1JGMA 3KRBA 1H11A 1KBKA 5A8QA 2FPVA 1D3GA 4FOKA 5IBXA 1EDGA 4WJ8A 5RUBA 2JQXA 3RLUA 3TYAA 2BWGA 4O19A 4KBXA 1IXQA 5DLCA 1VYRA 2CW6A 4YHEA 5IRPA 4WY0F 4O4WA 3G1RA 1CDGA 1DQUA 2GVGA 3QYSA 2A21A 4WDXA 1M01A 1SW3A 1V4YA 3BZGA 3GZAA 3P80A 3L0NA 4OKDA 2XISA 2Q3OA 4V27A 4IIFA 2VQUA 3WJWA 1FTXA 3SJNA 2ZX8A 2O92A 3KWSA 1Y5WA 4XG1A 4DM1A 2VP8A 1J0KA 2W61A 2V82A 4P7QA 3D46A 3HPSA 4FF5A 3M47A 1N8FA 1KLYA 3BAYA 3CYJA 2NLYA 3BLEA 4ADTA 3TAKA 3TQ0A 1Z41A 2WQDA 1HO1A 2ZRXA 3GAYA 1ISZA 3N4FA 4ICNA 2JKEA 2X8RA 1TX0A 5HJLA 2VOMA 3VNLA 4D6JA 1K3UA 1XLJA 2P5NA 3G8RA 3TJIA 1MQQA 3PBUA 3MPGA 4J9JA 1PHQA 1EDTA 4N9EA 1KGXA 5HULA 3VE9A 4F40A 1R3TA 2IMRA 1QXLA 4GACA 3KBWA 1AW1A 1QI5A 2CXEA 4UFLA 3UG5A 1JDAA 1LJYA 1T99A 4J1OA 2WHJA 1DXIA 1XLLA 4LTSA 2X2GA 3TTEA 1HIZA 4N02A 5BRPA 3Q4DA 1XFCA 2VFIA 3NQ6A 3FOKA 2Q09A 2FJKA 1XRTA 1AJ2A 2YZRA 3GVVA 1UW9A 3QOKA 1GVOA 1TB3A 1ZY9A 2A0NA 3O0FA 4C60A 1RVGA 1GQLA 3FGCB 2QAPA 3VFLA 3TLLA 3DYOA 4QDWA 2IKGA 3SB0A 1UZ4A 1XPGA 3WMLA 1YRRA 1EBGA 1TJ2A 3ITOA 1CIUA 3ARXA 1S5VA 5EMUA 2O4QA 4GVHA 2RH9A 4LAMA 1H61A 2FTWA 4DY1A 2BSLA 2AGKA 4PE8A 4IFOA 1QNRA 3UT0A 4FLSA 2UWFA 1RALA 1UD5A 3NO5A 1NOWA 4Z08A 1M7PA 3EA2A 4CN4A 1W6TA 2JEPA 1WV2A 4IIHA 4IISA 2A3HA 1O1HA 3KZPA 2PF0A 4X2PA 5FA5A 2TYSA 2CNCA 1REQB 4JYDA 4C7GA 3NPXA 2ZYFA 2E9BA 3PNZA 5CG7A 3EMQA 3HMCA 1XS2A 2XN0A 3U57A 2H9AA 2AOSA 4HYWA 3O05A