4ZRDA

Crystal structure of smg1 f278n mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
278
structure length
278
Chain Sequence
RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNNDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of product-bound SMG1 lipase: active site gating implications.
pubmed doi rcsb
source organism Malassezia globosa (strain atcc mya-4612 / cbs 7966)
molecule tags Hydrolase
molecule keywords LIP1, secretory lipase (Family 3)
total genus 95
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zrdA00
4AB1A 5CBKA 4UBKA 3WK6A 2DQYA 3WKDA 2HADA 3AZPA 1DX4A 1USWA 3K6KA 5ALGA 1LZLA 1DWQA 4BATA 2GBCA 3PFBA 4MWSA 4DNOA 3WA7A 3KWJA 4YX9A 4FBLA 1CUYA 5A71A 6YASA 4NS4A 5JAUA 1R3DA 4GLBA 2PSFA 4K5QA 1EK1A 1JKMA 3OTQA 2GYWA 5E4TA 4RE6A 4UHDA 2OGTA 1XRLA 3G0GA 5A7FA 4X97A 4KACA 4G9GA 2WTMA 3A70A 2IITA 4MEAA 2RI6A 3OPMA 2Y6VA 1XRRA 4L3WA 2DR0A 5A6VA 3W04A 1VE7A 3AIKA 1J2EA 1BN6A 2PBLA 1TCAA 4KAFA 1WPXA 4AO6A 1A8QA 4PSCA 3EQ9A 1UK8A 3D7RA 4OSEA 5K3CA 3X3HA 3QITA 1AURA 2GBIA 2XMSA 1BRTA 3AFIA 5AJHA 4U2FA 2YASA 4BRSA 1E89A 1HDEA 1VE6A 3ANSA 1TAHA 1M33A 3R3VA 1YB7A 3AIOA 1MN6A 3BJMA 3CN9A 3D2BA 3L1HA 5HF6A 5AKHA 3TRDA 4C4YA 1QTRA 4AMZA 2G5TA 5D3KA 3DS8A 2CBGA 1XRQA 5ALPA 1AUOA 1QGED 3BWXA 5LIPA 4LIPD 1ZICA 3E0XA 4ZGBA 2YXPX 4E14A 1EINA 4ITVA 3QPCA 4CIAA 2OLEA 2BUCA 1XQXA 4ZV9A 4QLAA 3WK9A 5ALZA 4FLMA 1UZAA 4XX1A 4DSAA 3H04A 2XI4A 3HJUA 2XB6A 4IHAA 4Y2PA 1YASA 4MXDA 2HA0A 1MNAA 1IZ8A 4Y2JA 3M82A 5AH0A 4L9AA 2JEYA 4BZWA 4F5ZA 5EHZA 4JH0A 2XMGA 4H7FA 1TRHA 1R50A 4UHCA 3T52A 4B0PA 3C8HA 5HZGA 5AKKA 4AN1A 1UT6A 1QZ3A 1MX5A 4NVRA 4GHWA 2JGJA 4AO8A 4B9EA 4GWLA 4RNCA 5DLPA 4J0JA 4QA9A 3WWPA 4XIIA 3QM1A 4J7AA 4FKBA 2DQZA 4KE8A 5CH3A 4C89A 3WYDA 4IH4A 2HU8A 3ZLTA 5FP0A 2HRRA 1J1IA 5AI9A 2DFPA 4A5SA 3IVMA 4B80A 2NW6A 4X91A 4ARBA 3PICA 1XZIA 1L7AA 3DDUA 1IZ7A 1QIKA 2IX9A 5CW2A 3G9TA 1CUUA 2OQIA 2V96A 2PSJA 3R3WA 1THGA 1H22A 5AI0A 5JIBA 5AK4A 5T4BA 1HPLA 2HL6A 4LYEA 1UXOA 2ROQA 3H1BA 4N8SA 1XZFA 1CFJA 5J3JA 1ODTC 5FDFA 4D9JA 4FMPA 1BEZA 1CUBA 3DYVA 2O2HA 1XZEA 4N8EA 2PM8A 5DNUA 4J0CA 2XMDA 3RM3A 3BE8A 3I2IA 5E4YA 1VZ2A 1Q84A 3EIOA 4FNMA 1DT3A 4IQ4A 5HKAA 2RHWA 1SCKA 1YCDA 3VVMA 5HCUA 1O6GA 4INZA 2J3DA 2QOEA 3G0DA 3C6YA 3EQ7A 5LZ7A 3AZOA 2ZJ7A 1FFCA 5ALJA 5FPQA 1I6WA 1ZGBA 3DNMA 5AKLA 2QZPA 1SC9A 4BE9A 1EHYA 4EY4A 4P93A 4UBLA 4E46A 1W52X 1O6FA 4GDMA 4GI1A 1N5RA 5K3EA 3A2LA 3V1NA 3JYHA 3F98A 1UK7A 3OG9A 4Q82A 5AI6A 4QWWA 3WWDA 1XZJA 1VA4A 3HYSA 5K5EA 5FKJA 5DYTA 4FWBA 3O0DA 4ZREA 5AOBA 5ALTA 1AQLA 2J4CA 3BF7A 5F4ZA 1QIFA 5K3DA 3KDAA 5DJ5A 4W1RA 1ZD3A 1CUDA 4DNPA 4H7EA 5ALYA 4G8DA 4BCCA 4MYDA 5CXUA 3F97A 5ALQA 3EF3A 2WUEA 4BRZA 5FV4A 1C7IA 1UOPA 1H2WA 3V9AA 5LKAA 2AJBA 2VJCA 3TGLA 1UOOA 1XLVA 1LGYA 3QMWA 4G8CA 2PVSA 3STVA 2XT0A 3VJLA 5JD6A 1ZJ5A 5D3ZA 5JAPA 1QJ4A 4GXNA 1YS2X 3I1YA 1RYYA 2HFKA 2HA4A 4H18A 5K3FA 2R8BA 1JI3A 3W9BA 4UPDA 4UBJA 4EBBA 3WWEA 5AM4A 4Y2UA 4UUQA 1JMKC 1CQZA 4ZV7A 5ALWA 4C6HA 2XE4A 3EBLA 3QPDA 5JAHA 5T4EA 1XZHA 3B12A 2PX6A 3FLEA 4V2IA 3G8YA 3STXA 4BBZA 4JYMA 2OQVA 4MQMA 4C87A 3I2KA 2V9ZA 4EB0A 5IH7A 4OB7A 3PF9A 4PNZA 4J0GA 4OB8A 1AKNA 1J06A 1G66A 2JF0A 5ALMA 4GEGA 1WPRA 4BVKA 5HKBA 5HQ3B 5KWJA 5SYMA 2WKWA 1OCEA 4OB6A 1H2XA 3WJ2A 2I03A 1XKLA 2QJRA 4LXIA 5DNWA 1P0IA 1WB6A 3DL4A 5EGNA 5AHXA 3HC7A 4DGQA 2BGRA 3HEAA 3H2IA 4X3CA 2OAEA 5DTIA 2XMRA 4KEAA 4UHFA 1UKCA 1PJAA 3WK5A 3IB3A 3B3QA 2OAGA 1SCQA 1THTA 3LIPA 5AM1A 3C6ZA 3V48A 4EA6A 1WB4A 3WA6A 3KWFA 5HF9A 4A23A 2WG0A 1VZ3A 5JAOA 3F67A 3OURA 2G4LA 4H77A 4PSDA 3GELA 1FFEA 1ZOIA 1Q0ZA 2RHTA 3VXKA 4FOLA 1ZI8A 4KRXA 5JYCA 3WYNA 4BYMA 2ZYSA 4BAGA 2QRUA 2XQFA 4E15A 3BXPA 1J07A 1GQSA 4WFKA 3FNBA 5AOAA 1H2ZA 2ECFA 5ALHA 3FSGA 3DJYA 2XUFA 1EVEA 2HA7A 5I7UA 5AO9A 4QDXA 2JGEA 2FX5A 4WY5A 2WFLA 1XROA 3ZI7A 1DINA 2GBFA 3AIMA 4BVLA 3VISA 3ILSA 4P08A 2Y2UA 1Q0RA 1LPMA 1FFBA 5LLSA 5FUMA 3D59A 4BE4A 2CMFA 4L0CA 5I8PA 1CUAA 3MUNA 3FSGD 2WUGA 5A7GA 1VA5A 1GKLA 5FLKA 3BIXA 4Y2YA 1GZ7A 4CFSA 3F96A 3WKAA 4CG3A 4BC0A 2BKLA 1GPNA 3SX4A 3SK0A 4HZGA 3D4LA 1BU8A 4HRYA 5ALLA 4UFPA 4BAUA 1IVYA 1YA8A 3LS2A 4G4JA 3M3DA 1E8MA 2ACEA 3O9VA 2VJAA 3ESDA 3I6YA 3R40A 2PU5A 2G63A 1BCSA 1EDEA 4QDOA 2XQGA 2C58A 3QH4A 2WHPB 4HS9A 4Y2VA 5ALEA 2HRQA 1QIMA 2XUQA 1U4NA 4Q3KA 4TGLA 5AM5A 1ORVA 1NX9A 3B5EA 3WK8A 5AKZA 2WIKA 1CPYA 2QS9A 4B0OA 1YA4A 2WHPA 4L72A 1WOMA 2JGMA 1IUPA 2ZYIA 3O4GA 3DD5A 2HDWA 2XUOA 1GPLA 4QNNA 2Z8ZA 1P0PA 1IUNA 2OG1A 1JJBA 1F0NA 4KE9A 2EDCA 4AX4A 1K5PA 1Z68A 1RP1A 1XZAA 3QPAA 5AICA 5HF5A 3WL8A 4EY7A 2XMQA 3WKBA 4PO3X 1LPBB 4OYLA 5ALRA 2K2QB 3HZOA 5CH8A 1UFOA 3ESBA 3IUNA 5AKYA 1RWQA 4F60A 5JALA 1W4LA 3HRHA 3N2ZB 2VAXA 1XQWA 3IBTA 1ZIXA 4UBNA 5HF8A 4J0HA 1AMNA 2VEOA 3L1JA 2JGKA 2WIDA 5A2GA 3DEAA 2C0QA 4UHHA 3KOOA 1GKKA 4XWGA 1K63A 1TCBA 3K2IA 2BCEA 3VKFA 3DYIA 3G9ZA 2WJ3A 2Q0XA 1XRMA 4BDTA 3AILA 3TEJA 1EH5A 3FVRA 2XQKA 1X2EA 5DWDA 4J0KA 2ZVDA 1UWCA 1CLEA 1LPOA 4XVCA 7YASA 3H2HA 2XUAA 5JZBA 2ZJ6A 1ETHA 2WSLA 2XLCA 3D0KA 4F21A 1QO9A 2EDAA 1CUHA 4S0XA 4W1SA 2PPLA 2CB9A 2VJDA 3VJKA 3HLKA 3BDIA 2WU4A 3HI4A 3CXUA 3ANTA 3S8YA 3VJMA 4X90A 1LBSA 4W9RA 3ZWQA 2RIPA 5C81A 3IULA 5EHXA 5K3AA 3R41A 1MJ5A 4KRYA 1KU6A 4U2BA 2BUBA 4N8DA 2HFJA 3PUIA 2OCKA 3C5VA 3PDCA 1ZJ4A 1LPSA 2JIDA 1JU4A 5CT5A 2VSQA 4GW3A 1ZI9A 4BCDA 4CCYB 2BJHA 3R3UA 2C5FA 4LXGA 3DOIA 4UFNA 3STYA 4HXGA 1R88A 1DT5A 3H18A 3RKSA 4MEBA 5HQ3A 2XUGA 2XUDA 3WK4A 4MJ3A 4H0CA 4XJVA 2Y6UA 1P0QA 5CRIA 2V98A 4W1QA 1DQYA 2G5PA 3P2MA 1NU8A 5IVHA 5C8ZA 2GYUA 4HTAA 4B6GA 4K6GA 1VJ5A 2FUKA 2XQIA 2C4HA 1JU3A 4WY8A 1QOZA 4WFJA 2I3ZA 5I9IA 4B82A 3WKCA 1CUJA 5DTJA 4DSZA 3OOSA 2UZ0A 4BC1A 5CH5A 2XMBA 5K3FB 4H7DA 2GZRA 3O4JA 3KSRA 1E8DA 3PE6A 3C6XA 1XLWA 2PSHA 1YB6A 1SFRA 1GGVA 3HACA 4FLFA 1HKHA 4HXEB 5EFZA 1TIBA 2OCIA 1F6WA 1TCCA 3C45A 5D6OA 4B7ZA 1GPKA 4H35A 5EI5A 1ZIYA 4AQDA 4AZ0A 1Y37A 2O7VA 3IUQA 5AI5A 3OM8A 3LCRA 5KBYA 3IUJA 4LYDA 2WIGA 2JGFA 3DOHA 2HA6A 2VT6A 1N8SA 4DMKA 3H1AA 5ALIA 2H7XA 2ACKA 3QYJA 4U2GA 5JZ9A 1MO2A 3PFCA 3VDXA 5JADA 2OXEA 2RONA 2H7YA 4WFIA 2PSDA 5ALDA 3H17A 3WZMA 1IMJA 1ZD5A 4QZVA 1NU6A 5IVKA 5ALKA 4BB0A 3R3YA 5AK3A 2B9VA 3GROA 1A88A 3DKKA 4FLEA 2B61A 2WHRA 1CV2A 1H23A 4J0IA 4Y2XA 3WWOA 1A8UA 5BWCA 3STTA 2W22A 5FOQA 1F8UA 3DLTA 1YS1X 1AZWA 4G4IA 4X7BA 5AK6A 4HAIA 5AKIA 3WIBA 4Y2QA 2WUFA 2WJ6A 2PUJA 1CUCA 1D07A 1MTZA 2WFMA 3H2JA 1K6EA 2JGLA 2BUAA 2QM0A 1ZGCA 4Y2RA 2QUBA 3DQZA 3W2TA 2VATA 1E5TA 1MT3A 4IO0A 1UK6A 4Y2SA 1MNQA 5LYYA 4J3JA 3V1LA 2ORYA 4AZ3A 1B41A 3KXPA 1E3QA 4O08A 4K2AA 4CIBA 1CUWA 4UBMA 1TKRA 3AINA 4KR0A 2OCLA 5EHNA 1WB5A 3WKEA 2BFNA 3HABA 3UUEA 1Y7IA 2WU3A 3GUUA 3ICVA 4C01A 1XZBA 4U2DA 4F0JA 4WCVA 2C7BA 4M0FA 4H7IA 3EQ8A 1XQVA 4LXHA 5EIHA 4I4CA 1QIGA 1CQWA 4BP8A 2OCGA 2YYSA 3H0CA 2J4FA 1W75A 4JEIA 3S2ZA 4QWMA 2XQJA 2WLSA 1VKHA 4WDQA 2XLBA 1LNSA 3FWHA 1UOQA 2AXEA 4B83A 5AIBA 1BE0A 5LZ5A 4EY5A 1ISPA 1TK3A 3WLAA 4MQLA 4PQEA 4Q3LA 4W63A 2Y2VA 2QR5A 1XZCA 1N5MA 3ESAA 1HL7A 1CUSA 3G9UA 3I6ZA 2Z5GA 4Y2TA 4MWTA 3E4DA 4X71A 2QKYA 5ALXA 1CUVA 4LKOA 1E66A 2WG1A 1ZI6A 3C6BA 5ALFA 4CI9A 4DLNA 3I6MA 3RARA 4ZRDA 3FLAA 5DNVA 1SOMA 4H7JA 2JGIA 1UKBA 1QFMA 4PSUA 5JANA 2JBWA 4B85A 5EIEA 2ONCA 4EUSA 2VT7A 1FJ2A 1DX6A 2ZYRA 3R0VA 1WHSA 2WIFA 3ZPXA 1K8QA 1MX1A 3I1IA 1GXSA 4ARAA 1AX9A 1DWPA 1QIJA 2DHDA 3G0BA 2CEKA 1ODCA 3H2KA 1K4YA 1G5FA 5AKEA 3NOXA 4OU4A 4U2CA 5ALNA 2C0PA 2RGUA 4CCWA 4RGYA 5C8XA 1MAHA 5HK8A 5K3BA 3V1MA 3DL7A 5DYYA 3ED1A 1CUEA 1FFAA 5AKGA 1XZKA 4OPMA 2DHCA 1SCIA 4ZWNA 2HU5A 4DYHA 1VLQA 3WL7A 4G4GA 1C4XA 1BROA 2DSNA 1PFQA 2FJPA 1ORWA 2VTVA 1YAHA 4C88A 2H1IA 3QMMA 4DNFA 1CIJA 3CCBA 3FCXA 2CUTA 4K6HA 4FNGA 3Q8WA 1W1IA 5FRDA 2AJDA 1U8EA 2YH2A 2HA2A 3M83A 5E2IA 2Y1KA 3GBSA 1VXRA 1XZDA 1LBTA 1QIHA 2ZSHA 3I2JA 1DTEA 2IIVA 1VXOA 5FPPA 2XMZA 4BTVA 5LZ2A 3E3AA 4AMYA 3ZV7A 3C5WP 3I2HA 2O2GA 4ROTA 4Q1VA 5AM0A 1UK9A 5BV7A 1LPNA 3FBWA 3LLCA 2VA9A 5CT8A 2BAGA 2QVBA 1LPAB 2WTNA 5AI8A 3QBJA 1YR2A 3O9MA 1ACJA 4JUIA 1GT6A 4CCYA 4KYVA 2Z3ZA 3MVEA 2HHAA 1ZD2P 3HXKA 4YK7A 4CG2A 2E3JA 2Z3WA 3O95A 3BDVA 3PF8A 4X85A 1XRNA 5HFAA 4G1FA 3E1GA 1U65A 1CUFA 2LIPA 1WM1A 2O2IA 2GYVA 4ZI5A 3I2FA 4NMWA 1QIEA 1EB9A 3WL6A 2RAUA 4AO7A 3WMRA 2X5XA 4JNCA 5IVIA 1AGYA 1EVQA 3NUZA 3GZJA 4EZIA 3C70A 5CT4A 4B81A 2HM7A 3FYUA 1JJIA 3IURA 4HRXA 4YPVA 3M81A 3ZLUA 1Y7HA 5ALSA 3UUFA 1JJFA 1LLFA 2PU7A 5JZSA 1TQHA 4DM7A 1T4MA 4IH9A 4Q05A 2DHEA 4N5IX 4BVJA 4X94A 3BL8A 4PW0A 1EDDA 1LPPA 1P0MA 4YASA 3IIIA 4MYSA 3TJMA 1MPXA 2QT9A 2XUHA 4GBGA 4DMHA 3H2GA 5CT6A 4OYYA 2X76A 3FOBA 4HVTA 4KE6A 3DKRA 1B6GA 1N1MA 3WZLA 3SC2A 4QEKA 3FLBA 3STWA 1OILA 1EXWA 3IDAA 1JMYA 1QFSA 4UBOA 2OGZA 1KU0A 1W76A 4CG1A 3AJAA 4P92A 2PSEA 4IH1A 2DCMA 4X6XA 1T2NA 3W06A 2BGNA 2WG2A 3C87A 3G9XA 5T4HA 1G42A 4OD0A 2HIHA 2B20A 3C8DA 1ACLA 1CEXA 5CTAA 4AXBA 5LKRA 5DYWA 5AK5A 1L7QA 3G02A 4BP9A 1MX9A 4Y7DA 3FYTA 3D5EA 4GECA 2WUDA 1CUIA 4X6YA 3D2AA 3SWWA 5CURA 3K9BA 3F9CA 1EK2A 2QXUA 3D2CA 2ZYHA 3QZUA 2WIJA 1H2YA 4UBIA 2I78A 3RK4A 4C4ZA 1BN7A 1F0PA 5KWIA 4BCBA 5AM2A 3QMVA 1XLUA 3UMJA 4RE5A 4QDUA 3L1IA 3MGAA 1JFRA 1OXMA 1QO7A 2JEZA 4X92A 1IUOA 5KREA 5T4FA 3BIWA 4PF1A 1UKAA 2ES4A 4UHBA 1XZMA 1EB8A 2XUPA 5D7BA 3JWEA 2QTBA 5LZ9A 3ICWA 4FBMA 1X70A 5AIAA 1QIDA 3T4UA 2ZSIA 5JASA 5A7HA 4I3FA 1EX9A 4BAZA 3GFFA 5ISMA 5EIAA 3WI7A 4KAJA 1FSSA 4Y9SA 2XDWA 3IA2A 3WQHA 4X93A 4ZXFA 4TVKA 5CXXA 5ALUA 5LP1A 4FFWA 2ZJFA 3BJRA 4EY6A 5ALVA 5A62A 2B4KA 3OC0A 5HFNA 1EDBA 5C8VA 4G5XA 4KE7A 4WDRA 4W1PA 3CCCA 4Q34A 5E4JA 1DQZA 1G4HA 3U1TA 3WJ1A 3YASA 1QIIA 2AJCA 5ESRA 5AP9A 5H3HA 1GQRA 4DNQA 5AOCA 1XRPA 3PI6A 1X2BA 1CVLA 1R1DA 3A2MA 3FVTA 5IVDA 3AZQA 2GZSA 4QE3A 4UHEA 4X6UA 5YASA 3WWCA 4A16A 3PUHA 2HA5A 1A8SA 4OU5A 5C7YA 3O4IA 3JW8A 4DMCA 1EA5A 2QMQA 1U2EA 3FYUB 4K6KA 2X8BA 3NGMA 4B9AA 2AJLI 4AN0A 1JT2A 1R9MA 4EY8A 1R9NA 4DTCA 4OCZA 2CJPA 2D0DA 2OPHA 1QTIA 3LIIA 1AC5A 1S8OA 1C7JA 1XQYA 1ODSA 2J3QA 1QE3A 3H19A 2WHQA 3WL5A 5JATA 4BTLA 2PUHA 3V1KA 5ALOA 3F8SA 5SYNA 3QVMA 2WJ4A 5JD4A 2XMCA 2VF2A 2W6CX 1EI9A 1BEEA 1VOTA 2I3DA 3A2NA 4KJXA 2XUJA 1WHTA 1QLWA 1CRLA 1BS9A 1W6RA 4RPCA 2QJWA 3R3XA 3A6ZA 4UFOA 4J0DA 4G8BA 4QDTA 5AM3A 5LZ8A 5IKXA 1CUZA 2CKMA 4FDMA 1HLGA 4KAAA 3G7NA 2XUIA 1YAJA 3O4HA 1A7UA 3N0TA 2WILA 3WK7A 5CMLA 5CT9A 4HXFB 3G0IA 4PV7A 4X00A 3I28A 5BOVA 3I2GA 2OGSA 2C5GA 4FHZA 1YSCA 2D5LA 5AKXA 5AI4A 4DIUA 2HA3A 1XZGA 2GBGA 2HU7A 1Q83A 1QONA 1L7RA 1DU4A 1E8NA 2VJBA 2EEPA 4N5HX 1LZKA 4Q3OA 1ZD4A 1DWOA 4X95A 4OUKX 5HK9A 3RLIA 4DMFA 4I19A 1CR6A 3Q0TA 1HQDA 4TPKA 3STUA 1XKTA 5LZ4A 1PV1A 1HBJA 4G9EA 2H7CA 5AKJA 4P9NA 3DCNA 3ESCA 3FCYA 3AUKA 4E11A 3CN7A 3C43A 3BF8A 3HSSA 2H9YA 2VAVA 4H7KA 4B84A 4BDSA 4C4XA 2AJ8A 2WM2A 4U2EA 5JARA 2PKYX 4J03A 4ETWA 4WJLA 3MUOA 1BCRA 4NZZA 2WFZA 4JYPA 5BWBA 4M0MA 4FTWA 4H7HA 1KEZA 3U0VA 3W9UA 3GA7A 4QLOA 4QDZA 2O7RA 1XFDA 2WFLB 4EHBA 1CUXA 3VVLA 3W05A 1MAAA 3KD2A 2R11A 1WCYA 2PL5A 4LHEA 3FAKA 5FXMA 3IUMA 3G0CA 3ZLVA 1FFDA 4Z49A 2VQ6A 2QXTA 1CUGA 3FYUC 2V97A 3NWOA 1XZLA 3D3NA 4BZZA 4M0EA 2XUKA 2WQZA 1MU0A 3R3ZA 5EHQA 2P8SA 3LP5A 2QUAA 4FFVA 1R4ZA 2CZQA 5JD5A 3WIOA 2Z8XA 2FJ0A
chains in the Genus database with same CATH superfamily
3FHJA 2QTCA 4MO2A 3OE4A 4DS3A 1PVVA 2IPAB 3F5MA 1MUUA 4V1CB 5EG5A 4AB1A 3OQBA 4N01A 2X0EA 4UBKA 5MGNA 1XTSA 5A3QA 4TTJA 1RIFA 1UM9B 2DP4E 4MQFA 4PXAA 1KPHA 3F74A 3Q11A 5G3YA 1G9XA 1FC0A 3A9UA 5DNEA 1V8BA 1AS2A 3UMSA 4EY3A 3HCBA 4KR9A 1VSQA 4JCCA 4N1AA 4R01A 1FYDA 1GNPA 4NBLA 4RZQA 3MS2A 3KP1A 1D04A 2B1RA 2Q5LA 3KTAB 4R3UC 1WAMA 3WNCA 1PQWA 2FZEA 4Q9JA 4Z4EA 1JV2B 2I3BA 3CGWA 1SXJC 2ZANA 2BEUA 3KZXA 3ADCA 2DY1A 4N0PA 1E0KA 3ZD6A 2WYOA 1FL9A 1XEXB 2BFDB 2OB2A 3MWKA 4MWSA 4ARZB 2AL7A 1GHTA 3S55A 2H63A 4M89A 5KTRA 1W85B 2LUOA 2BYTA 1C8BA 1TT7A 4ZQEA 5IKMA 1V45E 4JLNA 4KPUB 3E5NA 4M3NA 1VMIA 5EIBC 2ANBA 4NS4A 2O8BA 1D6MA 1L8AA 3AKYA 4KGVA 4ZC8A 4ND3A 1DC8A 3UHFA 4IWYA 3V7YA 1Y63A 1M73E 3OTQA 1DPGA 2WYUA 3BXEA 5E4TA 5HUQA 1PW5A 3R9KA 3VX3A 1GRQA 3EXFA 4M8IA 5I4KA 4FZVA 3A25A 4X97A 4NAUA 3LC2O 2B1JA 2BZ0A 3UJ9A 2WTMA 4BLQA 2IITA 3MMPA 5IH3A 3E35A 1Z0FA 5KYYB 2BGTA 4HHEA 3AL0C 2PO5A 4ER7A 1YZFA 3ZU4A 1IZ0A 1L7NA 1E2LA 1KR5A 1OKKA 2BRUA 4IMJB 4Y1RB 3FCOA 3T6KA 1RJWA 2I2AA 4DQVA 2AQ8A 4K28A 3W04A 4JT9A 4QG7A 1YGPA 1I2ZA 3ZI4A 3AWIA 1D0IA 1L6RA 4XUGB 5J4YA 4ZP1A 3GJRA 1CG6A 2REXB 1Z4LA 4UAGA 3FUUA 3HQ4O 3IQXA 4V0RA 1W36D 2HJVA 1BN6A 2P77A 5J1SB 4N49A 3CUWA 3X1MA 2YDXA 3MW8A 1A7AA 1QGUB 1YJQA 4YRQA 3DZ8A 4KAFA 5J9FA 4F8YA 2GAIA 2WUWE 1KZ6A 1YKSA 1TIPA 1GSHA 3H42B 3MCZA 4CQMD 2NMVA 1Y9JA 1LNZA 4PSCA 3EQ9A 4CF7A 3N8IA 3NFRA 4OSEA 3QVSA 2J3MA 4J1SA 4LV5B 4MV8A 5AW5A 1EXDA 1D5CA 1UJ6A 2HU2A 3DE6X 3LX6A 3M9XA 5FOXA 1TF5A 4QATA 3L7CA 3ZIAD 1H8ED 2PGDA 4QQ8A 2W5UA 5JXJA 1IAVA 2IXTA 3NW9A 3PR2B 3QXGA 1NR7A 2CLCX 1CLUA 1WDTA 3H9BA 5F35A 1J20A 2GLXA 4NWIA 4BRSA 1GUAA 2GLUA 1V2GA 1MIOA 2EZUA 3C3CA 1E89A 2H8KA 2C29D 5HA5A 3X2EA 4DCNA 5CXQA 2FG7C 2XR1A 2BT4A 2OR3A 1FTQA 1BVUA 1TAQA 2VUUA 4JKOA 4C22A 1QUEA 3QTTA 3FMVA 3TXAA 4CLHA 2G71A 2VYND 1IG0A 1MH1A 2H0QA 4D8UA 1SKMA 3V97A 2RMKA 2O2XA 1SHKA 1YJ8A 4EGCB 1F2TB 3H84A 1YE5A 2RJNA 2Y9PB 4BP3A 2HOQA 1KKUA 1T9AA 2RFLA 1B6SA 5FL3A 4KPYA 1BFDA 1JG1A 1M10A 2D3TA 3EGEA 1P1KA 4MVJF 4HYTA 5HF6A 3F5QA 5E2BA 4EG0A 3TW4A 1DBIA 3C48A 4OFBA 4YIKA 2LXNA 1IYZA 1Y5LA 2OGWA 2HSEA 2H31A 4DMRA 5BSWA 5E1MA 4AZ3B 1ULHA 3RC1A 2JGDA 3WBFA 1EE1A 4AG6A 3GFQA 3HDJA 2ZK7A 4QO7A 5KEIA 2C2GA 1TQ4A 3CT6A 2P1ZA 1OXVA 1NZDA 1HNWB 1KMIY 1UIRA 3A1NA 1Y5RA 1TUBB 5PNTA 5BQ3A 3PX7A 4XZ3A 2HBQA 1HYQA 2AR7A 1GGKA 2QLFA 3DB1A 2JLBA 2ZT6A 2O57A 1C9KA 5B2EA 3EGCA 4JXKA 3W4JA 1JDBB 4A7PA 3T0IA 1IHOA 1F2UA 3B6MA 1TLLA 3GYBA 1DAOA 2FW0A 2F1OA 3QPCA 4ITVA 2EFJA 2GZAA 5THKA 4DXDA 1UWLA 2Q4RA 3WIDA 2WP0A 2BUCA 4MR8B 1UUFA 1TF7A 3C7KA 3PCTA 2GD1O 2JFHA 4BPRA 1W8DA 4PZZA 5A5DA 1K98A 3W8RA 4XYEA 2JI6A 4JCOA 3CB4A 2FEWB 2O8NA 4IDQA 1CCWA 2VP9A 3O7WA 4LVUA 4LYHA 4DSAA 4B3RB 4OQDA 4RCVA 4F3YA 1AUXA 3FNFA 5AJTA 1WXHA 2VZLA 1RNLA 2FOIA 4NX2A 4MZDA 1STOA 3D6NB 2E5LB 1PT5A 4Y2PA 2C7PA 1T9GR 5L3RA 2DUMA 2OFWA 1Q5PA 4DDVA 1OIVA 1JJAA 1YU6A 2EX0A 3USCS 4BX2A 1SQSA 4FZRA 4R9VA 4L9AA 5J43A 2Y68A 4BZWA 2X5OA 3DLBA 1DEHA 5F76A 2RI0A 5BN3A 3MK31 1TRHA 4UZEA 2M98A 5K4GA 4QTZA 1KOGA 1V1RB 3G7UA 2PMWB 3T52A 1R27A 3TOVA 1SC4A 3CF2A 3T5TA 4AY2A 2ZSKA 2HQRA 1S1CA 4J94A 5IKOA 1GL7A 4B0PA 3CVXA 5CEEA 5HZGA 3I76A 2MSCB 3JTEA 1XVTA 3VZRA 3TAHA 2IPMA 4TZ0A 2ZR8A 1UOEA 4RQAA 3GGCA 1F2TA 3X2FA 1VSUA 2WMDA 3ECAA 4NVRA 4HCJA 3SR0A 4Z9BA 3WP1B 1UBOS 4Y6SA 4AO8A 2PCJA 1V41E 4GXTA 4MVJD 4YAJA 2V7WA 2UV8A 4OGKA 3L0SA 2P2LA 3DXYA 3IIEA 2XHZA 2YFYA 4GWLA 5F3RA 4GKBA 4J0JA 5IJ9A 3C3AA 1MG0A 1ECGA 1MB3A 4FKBA 4KE8A 4D3SA 4C89A 2GF2A 3K0AB 4KN8A 2Y1WA 3VHXB 1ORHA 3R0JA 2JJ1A 1NOJA 3SZOA 5BSVA 5GVSA 1GU0A 3SZLA 5KDDA 1GGMA 1L5HB 1M74A 3QWHA 4RU1A 1YVPA 1UODA 1J1IA 2WWGA 2A58A 2C7RA 2YWDA 1C50A 5DB4A 1V3VA 3I3OA 4ZPXA 2PUBA 4D92A 4UXIA 4TTSA 4AJOA 1RHUA 4BLSA 1UBUS 4FMBB 1G2PA 2WJAA 1E18A 3EGIA 5EWMA 1P19A 3ASYA 1SPBS 1MO5A 5BUCA 3MBIA 4BQSA 3FFTA 4K9MA 1XA3A 1QIKA 3DEIA 4RAQA 4DR7B 5DXAA 3V34A 3MJEA 3A6LA 4WLUA 2IPNA 3G2OA 3FSEA 5ICMA 1DMSA 1NVDA 2I65A 3GLRA 1RM5A 1KOFA 1NNLA 3OIYA 4WBNA 1OLUA 3ZEAA 3P9KA 2ATVA 2ONYA 5C8YB 2R47A 1ZNXA 1T35A 3RVSA 3ZWPA 1E3TA 4GXRA 5KOJB 5JIBA 1CE8A 2A4MA 1HPLA 3OQJA 3VPAA 3GVXA 3N0RA 4LYEA 2X8JB 4KXFB 1QO0A 3EDCA 4NECA 3H2SA 1W49A 2YIDA 3QLJA 2WJHA 4D9JA 4KQMA 5K99A 3I4LA 2DE0X 3O1JC 5LFAA 1W5AA 5FUVA 2XYPA 3GUCA 2O2HA 3MSXA 2BIFA 3ABSB 1DQRA 4WNAA 4NXMB 3A8TA 2PM8A 4CMEC 2P3OA 1JWBB 5SZJA 1OFTA 3TSYA 4WZBE 2YHIA 1KAQA 1L5WA 2MSKA 4B6JA 5L3SB 3KUCA 4O2AB 1VKOA 3GDFA 3O9ZA 2VBFA 2GA8A 3BE8A 1FXWF 3OP1A 4LRUA 2XF2A 2A5YB 3PLRA 4XFKA 2F43B 4FT4A 3SS7X 4D99A 5E4YA 4BEVA 2YWXA 1R0YA 1NVEA 1IQPA 1Q84A 1PJBA 5BQPA 4CQJA 4NNPA 1Y6FA 4OHYA 1NY6A 4P36A 2IPLA 3P0RA 1IXKA 4FNMA 3PE4A 4BMSA 5LYJF 1OB2A 2RHWA 1SCKA 3FCEA 4B46A 4DA0A 3IDSA 2HK9A 3NHAA 4Z86A 1JIVA 1H8EA 4F4JA 3DNFA 5HCUA 2BEUB 3E05A 3IV6A 4JP2A 4XLTA 1GCGA 3IQWA 4L76A 5EFOA 2I5PO 2QOEA 3S2YA 2QYOA 3G0DA 3THSA 4MW2A 5AXAA 5CK5A 3AEZA 3OBBA 3KTAA 3HKDA 3AZOA 2XSZD 5ECWA 3W8EA 1B6TA 4FK8A 3WZ2A 2J85A 1DAHA 1FFCA 4DLBA 1P5RA 1QZZA 5FPQA 4A92A 1I6WA 1VSVA 3H9GA 2W98A 3TDMA 4ZVSA 4KR3A 1KOJA 5B1IA 2QZPA 5I7SA 2CD9A 4MQFB 2GM4A 1KI3A 2ZOSA 1JKFA 2FW7A 5ES3A 2IYAA 4BE9A 4UBLA 4QUAA 3V4LA 3FOFC 1R6XA 2ZRGA 3DTTA 4H3SA 4AIRA 1TYEB 4HLUC 5L7WA 1O6FA 4QREA 1U3GA 1ZKDA 1PR5A 4R6WA 1XN4A 4MYRA 4UOZA 1N32B 1WKVA 4JLPA 5IFKA 1U7HA 4U39A 1LI4A 4H1HA 5KYVA 4HEA6 2WOOA 3PQ3A 1T36A 2LCQA 1WUYA 1PT9A 4P3OA 3W2IA 4EITA 2AG8A 3A4IA 3HGTA 1EFAA 1LXCA 3U4MA 2P2GA 4RGQA 3H9QA 2HPZA 3OF3A 3V7UA 2IJGX 1NT2A 2YTZA 1DP4A 2L69A 3DCJA 1G6HA 5IEJA 2Z4TA 4GU5A 1NDQA 1UXIA 1VGQA 4IMIB 1XVUA 4MRSA 3BRWD 1P9OA 4V1CI 3GOQA 3EZXA 1Y82A 1YR8A 4R81A 1OD6A 1R74A 3TB4A 2J4CA 5KSZA 2ZCJA 5F4ZA 1QIFA 4QQRA 1HEIA 5K3DA 5DJ5A 2NYAA 4J4BA 2P2NA 4HDSB 1OJLA 4EJ2A 4BO5A 1PZXA 4AZVA 5IWCA 4D43A 2ZKLA 2V0CA 1DQNA 2RB4A 4FONA 5I8PA 2X22A 2N9UA 3BFVA 2GCOA 2IW3A 2RGXA 5LBUA 3F97A 4QBTA 1X8LA 2Z08A 3EF3A 3KYDB 4EW2A 2BCJQ 3BMOA 5DCUA 1C7IA 5LQKA 4NL4H 1UPTA 2I2WA 2DUWA 4MV7A 4E09A 1ZIPA 3ZK9A 1UWKA 1P2DA 1TUIA 4TRMA 5CCDA 3W9YA 2TMKA 2NO9A 3A4MA 4DV0B 4EYQA 1ZDMA 2H5IA 1QGOA 2YWCA 2P5YA 5HS6A 3NEPX 4J0QA 5KSWB 3I5YA 4WXEA 2XT0A 5DX1A 1NAHA 2G28A 3EH1A 3PU6A 5TMBA 2N75A 2PZ8A 5AW6A 4GGPA 4GXNA 4QDKA 3HY3A 2PRKA 1YS2X 3WGHA 3ERCA 1KAGA 2HFKA 3K1ZA 2K87A 4A27A 1RWWA 4IIJA 4GBMA 4JSRA 2R8BA 1QFZA 1T0HB 4GT1A 4MGEA 3Q10A 5SY6A 1PJ3A 2W6IA 1J4AA 4FMCF 4UPDA 1DC4A 3MIIA 1YIDA 2GWRA 1N6KA 3AR5A 4KK4A 3RYIA 1P75A 3ID6C 1DUIA 3WWEA 1RAIA 4S1VA 4IFTA 2P6UA 5AM4A 1AKEA 1JN0A 2QW0X 3RB8A 8AT1A 1IM8A 5C46F 4UUQA 1PJ8A 1II8B 3VMMA 2FW6A 3FNEA 2IP4A 4IDCA 4KSBA 2ZDGA 1NYRA 1HH4A 1OUMA 3GMIA 4DLKA 1A97A 1XDUA 4E08A 1ES9A 5LD2B 3ZGOA 1M0SA 1VL6A 2P5UA 3AONB 3CWQA 3KQSA 4ZV4A 1OI4A 2ODAA 4I55A 2PD6A 4RQTA 1KAMA 1HL3A 1M5TA 2F3UA 5JAHA 5IM4F 1MIHA 4XUDA 3G8YA 2ZPUA 5LB4A 4BBZA 3UJPA 3LUCA 2OQVA 2IHNA 5KTPA 3VYTB 3FJYA 3RU7A 2QZ9A 3RVNA 3SDBA 1YFKA 2R7NA 1O9HA 1J25A 5DKFA 4KXQA 5FWXB 3CMMA 1HETA 3DMNA 3CE9A 3QKSB 4KXXA 5KI6A 5JZVA 2XVZA 4S05A 5EZYB 3DOCA 1G66A 4P4GA 1PYGA 2HF8A 1T0PA 3EVAA 3EZ6A 5COAA 4UEWA 4KKXB 1OYOA 5HKBA 3CFYA 4ZHSA 3SLGA 3D6JA 4PGFA 3C4VA 3E7WA 2PO7A 3VH4A 1IBRA 4IJVA 4PGAA 4I4LA 3A9TA 4WVLA 5C1PA 3WJ2A 1SCDA 4I4NA 1C9YA 3U7QB 5I51A 3BZUA 1W0JD 2QJRA 4YJFA 2EFGA 1YB5A 2FEKA 1IJBA 1H2EA 3H9EO 3A1DA 3AKDA 3AI7A 3ZHTA 1GGNA 5BSGA 4Q37A 5CDTA 1FX1A 3AL3A 3DEFA 1XPOA 1K8ZB 3OZWA 4FGZA 1ZUD1 3CX7A 3L92A 2BGRA 4OQXA 4A1FA 2CHGA 4F04A 4KEAA 1RP7A 4UHFA 5IVPA 3LD9A 1UKCA 2O6HA 3FGOA 4CNBA 5JFOA 1TYAE 4NLLA 3VR5H 5LVAA 1PJAA 1D4FA 4IJWA 3B3QA 3V48A 2E7ZA 1NW3A 2C7VA 1KAEA 2V7TA 1YGYA 2ZR7A 2FPSA 1VSTA 1A9OA 2B1QA 3BWBA 3IALA 3X44A 4DFDA 1JQDA 1IXYA 3IBCA 2CGEA 3EVGA 4E12A 5DM70 2VJKA 3OURA 5FTMA 3TMKA 1Z25A 4JYBA 4YAEA 4CKZA 3LZ6A 5BW6B 1GG2A 3KUUA 4FQ8A 4H77A 2V5UA 3OAAD 4FFSA 4JQYA 4LQLA 5IM5A 3CH4B 4PSDA 3GELA 3KE8A 3FYDA 3QX7A 1Z2EA 2BDEA 4Y0NA 2XA1A 1ZOIA 1EWVA 2R1TA 1J90A 3DO6A 3FPSA 1NM5C 1Q0ZA 5K0NA 1K4KA 1X9HA 4QTUB 2H5EA 5IXSA 4F06A 5KPDA 4QBGB 3RBVA 1TFRA 4FIZA 4KRXA 1DKUA 4U00A 1FS4A 5JYCA 3HS3A 3NNNA 3VH1A 2OBMA 3IO5A 1FUIA 1E1CB 1YZUA 2COUA 5FA6A 1E9SA 3C3PA 4O0LA 3S29A 3DPSA 1J24A 2OTCA 5KTKA 3GFBA 2RK4A 3KKMA 4CEJB 1UC4B 3FX2A 4DV5B 1THMA 4PONA 3H87A 4JBXA 2XSZA 5DLQC 1G1AA 3TJRA 1UZLA 3TQHA 4YP1A 2QSUA 3W77A 2PVCA 1BRMA 1D1TA 5EIOA 1H0KA 1M0WA 2QX6A 2VI5A 3UVEA 1DDIA 1R8SA 1U4SA 2V59A 2ECFA 2DAPA 2ZSAA 1P7PA 1KJJA 4LJLA 3O0TA 3RAEC 4UJ5A 1YS4A 3NWEA 2ZI6A 1V8DA 1T3LA 3RS0A 3VYWA 5ICFA 4PG5A 3W2FA 1DEOA 3DJYA 3KQHA 2XUFA 3BIJA 1EVEA 1HZZA 1VB3A 1TTPB 2IRWA 1RSZA 1Y34E 4QDXA 5KWSA 2CDBA 2KYRA 5L9AA 3UTDA 3DMRA 4PNEA 3KZVA 3LXXA 1ID1A 3OWHA 4PAGA 4ZU1X 3RLFA 2XNDD 3BWVA 2IELA 1VP3A 4EB3A 2YDYA 3FOAA 1RPZA 2R6HA 2VBIA 3D3KA 4ZO4A 4RKRA 2R8OA 5HIIA 2OYCA 1USUA 4AJ2A 1C0IA 3WDMA 5JE8A 1JLKA 4DUGA 3PUVA 2BELA 4D4HA 2X86A 2YVLA 4F6CA 4CFYA 4EZEA 3G5LA 4PX2A 1HE8B 1FLNA 4C0XA 5JI2E 4KFUA 1NUSA 3VKGA 3N07A 3IKJA 2ZDHA 4FWIB 2WF5A 4P08A 1NQUA 5E6RA 2Q2VA 4CR6A 1XTRA 4ZYUA 5DVZA 2ZE7A 2JL1A 4A15A 5DLYA 3QW2A 4RZUA 1DUSA 5JR3A 2EP5A 4J3NA 4O4JA 2X2FA 3DAPA 4NV3A 1PYDA 2CMFA 4L0CA 5DSTA 1CUAA 3EW7A 4MYTA 1KZ1A 2WUGA 3FSGD 1MCZA 2O7SA 2DB3A 1AKYA 1G21A 1VA5A 3DPUA 4TWBA 1ZCJA 1F0KA 1GKLA 2WSSA 3VPFA 2YNMD 2WMYA 3QU5A 1SBHA 4CCSA 3IVRA 1G21B 3L7NA 3ABRB 2NSHA 3Q7EA 2QRMA 3F96A 3U60B 4OHVA 4QOJA 4CCAA 4OGLA 3OLQA 1GAXA 2X0JA 5AUPB 1IY2A 2PCLA 2QRNA 3BYZA 4UTXA 1OLXB 4LX8A 2DULA 3FUVA 3DO8A 4R2LA 1E60A 4YA6A 3BE5A 1GPNA 1P4HA 2ZRPA 3UFBA 3W2HA 4KQFA 1CJCA 4QODA 2WJGA 2EHJA 4JI4B 1H65A 2WPDD 1CQIA 3RUIA 2Q8NA 4YCMA 5GZ3A 4HZGA 5EJEA 4EUKA 1M5RA 1G7RA 2D2EA 3R8XA 3MNFA 4FMDF 2ZR9A 4OHUA 1KJQA 1IVYA 2PQ6A 2QAIA 2FDXA 1U02A 3MPOA 3PPIA 4IHJF 4ZZ2A 3HBMA 4OQMA 3FDFA 4EELA 2ADMA 4D74A 1FYWA 4ML3A 1FXWA 1W30A 2COEA 1CEQA 2ACEA 4JODA 5FBLB 1NGSA 2IHJA 3HG7A 4JLOA 4BQPA 4D6YA 1PEDA 2GN1A 3P0EA 3THWA 3OPQA 3DKVA 5F12A 4OFXA 1QFJA 2FI1A 1M2OB 4FFOA 4MP6A 4WAUA 3PRYA 2H7VA 2PN1A 4HQOA 3D31A 3W7AA 1VL5A 3NHPA 4EUNA 2QVYX 1M66A 5FOSA 2CXRA 3IE2A 4J7XA 3HA2A 1J5XA 2WHPB 3ENQA 1WMDA 2F8MA 2IHYA 4Z4HA 1A4XA 5CIQA 2GKOA 1Z4JA 2QE7D 2MR6A 1U4NA 1XJWA 1SKYB 4O1HA 4WL0A 1L7EA 1KY3A 2W4IA 4TGLA 3QV1A 5TV2A 1Z6XA 5JSZA 4HGZA 2OBXA 4CEJA 2VHJA 2PX0A 4HNAB 3DR3A 1EG2A 3GYGA 4D3XA 1H05A 2EEZA 3UV7A 1IY1A 4B0OA 4LJ6A 2WHPA 4KVGA 3AGPA 1WOMA 1E62A 4GP9A 3LA6A 4JR1A 5LM3A 2NSYA 5JH7B 4LV6A 3O84A 2MINB 2R8ZA 2Z8ZA 1NLMA 4X54A 1P1CA 2BPOA 1RQXA 3CZPA 1PR2A 1PJTA 1REQB 4E03A 1NVTA 4UW9A 1PWYE 4MKHA 2PWAA 1JJBA 2Z83A 3S99A 1F0NA 2EF0A 4KE9A 2EDCA 4Q4HA 3T38A 4DCGA 3QBEA 4E51A 1N7HA 1K5PA 1Z68A 2XTAA 2SNIE 3E15A 2HI0A 4OBXA 2Q4BA 5EJ8A 4LWPA 1QNLA 3OHMA 1XZAA 1Y3DE 3RSOA 2QLJA 3PJEA 4UDXX 4KO8A 3O3MB 3SHFA 4CLRA 3TFOA 4WE3A 3KQNA 1R8XA 3HCEA 5DOVA 3VNSA 1HDRA 1LS1A 1OXTA 1Z5OA 2XMQA 4RL4A 1M2HA 1B4DA 1PJQA 2PJZA 2R8XA 1LPBB 4OYLA 2B5VA 3N8KA 3WMWA 2WICA 4GVXA 1CD5A 1BNCA 3QLVA 5CH8A 3LK6A 3NEAA 1UFOA 2OV8A 3TQRA 4AUKA 3RRFA 3DHNA 4GVPA 4BGDA 2C7GA 1R5BA 1ZN9A 5AKYA 5F51A 1BOOA 3EDRA 2WF7A 1LEHA 5JALA 2VAXA 1GNQA 1WE2A 5B64A 1E4EB 3TOCA 4D0RA 5JO9A 4KR2A 2B4QA 4YCNA 4HPWA 1G7TA 4J0HA 2XRYA 5LXTB 4XR9A 2VEOA 3RIEA 3U7QA 4EO9A 3L1JA 1AMNA 3ILHA 1B16A 1K3UB 2H11A 2BMDA 2CSXA 3R7FA 3ZE1B 4IS2A 5BMVB 1SXJA 3QWFA 1W5EA 3ENKA 4QUDA 4JLJA 2YJZA 4QXRA 1H2BA 1VG1A 5K0EA 2J0SA 3ZWVA 4D98A 3BQNB 3CX4A 4YHBA 4IXNA 3G9ZA 2QRQA 3ST7A 2Q45A 2GJSA 2IUEA 1UBEA 4XPZA 1PLKA 3JQ7B 3FTPA 5E6RB 2OOKA 1UDRA 2PIDA 1F4PA 2XE7A 4M7OA 1OXBB 3GOHA 1ZOOA 1GCAA 3IS3A 4MWBA 2PMFA 3UAVA 3B6IA 2AF4C 4HUQA 1QQBA 1DRUA 4OL9A 5EUCA 3WGUA 4GUDA 3TB6A 3GT7A 4C06A 1UJBA 3M2TA 2XQKA 4IV0A 1WCIB 3H4TA 1XKXA 4MGYR 1IWOA 1T4BA 3E2MA 1CLEA 1P2BA 1U1IA 1ZITA 4NZYA 1LPOA 4BEWA 3OLZA 4MA5A 4RA6A 7YASA 4MV1A 4K9OA 2F59A 4P7FA 2QLNA 3VR4D 1WW2A 3EEOA 5MN5A 2HF2A 2VWGA 2OHHA 1II8A 4KDEA 2WSLA 1Z12A 2XLCA 3FPCA 1QO9A 3LZDA 3EFOA 4D1YA 4ZFNA 1O96B 2X9VA 1UT5A 3G17A 2UXDB 1DKQA 1YZVA 4DAEA 2PPLA 4Q4DA 1G5RA 2DT8A 1MQAA 4XH9B 2V6FA 1GZ6A 4GNRA 1P8AA 1P81A 4EPRA 4B2YA 1UDCA 2I7VA 1I33A 3KR9A 3DWIA 2W6OA 5F2KA 2HYIC 2OVFA 3JQ8B 3IBSA 1FYFA 4KRFA 1TMOA 3CH6A 3PDIB 4MK4A 5LJIA 4BO4A 3DBRB 1LVHA 1FRQA 5G41A 4Z1MD 2SECE 4QBIA 4YCJA 1KVUA 2WEKA 5CLLA 3H9JA 4V39A 1J70A 1JH8A 1LBSA 1OGJA 1V35A 2ZB2A 4PLCA 4W9RA 4MV6A 4P3PA 5TEVA 4D45A 3O8BA 5JCXA 1RC8A 1JR2A 2NVWA 3R41A 3ZXSA 1L3CA 2OXTA 4QRDA 3IIKA 4BBAA 5JEDA 1ZPDA 4ZGGA 2V6MA 3C15C 3NIWA 4CT4B 1FUEA 4FQ5A 2P3LA 3KPWA 2BUBA 3QG5A 5ER9A 3PA8A 2Q46A 3PUIA 2X8WA 1Y7TA 1YR3A 2X40A 4IQ8A 1K6XA 1XMIA 4L07A 1EQ2A 4ARCA 1QS0A 2OD2A 3W3ZB 4AW9A 3TRHA 2GEDA 4IVPA 1LPSA 2JIDA 4IJKA 1JLRA 2BY4A 2YNMA 2OV2A 2GARA 2AN5A 1R8JA 2YWGA 3PQCA 2C98A 3NDJA 3WXBA 2HWWA 1WMFA 5C52B 4HDSA 4JJ7A 1V39A 4DL9A 4BYGA 5CT5A 1ZIDA 4IJMA 2X0IA 3I83A 4DCCA 4C0BA 5C7OO 4FUQA 1JHXA 2VLBA 1AK9A 1K5HA 1ZI9A 3HY4A 4BCDA 1TRKA 3EWAA 3LHFA 5DI9A 1I7LA 4E2ZA 3A0UA 2BJHA 3R3UA 4K26A 1U2ZA 5IBQA 4LXGA 2JLUA 2NP6A 4UFNA 4F38A 1MKYA 3LJKA 3UQZA 5JOQA 5LN1A 5KVQA 1KJIA 5KWEA 1FS5A 1PJZA 2DKOA 3HPQA 2EXXA 3DDCA 3O21A 1KO4A 1HSOA 1T5IA 2JW5A 3H18A 4MEBA 3TZQA 3DTNA 1KEPA 2XUDA 2O7QA 1KC1A 1EXMA 2H4HA 3DAOA 2QAGB 4H0CA 4RL6A 3V80A 5CB8A 3R5FA 5KJCA 3SCZA 3AVTA 3L7OA 3SS9X 5EZYA 2Y6UA 2W00A 1QRRA 1RBZA 4K6MA 1YTLA 4QPPA 4ZA2A 2XZLA 1RWNA 3D4OA 1LQTA 3OFJA 4GMKA 3SQNA 1LI7A 3OIWA 4UNQA 4MVWA 2BEWB 3KR1A 3V2UA 4EZBA 5C1IA 1DAFA 2IYYA 3I42A 2ZWPA 2HK7A 3LRXA 4EENA 3NP7A 1O4VA 1TM7E 4RFSA 2YCLA 2FUKA 5BXYA 4Z3OA 1F38A 2D7DA 2H4XA 4J1NA 5FUWA 1MFPA 2JK1A 3P4UA 1J9EA 3EAFA 4H4DA 1NQVA 3MERA 4I66A 2Y4OA 5BW4A 1AUVA 3A6EA 3CLUD 3HCNA 3MGBA 1G60A 3VU0A 4HVLA 2QR3A 4B3GA 2X0FA 1AO3A 4WFJA 4WADA 2AOXA 1SKAA 3EBOA 2KM1A 3CLVA 3IMEA 3INGA 5CX1B 1RI1A 2FDRA 1XD2B 2I3ZA 3DV0A 2IP2A 3DXZA 4IDEA 1LRJA 4DG5A 4B82A 4I1UA 3NTXA 2GXAA 4DKJA 1FVHA 4Q3BA 1EP2B 1V3TA 2PRYA 5DTJA 1Q74A 1PNVA 1YACA 4M7PA 1GZDA 5KTNA 2AQKA 4GUAA 3UC9A 4HX9A 2QTNA 4ER3A 2D4AA 4OXYA 4F4FA 1YHNA 3GARA 4PXYA 1NX6A 2VYQA 4AIIA 5BY2A 1DO0A 1U7ZA 2YZKA 1SC6A 5CH5A 2XMBA 1KS2A 3EMKA 1NLYA 2C8JA 2GZRA 3IXLA 3NOVA 5CA1F 2UYYA 2I91A 1ECLA 3OQNA 2GNAA 3UAGA 1P7VA 3OX2A 5D1HA 2YX1A 1PL8A 2PSHA 2W6ID 5H0IA 4E88A 1IZ9A 2ZAOA 4H6WA 3FCCA 1J2YA 3LYHA 2BSQA 4N39A 2W2XA 3TTVA 3L43A 1RKVA 4OREX 1BWQA 3IVAA 1NBMD 2OD9A 1X1RA 5EQDA 1OFVA 4AAYA 1M34E 5EI5A 2E89A 1ZIYA 2MWMA 3ZIUA 2NUTA 1Y37A 4NAHA 2C84A 2A8YA 1CR1A 3I6IA 2O7VA 1KMQA 3N8GA 4FR2A 1Z34A 3OM8A 4MHOA 3ZV5A 5LQAA 4LJYA 1ILEA 3LCRA 3JZFA 4U3JB 1SOUA 4WW0A 2FVYA 4F72A 2L18A 4O8ZA 1DIOB 4RZHA 4N48A 4RKFA 3PUJA 2QTMA 1Q2UA 1M5UA 1JAHA 2HA6A 3NUGA 1VCMA 1N8SA 4DVJA 2ZM5A 3F6BX 3H1AA 1E3DA 2JCGA 5B4UA 2H7XA 4I1OA 2B25A 1UBRS 5HJ5A 2BFBB 1I1OA 1E5DA 2VL7A 3MD9A 2XOKD 5DP2A 1G8PA 5ECGC 4YRPA 3P4XA 2PA0A 4DREA 4J75A 2DH5A 5SZHB 2FNAA 4C21A 1GU7A 2I1QA 1MW8X 2IYRA 2IE0A 4MGHA 3VHXA 5FUYA 2EIXA 2XDAA 3Q7TA 2C5EA 2OC4A 1YKFA 5A6SA 2BFFB 3H4VA 2IHVA 1NNEA 4RUKA 1H42A 1Z5PA 4XSVA 1AKVA 2ZJ0A 1H1LB 5LNK6 2DEUA 5HBRA 3QFRA 3RYFB 5JDCA 1PNRA 3B9BA 3PENA 2XODA 2WAMA 3UW3A 3GHYA 1ZD5A 5JY1A 4J7UA 3OFVA 4S0ZA 5FLXA 1NNUA 1NU6A 5JPDA 3PWSA 5BNWA 3MN1A 1DG3A 3FN4A 1QZTA 5ALKA 4HNRA 3UAYA 1ESMA 1ZCFA 2OZKA 5FD8A 5FBZA 3ZWCA 5CBPB 1WXEA 2C2HA 4B34A 2I1WA 5BWNA 2NTVA 1A88A 2RSLA 1DL5A 2AEEA 2AFIE 3DKKA 3JQBC 4FLEA 4L8LA 4YGYA 3TCKA 3IPRA 5CD1A 1Q0PA 5DEOA 3NB0A 4L5JA 1HOTA 2WHRA 1E98A 3UHOA 3QUTA 3HU2A 4YIHA 4FN4A 4J0IA 1FJXA 4MVYA 1VRWA 2VNIA 3T7EA 4MRNA 4MGIR 1T15A 4FILA 1IOVA 4GS5A 5G0WA 2B2NA 4UE6A 1QXSA 4IQGA 3H2YA 4MRRA 2CNNA 2QJFA 5K9ZA 3IVXA 3STTA 5BYAA 5EYPA 3KSUA 1T1EA 3R3JA 1CB7A 3GGOA 3QXCA 4FT2A 1O95D 2IZ5A 1F8UA 3Q5GA 2MYUA 1U28A 2BSAA 2H4FA 1YS1X 3DLTA 3LO8A 3O8RA 1AZWA 4G4IA 4C20A 3QFFA 4GM4A 1SB8A 5G0VA 3KAJA 2HJHA 1UEXC 4I6GA 4HAIA 4BQIA 1QHGA 3HMKA 3N3BC 4XI9A 2VDUE 4Y2QA 4LBVA 1BHJA 1U8TA 2WJ6A 3B1XA 3X1YA 4OK3A 4JEHA 4JVNA 1Q7GA 1CUCA 1D07A 1MTZA 1P2SA 1UZMA 2WFMA 3H11A 5EKSA 4NNJA 3I72A 4UAJA 4RVFA 5CGQB 4YECA 3BH7A 4WOPA 3W5BA 1J5EB 4R5HA 1ODLA 4PZ9A 3EPJA 3MELA 5K01A 3A7EA 3L6DA 3FGPA 1E2MA 1ZNYA 2DHQA 2QM0A 2R751 3MM4A 4NZ9A 2BMJA 1P31A 2QUBA 3P2OA 4Y2RA 1Q0QA 1N3BA 4GL4A 4ZQCB 3SKYA 3W7VA 1E77A 1SUBA 1HC7A 3CSSA 4JJIA 4I9GA 4QC2A 4PZAA 3IPCA 4ALNA 3B2NA 4L6CA 4EK9A 2ZZMA 1IY0A 3CKLA 1F3LA 2RGCA 3CO0S 2VATA 2VNJA 3HJNA 4KIJA 2FP4B 1SKQA 1AB6A 3PYMA 4IO0A 4L6AA 4LJKA 4N7RA 4RHYA 4TN5A 4Y2SA 5LYYA 1PEKE 1L9XA 4NDAA 3OE7A 4A8JA 2X2PA 4I9FA 4QLBA 4AZ3A 4B3CA 5AVQA 1CZKA 2Q3EA 4Z5XA 1JR3D 5C51B 1E3QA 2OHIA 2PRJA 3BGDA 2B78A 3I04M 4P33A 1K7XB 5L8VA 5HKKD 4F71A 4B2IA 4MGKR 5K45A 3OUTA 2Z1MA 4QPDA 4FE3A 2HAEA 3EPPA 2DTXA 2A14A 1ST3A 4UBMA 4WZBA 5I8WA 1L3IA 4TTVA 1ZH0A 5AVXA 5JJLA 5D84A 4IUYA 3OWOA 1HT2E 1QHIA 4TYPA 4IWNA 4MS3B 5KJEA 1OWOA 1ANKA 1ZNWA 4YQFA 1YULA 5GJWC 4ZYXA 5EHNA 2MIIA 4NCKA 4NU8X 4PIPA 5FTJA 5CPFA 1N7IA 1PHRA 2D8MA 2WU3A 3GUUA 3ICVA 1MIOB 2GNOA 6GPBA 1BKSB 3QOWA 3EW9A 2BM9A 2OZLB 4LYAA 1HY3A 2FSVA 1XZBA 7REQB 3MBKA 2A0KA 5IJ9B 4HDKA 4U2DA 2BZ1A 4K8OA 1YJBA 2OHVA 4JDUA 4MULA 2R1ZA 3LV8A 4KFTA 4WCVA 3GY0A 2C7BA 4GPTA 5TGZA 3SY8A 3ETNA 3P2KA 2J30A 4M0FA 4DR5B 3KLPX 3EQ8A 1KA9H 3A4LA 2YFKA 5BO5A 2YZ2A 1RWVA 2F1KA 2NT3A 3ABZA 3ND5A 1U3CA 2VF5X 4LWQA 1RYHA 1QQ6A 3E1SA 2INGX 2OCGA 2DBVO 3F49S 5GP1A 5BNFA 2WKQA 2J4FA 2VZ8A 1LK7A 5C31A 4D5EA 3TL3A 1QGUA 5FNZA 1FYVA 1HR0B 4BVEA 5MDHA 5EIXA 1TK9A 1I3OA 1NW6A 1Y8QA 3KOMA 1PWZA 1ZAKA 3RHSA 4WDQA 1TECE 5EP4A 4HD8A 5FWNA 2CE7A 4QEZA 4NOKA 3P2IA 3WQSB 2JPDA 3RABA 2XV1A 1TD9A 2YWJA 4B83A 3IL2A 2GRUA 1BE0A 3CVOA 3RC2A 2ZIWB 4ZTZB 2M6SA 3DVAA 4TKZA 4EY5A 2VLIA 1YIAA 1H9CA 4URFA 1TK3A 3RARA 3F6CA 3UXYA 2QLLA 3MRXA 2FCAA 1D2GA 4Y1RA 5EJ9A 1S2IA 4RZIA 2GD0A 2DFDA 3R6DA 1SCBA 5F64A 4Q3LA 4W63A 1C2TA 1DBVO 2FUCA 5HYVA 3HXMA 2NADA 1FFGA 2JLSA 2IYQA 3OJLA 2PL1A 3IEIA 4ZEXA 1FVFA 1E7SA 3ETDA 3EXFB 3K5PA 1QANA 4UPVA 3EZYA 5ADHA 1G17A 1U8YA 3PNKA 1G0OA 2FGKA 4K2HA 3IOCA 4D9BA 1C1DA 4KWHA 5EPEA 1JL3A 3W8NA 3VR1A 2JFQA 4YQEA 1TX4B 1SUCA 1WUHS 2QTGA 3BORA 3H8VA 4U63A 3RHFA 4BLWA 2LVBA 1HL7A 1CUSA 1CQJB 1Y48E 2SBTA 3CF6R 1U0RA 1G6KA 3ZHSA 1TVKA 2DU8A 4MWTA 4X71A 1JLMA 4ESEA 1EDOA 4DR3B 1RU3A 1J6UA 1P9LA 1LDGA 3D3JA 3O94A 4HOYA 4I7EA 1CUVA 5ALXA 1J2RA 5AT1A 3RAGA 4DQUA 3M3HA 2XIJA 3L8MA 4PG8A 4HDOB 1J1ZA 3G23A 1RAFA 3IJPA 1LC0A 1M2GA 1ZI6A 2RBEA 3BD7A 3O03A 3O38A 3EAGA 4B35A 4BMCA 3CNHA 3FD8A 3GAMA 5KINB 4ALJA 2BDTA 3DO5A 2N0SA 1T2AA 2WWTA 4DLNA 4MLZA 2ANCA 3CQ9A 3HN6A 4ZRDA 5TJHA 3N1UA 2JGDB 1BDBA 3FCSB 1ELOA 3NG1A 2AFRA 4PN7A 1CQXA 1RBQA 4LHSA 4RIGA 4H7JA 4K40A 1T91A 1V5WA 1I2AA 2FWBA 4OOFA 2IBSA 3I9OA 4B45A 5G0UA 1QFMA 1Z62A 4G0VA 2ZAIA 3T0FA 3LPAA 2FX3A 4TYQA 5IK2D 2XVMA 4WECA 5JANA 3TMAA 5J40A 1YTUA 3G2PA 3BH6A 3LDUA 1XDWA 5FOTA 5AJZA 4JQCA 3P32A 4OQYA 4XDHA 4CL3A 4LI0A 2VJMB 3L1UA 4JNKA 2JLCA 4ZEOA 3PA6A 5BURA 1R9GA 4KI7A 3E3OA 1GRRA 4HX5A 1P6UA 4X1YA 3R0VA 4ENUA 5GIOE 2O3QA 1WHSA 1Y89A 2R6DA 2GCIA 2HH9A 2WIFA 1BCRB 4FHCA 4X65B 5EEHA 3P9RA 2JASA 3MWEA 1GXSA 1AQIA 2FRXA 5DGDA 1QP8A 2R8EA 1V0JA 3C3JA 3Q9UA 1SVLA 3LY5A 3OZAA 2ZP1A 4K05A 4AF7A 1KTIA 4JXXA 1OHHD 3FTQA 3OMXA 3E0QA 3M1LA 1MOPA 4FYWA 4HVAA 3UT5A 4OXQA 1YVEI 1GZ4A 1Q21A 1V3UA 1HT1E 1SUFA 2Y1FA 1G5IA 3VZCA 3E3NA 2CEKA 2FZCA 1HG1A 1BJKA 1ODCA 3BIFA 1FLVA 1RLIA 3CNBA 3P4YA 4LXQA 3VSCA 3NOXA 3AXSA 3SEQA 1CF2O 2VHUA 1O57A 1PFYA 4JLDA 1ZXLA 3DZCA 5ALNA 3WLIA 2C0PA 2RGUA 5FTNA 3TL2A 4BMDA 1Y3AA 2QRHA 3DUFA 3ZDBA 3AJDA 4RC9A 4RGYA 2I6SA 2FUG6 4UTOA 3V8QA 5IFLA 1SY7A 1MAHA 3GRVA 3CUSA 1SH7A 3GCDA 3H9CA 1E1DA 2BGMA 1U90A 4MZXA 3ED1A 1QM5A 1CUEA 5DYYA 3V4ZA 3E2IA 2ZUVA 1NJ1A 3GT4A 4RWZA 4TWZA 4EBFA 3DKPA 4BNDB 4C2AA 5I7VA 3K2BA 3SHWA 4BNWA 4G1CA 2NUTB 9ATCA 3AJ8A 2DHCA 1SCIA 4ZWNA 5DT9A 2FOLA 5KQPA 1SU4A 3T5CA 1GPAA 3FNQA 3I05A 2ZSBA 3HRIA 3HH8A 2EGHA 1CQJA 2VHZA 4CPDA 3PDUA 5I9LA 1N33B 3DFFA 4IHJA 2VTVA 3TX6A 5HRCA 4OP3A 3W5CA 3NH6A 1YUBA 1YK1A 4OHCA 3WR5A 1HZZC 3ZQ4A 1UBMS 1CS0B 1DCFA 4DJEC 5H9WA 1VL0A 3R4CA 1CIJA 1Q3KA 2JEOA 3BD9A 1GZSA 1AGXA 3C98A 1PTKA 2H2GA 3CLHA 3GFPA 4H6VA 4PHHA 5KCZA 4DQLA 1Z28A 2CUTA 1CEEA 1GSAA 2GEUA 3NHFA 4X1OA 3ZY3A 4UJ3A 1C7ZA 3P9CA 2JATA 1A7JA 1NBWB 5DEIA 1JR3A 1E3IA 4YACA 3RFUA 2AJDA 1M67A 2AT1A 3C24A 3EIXA 5FBKA 5EEGA 3ICCA 2WPNA 3VI4B 2VDRB 4B5LA 1UAGA 2QYTA 2VKQA 5E2IA 3ZW9A 1WZNA 4ZAYA 4ZT4A 5EUQB 4JJGA 1E94E 5IJWA 3GBSA 4RVNA 3NKVA 4ON9A 4BX0A 1KK2A 3QBDA 4RJLA 1RXWA 1XGKA 3SM3A 2W2KB 4QT4A 4B6PA 4ZYWA 3T7CA 3AH8A 1H4VB 2I29A 3IPLA 3N2KA 3PXCX 4EATA 1AD2A 1DTEA 3WSVA 4N3AA 4P7BA 5FPPA 3TCNA 1X7XA 3VOSA 4GI7A 1BXRB 2I2BA 1XMPA 2OO5A 3IQGX 3R5XA 3U3ZA 4PNPA 3DZIA 4H16A 4C4TA 2XWQA 4CQMA 4AG3A 1N5OX 4YN3A 4C4RA 2AR9A 4NZMA 5MF6A 2BEWA 1UBFA 4G0WA 3HXPA 5AW1A 2QENA 2W6ZA 2QN9A 2ZU0C 3GPIA 1CW2B 3I2HA 4ILEA 4UQOA 1M8FA 1UJ5A 2C9ZA 4A0FA 2R00C 4F86A 3HVRA 3DMHA 5KKAA 1LPNA 1TK2A 1TPYA 2FMHA 5GOZA 4EHKA 4N6OA 3LLCA 1ZR4A 1V48A 1TO2E 5CT8A 4TOIA 3B8HA 4I14A 4NYJQ 4CTNA 1LPAB 3H4IA 2LGJA 2IZ6A 2MCFA 1V1JA 1Z4PX 3EDYA 2WV7A 3KHUA 2Z6QA 1H2AS 2P65A 1PUJA 5JLJA 4C0WA 2R2AA 1S7GA 2LDBA 5GGXA 4PS1A 3GHHA 2NSDA 3ZEIA 1FCJA 2A5LA 4JUIA 3T4PA 5KTMA 5JTTA 3ZBQA 3KQWA 1BU5A 2ZBUA 3ZGNA 1XVIA 5JSKA 3HRKA 5DM4A 5KVVA 4CCYA 1T26A 1RS0A 2Z3ZA 3F7MA 4RHUA 3HXKA 2GESA 4YK7A 3UV6A 2CVFA 4B5KA 2E3JA 4YDHB 5FUBA 4GX2A 5IDQA 2Q1UA 1O0BA 1NE2A 4C4AA 4MW7A 3WLFA 1R3UA 2LPMA 4ZICA 5TGDA 3UQYS 1SVWA 4A8JB 3HPRA 2J08A 4Q9LA 2OK8A 4FR5A 2YMPA 1WNFA 1A5SB 1YZQA 2NO0A 2W7TA 3UMYA 1I4EB 3GK3A 2G9ZA 2FFRA 2GBPA 1P1IA 2HJGA 3E1GA 1VQ1A 3NHWA 4H08A 3U39A 3ZV6A 2UAGA 2ZG6A 3BQMB 3L7KA 4ZK2A 3DWGA 3GEDA 2HT6A 3DZBA 2GYVA 2O8DA 4CVNA 1W1UA 3UTCA 1IU9A 1USIA 2GPBA 3H05A 2VRCD 4KO4S 3AQIA 1T9GS 7ADHA 3PXAA 1D3AA 2RAUA 4KH1A 4KMSA 4AO7A 1NHGA 2VEDA 5KNCH 4GMXA 4BWGA 2JA1A 1OZAA 3ESXA 5IVIA 3AERA 4GX5A 4MVJE 3K5HA 2AFIA 3C74A 4JP3A 1C2YA 1KTVA 2D0PB 1FW6A 4B47A 4DC0A 2CHUA 5DTEA 2EGUA 4M60A 1UDBA 1X6VA 2ZIXA 3CLSD 3CRNA 3FYUA 1EFRA 3KBBA 1BXKA 1I2MA 3AOEC 4GR5A 5FR2A 1V1MA 5TVGA 2R5NA 4IIBA 2IH2A 5J2TB 2VBGA 1VMDA 3WMFA 2ZWIA 4LC9A 4DJTA 1W1WA 4TTQA 1TQHA 4BNUA 4OQFA 4CMGA 1H0RA 1JI0A 2C9YA 2PKCA 4LDNA 4URUR 5EXSA 5C4IA 2DUJA 4M98A 1CF9A 1LS6A 3DT9A 1QP4A 4IH9A 1B6RA 4DMLA 4BLPA 4TLDA 3ZHOA 4BVJA 2J5XA 3NDRA 1J0CA 5IG2A 2O59A 4GG1A 4YXWA 3TX2A 4HPXB 1XK6A 4HDNB 4YASA 4IV8A 3VZQA 2AOWA 1RHRA 3TJMA 3GGDA 3AHCA 4I0WB 3PQ6A 1MPXA 3PI7A 2PKQP 5BQ5A 1Y1PA 4GBGA 4REQB 3PQ2A 3H2GA 2P9JA 4G5HA 2PX8A 5FI3A 3UXHA 2X5KO 2JFPA 5JHGB 3EGXB 3HEBA 4OYYA 4MW0A 1P4JA 4RULA 1OQAA 1DKPA 4N9QA 1VL8A 2DWUA 1VBNA 2HO5A 1JQBA 2X76A 1V7ZA 3JALB 4IUBS 5C1OA 3JAMA 4D57A 5HJ7A 4L50A 1JH9A 2C42A 1XA4A 1FE8A 1YI0A 3CGGA 1GG5A 3L93A 4NCNA 1FUKA 1A95A 2OBBA 3D7NA 4QSHA 5C18A 2AI2A 3B1KA 1QHHA 3VH2A 1PFWA 1WVMA 5TE9A 2O6LA 2XNJA 4R8SA 2I67A 5GVRA 3FLBA 2ZZNA 3STWA 3JQ7A 1H1LA 2HN9A 2WAOA 1EXWA 4LQCA 2V1XA 4O6VA 1JMYA 2X6TA 2CFIA 5DH9A 4UBOA 1GTG1 5L3VA 5CITA 2ZRHA 3AJAA 3C4JA 3NHRA 4WCFB 2PS0A 1W36C 2BFMA 5L51A 3EA0A 2PSEA 4IH1A 1R12A 3GD7A 4JB8A 1PVOA 2A9JA 3ETLA 1YL7A 2I6QA 4XVHA 2OO3A 2RGNC 2P0YA 3OZBA 4RD3A 4UZSA 3CF0A 3W1EA 2JJ1D 4I1PA 2IX3A 2Q5IA 3U4QA 1GG9A 1XG5A 2YOHA 4X6XA 2CL0X 4AM8A 1U1FA 4ZVRA 3W06A 2GCPA 3DMFA 5FYDA 3CZMA 2IUYA 2EFEB 3C87A 5LU9A 4G0YA 3GPLA 5KSOA 1JYFA 5T4HA 3KG2A 4HQ0A 4ZOQI 1RW4A 3QQ5A 3K70B 3LLVA 2D74A 2P8JA 4YRTA 1KQPA 4JBNA 2B20A 2QLMA 5K1ZA 4R1NA 2JIZA 3AJ9A 4AS2A 4FB4A 4TYWA 2X7XA 3C2QA 3C8DA 4L5BA 4HEJA 3V8RA 1CEXA 1JQ5A 3IAUA 2I22A 1EESA 2V9PA 1OGYA 1B1AA 3L7LA 1PV4A 2R7AA 4AMGA 2Z9BA 1Z0JA 2FQWA 4XOIA 4P7KA 1U6KA 4TTIA 5AK5A 3V33A 2P0AA 3VR5D 2DGDA 2YUIA 4PQYA 5KOYA 1L7QA 3UUWA 4WA7A 3LVQE 2CK3D 3G02A 2IYSA 4M1SA 4LBZA 4Y7DA 3RVRA 1KY5A 1ZH2A 5JCZA 1SC3A 2BJVA 1SEVA 2I4IA 4I46A 2FB9A 4EVIA 1F9AA 5D00A 4LNUB 4ZIRA 4BQQA 4YAIA 6PFKA 2HMTA 3AEKB 4X6YA 2XWSA 1XV5A 1E4YA 3D2AA 3EE6A 3AUJB 5CURA 3PXGA 1ZUIA 4AP5A 1K7CA 3EMDA 4D3DA 5IAAA 3IOMA 4B2PA 1DC7A 3QZUA 4RF3A 1TJ3A 4PCLA 4D9CA 3FPLA 4UBIA 3RK4A 3RVJA 1VPEA 4C4ZA 2P6MA 1UM8A 3RTAA 3BZWA 3JAKA 4M9SA 3K8YA 2VTKA 5BRAA 2JIBA 4RJKA 3HGQA 2IVZA 2CLKB 3T41A 3RPEA 13PKA 1G5PA 5KMGB 1M1ZA 1TC2A 3R77A 4RVOA 4JL8A 2Z2ZA 4QDUA 3L1IA 3MGAA 1JFRA 1KARA 1YOVB 5JAMA 4HFJA 4UREA 2Y27A 3UHJA 4B3FX 4LJ5A 3OFND 4X92A 1J1UA 3D6AA 1WQ3A 2H4JA 3P9SA 1OR8A 4DIBA 5JSHA 3ZUPA 3QHPA 4YWJA 1MD9A 4HXYA 4LFBB 1IRIA 4UHBA 2QAGC 2XJ9A 4C0HA 2IT1A 3PXXA 4S12A 1QAQA 4E5SA 1C80A 1S2GA 3FBGA 4LISA 2EG9A 1X70A 3K8OE 4G0OA 2EC5A 8LDHA 3C0KA 4OI4A 2AK3A 2O8EA 4EKIA 5C32A 3VR6A 4DW8A 1KZ7B 2QTRA 4L74A 5AIAA 4CM9D 2ZSIA 3AHFA 2F48A 1Q0LA 3LU1A 1RPTA 3ZK7A 5JASA 3LCMA 3QLEA 4V0OA 4H4CA 5BUZA 4RVUA 3F71A 4Q16A 2EARA 1F8GA 2CLSA 2NZVG 4B3SB 4Q3DA 2HD4A 1QH8A 4PICA 2CJYA 2MSLA 2OWDA 2VP5A 2FFQA 5TB5A 5BPFA 3T1VA 5AVWA 5J47A 3RD5A 3WLHA 1NWCA 5C5DA 1PR4A 2HX1A 1CQPA 5T8KC 4XVUA 1OLXA 5FPKA 1JB1A 3HVJA 2RKBA 3T0GA 3IA2A 2FGJA 1XU4A 2O3SA 1EHCA 1XP8A 2O1SA 4I4TA 4HMQA 5LDGA 3TPCA 3KQPA 5L6MB 4W99A 4RADA 3R5HA 1IJEA 3A6KA 2YRWA 5HTKA 4ZMRA 3R76A 1CDOA 1T3GA 2G08A 4QOEA 2IHBA 3TTSA 5JFTA 2C5BA 4EW3A 1T3ZA 4LRWA 5LP1A 4FFWA 3OTHA 1BW9B 1ADFA 2GCNA 4RORA 4DLWA 5ALVA 1F2DA 3IKVA 4L5IA 4TV9F 1OPRA 3RS3A 4AP9A 5B4VA 1CDEA 3GZTB 4PWYA 5C8VA 3WBBA 4G5XA 4CDNA 5JZOA 2JHGA 4AT1A 5E4JA 5IAEA 2MHCA 3B82A 4RLSA 5M04A 3ADPA 2AXPA 3TUJC 3RSZA 2Q28A 3T5AA 3K72B 2F8LA 3YASA 2BBWA 5JG7A 3HJGA 4LC0A 5CFMA 1QIIA 3BMQB 2EKLA 3BL5A 4LSMA 2XZTA 1NVUQ 5EHGA 2AJCA 4M4SA 5EN4A 3ITKA 4P4SA 1PL6A 4QOIA 2AVDA 4LY6A 1L8QA 5AP9A 1NXOA 1QMGA 4K9KA 1PE0A 3FDZB 1ULSA 4IR7A 4RA9A 3AI1A 1L1FA 4DT1A 3T1HB 3ZZUA 1FIUA 5FADA 3WLRA 3HO1A 5AOCA 3KUXA 2R1VB 1GYQA 3EA4A 1CVLA 3ZE8A 1TQ6A 3CINA 1JDSA 1C4KA 1KP2A 2XGMA 2W4QA 4DRXB 3EIHA 2KLBA 3AZQA 3DFZA 3BE4A 2JGNA 2XBUA 3JCZA 2FPGB 2IYTA 5A0TA 4HDNA 3CY6A 2ZTSA 4TTAA 2YZMA 2AGVA 4R8RA 1GNVA 1BQEA 3KFXA 1XTKA 1OAAA 4UHEA 4X6UA 5YASA 1NJ5A 1IK4A 2BM1A 3WWCA 4A16A 1A9QA 2WD8A 4D82A 5FEUA 5K8CA 2BHNA 1Y6RA 3H6KA 1B7GO 3KJXA 2JJMA 2HA5A 3KKKA 1A8SA 1TCUA 3NATA 3QFCA 4P84A 1KS9A 3PNSA 3EASA 5C7YA 3CG4A 1R0BA 1OBVA 2PZJA 5J1TB 1WB9A 3IEMA 3K35A 4ASUA 2WWYA 3UF0A 5G40A 3U31A 4DBLC 1E63A 3WXMA 3JATA 1U2EA 3GRAA 4L08A 2B1IA 1IZZA 2X8BA 2ZIXB 2VF8A 4Q9HA 4DARA 1YRAA 1ECPA 1JF8A 3BXZA 3C39A 4B9AA 3OCCA 2AJLI 2O3RA 4WK6A 2XWBF 3CH5A 3N05A 4AN0A 1QX3A 3AR8A 3L02A 2AEMA 4NH0A 3B70A 5IASA 3UPUA 3JXEA 1JT2A 1NW5A 3JD2A 4RSRA 4W6ZA 3V8MA 4PQRA 4U6SA 5LOVF 2F90A 3LC7O 1Z5WA 3IMGA 4ZAXA 2ESRA 2P9ZA 1TF2A 2BZGA 2QZ4A 4GC9A 4TL6A 4AD8A 3QOYA 1EK5A 4AY3A 5JNTA 1HEUA 3FCAA 3FUTA 3FWPA 1S8OA 1Z8NA 1XQYA 4GKJB 3QVJA 1X94A 1ODSA 2QIOA 4IIHA 1JPJA 1SZDA 2O0MA 3TQCA 4U9UA 2R4TA 1QGDA 4ZZIA 2MOKA 1UZNA 2Q3CA 1LY1A 4BTLA 1MC8A 4R2XA 1DAEA 1RKQA 2Y99A 1Y33E 1Z2AA 1U8CB 2G82A 3PK0A 1IHUA 4KPGA 5FBRB 2HCRA 3UOGA 2NU6A 3PZBA 5A06A 5B3JC 3WNBA 1O94A 3DHYA 3MS7A 3OF5A 2WJ4A 3CPSA 2Z1NA 3DFIA 4TSRA 1I5RA 1XAJA 2XMCA 3PHCA 4NP6A 4CGZA 2O0JA 4PO9A 4ZJPA 2I3DA 3UKDA 2REQA 1KL7A 1GYRA 1HE5A 1LWOA 1R0CA 4KJXA 2FOXA 5BSUA 1W4AA 4BNLA 4EI2A 3JU3A 4GQAA 5I7AA 2IYNA 3PC7A 1RFLA 3KEFA 4DLYA 4E7PA 2QPOA 4IGEA 2VH5R 5C35A 4KR6A 2OHOA 1D4OA 2CWWA 5CNKA 2WUVA 4IYRA 4EG1A 1VL2A 2CDCA 3JS5A 2ZCVA 4RDCA 2QJWA 3SNKA 1K9VF 3HFGA 4RS4A 1JHVA 4JB3A 2W2PA 3GJTA 1Y7LA 4PR0A 4J0DA 1H6BA 3AIIA 4P8RA 1GGFA 3A27A 1IN5A 2QG4A 3QKSA 2AVNA 2VDVE 3FE2A 3ZVNA 4AKHA 4D4JA 2IYXA 1ZY2A 2DPXA 4CLRB 1N0HA 4WLVA 1PR6A 1ZSVA 5K2MA 3TFQA 3BCRA 2Q1SA 1HLGA 3B1FA 4H0FA 4KAAA 2IS2A 2XE6A 3LZCA 3TQTA 1VCHA 1NIJA 1UDAA 4FEYA 4F3TA 1JZSA 4HAOA 4BLOA 2LD4A 1I14A 4I81A 2VO1A 4BKOA 1RKXA 4NFHA 3DBOB 4P6VF 4F85A 3AB7A 3O4HA 4MUKA 4U7PB 1A7UA 2YIJA 4DA6A 5JS1A 1FZTA 5FLEX 4I50A 5CMLA 3SXUB 3IPAA 5ULLA 1QH1B 4F2WA 3DZHA 3BCUA 4LJ8A 5C7LO 1T1SA 4CR7A 1NF3A 2Q0QA 2A3NA 3I28A 4Z0TA 3M4NA 4BZXA 5KYGA 1QDLB 4RTRA 2IDZA 1BMDA 4FHZA 3W5HA 2D5LA 2ZEJA 3NASA 5AI4A 5EVCA 4F97A 1O5IA 3KXKA 2O19A 1KJYA 5K8VA 4D4KA 2PNFA 5IJ0A 2JGRA 2AG6A 1KDYA 4WV3A 5DT2A 3AVXA 2GJAA 3FPGA 2P68A 3RRZA 1WIWA 2VYFA 2RGNA 4IDHA 1CULC 1WXQA 2VJBA 2ZSJA 4NHEA 3UWDA 2I9KA 2EYUA 4I1SA 4ENSA 4EPVA 1BGXT 1QKIA 3BWMA 3PCXA 4FEAA 1JIUA 4GBJA 4YRDA 3HYLA 2QORA 4DA8A 2BGWA 8ATCA 2BKVA 5FBQB 3UHAA 4QSMA 3QENA 3AP3A 3H1TA 2HJRA 5HK9A 1E2GA 3Q85A 1M2JA 4Z8YA 1I7DA 4R9NA 1NJSA 5B12A 3OEHD 4C6SA 5AW9A 3K8ZA 5KQGA 3M5WA 1FPQA 1DBPA 2HNAA 3OU2A 3Q0TA 4CN8A 3AB3A 4NQRA 2O07A 5G4KB 3EXHB 1HQDA 4PLTA 1W4BA 4TRNA 3IB6A 1N6RA 3RU2A 3TG2A 2P6NA 5ELXA 3TM5A 2H16A 521PA 3SF0A 3M6AA 5LZ4A 1HURA 1D03A 1SCAA 1PV1A 4H3KB 3WVNA 3VHQA 4URVR 3CZ5A 1J2JA 1DAMA 2YXEA 1LDBA 1R6TA 1WR8A 2KPOA 4U7JA 5J2UA 4YUWA 4HH1A 2HTEA 3B8EA 2QYHA 1JR6A 1JMVA 4P9NA 1Q6ZA 1ZN8A 2FK7A 3AUKA 5E9AA 3HJAA 3M6MD 1CNEA 1NYTA 5T8KA 3C43A 1E69A 3CRW1 5TR9A 2IOYA 1VLZA 5LDDC 4HTFB 4Q1EA 1SVMA 2OLKA 3ND9A 3CYFA 2XNHA 1NLUA 1JSZA 3N2EA 4H7KA 3AETB 4PSAA 3LOUA 3O6VA 3TLCA 1KPIA 1X92A 4GM0A 3WB0A 1FBTA 3ZLBA 1E1QD 2J3HA 4U2EA 4O4JB 5JARA 3ODGA 4U7TB 2PKYX 3LX5A 3Q8KA 3BGWA 4CM3A 6ABPA 1E99A 1EUZA 1BCRA 2IYEA 2JZNA 2WFZA 4ONEA 4V24A 2JH9A 3RDPA 2Q1TA 3UBTA 2O8FB 2ZWOA 3UAOA 4H1VA 4UXHA 1X80A 3GV0A 1BKDR 1AQUA 4BL5A 4MLCA 5H83A 5LSAA 3VZSA 4H7HA 4IVNA 2BTEA 3GGSA 5GPBA 1F5SA 1G55A 1IEWA 1ZK3A 1BXZA 3HY6A 1RI4A 4PSKA 4DJAA 1PWEA 3O7MA 1E5XA 2VHTA 4JXZA 4HGPA 1FMFA 3P9IA 1J8DA 2FAXA 1DEXA 1SN7A 2AHOA 3FHCB 2JBAA 3VO1A 4DYVA 1J56A 1VJRA 3SSOA 4E5KA 1SQ6A 4PS0A 1X7YA 4LHEA 4DV1B 2CDRA 3ZWKA 3HBNA 2BH2A 1KRHA 2FRDC 1UMCA 5CB4B 4AYXA 4P31A 2VHWA 3MLEA 2P2SA 2IOFK 1IN7A 5B3AA 3BTVA 4POOA 4CXMA 3MJVA 4C7OB 1E6EA 3NVAA 2EL9A 2AG5A 4XXHA 5L6LB 1WPQA 3KXLA 1ZM9A 3OJOA 5ARDA 5G1PA 4ALLA 3ZJYA 4TSFD 4DV2B 4KFSA 1AT1A 1UXKA 1MRZA 3X43A 2YY6A 3MWYW 2EFHB 2IIQA 4K3VA 5BSMA 3NHKA 2VVTA 1JAZA 4UQPA 4Q7KA 3AF6A 3NQ41 3NWOA