4ZRDA

Crystal structure of smg1 f278n mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
278
structure length
278
Chain Sequence
RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNNDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of product-bound SMG1 lipase: active site gating implications.
pubmed doi rcsb
source organism Malassezia globosa (strain atcc mya-4612 / cbs 7966)
molecule tags Hydrolase
molecule keywords LIP1, secretory lipase (Family 3)
total genus 95
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zrdA00
1T4MA 5AM1A 2WQZA 1M33A 4CG3A 5BWBA 3R40A 2O2HA 3D3NA 4P9NA 4WY5A 1AC5A 2OCIA 4MYSA 4J0HA 1YSCA 4G1FA 1SCQA 4BVKA 4MQLA 1H2XA 3I2IA 4J0IA 1JKMA 2NW6A 2CUTA 4I4CA 4H35A 2ZJ7A 2ACEA 3H2JA 1UK9A 4QDTA 1QIKA 3G9TA 3DNMA 5ALFA 4BC1A 2JGFA 4E11A 5EIHA 2HA7A 5EGNA 4X93A 1QJ4A 2XMCA 3X3HA 2Z8XA 2XUIA 1D07A 1TKRA 3GBSA 5CH5A 4DNOA 1IZ7A 3I2GA 3FCYA 1VZ2A 5ESRA 3I2JA 5AK3A 3MUOA 3IIIA 3LS2A 4X7BA 1UOQA 4FNGA 4LIPD 5CT6A 2GBFA 2YH2A 3BXPA 2GZSA 2WFLB 3A2NA 5C81A 3WIBA 2RIPA 2HADA 3ILSA 2Y6UA 3WJ2A 4U2BA 3C8HA 1QIIA 3V1NA 5HKAA 3QPCA 3D59A 4DLNA 3WIOA 1MJ5A 1CUBA 5AICA 5AKHA 4KRYA 5K3EA 4QDOA 1TQHA 2CEKA 4AZ0A 1YB6A 3WWEA 5CT4A 1L7AA 3OURA 4JH0A 2WTNA 5AJHA 4OYYA 3C43A 1NU8A 4ARAA 2XUJA 1TIBA 3H17A 4QE3A 3FWHA 1FFAA 2VJAA 4GDMA 1WB5A 2Z3WA 1QO7A 5FV4A 2H7CA 4UHHA 4CIAA 1GQSA 3PF9A 5HQ3B 1F6WA 4AO6A 2VF2A 2R8BA 4W1QA 4C01A 3NOXA 1Z68A 3BJRA 1MT3A 1K8QA 1CVLA 2WG2A 2V97A 1H2YA 4P93A 4DSZA 3BDVA 4WDQA 3STVA 4HS9A 4Y2XA 3WWPA 1BU8A 1IUNA 1JJFA 5AI0A 1H22A 4M0FA 4Y2UA 2AXEA 4ROTA 1EK2A 4IH9A 5AKZA 1R9MA 1E8DA 5F4ZA 3WK5A 1EH5A 1EB9A 3PICA 2J3DA 5A7FA 2XUGA 5K3DA 2BAGA 1MNQA 5AP9A 4D9JA 1XZLA 1IVYA 3IDAA 1W1IA 5AKEA 3WYNA 3IBTA 3HABA 3OPMA 3WQHA 2RHWA 1NU6A 1ZD4A 3KWFA 1EA5A 1QTIA 5AH0A 5CXUA 1G42A 5HF8A 4C6HA 4EZIA 5DNVA 2XMZA 1WM1A 1UKAA 5CURA 4NS4A 2OGSA 1GXSA 4GLBA 5AKXA 1CUVA 3PI6A 1JJBA 1N8SA 5SYMA 1IUOA 3ZLTA 3C8DA 2WHRA 1CUZA 3N2ZB 4N5IX 4N8DA 3V9AA 4NVRA 4H7KA 2QKYA 3FYUC 3HZOA 1BCRA 2IX9A 3K9BA 2XLCA 3TGLA 5JALA 3STYA 4LKOA 2OLEA 3FNBA 3E3AA 2UZ0A 5LZ9A 3WL8A 1QIGA 4C87A 4TPKA 4Q3KA 2AJ8A 1MPXA 2Z5GA 1THTA 3LP5A 5ALMA 1X2EA 1H23A 4X71A 1RYYA 3B5EA 4AN1A 3KD2A 4Q1VA 4X6YA 4DMCA 3O4JA 1GPKA 3D7RA 3DQZA 2QM0A 4BTVA 3OG9A 4UHDA 3C5WP 1XRLA 3V1MA 1F0PA 1LPAB 3DS8A 1QONA 2EDAA 2QUBA 4J3JA 1VLQA 1BCSA 4H18A 1XQXA 4UBMA 2R11A 1ZD3A 1LPPA 4J0CA 2V9ZA 3HEAA 3FYUB 1HBJA 2PU5A 5LZ4A 5AI9A 2JF0A 1QE3A 2XT0A 2HFKA 3WL5A 2OGTA 1XLWA 1AQLA 3C6BA 5ALOA 5FP0A 5K3AA 2C0QA 2DR0A 4X94A 4IO0A 3TJMA 1YB7A 4L9AA 1XFDA 3EF3A 2HU7A 3T4UA 1XRRA 1P0MA 3M82A 4PQEA 3V48A 4HRXA 4FFVA 1PJAA 2FX5A 5FDFA 3WWDA 1UWCA 3YASA 3FLEA 1IUPA 3RARA 1DU4A 4BRZA 4A16A 3LLCA 1YASA 4KE6A 3WKCA 4UHFA 4MEAA 3PFBA 4B9AA 2QVBA 4WFJA 4QA9A 5ALYA 3AIMA 1S8OA 3EQ9A 1CUGA 2RAUA 3FYTA 4AO7A 4M0EA 5CW2A 1JI3A 4A23A 4G4GA 1ZD5A 1J06A 2XQIA 4DMKA 1EDBA 1MNAA 2ZYIA 3D4LA 3FLBA 4H77A 1BEZA 4FLEA 4PO3X 1TCAA 2HU8A 3STTA 4RPCA 4JEIA 2H7YA 2I3ZA 1W4LA 3ED1A 2CJPA 1GPNA 1VOTA 2DHDA 3GA7A 3PDCA 3GELA 2EDCA 1BEEA 4W63A 5KBYA 1ZGCA 1XROA 2ROQA 3SWWA 4YPVA 1ZI9A 4DIUA 2OAGA 3QBJA 4QNNA 2AJDA 3QPDA 2QZPA 1X70A 1QIDA 4FBMA 2PUHA 1DTEA 1JFRA 2O2IA 5AHXA 1YAJA 2CZQA 1WB6A 1QIHA 5K3CA 5EHNA 5LZ8A 3DYVA 1WPRA 1ODTC 1VA4A 2DQYA 3W9BA 1XKLA 1AUOA 1CUYA 1R9NA 3IB3A 2OQVA 2OPHA 1P0IA 3FOBA 4J03A 5A6VA 5ALGA 2I3DA 3EBLA 4PF1A 2H9YA 2ZSIA 3FSGA 1XZFA 2HFJA 1E3QA 4K2AA 1FFCA 2HRQA 1C4XA 2GBCA 5JD5A 4B80A 5T4FA 3DD5A 1ZGBA 5A7HA 5AOBA 3W06A 1LGYA 3DYIA 2QT9A 3C70A 4HVTA 3CCBA 4B0PA 3STXA 3C87A 4UHBA 3G7NA 3QZUA 5AM3A 1JU3A 3I2KA 4KAJA 1K6EA 3CN9A 5I9IA 3OOSA 1DT5A 1XRMA 3FAKA 1XQVA 4GI1A 1WOMA 5HKBA 1CUJA 1OCEA 3A2MA 4OB6A 4B81A 3DLTA 3D5EA 1UOPA 1UKBA 5D6OA 3D0KA 2XUFA 4EY5A 1L7QA 3RKSA 3WJ1A 4G4JA 2HA2A 3VJMA 1ORWA 2DFPA 3CXUA 3W05A 5AM0A 4X90A 4CI9A 1H2WA 5HK9A 3FYUA 3VXKA 3LIPA 3C5VA 1XZKA 1P0QA 1HLGA 4BC0A 3P2MA 4KE7A 1ODSA 1TCCA 3G9UA 4ZGBA 1VZ3A 1HKHA 4RGYA 3EIOA 4QWWA 4U2FA 4FHZA 3KWJA 2XMRA 1SCIA 2QJRA 3Q8WA 5ALZA 1JMYA 1YAHA 3DOHA 3HACA 4FDMA 1QIMA 3ZI7A 5H3HA 3QPAA 2VSQA 4EB0A 4ZREA 4FTWA 1B41A 2HHAA 5BWCA 1EINA 2FUKA 1AURA 3ANSA 2BGRA 3GZJA 4UHCA 4W1SA 4KR0A 3AUKA 3G0GA 1E89A 4F0JA 5D3KA 5ALNA 3AZQA 5AI5A 4X3CA 3N0TA 2XUAA 2OCKA 3AINA 1O6GA 1CQZA 3VKFA 3BIWA 2XUOA 1ZIYA 3R0VA 1UZAA 5LIPA 4OCZA 3FSGD 4PSUA 3R41A 1QLWA 2ZJ6A 3G0DA 2ZSHA 3BJMA 1ZJ4A 1YS1X 2ZJFA 5ALUA 3H2KA 3ZLUA 1EB8A 2ECFA 3L1JA 1XRQA 3HXKA 5EI5A 5AIAA 5J3JA 2CBGA 1ZI8A 4FWBA 2WM2A 3RM3A 1R3DA 4UBLA 1A8UA 1LBSA 2QMQA 5FRDA 3WL6A 2YXPX 2WSLA 2WILA 5LLSA 1LBTA 5EHXA 4QDUA 1N1MA 4Q3OA 2RGUA 3K6KA 3WWCA 2OXEA 5AM2A 2B20A 1AMNA 2P8SA 4J0KA 3QMMA 3C6XA 3SC2A 1CUHA 1SC9A 4OU5A 2JIDA 5CT9A 2AJCA 4Y2SA 4X00A 2JEZA 4BAUA 3WK6A 4AO8A 1DWPA 2EEPA 5AKGA 5CRIA 4B0OA 4PV7A 4W1RA 2B9VA 3D2BA 4DTCA 3I6YA 3F98A 5AKKA 4DMFA 3DDUA 2XMQA 2QUAA 1XQYA 2HRRA 4DNQA 1QZ3A 4FLFA 4EA6A 1MTZA 4CG1A 2WHPA 5EHQA 4G8CA 1CUSA 2XUKA 5AI4A 1UK8A 2C4HA 1BRTA 1LLFA 2JGJA 3W04A 4MXDA 3BF7A 3O4HA 1XZMA 1HPLA 1EXWA 1SOMA 4PW0A 2QTBA 4H7FA 1ORVA 3VISA 1XZEA 1FFDA 5JD4A 3H1AA 1K4YA 5DTIA 1UXOA 4OB8A 4OSEA 2XUPA 1U4NA 4OB7A 4GWLA 1QTRA 2W22A 2VEOA 4FKBA 5K3BA 2DCMA 4W1PA 4W9RA 4ZRDA 2VJBA 4OPMA 3S2ZA 2PSEA 4FFWA 1GPLA 4BATA 3NGMA 4B85A 4X6UA 1MN6A 4UFPA 5ALLA 1XZIA 3GFFA 3PFCA 3G9ZA 1J1IA 4YK7A 3DEAA 5IVDA 4EY7A 4HTAA 3U0VA 1HDEA 2VT7A 3F96A 5JAPA 3FBWA 4ITVA 2X8BA 4JYMA 4ZV9A 3KOOA 3O4IA 2QR5A 5K3FA 5LKRA 4BAGA 5JAOA 1G4HA 3KSRA 4EHBA 1N5MA 4LXHA 5A7GA 3W9UA 4G8BA 2WUEA 3HYSA 3F67A 1PV1A 3BIXA 3OM8A 5CH8A 1W75A 3DOIA 2B4KA 1C7JA 4INZA 5DJ5A 4J0GA 5C7YA 3AFIA 1GT6A 2G63A 3STUA 3F9CA 4X85A 4AMYA 1GKKA 1LPSA 2QXUA 2CB9A 4P08A 5SYNA 2YASA 4BRSA 2C0PA 4K6KA 3H19A 5ALPA 1H2ZA 2HA6A 3PF8A 3IUNA 1WHTA 2WUGA 4UBKA 4UFOA 3WKDA 2OCLA 4N8SA 4BZZA 4B82A 5ALQA 3BF8A 5E4YA 5KWIA 3TRDA 3V1KA 1QO9A 2XQGA 1XZGA 1XLUA 3EQ7A 2VT6A 1EVEA 2E3JA 3V1LA 4IH1A 4GHWA 1QFMA 2C5GA 3B3QA 4G4IA 4Y2QA 1FFEA 2RONA 5AM4A 1CQWA 2AJBA 5JD6A 1LPNA 4U2DA 3JW8A 1VXOA 4BVJA 5FLKA 4MEBA 2CKMA 3ESAA 3PUIA 1CFJA 1DWOA 1EDDA 2BUBA 3RLIA 4DNPA 1ZI6A 4AMZA 4C89A 4Y2RA 5LKAA 5AKIA 3S8YA 3ZV7A 2GBGA 4J0JA 5JADA 3ZWQA 1U8EA 1CUCA 4JNCA 1CIJA 1R4ZA 1LPOA 1LNSA 4F60A 4XIIA 4YASA 1F0NA 4G9GA 3O4GA 4HXFB 2XUDA 1K5PA 4QEKA 4HXEB 3R3VA 2OG1A 5D3ZA 4K5QA 5FPQA 4BZWA 5FPPA 4C4ZA 1A8QA 1XRPA 3MVEA 4EY8A 2OQIA 4BCCA 2K2QB 3R3ZA 3M3DA 2VJCA 1XZCA 5HFAA 3WMRA 5E2IA 4K6HA 1UOOA 1CUWA 3GROA 1DX4A 1XZAA 4UFNA 4E15A 4TVKA 4DNFA 4V2IA 1XRNA 2IIVA 3WA7A 1CUXA 3MGAA 4UHEA 3ICVA 2I78A 3H2IA 1Q84A 4G8DA 5FUMA 1EDEA 5DYWA 2GYUA 2ES4A 2ZVDA 4DSAA 4EY4A 4PSCA 1IMJA 2WJ3A 5CT8A 1HQDA 4KACA 3R3XA 1U2EA 2PX6A 2PVSA 3IUJA 5HF9A 3IUQA 4WY8A 3I1IA 5K3FB 3PE6A 4B7ZA 5EIEA 4CCWA 4H7DA 4GEGA 2PM8A 1RWQA 1MU0A 3HC7A 3UUFA 2WJ6A 1W6RA 3WYDA 1J2EA 2FJ0A 1AX9A 1LZLA 3PUHA 4G9EA 3UUEA 1WCYA 1LPMA 2Y2UA 2FJPA 4XVCA 5LZ2A 5FKJA 3VVLA 1XKTA 2DQZA 3C6ZA 3R3WA 4FLMA 2VAVA 4BE9A 2HA5A 2C58A 1R50A 2GYWA 7YASA 5IKXA 3QYJA 3IVMA 4E46A 1CRLA 2J4FA 2DHEA 4BVLA 3OC0A 2WTMA 3M83A 1ZIXA 2HIHA 2G4LA 2G5PA 4RE5A 1DQYA 1VA5A 3WA6A 5T4BA 2OGZA 1TRHA 4LXIA 5ALWA 2HM7A 5FXMA 1N5RA 1PFQA 3HRHA 1MX9A 3O9VA 3I1YA 3A70A 5HZGA 5C8VA 4E14A 5ALSA 1EVQA 4HZGA 2Q0XA 2WFMA 2ZYSA 3BL8A 5EIAA 4Y7DA 2BJHA 3DL4A 5LP1A 4H7JA 1CUAA 1JU4A 2D0DA 1E5TA 5HK8A 1W52X 3HLKA 3H18A 1X2BA 1CUEA 4DM7A 3R3YA 1TAHA 3G02A 1DQZA 2WFLA 4C4XA 4I19A 2GBIA 4HRYA 2Y1KA 2X76A 2W6CX 1RP1A 4X92A 3JWEA 3CCCA 1FSSA 5EHZA 2XE4A 3AJAA 1CPYA 4DYHA 3MUNA 2O7RA 1XZDA 2XDWA 1JT2A 4BCBA 3A2LA 3STWA 1Q0ZA 3L1HA 3M81A 1ACJA 4Y2TA 4LYEA 2HDWA 3H2HA 1MAAA 4X95A 4XX1A 1VE6A 4X97A 2WLSA 1BE0A 1QIEA 5HQ3A 4AN0A 1FFBA 3FCXA 1UFOA 3BWXA 5ALVA 3WK4A 1IZ8A 4NZZA 1CUFA 5LZ7A 3I6ZA 1VKHA 3WKAA 4B83A 3ZPXA 2V96A 1QOZA 3EQ8A 4ARBA 3U1TA 3WZMA 1K63A 2WIJA 5AK6A 3VJLA 2C7BA 1QGED 2PBLA 1VJ5A 4B84A 5AOCA 5AK4A 1HL7A 3E0XA 1KU0A 5IVKA 4Y2JA 5JYCA 1I6WA 5JAHA 4UBOA 4F5ZA 4EUSA 2QJWA 1T2NA 2JGIA 4KEAA 2J4CA 3QM1A 3ZLVA 5CH3A 4BTLA 3I2HA 1ZICA 4QLAA 1GKLA 2HU5A 2XMDA 3H04A 4QLOA 2VA9A 3H1BA 3DCNA 3IULA 2XUHA 1Y37A 4J0DA 1F8UA 2VTVA 4EY6A 4UBIA 2QXTA 3UMJA 4F21A 3IUMA 1SCKA 5JASA 2IITA 2XI4A 2HA4A 3IA2A 5DWDA 4QZVA 1ODCA 1XZHA 3AIOA 5DLPA 3CN7A 4MWTA 1A7UA 1E66A 4KAFA 3RK4A 2WKWA 3F97A 4ETWA 3FLAA 3IURA 4FMPA 1EHYA 5ALHA 5E4TA 2WU3A 1DT3A 2O7VA 5IVIA 4ZI5A 2VQ6A 4Y2VA 2BGNA 4HAIA 2XMBA 4BP8A 3ICWA 4BP9A 1OILA 3NUZA 1ZJ5A 4EBBA 1EK1A 2XUQA 5DTJA 4LHEA 5AIBA 3WWOA 5JIBA 4Y2PA 3A6ZA 5AK5A 4A5SA 3WL7A 1MAHA 2PSJA 2JGMA 3AIKA 3WLAA 5JAUA 3O95A 4KRXA 1XZBA 4AXBA 2WG0A 3HSSA 2WUDA 3O9MA 4AX4A 2WIGA 1E8NA 3WK8A 2BUCA 4UBNA 3KXPA 2WHPB 5ALKA 2HA0A 4N8EA 5AI8A 2GYVA 4TGLA 5JZ9A 5JATA 2OAEA 3DJYA 4KJXA 4MQMA 4H7EA 1THGA 4JYPA 3WZLA 3OTQA 3KDAA 1LPBB 4GECA 3LIIA 1VE7A 3AZOA 4GW3A 2G5TA 5AO9A 3QH4A 3Q0TA 2PUJA 1GGVA 3HI4A 1QIJA 5E4JA 1YA4A 1DINA 5ALDA 1BN6A 2WIKA 4Q82A 4GXNA 4XWGA 1ACLA 5KWJA 4U2CA 2Z8ZA 4AZ3A 4DMHA 1OXMA 1WHSA 3VJKA 4OU4A 3H2GA 4ZV7A 2AJLI 1G66A 4WFKA 5AI6A 4H7HA 1QIFA 3DL7A 1CR6A 3WK9A 3WI7A 1CEXA 4I3FA 2WFZA 4XJVA 4UBJA 1R1DA 5DYYA 4C4YA 2JEYA 2CMFA 5LZ5A 4Y2YA 5IH7A 2B61A 3NWOA 2JBWA 2WU4A 4RNCA 3I2FA 1GQRA 5JZBA 5I7UA 1VXRA 3ESDA 4X91A 1LZKA 1YR2A 5T4EA 5K5EA 2DHCA 2HL6A 4Q05A 1O6FA 4BYMA 3QITA 5ISMA 4CCYA 4O08A 2H1IA 2WUFA 2J3QA 2ORYA 3QMWA 1A8SA 2JGLA 2WHQA 1UK6A 3R3UA 5DYTA 3AILA 3ANTA 2VJDA 4JUIA 4Z49A 5A62A 3VDXA 1ZD2P 4BAZA 3W2TA 2O2GA 1XZJA 4BDTA 5JARA 4FBLA 4HXGA 3WKEA 3I6MA 4FNMA 2LIPA 4IQ4A 4H7IA 2JGEA 2JGKA 5KREA 3JYHA 1YS2X 1EI9A 4J7AA 3G0CA 1MX1A 1G5FA 3SX4A 1FJ2A 2XMSA 1P0PA 3GUUA 5BV7A 3D2CA 1Q0RA 3HJUA 4UUQA 3G0BA 4AQDA 4MWSA 4QWMA 5DNWA 2XLBA 2XQJA 5ALRA 4L0CA 1EX9A 2WJ4A 2V98A 3L1IA 5A2GA 1XQWA 1SFRA 4G5XA 5DNUA 1KU6A 5ALIA 5JANA 5AKYA 5EFZA 5CTAA 5D7BA 4GBGA 4ZWNA 5ALEA 3H0CA 5A71A 4OYLA 3E1GA 3G9XA 3TEJA 1ISPA 2QS9A 2HA3A 4FOLA 3ESBA 1AKNA 3BDIA 4PSDA 4QDZA 4B9EA 1BN7A 4IHAA 2X5XA 2BUAA 1WB4A 4KE8A 4OD0A 4LYDA 4CG2A 1XLVA 4WFIA 4WJLA 1TK3A 2YYSA 3WK7A 3I28A 1UK7A 1CLEA 1MX5A 4WCVA 5BOVA 2PPLA 1Q83A 3LCRA 1UT6A 4ZXFA 4CFSA 1W76A 1C7IA 3VVMA 2PSHA 2QRUA 3DKRA 1CUIA 4KYVA 5I8PA 1BS9A 2BFNA 4RE6A 5T4HA 2XQFA 1GZ7A 2WIDA 4CIBA 1R88A 2PU7A 3FVTA 4OUKX 1BROA 4DGQA 3AZPA 5CMLA 1USWA 5AM5A 2RI6A 3C6YA 4B6GA 1YA8A 5CBKA 4L72A 4BDSA 4Q34A 4MJ3A 2ZYRA 4IH4A 4BCDA 5HCUA 5ALJA 4KE9A 4BBZA 2XQKA 1MO2A 3FVRA 4X6XA 2Y2VA 2H7XA 3F8SA 1KEZA 5C8ZA 1DX6A 3BE8A 3QMVA 2RHTA 2D5LA 3O0DA 1A88A 3B12A 3K2IA 2ONCA 1ZOIA 1Y7IA 2QOEA 4L3WA 1AGYA 3DKKA 1UKCA 2Y6VA 2OCGA 2XB6A 3D2AA 2I03A 5C8XA 2DSNA 2WG1A 1JJIA 1CUDA 2VATA 4KAAA 4H0CA 2BCEA 2PSDA 3T52A 3G8YA 2XMGA 5CXXA 1B6GA 4AB1A 4CCYB 2WIFA 4UPDA 5LYYA 5AKLA 5CT5A 1WPXA 3WKBA 5FOQA 1AZWA 4M0MA 4YX9A 1CUUA 1DWQA 4BE4A 4BB0A 3QVMA 4K6GA 2C5FA 4PNZA 3G0IA 4C88A 1J07A 5AOAA 5ALTA 1ETHA 5JZSA 4NMWA 4Y9SA 3SK0A 4Q3LA 1NX9A 4U2GA 3E4DA 4LXGA 5HF5A 4MYDA 5HF6A 2PKYX 2GZRA 1TCBA 2ZYHA 1E8MA 1JMKC 3ESCA 1CV2A 5HFNA 1QFSA 1U65A 2PSFA 4U2EA 5YASA 5AKJA 2ACKA 2VAXA 4P92A 4QDXA 1Y7HA 2PL5A 4N5HX 5ALXA 5IVHA 2Z3ZA 1L7RA 1YCDA 6YASA 3C45A 4S0XA 4WDRA 2BKLA
chains in the Genus database with same CATH superfamily
1T4MA 3F0TA 1KMQA 3S99A 4YMIA 3TRFA 2GPJA 4JYBA 2FA9A 2GARA 4R8VA 2HUPA 4EMBA 2FW6A 4IZOA 5TC4A 3HCOA 5CX4A 3X1XA 2YV5A 3AY7A 4K9OA 1ZPDA 4HI0E 3R0XA 4ZVUA 1JFTA 1BXRA 5AUNB 4MYSA 4QUDA 3TZEA 1MC1A 1SCQA 2WAYA 2XPCA 4H0NA 1EDOA 1UWLA 1N2IA 1D2GA 1N3BA 1RLMA 2Q1TA 4J0IA 1D6JA 3TFWA 1N6LA 2AN9A 2VWPA 5AW9A 6REQB 1N25A 2W2PA 4KYTA 4E30A 1ICEA 1OKKA 4BU1A 4LCBA 3HKBA 4EVSA 3Q9UA 5A5EA 1GGNA 1ZM2A 2HIGA 2NW6A 4XB1A 5DWQA 4BFCA 1NF3A 1E94E 3FE2A 2ZAGA 4DHEA 3S55A 4V1CI 4H35A 2ZJ7A 1APBA 1C4WA 3EXIB 4NI5A 3NM4A 3V4OA 1PGOA 2I2XB 2QMYA 5B6IA 1T26A 3J7AC 1ZC3A 1Q0QA 3M6LA 1PBNA 4QDTA 1AQIA 1JDVA 3SC2B 7AT1A 1XF1A 3G9TA 4TYNA 4RH1A 3V4RA 3HHEA 4C1BA 4BC1A 3T15A 3IAHA 1ZUIA 2JGFA 3T0IA 2WSIA 1NBHA 3A1NA 4YRLA 5I8ZA 3WL4A 5EGNA 4AT1A 4CF5A 4OQMA 4NXMB 4I66A 5HKOA 2KX7A 2QX6A 4XB2A 4HT3B 4KPGA 2K4MA 3PEFA 2FWJA 4X93A 4FU0A 4YV0A 2V0CA 2Q41A 3LDHA 3WP1B 1H2EA 2PAFA 1XMPA 2FUEA 2CHGA 1TT5A 4COOA 2NVWA 4EMTA 3II6X 3A1TA 3BFVA 4I55F 4Z9AA 4YUWA 2YZGA 4R9VA 1QMGA 4F2PA 1GL3A 3FBGA 1O95D 1UBTS 3LW7A 5U4QA 4C3ZA 1IWBB 2UZ1B 1RI3A 5E8RA 2XUIA 3VR5D 1MF7A 3ZZNA 2B78A 3LKVA 1M75A 3I5MA 1LBQA 4KV9A 1OXKB 5CDSA 5AK0A 1RWXA 1F2UA 2NTYC 3DFMA 4Q4HA 1X8JA 5D01A 5CK5A 1BDJA 1JPNA 3CMMA 3E7WA 1X13A 4I8XA 1W2WB 3FRIA 4R71A 1MEOA 1NUSA 1UOQA 3B89A 1NV8A 1C50A 1BVYF 5IBPA 4BIMA 4EITA 1GEGA 1ZM4A 1ISRA 3EAQA 4UNNA 2WFLB 4S2EA 1FFXA 2OFPA 3LK6A 3E82A 3F6RA 4PLGA 3ZV4A 3A2NA 4CI0B 1PZNA 1HDRA 2F1HA 1LWNA 2ZAYA 3AFMA 4FFNA 4IJ5A 4LRTB 3WIBA 1J49A 3JXEA 3QWHA 5EIBC 1SEPA 4BEWA 4Z0HO 4YHHB 4CUKA 3O8OA 3K1ZA 1SPXA 4XH9B 1HOTA 2MYPA 2PUDA 1ZOSA 3KU1A 2A3NA 3E84A 3ILSA 1G291 4MV0A 1K68A 1GSIA 2P9GA 2Y6UA 3AFHA 4K9QA 4EB0A 4KWTA 5CBPA 4U2BA 5JWRA 1E0DA 1TM4E 2Z2XA 1Q22A 4NQRA 3TSAA 1CZUA 1M1NA 5ICGA 1ZXBA 1NXSA 3NHLA 3EVDA 2DZDA 1JEJA 4FYMA 4IRMA 4F7DA 3SR0A 3WMGA 3D59A 2ZZMA 7MHTA 3AIIA 1RRCA 2ERXA 1R6BX 1U5BA 3RYIA 1W1WA 3T7JA 5FCDA 3ZJ4A 2HIAA 2YYAA 1GTJ1 2K2WA 3M3PA 4LQDA 4MPDA 4G1UC 5DCWA 5B7QA 1W35A 2HCFA 4KRYA 5AKHA 1U7WA 2YINC 5T8KC 3K7EA 4EF5A 3ZEAA 5HIAA 3E53A 5FBHA 2WJYA 3MT8A 3G7SA 2CEKA 4V0SA 5T5QA 5MN6A 3EFEA 2CLHB 1Q1AA 3AOEC 3D7KA 4HH0A 3DXZA 2DUWA 4C1NA 2FRDA 2Y05A 4LFAB 1BRMA 1J8FA 2P1ZA 2CJWA 3IPCA 3PHIA 3QEOA 4JH0A 3DO6A 1M9NA 1EX1A 1QOPB 3UH1A 3GW8A 1EFUA 3IR7A 4OYYA 4OJNA 1M34B 3FZGA 1Z28A 5FHRA 3GUVA 3BE4A 3C14C 4HQOA 4J4BA 1DIBA 3RYFA 3PC2A 4P7JA 2XUJA 1XNGA 2ERCA 3DQPA 3I32A 4YN3A 3V46A 4XJTA 2C95A 2XITA 3OOHA 4TMWA 4UU8A 5CNKA 3ZCTA 1XK7A 4P3OA 4TVOA 4OHRA 2B2NA 1QWOA 2W58A 3K0KA 9LDTA 3KETA 4L76A 5G2OA 3HVJA 3V2UA 1FFAA 4FP9A 3V3TA 1CJMA 1SHZA 1VG9B 3Q3GE 1MPTA 1PJSA 3UK1A 2PZLA 3E81A 4DIEA 4EQ6B 2YVQA 2Z3WA 2D2VA 2CXTA 4HP8A 2UYGA 5FV4A 5FLXA 2F55A 4UHHA 1LI4A 4CIAA 1ZDMA 1QDEA 1ISFA 3IOCA 1JHYA 3PF9A 5E9QA 2CW5A 3HJFA 4MS4A 3ZWAA 4FT4A 2B6HA 2BGJA 3BK2A 3KTFA 1YZHA 1GO2A 1GCIA 1WDMA 2VF2A 5ER9A 1D4ZA 3P2IA 3M5WA 3E9QA 2GWRA 3TO5A 3FHTA 1Y34E 1Z68A 1K88A 3FDXA 2B1RA 1MT3A 4TRJA 2PE5A 1EE1A 1JLRA 3SSOA 2P6OA 2P41A 3G8DA 4O4JA 1CVLA 3AKCA 2F62A 4MLDA 3VPHA 4ZZIA 2O19A 4RHCA 4BFTA 3W6PA 1BE8A 1XA0A 4ODIA 5K8UA 2B6NA 5A3JA 3OQBA 3AOEA 4YP7A 2VHUA 4M55A 5TPWB 4HS9A 5IZ4A 4HUQB 1RIIA 2C78A 1K3TA 4Y2XA 2F59A 1A7AA 3NEPX 3LY5A 4L3OA 4X64B 3AVTA 2QMZA 4P3YA 1JEYA 4G0OA 3QSYA 1B76A 3KV3O 3VJRA 2FEKA 2YUTA 4M0FA 3USZA 3K6SB 4DR1B 3OE7D 3GP8A 1Y8ZA 4GRDA 1EK2A 1O03A 1X1TA 5JS2A 1CRWG 1ZH4A 1QH9A 5JO9A 3GPDG 2AOTB 4CR6A 3IO3A 1Z4OA 4GKVA 1E8DA 1L9KA 1VDMA 2A9VA 2CNWA 2FX2A 3M33A 2W48A 1G7CA 2ZSFA 4ND1A 4BWGA 1RW4A 5HRCA 3JD1A 3AHGA 1VKJA 2PUAA 1GN9A 1X0VA 1Q95A 2OZPA 3NHSA 5A04A 2V7PA 3MTBA 2Q2NA 1UFRA 3QA3E 2C59A 1EB9A 4N5NA 1UEIA 5K4GA 3AJ8A 4LZAA 3AVOA 2OXRA 3GRRA 1QU3A 1ONBA 4MO9A 4I1PA 1FFSA 4LJKA 5EC8A 2GZDA 2Y1WA 4D3SA 4K8OA 1MNQA 5AP9A 1FMLA 1NZDA 3D4OA 4YQFA 1GIAA 4URHA 2PS3A 1NVVR 1ZOOA 3HM9A 1XZLA 2C03A 2VSFA 4CKEB 1FLAA 4BVEA 3RG2A 1IK6A 1W1IA 3HCWA 2MJLA 1FX0B 1ZG3A 3V6LA 2XZLA 2WJWA 4JNKA 4EHAA 3OPMA 2BCJQ 1KEVA 1Q7TA 3I9OA 3SYTA 3BJIC 2QP9X 2UDPA 3KWFA 1NW7A 3AI3A 1QTIA 3LQFA 2XUZA 2YN2A 1DCMA 1VIDA 3QKRA 3ZTWA 2RGGA 5FNZA 4NX2A 1I6KA 4EO4A 5IEBA 2H92A 4C6HA 4YJFB 3ZU6A 5CA0F 1TW3A 2O8EA 1E4VA 4KLCA 4EZIA 3CG4A 2BP7A 2CL7X 4TV9B 1SWVA 4CM4A 2QMUA 2EJUA 4IGFA 3FB4A 3V7WA 1EP1B 1FUUA 3Q2KA 5CLGA 3DE5X 5FOUA 2GSDA 1QUFA 1DBPA 3IAEA 4J1QA 3RKRA 3KPYA 1I01A 2Z4SA 4GLBA 2HTEA 1P2GA 2OORC 3V2GA 1JJBA 2IEIA 1N8SA 5HIKA 1CNMA 3GQBA 4MIKA 4WZ6A 4FHFA 5CA1B 5E9JA 4UNSA 5K8JB 4BQQA 5AW5A 1Z6XA 2AT1A 1CUZA 2OD2A 1RWOA 3S1SA 3DVAB 1CG6A 2ODEA 3ND9A 4N8DA 1X7YA 2IY8A 3FUWA 4CLEA 1RTKA 4S1WA 4EDHA 3OZIA 4QOSA 3V4SA 4IHKA 3EZGA 1AY0A 1E59A 2C8KA 4Q5IA 4YP1A 3QUTA 1KTVA 1P2SA 4FFDA 1RU3A 1M2FA 4RZQA 1BCRA 3K9BA 3D1VA 1NY5A 1U6JA 2BN4A 4KXMA 3SJBA 1PD1A 1IG0A 1NQ5A 2HF8A 3H1FA 3Q1KA 3FH0A 4A26A 3M70A 3OM1A 5JI2E 3AESA 3V5NA 1B6SA 4JP5A 2FE4A 4M60A 4RX1A 5I7VA 4E5UA 1P3JA 3PV0A 5JALA 5C51B 3ZZ0A 2HPHA 3MUFA 2R68A 1F1JA 2Z6UA 1SD2A 1XO1A 3AR2A 3LT0A 1WKCA 1BGXT 2OLEA 1W4CA 3PFKA 3PHBE 2NZJA 4HGOA 4INPA 4HLUC 3V6MA 4UDYX 3U4AA 5DU2A 3AOGA 3DEJA 4NICA 1L8OA 3HVKA 1WY5A 1GAQA 2AK2A 2X19A 4JLPA 4BXOA 3AH8A 4K1XA 2Q46A 4BKUA 1ZNYA 6GPBA 3CLTD 3H84A 1Y6FA 1N4AA 2Z5GA 2ADMA 4BFYA 5DTRA 1IXRC 2C7QA 2CGEA 3TW4A 4YP5A 1THTA 1SR8A 1YONA 4N3BA 5ALMA 4JJIA 3U3ZA 3RVBA 1W85B 5EEGA 5BNFA 4IHQA 3N59A 4PO1A 5WRFA 3SBDA 3P8ZA 3QFTA 2XXJA 1DRKA 1DXQA 1O94D 5D85A 1G2QA 1EWKA 1KDPA 3BHNA 3EYAA 1NQAO 1KS9A 2QG4A 4I7EA 4OXQA 4PG5A 2RHGB 2F1OA 2VSXA 4TS9A 3RYFB 1FNDA 2Q5JA 1VJ1A 2OP1A 2FETA 2YOFA 4KGZA 1VB5A 3W4KA 2B1QA 3ZZ1A 1QRAA 1O9GA 3C5WP 3LOPA 3OG9A 1E1CA 2PRJA 1JXMA 3FCOA 4P0QB 1FTGA 2QUBA 2EDAA 1EVKA 4XKJA 2Q6TA 3KOZA 3U1VA 4B4KA 5LNK1 4KVFA 4ZVNA 1VLQA 3TQQA 1SHUX 1O9HA 5EZSA 3ROQA 3IJRA 1Z06A 2BGIA 5C32A 4D0NA 2ONJA 3FYUB 4K8RB 1D8AA 1TF7A 2WIBA 3K8OE 3PG5A 2EAUA 1QE3A 3ZW9A 2HFKA 2Y0BA 2OLJA 3IMKA 3WL5A 4BLVA 1QMPA 4NAUA 3L04A 4D97A 5CR9A 3FM9A 3MJDA 1CB0A 5SZHB 2IUTA 2QDXA 3TOVA 2D7DA 1SBCA 3IOMA 2F7SA 4OH1A 2Q62A 5ALOA 5JSHA 2PUEA 1GY8A 5K3AA 3C4JA 2I6SA 2OA0A 4TLEA 1NDUA 3W3AH 4D9HA 4CKBB 1JG6A 2QTRA 1D2EA 2OYSA 5KYYB 2DR0A 2ZW9A 4WK6A 3SG0A 4A6XA 4DDUA 4L9AA 5IS2A 1Z62A 2OYCA 1X14A 1XFDA 1IY1A 3CT6A 4KDRA 4D8XA 4E1BA 5BN4B 2B30A 3IRVA 3QUSA 1T8TA 5JRDS 3TNYA 2G70A 4XCXA 1BVHA 3L7KA 1VMDA 2PVPA 2VBGA 3E9ZA 3NZEA 1X15A 3TVTA 4ZGWA 5KMGB 4FFVA 1OTXA 1MVOA 3CW8X 1Q0LA 3CV3A 1UWCA 4BO4A 4CHTA 5JFOA 3JRWA 3COJA 4LHSA 2D8MA 3FLEA 4A82A 4ZTZB 4ENQA 3B1KA 2XB9A 4HWKA 2BFEA 4I5DA 3OZXA 1IUPA 3LLUA 5FNVA 5TQ0A 1SUEA 4IDGA 2EYQA 3LLCA 1YASA 4KX3A 5EZQA 2PNJA 4A16A 4YXFA 3FNHA 4UHFA 3OY7A 4UM5A 3GFOA 3PK0A 4MEAA 1F06A 2QVBA 3DR3A 4E1VA 5ALYA 4UQOA 1C7QA 1PD0A 2P9EA 1VBKA 2EW1A 3U4CA 2RJOA 2O4CA 3BRQA 2PZFA 3H3JA 4C29A 4BX0A 2RAUA 1JG2A 3PFHA 1D2NA 2EP7A 4YJ3B 2L42A 4FB4A 3VR2D 2PT5A 4CKEA 4MUXA 4AO7A 4TTJA 3JRNA 1R2QA 1TYBE 4PFJA 3X2EA 4M0EA 3HJAA 1W9MA 4A23A 3UGKA 3O94A 2OP0A 2G08A 2QPTA 2W6JA 3FMVA 3OUUA 4RD6A 1J06A 4NOJA 4RSGA 2O8FA 4HDMB 2JFQA 5DBOA 4DMKA 3NHWA 4O6VA 2JFNA 4GU5A 3PHJA 1GTZA 4AROA 4JEMA 4PO3X 1A96A 4KKXB 4NCBA 1TCAA 1IJBA 3LZCA 4KO3S 2IYQA 2QNIA 1I13A 2C9YA 2HU8A 3DO5A 3QUCA 3STTA 2FCRA 3OJLA 1R0WA 2XWQA 2H11A 2H7YA 1A4RA 3DEFA 3RPEA 1FFHA 4G01B 2G36A 1RSZA 1NXXA 1XDGA 1XXHE 3PFGA 3N8HA 4KWIA 4TWZA 1ZGAA 1N5IA 1JJAA 4NMHA 3V32A 1TMOA 3FIJA 1GPNA 1OJ7A 1M72A 1VOTA 3OEED 1YR3A 4PRYA 4EX7A 2DHDA 1BHO1 2PV0A 3LBIA 3MW8A 3OICA 1IH8A 4HTFB 4N3AA 3T7TA 3X1ZA 4LZLA 4NRDA 4UASA 3PP8A 3VO9A 1AZSC 2Y4NA 3HL0A 5CA1A 4C2UA 2TECE 2ZRAA 4TTQA 1F2TA 3L49A 3GNTA 1YQXA 3O3NB 4WUTA 4HNVA 3SWWA 2A1UB 2RGCA 4YPVA 1A8HA 1PT6A 2PXAA 3C3MA 4QXQA 2O48X 3THYA 2DRIA 2R6ZA 2XVMA 2EV9A 1V8PA 1AO0A 3RNOA 4QELA 3ROTA 4F96A 4Z7JA 3EGWA 1OB2A 3ND5A 4S1TA 5KYUA 1WV1A 3D8BA 5J5AA 1URPA 1IN1A 4WNCA 1TCUA 5EVCA 3BEDA 1QIDA 4D45A 5H16A 2AR7A 3SE7A 1RR6A 4FMCB 4J1SA 1DO0A 1H2BA 2SNIE 1JQAA 2WJJA 3AHJA 3G13A 3JVEA 1T9BA 4IINA 2X0NA 4C4PA 5JAMA 1WQ1R 5DOZA 3HP4A 2AOVA 3DO8A 1JFRA 3I61A 3R6GA 4JBGA 5GIOE 2RARA 1RYDA 1DEAA 5IYZF 4WOBA 5AHXA 1YAJA 2GNAA 3GRUA 3D8RA 3P0RA 1BKDR 1NQUA 2AN3A 2G7MC 1CQPA 2VAPA 4RL4A 3DPSA 1JPJA 3DAYA 4X54A 1GGJA 1LVHA 2HHCA 1K66A 2J9XB 1SUWA 4GOJA 4I4NA 4IJVA 4DMUB 1J23A 1SRQA 3MSCA 5LZ8A 5EPUA 4AXXA 1DE0A 1THZA 2QN6A 1K1EA 5LC1A 1UANA 1AUOA 2PANA 1CS0B 3JPWA 3KSDO 1J8VA 4R01A 5EIOA 3M7IA 3ZYCA 1JZTA 5JCJD 3H97A 1IBCA 2VNSA 1G19A 1S8FA 3LPLA 3CLRD 4MGIR 5HUJA 1U0GA 2YNMD 2W8BB 3N74A 2P2SA 3L7DA 2XR1A 5CEEA 2YDYA 1F20A 4PYOA 1TNDA 3VAZA 4LRXA 3ADKA 5DT9A 1J24A 3U40A 5I7SA 3L4EA 2I3DA 3DV0A 2H9YA 4L4YA 2D62A 4I4TF 2O2DA 4C0KA 4QC2A 4E6EA 3HBAA 1XTKA 2WWVD 4NESA 4TT3D 2Q2VA 2GRAA 3TRHA 4A2PA 4A8JB 1B00A 2IUFA 4DT1A 1JWAB 4DLXA 3PFNA 2YIVX 1HMYA 1XZFA 1ZM9A 2XHEA 3DBLA 3PTLA 4IIJF 4TLCA 2HF7A 4HDKB 2P1RA 4QTXA 1B0AA 3LUJA 5I7WA 2F43B 2HMWA 3QE4A 2A0FA 4E12A 4UCXA 1C4XA 1SVIA 3SZMA 4I1IA 1G5QA 4ZK6A 4FEYA 5IEJA 1NAHA 3QKSB 1ANKA 2GERA 3K5IA 4N6NA 4QQ8A 4A0FA 1LLUA 1XJCA 3C3WA 2VYVD 4RFSB 1V1JA 2LP4Y 4AF7A 4UE3S 2AQHA 2DHQA 4JP3A 1GDHA 3GGDA 1L5SA 3GRZA 1CERA 4GZ3A 1LKZA 4LPSA 5AOBA 5CFMA 3EVTA 1LGYA 2EP8A 4KO1S 4QQRA 4N41A 1BOFA 2QENA 1NPYA 4DCTA 2UXCB 4V0NA 2XNDD 2IOYA 2ILVA 1ZMBA 5T6MA 5KYYA 2RHLA 3TOCA 1J33A 4CEIA 4JX8A 4MOWA 4PAOA 4HVTA 2NO6A 3CCBA 2GD0A 3P9IA 3P7MA 4FHCA 4ON9A 1P9OA 3S68A 2GCGA 4IDAA 1JQKA 1C80A 3T4XA 1R00A 1SQ5A 4JQZA 3RHTA 3TIIA 1JU3A 4QPDA 4HMOA 3NTXA 2D0PB 4UCWA 1I7LA 4DYVA 3O1JC 3OBBA 2BR5A 3H9CA 4R51A 2C7RA 1XRMA 1QK4A 2VN8A 4NCXA 1KDVA 3RT7A 2LWIA 1JR6A 4WTOA 1QHHB 4O4IF 4GI1A 1T0PA 1XTUA 1LC3A 3AY0A 3DCJA 4WE3A 1VKRA 1FDTA 5DIZA 5HKBA 3A2MA 4OB6A 1EHCA 1U2GC 4KL8S 3D5EA 5FJJA 5HDQA 4Z6KA 2DM6A 2F9FA 3N2IA 3IOYA 4R6WA 1T36A 3TDMA 2XUFA 2A5FA 6ADHA 2UV8A 3OPNA 2CDNA 4PC6A 4KLAA 4MS3A 3RKSA 3EODA 5DX1A 4LVUA 3HPRA 4U1RA 1XI2A 2HA2A 4KQWA 4MRNA 1V4BA 1VLLA 1QR6A 1ORWA 4J43A 5KUTA 1DC8A 2XD9A 2YR0A 2BMFA 3EEYA 1O4WA 1EBUA 3CXUA 4HNAA 3W05A 4U02A 1A5ZA 1LBEA 1MH1A 4NAHA 1F3LA 1GKYA 1US8B 4R9NA 3VTKA 2YRFA 5KO2A 4NCAA 3LUPA 1H2WA 1AKRA 3NXKA 4DIFA 5HK9A 4MRPA 4R3UC 1Q14A 1H1LA 5JVDA 2D0OB 2YZ2A 4K6OA 4Y0AA 4WNAB 3I6BA 3LIPA 4J29A 5D1HA 2WTUA 3RTAA 3C5VA 4JBYA 4L2IB 1VDZA 3L05A 4GGMX 1HLGA 4YI5A 4OI1A 1LFAA 3MEQA 1HZZA 1ODSA 4HQLA 1TCCA 1X19A 3Q5EA 2CCGA 1C0PA 1VZ3A 5ECDA 1HKHA 2A30A 3DZJA 5J4VA 4JJAA 4I4IA 1IUKA 3I9LA 4U2FA 3TTYA 3FFWA 4E4RA 4O1MA 2IP4A 2D06A 2H9AA 2I62A 2B0CA 2XMRA 1SCIA 1KY3A 1U4SA 3SXPA 3VC2A 1VPDA 3PQFA 1S2DA 4LXQA 5CAEB 3X1YA 1QHFA 4MGEA 3B85A 3FYHA 3KTAA 1AK9A 4CMKA 1GVHA 3EC1A 3Q98A 4KK3A 1HETA 2VSQA 4R5HA 1SG6A 1CNEA 2GA9A 4GOMD 4ZQEA 3M4ZA 3WFZA 2IODA 4OLBA 1PUIA 4R8RA 3WQBA 1XAJA 1Z12A 4HEJA 4K7JA 3GLGE 3GFVA 3RT1A 2Y68A 2JBAB 3LECA 4DV6B 4W8HA 3PE4A 5F5LA 3HZRA 4J76A 2BGRA 4RS4A 1KA9H 1O89A 4AURA 2WMNB 3FJ1A 1HG0A 2H2DA 4DCCA 3RBXA 5J4KA 2ZUWA 1M8JA 3DMGA 4KR0A 5EKDA 2BMEA 1P2BA 3DDNA 3OFJA 2IZ6A 3KK0A 2R4TA 1T4CB 1SRRA 2OFOA 3IODA 1AKEA 3JTMA 4G56A 3ZW7A 5K4HA 1Y42X 2RFLA 3UAZA 3AZQA 2V8BA 3AK4A 1DJQA 3FKJA 1Z0DA 4N6GA 2PR2A 3SP1A 1UBHS 1NDQA 1BX3A 4HYYA 4X3CA 3CRQA 2RHHA 3GLFE 1M0EA 3C7TA 2LTAA 1N2BA 5KQGA 2I4TA 3N0TA 2Y1EA 3HXMA 4HDAA 3OIFA 3ZE8A 3IBFA 2YJ4A 3B2NA 4KQXA 4OKNA 3KSZO 3PPWA 3TRIA 1U1EA 5K0FA 2GNOA 1VLJA 4UMDA 1HRDA 4U8GA 5H82A 1Q0UA 4TLBA 3SOZA 5DNCA 3BIWA 1HQCA 1PL8A 1VPVA 1DKOA 2Y0CA 2C83A 3KYDA 4YHBA 3V7NA 4F9FA 3AB8A 1BX0A 3SHWA 1EGHA 5EWMA 3O38A 4HD8A 2W2VA 1GUFA 3SVTA 3GVPA 3ETGA 3E18A 1JEYB 1CJTC 5JSKA 4YDHB 2ZJ6A 1T9GR 2OHOA 3TL6A 4FZVA 3UPUA 2FFJA 1YFKA 3G0DA 4WZBA 1YBFA 2OXCA 4PFSA 4U0KA 4EP1A 3DEHA 3ETNA 3ONWA 1QHEA 1JAXA 7GPBA 3AG6A 1Z0AA 1ZJ4A 3BIJA 3LP8A 1QH8A 1VGVA 1U9IA 3RC8A 3ZXIA 1GA1A 5E1MA 4PPGA 3CISA 3P0IA 4CGYA 4YPOA 3DTVA 1K6IA 4B8WA 1A2QA 4KQCA 1FQOA 1XPRA 1J5PA 1J9ZA 2B82A 3IO5A 3OCUA 1E6EA 1EB8A 4HDCA 2PNFA 4DEYA 4HJRA 2DT5A 2WAMA 1P75A 4OK3A 5G0WA 5GP1A 3U44B 1JXQA 4MQ6A 4HNRA 1R6DA 1K89A 1XCBA 3AHDA 3U4GA 4JVLA 5KQMA 2CBGA 2HRZA 3DP7A 3QXHA 3CX8A 2V55B 4FWBA 1NI3A 1Z25A 4FQ8A 1E6MA 4R1QA 2CV0A 1LS1A 3PSAA 3R0ZA 1Y63A 3E9NA 4QU5A 1LBSA 2QMQA 1AKQA 3QENA 5FRDA 5C9ZA 1KXJA 4I1YA 4PBSA 1P7WA 2QMOA 4J7XA 4WLOA 3OESA 3SJAA 3TX6A 4RD1A 1ND6A 3L4BC 3JQAD 1QOQB 4GVXA 2QRJA 2YHAA 1JSXA 1DV2A 1YC2A 2GHIA 1KPIA 1E99A 2IDJA 3G0HA 1AKMA 1RWBA 4ZU3A 3CSUA 5IFLA 5LQMA 2UZ3A 3DVLA 1II9A 3SJUA 5BOSB 1MC4A 4B7AA 1L1FA 2AE1A 1SZPA 3R23A 2FFHA 4OEHA 4JGIA 1PR1A 3P9PA 4Z4EA 2XVXA 4Q93A 1FQJA 1G1AA 1QHYA 1II8B 3HWWA 3WNCA 5JC8A 1LDGA 1N1EA 2HGZA 4P3NA 4TMZA 5B1HA 3U80A 3FOZA 3M6AA 1S1CA 1J97A 2VUHB 4RESA 4ZYZA 4GUAA 2B20A 4NCKA 5C3MA 1AMNA 2CXHA 3I9FA 1A8IA 1FVXA 2IEYA 4RXUA 5B1EA 2E4YA 2H4FA 4D9CA 3NFRA 5DASA 5CGZA 4J0KA 1CY2A 2G1PA 4F4DA 2DBQA 3KHTA 4LQCA 1GPJA 3HNOA 1C3LA 2JFUA 2UZ1A 3WB9A 3SC2A 3LTNC 4EKDA 4DUGD 2P9ZA 1U02A 1FX1A 1NOKA 3A36A 3O03A 2BE9A 3PB3A 1F5NA 5CT9A 3LVQE 4G5YA 2OBYA 2OVFA 5AR1A 4RIIA 2ZJ1A 2A9KA 2JLRA 3DLCA 4OX9Y 3MBKA 2A1TR 2PKQO 4KOAA 4UNPA 4X00A 1UDXA 2HLPA 4HGYA 4HLCA 3WK6A 2BFDB 4GI5A 4K9LA 4C0HA 2EEPA 4B0OA 5AW8A 1W7AA 1NXVA 3LZ6A 3LUKA 4W1RA 2B9VA 1SK9A 3D2BA 4LK2A 4X8HA 5ICFA 1M1UA 1T0HB 2DQ4A 3A27A 3UMMA 5CLJA 2ONKA 4EGSA 1KVUA 2D74A 2VUSA 1TAUA 5CFZA 3HJGA 3DDUA 3I8OA 3OFKA 3FFXA 3ICEA 2Q9AA 4M6WA 4OL0A 3P9NA 4BMCA 4R7ZA 1DL5A 4Q39A 4A15A 1QG4A 4HB2A 3LVBA 1DS6A 1NLZA 2CHUA 2FGJA 3O3OB 4YDRA 4C22A 4F1WA 2QLTA 4QGSA 4I4TA 2JG3A 4ENWA 4AKGA 4EF6A 1A7JA 1TM1E 2QN8A 3ROGA 4QRHA 4ZOLF 3UM9A 4MTCA 1FEZA 3K73O 1EFPA 2NG1A 1Z6YA 1MMFB 4IKPA 3KM0A 3COSA 2O3UA 4GPZA 3OZSA 3HRKA 2AZTA 2X5JO 4L9RA 4MV7A 4P4TA 2P11A 4HZIA 2C4HA 2XAUA 2VUIB 5F98A 2ZYGA 3W3ZB 3FDIA 3OFND 3LLSA 1YE8A 3G2LA 3IAAA 4OBXA 3ZGOA 2A9RA 3ED5A 3VKVA 5EJFA 3DBVO 4X63A 1J0AA 3ZNOA 2M1ZA 3O4HA 1XZMA 4RVGA 3S0JA 3DWGA 3ZU3A 1EEHA 4E22A 1T2DA 4KN9S 4NKRA 4AUEA 1VSQA 1KZ7B 1JHUA 1HPLA 1WHSB 2E4WA 4Q7MB 3SC3A 3NX4A 3KJQA 2FWIA 4JR0A 1NF8A 2CJWB 1IY8A 1SOMA 3CNOA 3AI1A 3QWAA 4GEKA 4LOJA 4PW0A 3SCZA 2IIBA 3KVRA 4K86A 4TXLA 1T3SA 1FFDA 4NBTA 1NG1A 1V8OA 5JD4A 1YR8A 2BFWA 3KHKA 4KVZA 1MJNA 3I5UA 5KNDD 1F9EA 5H83A 4DVGA 1IM2A 1UXOA 3H5LA 1TZ2A 2JIMA 2W00A 5C5CA 3EN0A 2GCIA 3GCXA 3F90A 3VYRB 4DDTA 4GT1A 2J32A 2MYUA 1YBAA 4ENTA 1P73A 2H5IA 2V58A 3E8MA 1GCGA 2CVFA 2ZZNA 4M9SA 1NN5A 2DCMA 3CZAA 3HE3A 3KKLA 3D5QA 4I1RA 4IY1A 5HA5A 4FVTA 4PG7A 5I9TA 3R7SA 2Q3HA 2VJBA 1UP6A 4RM3A 1L9XA 2OOKA 3MWDB 1AT1A 1K08A 1WRBA 3TG2A 2BKAA 4MLZA 3KZOA 1QRDA 4HQ0A 3RRYA 1NMZA 4LYAA 4KKVA 3E05A 2ZXEA 1TJYA 4IXMA 2QAJA 1ZR2A 2R7KA 4MNTA 4IMJB 5BSKA 4JITA 1BD3A 1RHJA 1MN6A 4RU1A 1T4GA 3M49A 5CB4F 3LUHA 3KQLA 2JVKA 1Y1KE 3O7WA 2EP5A 5FFNA 5A9SB 3V4FA 3NRCA 3ZUPA 3AM1A 1UFQA 3LHIA 3FWKA 5BV1A 1HE4A 3KZNA 3PEYA 4C6SA 2HV9A 1SHTX 1NQTA 4IVPA 4WWHA 4IIUA 3I9JA 2NN3C 1SPBS 4DSTA 1GGFA 1MIOA 2VK4A 5ABPA 1RXCA 4GD3Q 3V7FA 4EY7A 4YCNA 4S0ZA 2WLTA 1M2VB 1WS6A 4G5QA 4WRRA 3F96A 2GHTA 4M7RA 4F46A 3L02A 5KOJB 3FPKA 5EE1A 3NWEA 3T12A 3MMXA 2DGDA 1VHLA 2ID8A 5EYPB 3GEBA 4UMVA 3T5TA 4DC0A 3IQDB 1F4VA 2ZI3A 4CFYA 3IVGA 1QF9A 1POWA 4XVUA 4S2UA 2QE6A 3MZ0A 1FFYA 2VP0A 2QR5A 5DDIP 3LG2A 1MB9A 5JR3A 2IZZA 4G5HA 5IDXA 2QTHA 3PTAA 2QV0A 2E2WA 3Q2IA 4MTLA 4PHHA 5JAOA 4DF3A 5K6AC 3TJZA 2WC1A 4EHBA 5HPYB 2O14A 1JFSA 1EYZA 4LXHA 1CR1A 4F1JA 4LY0A 3P4UA 2O54A 5A7GA 2AXPA 2HK9A 5A5GA 5HGXA 2C7PA 4IDPA 1RQPA 2W2LA 2ERYA 5E9WA 3JQ8A 5CHEA 5CVJA 2Q4DA 1PV1A 4RD4A 1WIWA 4RDIA 5AVRA 4LV5B 3KLMX 3Q7RA 1TADA 1YZUA 4FHGA 1RRGA 3JQ9A 2B4KA 3B1XA 1Z6PA 3WS7A 5BRNA 4AG5A 1U2RA 1GT6A 2BM8A 3E35A 1QHXA 3ZBUA 3AMVA 3K31A 2DKOA 3CLRC 4B3MB 2F90A 4GICA 1BVRA 3D0OA 2AK3A 5FUYA 4TTVA 3NBMA 1M6EX 3BORA 1RXVA 1LPSA 3GA5A 5TIIA 1XTTA 3IPAA 4HWPA 1E6UA 1DCTA 2CB9A 3AU9A 3IP8A 4K88A 4P08A 3S7TA 1TPYA 3EA4A 5LIRA 5J43A 2HLDA 4FQ7A 4ZQFA 3UZUA 3ILYA 4MV4A 4TL7A 2ECQA 3BMOB 3U4MA 3CNLA 1TGVA 3DMTC 5CXSA 1S7GA 5KKAA 2Q4EA 3DEIA 3ZWYA 2FZGA 2XYVA 4ZRMA 2O8EB 2ZSKA 4WGGA 1FU4A 1KAEA 2GM3A 2I4IA 4UXIA 3DZBA 3I12A 5JYBA 4JLUA 4UFOA 5JHGB 3B3JA 3VR6D 3WKDA 1NP6A 4UD6A 2I7XA 2OCLA 4BZZA 2DUUA 4B73A 2IDMA 1J0CA 3KPVA 4WN9B 2DY0A 4QREA 3BF8A 3A7EA 5B30A 3TRDA 3D6NB 5KWIA 2PX8A 1NBAA 5FUBA 1UUFA 4WINA 1OVGA 5IC6A 3VR4H 1C1DA 2OV3A 2JFFA 2DHRA 3EQ7A 2B99A 4HDQB 5BQ5A 5A3SA 3VR5H 4C0XA 5JNVA 1ZINA 2VT6A 4WADA 3CJQA 1WZIA 4EF4A 3L3BA 1P3DA 3V1LA 5IXYA 2LKDA 2O1EA 2C57A 2MYTA 4LSMA 2TSYB 2F4VB 2RC5A 2A9JA 1T0BA 1W6UA 4R3WA 1PJRA 2JNWA 4RDHA 3RSLA 2DXIA 1KKMA 1WKVA 3O4VA 1UKEA 2WJVA 4HX5A 1P1RA 3F6EX 1DAFA 3DBRA 4MYUA 3ORRA 3EWNA 1PP4A 1NF9A 4ZYWA 1P81A 2B8JA 3D3JA 4BQPA 4NDAA 5LD2C 4G4IA 3UCEA 1G17A 2WR8A 3DW1X 4G0XA 4Q4AA 2IL1A 4PS0A 1EFRD 3WGNA 1R8JA 5CG1A 2C1EA 4Q7KA 2RONA 4YAEA 5AM4A 3S1LA 2FMHA 2AJBA 5FO1A 4WASA 3TTVA 1LPNA 4HAYA 3IDSA 3HU1A 3OLQA 5KHLB 2ZUUA 5AVWA 2F4NA 1FDRA 4XXHA 2R86A 2ZVJA 4MEBA 5IAKA 2GVDC 2YVKA 1YFLA 3CUKA 1PLKA 3K9LA 1E3SA 4BMXA 4I3GA 2CKMA 3PNOA 3ESAA 3DVQX 1HEYA 4P82A 5JMTA 5JDCA 3OT5A 4P0PB 2BUBA 1K98A 3EGIA 3QOXA 3A6KA 3HJHA 5H4GA 2FF5A 2XJ9A 4PGMA 4RW0A 4DNPA 4QGHA 2PYZA 1YS6A 4PNEA 5IJAA 1OE0A 1W85A 3ETCA 4MQ5A 1L7VC 5A4KA 3STHA 2CL5A 4ZO8A 2H1LA 5KNCH 3L7OA 1QFZA 3EXEA 4TYQA 2GBGA 2R62A 4UUOA 4J0JA 2JCGA 2QDKA 3G85A 5JADA 4Z1MA 4GMKA 3ZBPA 4TXNA 1EXDA 3OZTA 1Y4UA 4B7UA 5I8WA 1CIJA 1R4ZA 2W6MA 4HAWA 4XGKA 5DW0A 1NJ6A 1Y1SA 4RPLA 4A8JC 2NO1A 4CKBA 4F60A 1C30A 1BEUB 2HO4A 4XIIA 3SDZA 4V0OA 3BB3A 2OPBA 3NR2A 4QBFA 4WKCA 3JQEA 4Y0NA 1Z3CA 3WYGA 4ZI7A 1DPGA 3HB4X 4XSVA 3L0IB 3SD7A 3I01A 4QEKA 4BWFB 5BPHA 3S2GA 1S8AA 3G1WA 1CZRA 5LOVB 1D2HA 2C3MA 4WXPA 4E2FA 4L78A 4IOKA 1V8BA 1Y1RA 2H1FA 3L9XA 4W99A 4CDGA 1RRMA 1M5RA 4AW9A 1JIUA 1NW9B 4RHFA 2OQIA 3ELDA 4B3JA 1JKIA 1UQTA 1BXZA 2RGNC 2X6QA 3JY6A 4FDVA 3T4PA 5TQ0B 1YO6A 1W59A 1ZJZA 2IXTA 1XTPA 3QVLA 2BSXA 4FC7A 3WBBA 4HAXA 3ZBQA 3W1EA 3R3ZA 4AVYA 3FKSD 1T29A 3EQ2A 4UOZA 1XZCA 4RNDB 2RHOA 1SKYE 2AQIA 5HFAA 3DFKA 5JWHA 4QOHA 4ZT4A 3FSEA 1CULC 3ONFA 1I4LD 4MHOA 4N9WA 3NGXA 3FPAA 1P4SA 2ZR9A 4MQEB 1ONPA 1XZAA 4NNPA 3RU7A 2AOXA 4NMLA 1P6QA 3OCYA 4UFNA 2VDMB 3HVRA 4YJ3A 4PU0A 4HQKA 3BZUA 2GT1A 5DFAA 3H9GA 3KPJA 3QE9Y 3FXAA 1XRNA 4HNHA 5CVVA 2Z9DA 4B35A 3U5ZB 2C9ZA 4UHEA 2BFEB 4AU1A 2V3WA 2ZJOA 4RV5A 1V39A 3B3AA 4RHXA 3P9CA 3X1JA 5BN3A 3PT9A 5LQAA 3NLLA 3ZWCA 1XNRB 3D8SA 3OU2A 4GPAA 3RIYA 1K7CA 5DYWA 2GYUA 4IR7A 4NU5A 4DSAA 4PSCA 3WRXA 1HMPA 2WJ3A 2XVZA 3L8ZA 1V9CA 1HQDA 4KACA 3R3XA 1KFEB 4BKPA 5EJEA 2W0MA 1BDBA 3UCXA 1L1EA 3W8DA 4D9KA 1TXGA 3HJNA 3VKGA 1JR2A 2PX6A 2P79A 3NUQA 3L06A 4M21A 3UJ3X 3OHMA 4AJPA 4JIGA 3A8TA 1RC0A 3I3OA 5IN5A 2Q7DA 2NZUG 4TMFA 3IUPA 4BIIA 3I1IA 3E7FA 5K3FB 4GL4A 2EFDB 4QU8A 3PE6A 1YDMA 4D41A 5E2AA 4WH0A 3OMLA 4GEGA 5EIEA 2VCHA 2JIQA 1M6YA 2PM8A 2IE8A 4FDTA 2DOKA 4OJYA 3GJRA 3UQYS 1DEXA 2OQRA 3ZQJA 2ATCA 4DV2B 5HCIA 1EZ4A 2XIQA 4OMFG 2WJ6A 1KC3A 3RC1A 1W6RA 1FP4A 4KFRA 3WYDA 4F5WA 2FJ0A 1ZU5A 3L7JA 3PXEA 1OXSC 4L27A 2CZGA 4DKJA 1AX9A 5FH9A 2VHJA 3QVSA 3T7CA 4BNLA 5JBQA 2FNAA 4AKIA 4TSFD 1J9GA 3VC1A 2JDIA 5I9MA 3HVIA 4FNOA 2JATA 4WN9A 3UUEA 3BH7A 4ALIA 5FWYB 1JYFA 2VH5R 2Y2UA 1TOAA 1MC5A 1E0SA 4WKOA 4LTMA 5AJZA 4PYRA 4KMMA 3C6ZA 4EG7A 4MYCA 1W25A 4WCDA 1HRKA 2V7VA 3L41A 3R3WA 5HJ2A 3EIWA 3G2NA 3KE9A 1WUJS 3R3JA 3OTIA 3BHJA 4TS1A 5CK4A 4DLPA 2ZR8A 4TUYA 3T54A 5K8VA 3BB1A 1R50A 4MPPA 1D03A 3O1HB 3E6AA 1JG1A 2D4HA 5IKXA 3KZCA 3LPMA 1FSGA 5HUQA 4LF5B 2YJTD 4JAVC 1T3HA 1Z39A 3ES9A 1RJDA 1HKUA 4HDNB 1KOJA 3E61A 4Z0NA 3N39C 1KK0A 1ZMXA 1JG3A 2G9ZA 2J08A 1JAZA 2QROA 4WNYA 3GEMA 2B2XA 5EVJA 2EZUA 1IN4A 2XYHA 1NZJA 4Q9LA 1DQYA 1VA5A 4NOKA 1W46A 2OGZA 2XCTB 2ID4A 4QOFA 5F77A 3M5CA 4L7QA 4KIGA 3OKFA 1YMVA 1T34A 3RUCA 1Z3IX 5BV2P 3HLTA 4R9RA 3KOUA 2I7CA 2P9QA 2IW3A 4KQFA 2DFLA 2EIHA 2KQUA 1RWKA 1XEFA 3TVDA 1ECGA 3H5NA 2Y1CA 3FPJA 2J9RA 4A0RA 4QGFA 4KQIA 3HRHA 4JXZA 4CT0A 2IXFA 4Z4IA 4FFBA 5HXAA 4Z1MD 1AHPA 2RB4A 3A70A 3UGJA 4CMCA 1VFNA 1E79A 3H5VA 3WSVA 3VV2A 1Y5MA 3C5CA 3KSAC 4R0NA 3NWBA 3NAQA 4EKNB 2AUMA 2ZUVA 1DJOA 4DV7B 4B09A 4CU5A 1BHJA 4DDKA 4KLNA 1NOIA 1XQ9A 4Q19A 1GPBA 2C9BA 4FOPA 1IXKA 1L4KA 2PDAA 3VHXB 4B6OA 2FQ1A 2AUNA 4TV8F 4H7JA 4E1AA 2GM4A 4JJ4A 1BMDA 1NVGA 4I46A 4UVHA 5HK8A 3U61B 3ZV6A 3HLKA 8LDHA 1DAPA 2BCGY 3I83A 1X2BA 2XB8A 3MN1A 3UVEA 4UQPA 1QSGA 3TSYA 4KOEC 2JFWA 2VDNB 2WMDA 5JVDF 3C5EA 4LE2A 2QYOA 3G02A 1ITZA 1DQZA 4ZPJA 1F7UA 2KW5A 4DBZA 1ZUWA 2Z58A 2GBIA 4I19A 4OFWA 4RF5A 4FI3F 2WA1A 3VHQA 5K0CA 2HV8A 5LL6P 1NW4A 4IDDA 4EFKA 3KTDA 3P0HA 1GAJA 2B3TA 4GG1A 1ADFA 2HRCA 5JCJA 4AKEA 2HJGA 3JWEA 5A4FS 4KRFA 4BYGA 2QL6A 3RF7A 2BBOA 4FOSA 2V5VA 3E15A 2XE4A 3E5NA 1YV9A 2IP2A 3IIKA 4YQEA 1OXTA 4H1TA 1UBNA 3FNQA 4AUNA 4JXKA 4JCOA 2J3IA 1KMIY 3EEIA 2H51A 2PX4A 5B7PA 2EF0A 2M6LA 1H69A 1B2RA 3F71A 4AJJA 2ICAA 3CPHA 1ZD1A 3WDSA 1Z34A 5C5IA 1FFGA 2R7AA 1WW2A 4OAQA 4YLYA 3VU0A 1ACJA 1X80A 4Y2TA 1IY9A 3H2HA 4FGSA 3UW1A 2DFKB 2HDHA 4CUZA 2WLSA 2OXTA 1HORA 3ZHZA 2VTKA 5HQ3A 2VF5X 3TD6A 4N7BA 4F2WA 4JOBA 2OSBA 4OQLA 4EYKA 1PZMA 1OFUA 2FLWA 1PR3A 2GBLA 1X9HA 2Z5FA 2A78A 5MGBA 5E0KB 3N70A 4IOLA 3RUEA 5JCZA 3WK4A 5A0TA 1NYLA 1IZ8A 2QTTA 4NZZA 5AXAA 3OLCX 1KJ8A 1W2HA 5JS7A 5BWBA 4IG9A 4YCMA 1ZJ6A 3NRBA 3BMNA 4ZAWA 3LYHA 1VKHA 3WKAA 2XF2A 4CT4B 2W4MA 4MVCA 3ZWKA 1UBGA 4I50F 4NF2A 1QOZA 2G0NA 4B83A 3REQA 3RYHA 5K0NA 4I0WB 4ZI2A 4ZTBA 3VPFA 3NATA 4EB3A 3PJDA 2B92A 2WIJA 3U9LA 1GTRA 3BILA 1P7CA 1EVZA 1QBGA 1ETUA 5TR9A 4XTCS 4OHKA 4KQ2A 1EP2B 2N1MA 5IM4A 1Q7CA 5AOCA 1HL7A 1RZUA 2BFPA 4F6LA 3SIRA 4MX8A 4QEZA 3W8EA 3VTAA 2C42A 1FP7A 1KU0A 2R97A 2V6MA 2EF1A 4HYEA 4Y2JA 5KTSA 2B69A 5JYCA 1EHIA 3TR6A 1WBJB 4PN3A 2M9MA 4UBOA 1SA0B 1GHTA 2QJWA 4JSRA 1WBBA 3G6KA 4DM3A 1F5SA 1T2NA 2P3SA 2ZR0A 2OCBA 3K09A 4QYSA 1SUSA 1MDBA 3BXHA 3PS9A 4BX8A 3U4IA 4WZBE 3GBPA 2H63A 2R8XA 5CH3A 1IXZA 2X9QA 3IUBA 3I2HA 4QLAA 5FTMA 4CKXA 4DJEC 4ZANA 3H04A 2UXBB 4NYJR 3H99A 1KTIA 2OWEA 3CEPB 3MGBA 4NZ9A 1W0JA 2Z2ZA 2WHEA 3G8CA 2PZBA 4J16C 4J0DA 1F8UA 4O5OA 2QXTA 1D2RA 4F21A 3IUMA 3KL2A 4IIDA 2DT8A 1CNFA 1E9BA 1GQQA 4RJJA 5BWLA 1YS4A 3VC7A 4YRSA 2HA4A 4EDFA 1GTL1 4QZVA 1QGUB 1CEYA 1ODCA 3KBOA 4DILA 3AIOA 2LIVA 2ZSDA 4DFDA 1QYXA 1ILEA 3IDQA 1X7XA 4UATA 3BBPA 1PGPA 1T4CA 4QQKA 1T91A 2FQYA 2I80A 5J23A 4V1CA 4A03A 1FVOA 2PGLA 1H8HD 3RK4A 1KI6B 3LBFA 5JHHB 2HB6A 4BQIA 2LVBA 2CWWA 4X6LA 2A35A 3DONA 4OMUA 3N8DA 1I1NA 2NIPA 3EHDA 3T8YA 3UIEA 3ZXSA 1DAEA 4QULA 2C4MA 4OBWA 1ZBDA 5CA0A 1Q44A 1XHEA 1QVRA 3OX2A 1IWOA 3O1LA 3AI7A 3FR7A 4IKEA 3SQNA 2QVZX 3OQPA 3V4PB 1QHSA 4J6FA 4Y2VA 1QZTA 5DSZA 3GLIE 2ARKA 2XMBA 3WYFA 3GJ8A 3I30X 3RTCA 2ZATA 3NHZA 4JQOA 3BTVA 2Y92A 3V3KA 2XBLA 1JSLA 4FX5A 4LWOA 1JR3A 4RUKA 4EQ6A 3K9NA 3SHOA 1XYYA 2MIIA 5HTKA 1VSVA 2P0EA 4D0RA 4EBBA 1TC1A 2AFIE 2VBIA 2GBPA 3MCWA 1KJQA 3KQPA 4H1UA 4C08A 2YL2A 3K5PA 1O7JA 5DTJA 5AIBA 2CVZA 3OBIA 1PZHA 1LW6E 1DXYA 1U5AA 1VHQA 1D4OA 4UTOA 3WWOA 3K0SA 3NBUA 1I5OA 5EUCA 3DAPA 5AJTA 4JBXA 5HJEA 2R8OA 1VSUA 1HT1E 4MK4A 4MINA 4RH0A 5DYIA 1YJXA 5IBQA 1GDDA 1UF9A 2YOHA 3A6ZA 2E82A 1ZOLA 1TKCA 3FX2A 4L8LA 4NFSA 3UF0A 4D9IA 3U44A 3HHPA 1BOOA 1T8YA 2NMVA 2PSJA 3PJGA 3LHFA 4ERXA 1ZRMA 2JGMA 3AVPA 2QUZA 1EJ6A 2CMKA 3IFSA 1RLTA 4D9GA 1TJNA 2J7KA 4HB0A 3FHOA 4KRXA 4RLFA 5F2KA 3PNSA 1T2FA 4B44A 1AKWA 1U0HC 2WG0A 3HSSA 1XJ0A 3GPIA 1ZR4A 3QTBA 5FL3A 2I2CA 2VEDA 4P81A 3A3YA 3DC7A 1YCFA 1T4BA 2BRUC 1E8NA 2FHPA 3E1SA 3WGZA 3WK8A 3CCFA 3PNLA 3AEXA 1TFRA 3C8UA 5CHYA 4UBNA 5AJVB 3RK1A 2D5BA 1UM8A 5GZ1A 2VYCA 1PSDA 1E1YA 1U2PA 4H27A 4N01A 4N8EA 4X1IA 5AI8A 1Z63A 2GYVA 1O97D 2OCXA 1NUAA 2VNJA 3QRWA 2NV0A 1SZCA 3WLFA 4ETMA 1XL1A 2A0WA 1HFJA 4Q6WA 1NQOA 4DLZA 3ONNA 4GGPA 3LC1O 2EBHX 1N2CA 1NR7A 5EP1A 3SF8B 5KC8A 4C2TA 1XDUA 4Z2YA 2O3QA 1Z5WA 1J5XA 3WZ2A 3DTTA 4LFCB 1U0SY 2WT9A 1EX7A 2FUNB 3WFJA 4JYPA 3WLPA 4CU2A 7ABPA 2RH4A 2IXBA 3NEYA 3BFKA 3SKYA 3RV3A 4K03A 2JA1A 2Q3CA 5HKLA 5F2NA 5A4MS 2I3AA 1SURA 4GECA 3LIIA 3EF1A 4M1EA 2FZVA 4Q9AA 4MKXA 2AMVA 2XOEA 2L17A 5COBA 4MB0A 4P4LA 4C04A 3RREA 1Z29A 2R5NA 4ZDIA 2BFFA 1PT9A 1XMIA 1FOEB 1SVOA 5BYBA 2GN2A 2ZBQA 4IDNA 3KWMA 1NSFA 1PT8A 2W2MA 4K0RA 1DBIA 4YA6A 5JH7F 3QH4A 3EY9A 3Q0TA 4FFLA 3G1TA 3KAKA 2PUJA 3CY6A 3CLSD 1L4UA 3K4PA 3B20A 3L7BA 1BFDA 4EHJA 2WFAA 3TW8B 1TF5A 1ACMA 3HI4A 2BFDA 2Q3JA 3UWMA 1IONA 4F8JA 2B83A 1DKMA 1E6CA 2ECPA 1NYRA 1HZJA 1OV4A 3HN6A 1CQXA 2W9XA 5CX1A 5FLYA 3U60B 1QQ5A 3PQ2A 5J2UF 4RAQA 2WB2A 3QXJA 2IHNA 5DI3B 5G02A 5J47A 3GQBB 1GD1O 1XELA 4NYMR 1KQGA 5IJ0B 1FF9A 1LFDB 3E7DA 3EK2A 3SPXA 1SD5A 4PX5A 3DB2A 2YJ5A 3VPGA 1NVUQ 3DVAA 4Q82A 3TZKA 3THOA 2VPIA 3WMXA 3BKXA 3JX9A 4MKFA 4XWGA 2BFBA 1L5LA 3RTBA 5KJCA 1XQ6A 2VNAA 3PQ3A 2QTAA 3OCCA 3OQ1A 4MSUA 1LDBA 3LLVA 1WMDA 5KNBH 1FXWF 1DRVA 5GONB 4ENSA 1WHSA 2DMRA 4D4GA 1BS1A 4GX5A 4H4CA 5CDUA 3BIFA 3CVWA 3HCRA 4JLMA 4KN5A 4N0MA 1TVKB 3EGEA 2EJCA 4WA7A 1G66A 1U90A 3HDQA 5EWLA 4BGVA 4L5YA 4DE5A 3RVJA 1KIMA 2WWGA 1EM6A 4PHGA 4QYIA 3EVNA 3IDFA 4R2IA 1PSZA 2HXYA 3PVZA 2VPXA 4CWAA 2XOKD 4GBMA 3WK9A 4KNYA 3WI7A 1ONSA 3PIRA 3PGMA 4XUCA 4AS3A 4TKMA 4A10A 4CMEC 3EYWA 1OI4A 3EXFB 4ZCSA 2P91A 1SIBE 3GDGA 4QBHA 1ML4A 1P9RA 4C4YA 3QE0A 1ESZA 3MXTA 2QI9F 4DUYB 5BR1A 2Q6KA 2JBWA 2V5UA 1NVKA 2WU4A 5HCNA 3KYCB 2QQ0A 4RULA 4O2AB 5EL0A 4BKMA 4HWSA 1VIMA 4NPAA 2VZ9A 4HDSB 3OOJA 3OQVA 5KNBA 1ZD9A 4RENA 4DGSA 3ZWPA 3NM5A 3KSMA 3B2EA 3QVUA 4QTTB 1JQ3A 1CZNA 1LZKA 4N5LA 4O4LB 1YR2A 5AESA 4IEEA 5T4EA 4IMRA 1LC0A 2XODA 1UPTA 4JQCA 1WCXA 2I6UA 2R3SA 3RWBA 2AMLA 3S5UA 1XOIA 3HUUA 1GPH1 3QJYA 1ZW1A 3BOSA 3TIFA 3W4JA 2BZSA 1I36A 2PQ0A 3IBSA 3Q3EA 4V0LA 3TLXA 9ATCA 1EXVA 4W5OA 4XYLA 2X86A 2C3YA 2HL6A 4D0GA 4BYMA 2R6HA 4KXLA 1KH1A 3U7GA 3MHTA 2WUFA 3KOXA 3B51X 2J3QA 2JGLA 2WHQA 5TARA 1OIWA 2IYRA 3CF0A 1DO2A 1JDNA 1T1SA 1WDWB 3L6EA 2PUWA 3QVGB 2UAGA 1JLSA 4AJ9A 1UPAA 3MWDA 2YIDA 1KL7A 4X7MA 4IBOA 3V42A 5JBNA 1MW8X 1NHGA 1TW2A 5DYTA 3D9QX 5G3ZA 3UMYA 1Z2DA 3AILA 1HO3A 1G5HA 3DBHA 4R0VA 3LU1A 2VJDA 4PGGA 4UVGA 4DWWA 4JUIA 2PT6A 2KHZA 2E0IA 4BUCA 1XVIA 2EZ8A 2YWGA 1Z2EA 1ZD2P 3IRUA 2X6TA 4BAZA 2X2OA 1E64A 4H31A 3PDIA 3R75A 4WOPA 2ZVQX 3K5HA 2NX2A 1XZJA 4XIYA 4BDTA 3ICPA 1TI7A 1TYEB 4OHWA 1G8JA 2R6CA 3AKYA 4FBLA 3WKEA 3COPA 3DE7X 1FPMA 1XMVA 1IM8A 3C1OA 4IRUB 1OA1A 4MYHA 4PSAA 5KAMA 4N47A 3TQSA 4PCUA 1HZZC 2OZLB 3JQDA 4RM2A 4IQ4A 3C7DB 1UDBA 5IT9A 2JK0A 4LZNA 2JGKA 1TL7C 1RBZA 2N42A 4RKFA 2QG6A 1XD8A 1YS2X 4GOKA 1WHTB 4X0EA 5AVTA 1ZM3A 2COKA 3GLIA 3FOAA 4HEA6 2ZUEA 1L7EA 4XQEA 5EYPA 1KP3A 1P3Y1 5JLJA 2FPGA 2QZJA 2H65A 3FHCB 2XMSA 5IJZA 1SCAA 1YJ8A 1KZ6A 3BC1A 1N33B 3NIBA 1HURA 2QTMA 3HJUA 4UUQA 3ABIA 5C34B 1HE5A 3IIEA 3G0BA 3LLMA 2B21A 5A06A 3S7ZA 1SBIA 2FKAA 2J6IA 3KUCA 4RBNA 5GONF 1JE0A 1P72A 3LNCA 3WYAA 3A3OA 1QGDA 2E4ZA 1Z2PX 3GYGA 1QHIA 3QUBA 3SS8A 3GGJA 1R0XA 4URZR 3AVYA 4KQ1A 1FU8A 5BUZA 3RIMA 4LJ5A 1GUYA 3OIWA 3HL4A 3U4QB 5L3SA 4W9NA 2XQJA 2GMWA 1TJ5A 2XNCA 2ZTMA 3TLJA 2H8KA 1GP2A 2Y67A 2JLSA 3NW9A 2OUIA 3AL2A 3MCZA 2X5NA 3O2QB 4O1HA 4RFLA 3TB4A 5BNWA 5EXSA 3WWZA 4CQMD 3GEHA 2WJ4A 2J9FA 3I8SA 2GFHA 4GYKA 5KVCA 2E1PA 3DKIA 1P91A 5A2GA 3Q12A 4ZCTA 1XBTA 4G5XA 4HDMA 4KMSA 4LCJA 3TKYA 3E5MA 3RRMA 1U8AA 1NG9A 1T5SA 4WY2A 1A5AB 3M9WA 3AEKA 4W5TA 5JANA 3GFBA 4RSHA 1TZCA 1ZCJA 4O0LA 4IHJB 4YACA 5JSUA 2W2QA 4J49A 4O8CA 4IWNA 2OHGA 2YMQA 4U3JB 4GBGA 3SDBA 5JFGA 1KO5A 4ZWNA 2YFQA 4L9SA 2BKXA 3WHLA 1PGQA 5ALEA 1ZFNA 4HNUA 2P7HA 4PRZA 3GP5A 3NHAA 5CPBA 4EI2A 2WT8A 3E1GA 4WAUA 5D2CA 1YQGA 3NHMA 3ISJA 3TEJA 4AICA 4F3CA 3UWKA 2IYSA 5HVNA 2M6RA 4FOLA 4ARZA 1YB5A 3DZDA 2RGNA 2BEJA 4IOMA 2ZJ3A 4MS1B 4QASA 4QDZA 2F3TA 1WZEA 5EKTA 2ZM6B 3QEBZ 1Y1LA 3VPSA 1I9CA 2BUAA 3O8OB 4Z3KA 1L5WA 2BE7A 2O6HA 4BMOB 3A7DA 3BXZA 3NTLA 1H9CA 4KE8A 2VZ0A 2QW8A 4EUNA 1QQTA 3VH2A 1C9MA 2ZKLA 2J6HA 5EIXA 1Q0TA 2ZSEA 2ZT6A 1DKRA 1T2EA 1VP9A 1T6ZA 1DPFA 2G40A 2V7XA 3L7AA 4LDNA 4LYDA 5JO0A 5E95A 3FCUB 3RTEA 2P77A 3AFOA 1LSOA 1GADO 4C0LA 1JA0A 5JU6A 1L8LA 3TTXA 1TK3A 3IIJA 1VMIA 4Q4AB 4C5AA 1G6OA 1ZNZA 2YYSA 1LRJA 3H83A 3UXEA 4BFWA 1DJMA 4LGVA 1MX5A 1WY7A 2LV8A 2P40A 4FQ5A 3DZIA 4ZOCA 5BOVA 4F4JA 5C4MA 5C8YB 1X8LA 4HYQA 1U5BB 3RYIB 4TM8A 4KG7A 3CC8A 3ZY2A 2X9VA 3O3MB 4NBNA 1W76A 5TQVA 1ZA1A 4L5JA 1Y1PA 4M76B 1E6WA 4R1UA 4IZ6A 1HFKA 3BN3A 3H86A 5BWOA 3IEMA 4MW4A 8ABPA 4AECA 4L5IA 2CD9A 1ZHFA 1I3CA 4AJ1A 4OQQA 1G8PA 4F06A 5LR6A 4ISCA 4LQ4A 4RE6A 1OLUA 4FGWA 4ZVPA 4A36A 4Q9JA 3T38A 3IMCA 1U8FO 1M6VA 1ODKA 2LDBA 2VRBA 3DAOA 3HXLA 4ND2A 4KO2S 1XWFA 5TQJA 2PU7A 1HUQA 1OKKD 1EVJA 1YR7A 3Q6MA 1RCUA 4PIVA 5CP8A 2WAXA 4EUFA 4YRPA 2J33A 5LVAA 3NBXX 3AZPA 4LDQA 2IH4A 1V3VA 2GN9A 3MPOA 3RIXA 3W5BA 1BHSA 1H42A 1TYAE 2BMJA 3TIGA 4YUYA 1TO2E 2HSZA 2C8VA 3DBLB 4OP3A 3TNDA 5CBKA 3RC3A 1MV8A 2OHXA 2FGKA 5CJ2A 4Z7OB 5LFAA 3JYPA 3L6OO 4WVLA 3F6SA 1M1XB 3QWBA 4R1SA 5ICCA 2FFRA 4TKLA 4RY9A 5ALJA 5MN4A 3HXPA 4X3OA 1J8DA 1NFFA 3GO4A 2BHNA 3HDYA 2ZU0C 4MUAA 2QD4A 2WEKA 2YBEA 5CLLA 3Q9NA 2NU9A 3GLUA 3H1PA 3N1UA 1U9ZA 3PRKE 3RIEA 5LYJF 3F8SA 2XA9A 5A5DA 1ZMRA 1A82A 3WRWA 1PGNA 5ADVA 3BE8A 4Q9IA 3DMNA 3ASVA 4JLNA 2HK8A 1G6Q1 4N0QA 2ZWPA 4RTKA 4HR7A 4GMDA 2VHZA 3WV5A 1QRTA 1Y5NA 3O0DA 3H3XA 3B12A 4BKQA 1EFRA 3O6VA 2IYLD 4XGNA 5C46F 3R6WA 1OFIA 3E1KA 1VPTA 2J5BA 3PDHA 4NMMA 1FTWA 5DHFA 4AJOA 4AZSA 1AGYA 1RMTA 3PXCX 4X1YA 3DMTA 5JJCA 2CDAA 4NAVA 3UG6A 4PZDA 2Y6VA 1QHHA 3AR3A 2XB6A 3CUWA 3D2AA 4YR7A 1E7RA 4G2TA 5C8XA 1NATA 3C8ZA 5ICEA 1SQ0A 1C3OB 2CSXA 1Z4QA 2WG1A 4D25A 2IZ0A 3PL5A 1NXQA 1I2AA 1T36B 2HF9A 1EFAA 3VFDA 2ZDGA 3T1HB 1XTBA 3KD3A 1GG8A 2XXAA 4MI1A 1KI8A 1QH0A 2ODQA 3ORFA 3T52A 1OZHA 1T8UA 5CITA 3LT2A 2PZJA 2QN2A 5IAAA 1J22A 3MWEB 4WJKB 2P67A 5M29A 4B79A 1A0OA 4FYPA 3IE2A 2CFOA 3H4MA 4KWEA 4CCYB 4YMVA 1R3UA 2G5GX 2H1VA 2WIFA 3GNSA 2Q4OA 3ZNPA 3I4CA 5F7XA 3FDZA 4QRDA 1FW8A 1G7TA 5ICSA 4BVGA 3WKBA 1B4DA 2F8LA 1KDRA 1HG1A 1KR5A 2NTNA 3VH1A 1SUCA 2V7GA 4QPCA 4D4MA 5I01A 5EJ7A 5C3UA