4ZRDA

Crystal structure of smg1 f278n mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
278
structure length
278
Chain Sequence
RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNNDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of product-bound SMG1 lipase: active site gating implications.
pubmed doi rcsb
source organism Malassezia globosa (strain atcc mya-4612 / cbs 7966)
molecule tags Hydrolase
molecule keywords LIP1, secretory lipase (Family 3)
total genus 95
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zrdA00
2CJPA 1X70A 1QIDA 2PSJA 1LPMA 2PSEA 3WKEA 3ICVA 5AOCA 1U65A 5HQ3B 2QXTA 3BF7A 5ISMA 5IVKA 2QRUA 2ZJFA 1R1DA 3W05A 1WB4A 1YCDA 4X6YA 3EQ8A 1O6GA 1WPXA 3WK4A 2D5LA 5D7BA 1GKLA 3GELA 2O2HA 1IUOA 4KE7A 4AO8A 2BFNA 1DWQA 2QXUA 5JALA 4IHAA 2WTMA 2PBLA 3WIBA 1XKLA 2JEZA 4Y2UA 3D2AA 4AMYA 4ZGBA 5LZ9A 3H18A 2D0DA 1AX9A 4BAUA 1XZKA 1TIBA 3GFFA 2VJAA 1UK8A 1KU6A 3G0CA 1UK9A 4OYYA 3PUIA 5EFZA 3V1NA 3AFIA 2EDAA 2XUDA 1W4LA 1AURA 4U2CA 4XVCA 4C4YA 4UUQA 2WUFA 3VJLA 3GBSA 4RE6A 5ALUA 2EEPA 2V98A 4A23A 1LNSA 1CUXA 4E11A 5IH7A 3FCXA 4DMCA 3DYIA 4J3JA 1USWA 5ALIA 1VXRA 3STXA 1Q0ZA 2WIGA 2WLSA 5T4HA 2JGLA 2XUJA 3R3VA 5AI9A 2HHAA 1SOMA 3E1GA 5DYTA 4UBOA 4F5ZA 3R0VA 5AHXA 3S2ZA 5HZGA 5AK6A 4LXGA 4QZVA 3D0KA 4HTAA 4Q34A 1QJ4A 2HA7A 4HXEB 1EH5A 2Y6UA 5DYWA 4BC1A 4YX9A 3C6XA 2CZQA 4W1QA 1CUAA 1XRNA 2VA9A 3R3YA 1CUBA 4MWSA 5AOBA 3PF8A 2XQIA 4CCYA 1WM1A 3WWOA 2IX9A 3ICWA 4HZGA 2VAVA 3V1LA 2WIJA 1KEZA 2O7RA 4I3FA 1JMYA 5ALTA 5AM3A 1AZWA 2RAUA 4NVRA 3FYUB 3QPDA 4G9GA 1MO2A 3IUQA 4RGYA 2PVSA 2ZSHA 5A6VA 1Y7IA 4AB1A 1UOQA 1VZ3A 5CMLA 3I6ZA 1TCBA 1Y7HA 1VLQA 1Q0RA 1MJ5A 4G8CA 2Y1KA 3QPCA 2DHEA 1SFRA 4BVJA 3CXUA 1SCKA 1AUOA 1XLWA 1HBJA 3ZI7A 2J3DA 3D2BA 5CW2A 1CUEA 4WJLA 4ITVA 1P0MA 3PICA 2QJRA 2DCMA 1EVQA 1WB5A 5AI0A 4Y2SA 3FYUA 2C5GA 3AZOA 1N1MA 4EY5A 3BDIA 5FLKA 1VA4A 4Y2PA 1WOMA 3OG9A 3WK7A 1CPYA 1X2EA 3IVMA 3NWOA 1ZICA 2XUFA 4XWGA 1HKHA 2QZPA 3T52A 1O6FA 3VVMA 1EDBA 4QDZA 4Q1VA 2WUGA 1J1IA 4LXIA 1GPNA 2YYSA 3HLKA 4O08A 4BE4A 2OGSA 5LYYA 4B0PA 4UHFA 2XMSA 4WFJA 5HF8A 2OG1A 4IQ4A 5K3EA 3TGLA 2WHPB 3EF3A 1QFMA 2QTBA 3C5VA 2CBGA 1Q83A 3WA6A 1CUVA 2BJHA 1EHYA 2HL6A 4A16A 5CH3A 1UKBA 4BCDA 2GBCA 2V96A 5J3JA 4FMPA 4UFPA 3CN7A 5DNWA 1J07A 3R41A 4GBGA 4KACA 4EY4A 4GI1A 2AJDA 4HVTA 1YS1X 4AO7A 5EHNA 4X00A 3AIOA 4AZ3A 1TCCA 3HC7A 4FTWA 3BE8A 4EY8A 3WYDA 5AIAA 4YASA 2WSLA 3U0VA 3WK9A 4WY5A 3ZV7A 1MX5A 3R40A 3VISA 3V48A 1GPKA 1QONA 4J0DA 4BZWA 3BDVA 2GBFA 4G8DA 4KAAA 2OGTA 2QT9A 1W6RA 2G63A 3AZQA 5DLPA 4JUIA 3OM8A 3O9MA 1CVLA 2C4HA 4IO0A 2ES4A 2Y2UA 4WFKA 4UBKA 1CQWA 1GKKA 1N5MA 1YAHA 4UPDA 1W75A 3W06A 3R3ZA 1CIJA 5AK4A 4BB0A 2ZSIA 2ZJ7A 5FOQA 1ZJ4A 5ALFA 3E0XA 3DYVA 3VKFA 4OUKX 3QYJA 4X7BA 4FWBA 5E4TA 2RONA 3X3HA 5HQ3A 1G66A 4JYMA 5K3AA 2HADA 2V9ZA 1FJ2A 4FKBA 1JT2A 1QE3A 3F67A 2XQJA 2XMCA 1G4HA 3WA7A 4UBIA 3G9UA 4QLAA 1QIGA 1LZKA 5HK8A 4RE5A 2DSNA 2VAXA 1ZI9A 1TKRA 4LXHA 2B61A 1OCEA 4JNCA 3ESCA 1N5RA 1EX9A 3QITA 2BUAA 4I4CA 5HKBA 1JJFA 3LS2A 4Y2XA 4PF1A 4F0JA 3GROA 3G9ZA 5HFNA 2XE4A 2HU7A 1XLVA 4DMKA 2BUCA 5CURA 1CUGA 2WM2A 1BCRA 5K3BA 1JJBA 4CCWA 4KE9A 3SK0A 1PFQA 1THGA 1XZLA 2OPHA 1VOTA 3G8YA 1DX6A 2HA5A 4JYPA 1XQYA 4C87A 4OB6A 1ETHA 4GXNA 1LPNA 2QUBA 1UFOA 3H2IA 4HXFB 4C88A 2O7VA 5BOVA 4EBBA 3QPAA 4GHWA 1VE6A 4U2BA 5SYNA 1DT5A 1R4ZA 3TEJA 3I2HA 3K6KA 1CUCA 1XZAA 1N8SA 3KSRA 2HA4A 1BE0A 1F0NA 1H2YA 1PJAA 3BF8A 4Y2QA 5HF6A 5AM4A 2XUOA 1L7RA 2WG1A 5CH5A 3BWXA 2Z3WA 4ZWNA 2XMRA 3QMVA 3FLBA 4FLEA 4ZREA 4B7ZA 1XRPA 2AJ8A 3M3DA 3HABA 5CT9A 5C81A 1LPPA 1T2NA 2JGMA 4EHBA 1H2ZA 4AQDA 3LIIA 1XRRA 2OCLA 1MX1A 3ESAA 3GUUA 3I2GA 2PSDA 2BGRA 4GECA 1LBSA 2I03A 2IITA 3WKAA 5CT8A 2XQKA 1YSCA 3T4UA 2XUQA 3WYNA 4B6GA 4LIPD 4DIUA 3C6BA 3DS8A 1QIFA 4J0IA 4P08A 5EIHA 1QIEA 1K4YA 4F60A 3GA7A 2RGUA 3IB3A 4Y9SA 2DQYA 5E2IA 1HLGA 1JU3A 5LZ5A 1ZOIA 3IUJA 1TRHA 3ZLUA 1TQHA 1E8DA 2ONCA 3H2JA 1AGYA 1K5PA 3QVMA 4GW3A 3BXPA 4DNFA 4OU4A 4V2IA 4Y2JA 3WWDA 4ETWA 1J2EA 2HA6A 5FUMA 4LHEA 1E5TA 1VA5A 3OURA 5JYCA 3LP5A 3WKCA 4H7JA 1A8SA 4M0FA 3MGAA 2WHQA 3DCNA 3N0TA 2H9YA 3PDCA 4UBMA 4QWWA 5KWIA 1GQRA 3H19A 4G4GA 3IULA 3ANTA 1CUIA 2B20A 5AM5A 2XB6A 4ROTA 3WL6A 3EQ7A 5JD4A 3DQZA 2X76A 3WLAA 4WDQA 3M81A 2GBIA 2O2IA 3QM1A 2VTVA 1B41A 1ZJ5A 3BJMA 3OC0A 1UWCA 5ALJA 5HF5A 5CH8A 1HQDA 4KRXA 1CUDA 2R11A 5ALGA 3OTQA 2ZJ6A 3PUHA 4Y2TA 2QKYA 4FBLA 3F98A 4PQEA 3IA2A 4DM7A 3FLEA 2QVBA 3RK4A 2J3QA 2Q0XA 3D3NA 4TVKA 5JZ9A 2VSQA 2ACKA 3IBTA 2XUIA 4AX4A 2VJBA 3RLIA 2HRQA 2WQZA 2GYVA 3KWJA 2ACEA 3A2NA 5E4YA 2XMBA 2QMQA 4W63A 3NGMA 4XJVA 4H7IA 5EGNA 4BC0A 1MAAA 4KE6A 1JMKC 2JGFA 6YASA 1CFJA 2ZYHA 1CV2A 1LLFA 3DDUA 3ED1A 2PU7A 1ORWA 4H35A 4ZRDA 2RIPA 1G42A 2FJ0A 1IZ8A 2CEKA 3FVRA 5KREA 3F97A 3HSSA 3H0CA 5A7FA 4JH0A 4PSCA 2Z5GA 2W22A 4Q05A 2XMGA 3C5WP 4IH4A 2J4CA 2XDWA 4KJXA 5AKXA 2OAEA 5IVIA 1XRLA 1DU4A 4FLMA 4L3WA 1XLUA 3G7NA 2PUJA 1H23A 3FSGA 5AK5A 4F21A 2YASA 4C6HA 3WIOA 5HK9A 1T4MA 2WG0A 1YA8A 3BJRA 4Q3KA 4W1RA 3C43A 4DMHA 3R3XA 5HF9A 1R9MA 2OCIA 2OLEA 1EK2A 1ODCA 1QOZA 3F96A 1XZHA 3FLAA 4BTVA 2O2GA 2WU3A 2BCEA 4BZZA 3R3WA 5JAOA 3G0DA 2XQFA 4CI9A 2FUKA 1FFCA 3STVA 4G5XA 1YB6A 5H3HA 2WUEA 4J0HA 1IVYA 4BCBA 3FNBA 1P0QA 1LPBB 1R88A 1VXOA 5JZSA 2AJLI 4G8BA 3TRDA 4C01A 1F6WA 5DTIA 2HIHA 4KE8A 2PPLA 2VATA 4J0CA 3WJ1A 1XRQA 2DHDA 5LZ8A 1BRTA 1S8OA 3WI7A 5JADA 5KBYA 3STYA 4E46A 2HM7A 5ALMA 2XUPA 4NS4A 4W9RA 1QGED 2H7YA 4BAZA 5ALKA 3D5EA 4G9EA 1MN6A 2XLBA 4WFIA 4OU5A 5ALLA 1GPLA 4U2EA 3H2HA 2C7BA 3K2IA 2I78A 4BTLA 2H7XA 2CKMA 2WHRA 4QNNA 3C6ZA 5LKAA 3V1MA 3AIMA 2WIKA 3FYUC 5AI6A 4MQLA 4EY6A 1AMNA 4WDRA 5K5EA 4DMFA 3BIWA 1BU8A 1EINA 3G0GA 3WJ2A 5AI8A 5K3CA 3AUKA 1ODTC 2QM0A 3KD2A 4B80A 1ODSA 1U4NA 2QUAA 5IVHA 1M33A 2CUTA 4U2DA 2G5PA 3C8HA 3C6YA 3DOHA 3ESBA 3D59A 2H1IA 1JI3A 4BDSA 3FSGD 1B6GA 3WQHA 1R3DA 2B4KA 1OXMA 1XZIA 3WZMA 4BCCA 2RI6A 3WL7A 4BAGA 4K5QA 1MNAA 2WKWA 4U2GA 4AZ0A 4X95A 1VKHA 3H1BA 1JFRA 1UK7A 3L1HA 1EDEA 5AIBA 1EVEA 3GZJA 3TJMA 3G9XA 4XIIA 2JGJA 1H22A 2HU5A 2VJCA 3FBWA 3FYTA 4OYLA 3HRHA 2WUDA 3VJMA 4X92A 2GZRA 3DL4A 5FDFA 1CEXA 1Z68A 3O0DA 2QOEA 1QIHA 3D4LA 3LLCA 1G5FA 3FWHA 4KAFA 1W1IA 1WHTA 3R3UA 1NU6A 3SC2A 2UZ0A 1L7AA 4MYDA 5JARA 1MPXA 4AXBA 4OSEA 1HL7A 4Q82A 1X2BA 5I8PA 4PSUA 5AP9A 4M0MA 2I3ZA 1GXSA 1TAHA 4IH1A 1UOPA 3L1JA 3W2TA 1E8NA 4N8DA 4H7DA 3A2MA 5D3ZA 4AN0A 1VZ2A 1YR2A 1A7UA 1EI9A 4Y2VA 2XQGA 1ISPA 2ZYIA 1F0PA 5EHQA 2WHPA 2WFZA 2VEOA 5FKJA 2VQ6A 4QDXA 2QJWA 3E3AA 3KDAA 3AZPA 5DWDA 4BDTA 5LKRA 2JEYA 5A62A 4K6GA 1CUFA 2WTNA 5LZ7A 3C87A 3B12A 4M0EA 1XKTA 1I6WA 2WG2A 4CG1A 2HDWA 4MEAA 2JGIA 4G4IA 1XZFA 4NMWA 5BWBA 1MNQA 4DYHA 5AKZA 4J7AA 1DWPA 5AM2A 5AI4A 3O95A 1JJIA 2WJ3A 5CT6A 1A88A 4BE9A 4MQMA 1FSSA 1VJ5A 5CRIA 2WFLB 4L72A 3I6MA 1A8UA 4X6XA 4Q3OA 4DGQA 4H0CA 1UT6A 2EDCA 3HYSA 3U1TA 4TGLA 7YASA 3W04A 1ORVA 2PSHA 3F8SA 1DINA 4MWTA 4BRSA 1H2WA 4B85A 5C8VA 1RWQA 2DHCA 4N8EA 2XUHA 2VF2A 3QMMA 4X3CA 1ZD4A 3I2KA 4X94A 4UFOA 5BV7A 1EDDA 2ZYRA 4UBNA 3A6ZA 1XFDA 3PE6A 5C7YA 5AKHA 5ALEA 2WIDA 2JGKA 3AJAA 3STTA 1LZLA 4ZXFA 4RNCA 3ZWQA 1XZBA 1BN6A 4OPMA 1QTRA 1UK6A 2QR5A 2X5XA 2ZVDA 1H2XA 3MUOA 1HPLA 5FP0A 3D2CA 3M82A 2XMQA 4D9JA 4EY7A 3D7RA 3OPMA 5T4BA 5DTJA 5IVDA 4ZV7A 4DNPA 1P0IA 4S0XA 3H04A 4CIAA 1EXWA 3B3QA 4A5SA 1HDEA 1XRMA 5LIPA 3BL8A 1EB8A 4OB8A 5JAHA 2AJBA 1DWOA 3C70A 2JIDA 4BBZA 5F4ZA 2WFLA 4HAIA 4FNMA 2K2QB 3KXPA 5AI5A 5JATA 1LBTA 2C0QA 5ALNA 4QEKA 4BRZA 4UHDA 1XQVA 5AKYA 3G0IA 2RHTA 3E4DA 1D07A 1AKNA 1BN7A 1CUYA 4H7EA 2ROQA 4PW0A 5AKEA 4INZA 3WK5A 3STWA 5ALZA 1CUUA 3V9AA 5EIEA 2DR0A 3FOBA 4NZZA 5AKIA 4AN1A 4B9EA 4BVKA 4W1SA 4JEIA 5FRDA 2AJCA 1MX9A 5ALVA 4Z49A 3L1IA 5AOAA 3EIOA 3Q0TA 2B9VA 4Y2YA 5D3KA 1JU4A 2NW6A 5AKKA 4EA6A 4B83A 3HACA 1K8QA 1DQYA 3MUNA 1QO9A 3I2IA 2AXEA 3DKKA 4X93A 5IKXA 1CRLA 2FJPA 5ALDA 1UOOA 4ARAA 2JF0A 3NOXA 3K9BA 5ALQA 4CFSA 2HFKA 5K3DA 3ANSA 5JZBA 3WZLA 4GWLA 4W1PA 4OD0A 3A70A 4G1FA 4MEBA 3G9TA 2HA0A 4KRYA 3STUA 3H2GA 5A2GA 5K3FA 2W6CX 3VVLA 2Z3ZA 4X6UA 5AK3A 3CCBA 5ALPA 1XZJA 4Y7DA 1IZ7A 3N2ZB 1LPAB 3O4JA 4N5IX 3QBJA 3C45A 2XT0A 5JASA 4DNOA 1PV1A 1U8EA 4B81A 4XX1A 2OQVA 1EA5A 1QO7A 4LYDA 4K6HA 4PNZA 3QZUA 1EK1A 4LYEA 2DFPA 2OQIA 5ALRA 1YB7A 3EBLA 5AO9A 2HU8A 5ALXA 4N8SA 2WJ4A 4GDMA 1IMJA 4B84A 4QDOA 4ARBA 5CT4A 1CLEA 4UHCA 2WFMA 4HS9A 1J06A 1P0PA 3JWEA 5ALHA 1ACJA 4MYSA 3FAKA 1SCIA 2CMFA 2PX6A 3CN9A 3DKRA 1LPOA 2BAGA 1SC9A 3JW8A 1QTIA 4QE3A 4QDTA 4B9AA 1Q84A 1NX9A 5CXXA 3VDXA 3VJKA 2CB9A 3YASA 1F8UA 3DJYA 3W9UA 4K2AA 5ALWA 3SX4A 1QIIA 3ZPXA 2GYUA 2Y2VA 2OCKA 4KYVA 3DLTA 1CUJA 1YA4A 1RYYA 5CBKA 4H7KA 4QLOA 2ORYA 1BCSA 3I2JA 5ALYA 3LCRA 5JAPA 1SCQA 3PF9A 1DQZA 4GLBA 1WPRA 4X91A 4L9AA 1WHSA 1CR6A 2OGZA 3F9CA 1QLWA 4EZIA 3AIKA 1E66A 1XQWA 4CCYB 4X97A 5AKGA 2XUAA 3H2KA 1XZDA 4DLNA 2IIVA 2FX5A 4P93A 3BIXA 3I6YA 4E15A 1MAHA 2GZSA 1UKAA 2DQZA 1YAJA 4UHHA 5EHZA 1QIMA 3O9VA 2GBGA 3B5EA 1FFBA 4HXGA 3DEAA 3DOIA 2Y6VA 1EB9A 3DD5A 5LZ4A 4N5HX 3UUEA 1ZIYA 4UHEA 1JKMA 1GT6A 4FLFA 1Y37A 3I1IA 3O4IA 3HI4A 5ESRA 4B82A 5LLSA 2Z8ZA 4HRXA 3SWWA 4H7FA 2JGEA 1E8MA 1OILA 4GEGA 3IIIA 1XZEA 4L0CA 2HRRA 4KAJA 1CUSA 1MTZA 3JYHA 4PSDA 3LIPA 4FOLA 3HEAA 3WWPA 3HJUA 2OXEA 3RM3A 2PKYX 1ZGBA 4FHZA 5KWJA 2PL5A 1C7IA 5T4EA 5AH0A 3M83A 4YK7A 1KU0A 2OCGA 1C7JA 5EIAA 3I2FA 2ECFA 3O4HA 3IDAA 4P9NA 1GQSA 3DL7A 4Y2RA 5C8ZA 4DTCA 2C0PA 2C58A 2WJ6A 4DNQA 1W52X 2XMDA 4J0GA 1QFSA 5AM0A 4LKOA 2R8BA 3OOSA 3AINA 4P92A 4B0OA 5AM1A 1E3QA 1ZI6A 4UFNA 4AMZA 5ALSA 4FFVA 1GGVA 4FBMA 1ACLA 5FPPA 1AC5A 4H18A 5A71A 1LPSA 3KOOA 1TCAA 3V1KA 2BGNA 4OCZA 1NU8A 1MT3A 3ZLVA 3WKDA 1UXOA 4BP9A 5K3FB 3AILA 2HFJA 1DTEA 1WB6A 2BUBA 3ILSA 4BP8A 5CTAA 3QH4A 4C4ZA 2OAGA 3WL8A 5CT5A 1BS9A 3S8YA 3RKSA 2VT6A 4H77A 2HA3A 2YXPX 1WCYA 1R50A 4RPCA 1XZMA 2C5FA 5FXMA 4KR0A 4J03A 4U2FA 4CG3A 1TK3A 5HCUA 4K6KA 4TPKA 1K63A 1XQXA 2V97A 3UUFA 5JANA 4I19A 1ZGCA 1BEEA 4Q3LA 4CIBA 3DNMA 2PUHA 4FNGA 1ZI8A 5AKLA 3PFBA 1CUWA 2GYWA 2E3JA 3I1YA 4X85A 3CCCA 1UZAA 3I28A 5HFAA 5FV4A 3RARA 2WILA 3G0BA 1XZCA 4J0JA 1A8QA 3WL5A 3IUNA 3IURA 3A2LA 1FFAA 4OB7A 1K6EA 2G5TA 2QS9A 1QZ3A 5AJHA 1CUZA 4KEAA 5D6OA 5I9IA 3ESDA 3C8DA 5JD6A 5A7HA 4DSZA 1CQZA 1YASA 5DYYA 2H7CA 5SYMA 4BATA 3G02A 3MVEA 2ZYSA 1BROA 1FFEA 1CUHA 4G4JA 5JD5A 4H7HA 4QWMA 3ZLTA 4J0KA 2WU4A 4E14A 5CXUA 2XUGA 5E4JA 3WK6A 1RP1A 1QIJA 2BKLA 5EHXA 2RHWA 4PV7A 3O4GA 2XLCA 1DT3A 1DX4A 1E89A 3KWFA 5DNUA 3H1AA 3IUMA 4C89A 2Z8XA 1ZIXA 4UHBA 1ZD5A 5T4FA 3EQ9A 4MXDA 5AKJA 2PSFA 3WKBA 4QDUA 4WY8A 1GZ7A 1MU0A 4ZI5A 2WIFA 4X90A 2HA2A 3FVTA 3WK8A 1UKCA 3PFCA 2XMZA 5I7UA 5EI5A 1ZD2P 3H17A 3W9BA 1FFDA 5DJ5A 4CG2A 1QIKA 4AO6A 5JAUA 4HRYA 3UMJA 2YH2A 4FDMA 3QMWA 3NUZA 1R9NA 1IUNA 4C4XA 4EB0A 2VT7A 4BVLA 3HXKA 2X8BA 1XROA 1BEZA 1THTA 3FCYA 2PM8A 4YPVA 4PO3X 3WWCA 5AICA 5BWCA 2PU5A 4EUSA 4UBJA 1AQLA 2XI4A 5A7GA 1W76A 2G4LA 5ALOA 1LGYA 1XZGA 1L7QA 3WMRA 2VJDA 1IUPA 5FPQA 5LZ2A 1U2EA 3VXKA 3WWEA 4BYMA 1VE7A 3P2MA 3Q8WA 4FFWA 4DSAA 2XUKA 5C8XA 5HKAA 2I3DA 4IH9A 1YS2X 5JIBA 4ZV9A 4QA9A 5YASA 3PI6A 1C4XA 1ZD3A 4UBLA 4X71A 2JBWA 4WCVA 2J4FA 2LIPA 5LP1A 3HZOA 5DNVA 2P8SA 4MJ3A
chains in the Genus database with same CATH superfamily
4E5PA 3FHCB 4R9NA 3I39X 3VTKA 4EG3A 2DZDA 4YN3A 2QTHA 3HKCB 1WUJS 1X70A 2NV6A 2IQ5A 2GM9A 3N0XA 4XR9A 1JWLA 4OQZA 1GXSB 3BXHA 3FPAA 1PVOA 3N07A 2NSYA 2PSJA 2W58A 3RASA 2VZ0A 3WKEA 2GKOA 1JYSA 4EELA 1VL2A 2QXTA 1GSOA 2VDLB 3EGVA 3MWEB 4HH1A 1N2OA 5IN4A 2Q1SA 3BF7A 3G2IA 2LVBA 5ISMA 3WY9A 4N0EA 3TQQA 4XLLA 5IVKA 2QRUA 2ZJFA 3ZCQA 4C04A 2GB4A 5GM2A 1W30A 1Z3CA 2Q5FA 4QU8A 5ARDA 4D6XA 4RKEA 5CIYA 4QM6A 4P35A 2VQSA 3FRJA 3NYQA 1UAAA 1EGVB 4U63A 1QPZA 1PZXA 3L79A 1OXUA 4D25A 3OCWA 3UC5A 4GOMD 3ZX4A 1ABBA 5B4VA 1NF9A 2QPTA 1I3CA 2CJFA 4A0FA 2DTDA 1PW7A 4EARA 3LX8A 5D7BA 5CLFA 3BMCA 1AKMA 3K1YA 1GKLA 3G8DA 2J9FB 5I4BA 2O2HA 2O5EA 2VWHA 1PQPA 5C34B 4YDSA 2ID7A 2BFNA 3U3MA 5KCZA 2PLFA 4EKYA 1KSFX 2QW0X 4CEHA 2VK4A 4JJEA 3WLNA 5JALA 2A88A 2B6HA 2AUTA 4JJ8A 3OBBA 5JDCA 3EIHA 3T35A 1OFTA 2D7JA 2PKEA 3H83A 4F9EA 2P90A 4YFVA 1KGSA 2F62A 1F7VA 2C1ZA 4TTPA 1G21A 2E85A 1I2AA 4NYIR 1DAEA 1JA0A 5T3UA 5HM6A 4LGYA 4DV2B 4B6RA 3WB1A 3N2GB 4EYSA 2HW8A 2OCAA 3JVEA 4ZGBA 1GZ4A 1S5PA 1WVIA 1D2CA 3AF5A 3H18A 1A95A 5IDYA 5SZHB 3TH5A 3X1YA 1IU9A 4D82A 5KOJB 2F64A 1XZKA 2A59A 4YPFA 2IYLD 4RCYA 1TIBA 3NATA 5CLQA 4UCXA 2YQ5A 4QFDA 2PKWA 4BBAA 4OYYA 3PUIA 4RH1A 3CA8A 5EFZA 2GN9A 1AS3A 1QHGA 2O06A 3B89A 4EITA 2EDAA 2XUDA 4WT7A 1K08A 4CKZA 2OP0A 1EVZA 3ZGZA 3O31A 5J2UB 1GPUA 2C2OA 5AWFC 1X1TA 1NATA 4EB6B 4Y18A 4HVCA 3GGDA 1VJGA 3OJEA 4RIEA 4BU1A 3KJFA 1A5BB 1C9MA 3R0IA 1IY0A 1G63A 3KLBA 3A25A 3GBSA 1N0UA 1T8RA 4RE6A 1JI0A 3TFQA 1PSZA 4O33A 4MO9A 1N77A 3U31A 4J29A 1Z6TA 1E1QA 3NH6A 2FPPB 4NCBA 2F8SA 2AFVA 2ZUDA 5KYUB 2NZ2A 3SD7A 4U3JB 2J67A 2O5VA 1Z0JA 3LTEA 1EFRD 4OI2A 3RYHB 6NULA 1B0PA 2PL1A 3M6AA 5IH7A 1KEVA 2DQSA 5LP6A 1E4EB 4KO3S 1YI8A 4DMCA 4ZN6A 1C0LA 2CHEA 3JRWA 4Z0HO 2P9EA 2V55B 4G09A 3IRUA 3NDPA 1KMHA 2V03A 2LZ0A 5FWAA 4YCSA 2ARKA 4K6MA 4OHVA 3PX2A 1Q0ZA 5LOVB 4ND8A 2CLHB 4BO6A 2WIGA 3SSOA 3VO1A 2PYDA 1YZGA 3S27A 2QE7D 2JGLA 4LRSB 2XUJA 3L84A 2PRSA 2BFAA 1M0SA 2EWMA 2NGRA 4GZMA 1E3MA 1S96A 2DKNA 2PMFA 4D9IA 3EWAA 4Z7NB 5JAMA 4J7CA 3UJ8A 4B3RB 5DYTA 4UNQA 3MUFA 5E8JA 4Q9JA 3L6OO 1J0EA 5J1SB 1QFZA 4UBOA 5TQJA 4GXQA 1SPXA 4F5ZA 2QX6A 1L4UA 2PDAA 3R0VA 4RH0A 5EXSA 1ISRA 4JLNA 5E0OA 5K0SA 3S2ZA 3AEYA 4WCDA 4S1VA 3W8FA 2YNMD 3UWSA 4DNXA 4QZVA 4NAUA 3F5DA 1VG8A 3CZ9A 3SDZA 4LI3X 3TAUA 4DE5A 3DE2X 1UZMA 2WM9B 3GCZA 1E2FA 4ZKDA 4K1LA 1FMJA 4BX3A 1EH5A 5C1IA 1E3EA 4YX9A 1QYIA 2AG1A 4V1CI 2BKAA 3A37A 4RL6A 3S70A 2HT6A 1YQXA 1T3HA 4NAHA 4N65A 4K1XA 1E4YA 1UBMS 1VPLA 2Y9MB 1BXKA 3LT2A 3LGAA 3S5UA 3ZV4A 1VDMA 4MTCA 1M0TA 5AOBA 3ZZUA 4ISCA 1XD8A 3DE3X 4K6OA 2B1RA 3TFOA 2XQIA 1L3CA 1LVUA 5DSXA 4F4DA 4I50A 1MC4A 1SWVA 3AHIA 2EJWA 1VCHA 2IX9A 1CR1A 2PHZA 1Q19A 1IWBB 1WHSB 1T25A 2D2XA 5ITZA 2W6IA 2FH5B 3CGWA 3OFNA 4F46A 5MN6A 4QOJA 5J47A 3Q15C 4PAWA 3JQ8B 3MWEA 4HZGA 3UBTA 2VAVA 1WCV1 2FG6C 1ZAKA 2KX7A 4M98A 5J4LA 4LHZA 5C53B 4JBWA 4BB9A 3ZY3A 1GZDA 3LT1A 4YMHA 4PYRA 4HUQA 1O1YA 4MW9A 3E7PA 5LYJA 1I5EA 2VYVA 1K97A 4DPLA 5AM3A 1IDN1 1LF0A 1UUFA 5C8DA 2P91A 2RAUA 2J09A 3C14C 2G36A 3FYUB 1PWXA 3L4JA 3IUPA 4R41A 4DQVA 2BR3A 2FSUA 5EZQA 1WIWA 4CMJA 2G1JA 5EKDA 4O5OA 1MO2A 3IUQA 4RGYA 5A6VA 3ORSA 4YHHB 2GZHA 2ISCA 1RHRA 1Y1KE 5AHKA 2PO7A 2V9PA 4F9GA 3OZSA 1OV4A 2PH7A 2ZIAA 5KYYB 4LX0A 4N3NA 3MZ0A 4HDKB 1U2QA 1Q50A 1GARA 2I7DA 3B2QA 4L4XA 1XX6A 1E99A 1VLQA 3SI7A 2VJYA 3KR9A 4G8CA 4MUHA 2HDHA 1QP7A 5CNKA 1I94B 4CJXA 4GVLA 1AKYA 1S3FA 4TLLB 3KCQA 3C39A 4BVJA 4MQEB 1SCKA 1AUOA 4NE7A 1DJNA 1BS1A 1GCUA 4ZP1A 1H05A 1HBJA 3KFXA 1SUWA 2X9QA 3RWBA 1IZYA 2IHTA 4WJLA 2H16A 4DIDA 4NK5A 1SO8A 4AFNA 2AI3A 2CD9A 3NEPX 3MFQA 1G4UR 1LQ2A 1ZIDA 3BCUA 3IO3A 2QJRA 4RKWA 4BNVA 1AHHA 3I58A 4AY3A 3AVPA 3GLRA 5EPUA 5E3HA 4HWSA 1YR3A 4OA5A 1U9YA 5GADl 1T4CA 2BTEA 4BUCA 2C5GA 4N5MA 1JQAA 3ZZMA 3AZOA 1G17A 4IGEA 4L1KA 1N1MA 4MR7A 2NM0A 2O3RA 3QA9A 5K4GA 1EUDA 1HNNA 4FR0A 4X20B 1CR2A 1T2AA 2W2PA 3IEXA 1WV0A 2QJFA 3PITA 2ZOSA 1VA4A 4LRYA 4IDCA 2FPXA 1TO6A 2YVLA 4F9TA 5ABPA 2X4LA 4Q9KA 4ZO9A 3MGGA 4POOA 5A4DA 1B2RA 2WU1A 1N6LA 1XJ5A 4EOGA 3PQ3A 5MF6A 2ZPUA 3HU3A 4B3HA 2CV0A 4ENRA 5CCBA 1I5OA 2ZRNA 4UTRA 5ILQA 1WUIS 2NVBA 4OK6A 1P1JA 3L0BA 3K96A 4ZDJA 3UMSA 4E09A 1I30A 2MSLA 2P30A 4PPQA 2P35A 4HXYA 4UEJA 3KHUA 2XCSB 1TU4A 1XMVA 2D5IA 3L7DA 1WV1A 2KW5A 4UQPA 2QZPA 1Z26A 2AZXA 2MCFA 3TUZC 1A77A 4TSRA 3GJ8A 1MGOA 1QVRA 4JK3A 3EW7A 4HQKA 3UK1A 5IZ4A 3RIGA 1SZPA 2Q2WA 1J1IA 4ZT2A 3TRJA 4IRUB 3OZIA 4AJKA 5LQKA 3Q9NA 3EAFA 4FZVA 3UT5A 1NBHA 1GPNA 1AB5A 4ZAFA 4A8JC 4MV7A 1F7UA 3HLKA 4O08A 1UMCA 2ZSJA 4IGKA 3DAFA 4INOA 1AXEA 3K72B 3NFYA 3GRKA 4QYIA 1ISIA 2ZLBA 1RM0A 4S1NA 1BCRB 4JCCA 1B73A 4FEEA 3ECCA 2H9IA 1MZVA 3Q7RA 3KYCB 5GONA 2H06A 3QBTA 5DE3A 2P68A 3KR1A 5CAEA 2I80A 3NKLA 4JI8B 3R6GA 4YQFA 2Q99A 1QYRA 2WHPB 4PLTA 1CTQA 2UV8A 3I76A 4MRAA 1TIPA 3H16A 4IIFA 1IE3A 1CZOA 2L17A 3C5VA 3ZR4B 4CI0B 1Z5GA 1DG1G 2OC9A 1MJGA 4OGKA 5D6NA 5A9SB 1DIOB 5DX0A 3WA6A 4AKGA 1XB2A 2BJHA 1I4OA 2ID4A 2SICE 2GGSA 5CIQA 1ZJ6A 1Z6AA 3G6WA 2I6QA 4G5HA 4PEVA 1DAFA 4KITB 3QY9A 1TT7A 2ZIFA 3CF2A 2R62A 5CH3A 2XYGA 2MR5A 5DHUA 1FTGA 1PKXA 1ZK2A 2GBCA 2VTBA 1X42A 4Z4HA 4C0KA 2O8NA 3M6MD 5SZJA 2X2EA 2FB9A 3O21A 5JCJD 3LHFA 4R6WA 4KN5A 3NP9A 3HKEB 3SU8A 1C4WA 1PGOA 2BI4A 3R41A 3Q87B 5NLLA 4AMBA 4KO8A 2BEVA 4P4SA 3WJAA 2W48A 4EQ6B 4J94A 1OXTA 3FDJA 1OROA 5EE0A 5IWAB 2WKSA 1SNYA 4HTFB 1CRZA 1X87A 5JHGB 4DUZB 2GCOA 1NBWB 3ELBA 3FWNA 5B30A 2P9ZA 1W0JD 5LR6A 3AIOA 3C4QA 4CHGA 4AZ3A 1TCCA 1DAKA 1XD2A 4MINA 3B78A 2ZIGA 1LI4A 3QWHA 3IMEA 2XTAA 5DP1A 1ULBA 5FWXB 1HDZA 1SXJE 1KKLA 5J9FA 1JKXA 1H65A 4B3IA 2FVYA 1FB5A 3DE1X 3ETLA 4J3FA 3RVJA 4WY5A 1P73A 4KX3A 4AG6A 1AGXA 3ETGA 2JLRA 1SBHA 3ZXIA 1JWAB 1YZTA 1MX5A 1WAMA 4XGIA 2MSEB 2P3LA 1SU7A 2AMFA 4JWTA 5CLIA 3V48A 3ROEA 4J6EA 5JMWA 4L07A 5DZSA 1QONA 2EFGA 1NQTA 5CA0F 5I4KA 2RH5A 3DPSA 2GTIA 1GPBA 3LDHA 2OGTA 3Q0IA 1K68A 1W6RA 2G63A 3SC2B 1U81A 2B92A 4RETA 1N5IA 1XU9A 1GFZA 1KFKB 4CODB 3V7YA 2CV2A 4EJ0A 3CRW1 5FO0A 2X8WA 1B3BA 1E3TA 4MV8A 3PYMA 1FVOA 3AERB 3QX7A 2HN9A 3O9MA 2C4HA 2JFUA 3RREA 4Q4CA 2H85A 4HQLA 4S2EA 3QIVA 4PYMA 4WFKA 1FLAA 2IHZA 3RAPR 4D81A 4UD2A 4CQMD 1YULA 5DBFA 1P3Y1 4UPDA 4MVWA 2XOEA 1ISJA 1FMTA 2WFAA 4JN6B 2I6GA 1L4LA 1XMJA 4JYAB 1I7QB 4M0KA 3KJEA 3UMCA 4DAEA 1UBUS 2QU7A 3QF7A 4ML3A 2GD6A 2BM0A 1ZLYA 1JA1A 4CF4A 2ZJ7A 1RQLA 3N59A 2RC6A 1U3UA 2GWHA 5ALFA 1DKOA 4OHXA 3DVQX 3DYVA 1P72A 5DT9A 1ZO8A 1II8B 3QYJA 4MLZA 1X9HA 3EA0A 2QSZA 3QG1A 4I8XA 4FWBA 2G8LA 3LFHA 5E4TA 3AF6A 1TM5E 3W77A 3V00A 3F9IA 3OFJA 5CVTA 4ZZ0A 1QO0A 1XDWA 2AG8A 2HADA 2A0KA 4OSOA 1VKJA 2DPHA 2RE8A 2BL4A 4PGGA 3RU7A 1L4KA 1NJ8A 2WJPA 2YVUA 3BJIC 1TLLA 2DBQA 2VSFA 1TQ4A 1YU6A 1SVWA 1F20A 2DWOA 1UT8A 1DC7A 2GLUA 1QV7A 2XMCA 4RY2A 4WSOA 4WXRA 1G4HA 5EEHA 5K2MA 5BNWA 2CJWA 1QR2A 3M5WA 3OUUA 4XW2A 2YZGA 4EGSA 4DDKA 4U7HA 1GTJ1 2ZE6A 3GFQA 1DBRA 1A8HA 2QI9C 4YCCA 2GFIA 1TKRA 2CGEA 4LXHA 4ICIA 3ILVA 1ZMTA 1SXPA 1EUDB 1XCJA 3L77A 1R15A 3DAGA 4NDAA 1DOAA 4PNEA 4PU0A 4CWAA 1KRHA 2FQQA 2IDMA 3UWDA 3DDZX 4PCLA 1T1SA 1GAJA 2VRNA 5C3MA 5HFNA 3T7SA 4MITA 3DHYA 4C7OB 1YRAA 4RIGA 4CKWB 2P2GA 5D3MA 2FSHA 1XLVA 2P0YA 3ANXA 4WAUA 2IS1A 4YMIA 4GZ5A 1Z06A 1E32A 2XT9A 1CZRA 1BCRA 2H5JA 3PQ5A 1LFDB 1JJBA 4QYTA 2GJ9A 2PS9A 3QEMB 1MB0A 2YKGA 2PWBA 3IKMB 3LUFA 1PK9A 3C24A 4BX0A 5CK5A 3WIDA 4I8IA 3I53A 4ZT5A 5ITWA 4WV3A 5KVSA 1Y5LA 5H1YA 4YNBA 3SR4A 1UJBA 4B32A 1VOTA 3DT6A 2EAUA 2XAAA 1DX6A 5B5SA 4HNRA 2NZVG 4K2HA 5CA0B 3ZTYA 1SEPA 1UMDB 1XQYA 2BEWB 5DK4A 3QKUA 1ETHA 4BP3A 3IAS6 2R85A 3AONB 5DBIA 4GXNA 3WRXC 2FKNA 4A36A 5LNK6 4JI2B 1M2OA 1EBFA 1LI7A 3UHAA 1NNLA 3Q9SA 4HDKA 1QKJA 3DFZA 3MYYA 4LY3A 1UFOA 1D2AA 2C4UA 3IE2A 1WZ2A 3UFXA 3CNEA 4FGLA 4HXFB 3E2PA 5F3WB 3VSDA 3IRVA 3RRYA 4MQ4A 3F6BX 4GX2A 2W2XA 5CVVA 2FMUA 2WY2D 3HA7A 1LEHA 4U2BA 8ATCA 4PVCA 3I64A 1UP7A 3OPXA 4C0BA 2BTQB 3TEJA 2GH1A 1XPOA 2QW8A 3DE0X 1N9KA 1YDFA 1ZMRA 3D7MA 1GAXA 3N75A 4QGGA 2UYCA 2JCXA 4X8MA 4GM1A 1LK0A 4HQRA 3ASYA 3R7FA 4ZQCB 1N1GA 3LUAA 2HA4A 4C22A 1DX9A 2BFDA 4N7BA 3OT4A 1H2YA 1MB9A 1YBAA 3RIMA 2YZKA 3BHMA 4A10A 5SY9A 1EFPB 1KYWA 5AUOB 2N1MA 5J40A 1LX6A 2WG1A 3H9QA 5IF3A 4ZWNA 2O2DA 4EHFA 3QMVA 4L76A 2B1JA 3CGGA 2R68A 1GDDA 4KZPA 1U94A 5C8YB 1Q0QA 1XN1A 1JG7A 5BY2A 1LRJA 3GEGA 3JRNA 4CLOA 1LPPA 1T2NA 5K8VA 4Q00A 3HUDA 2Q7OE 4XUDA 4EHBA 3P9YA 1LF5A 5KAPA 1P9RA 2HLPA 1EFTA 4W5WA 1S2MA 1GL7A 4LZNA 4OI0A 3QPUA 1OSNA 4MS3B 3E2MA 4JR0A 4UJ3A 4EQ6A 2ZRGA 2XWQA 2Q27A 1YCGA 2AD5A 3EODA 3W1WA 4UU8A 1ZNQO 2PH5A 5A02A 4YAJA 3HSYA 1TCUA 4XGKA 2N47A 621PA 4WNAA 2GEKA 1AHPA 2YHIA 5KU7A 2JD2A 3GUUA 3IQXA 4BFWA 2R2AA 5AW0A 2GBPA 3RFVA 3GMTA 2IEAA 3F3KA 5TNXA 3KOYA 2CMHA 1ZRSA 3TCNA 4D0GA 1ZESA 3LW7A 3VYRB 2X3YA 2BGRA 2ZANA 4UNIA 1LBSA 3ZIUA 5F64A 1I3OA 1WRBA 3AFGA 3WJ7A 4EGJA 5B6IA 2YYAA 5JNLA 3M9LA 4BEBA 2RC5A 3CVYA 4DV7B 1QZZA 1YSCA 1SEVA 3LI2A 1TDJA 1GD1O 2C00A 2R8YA 1O9BA 4P08A 1T6YA 3O3OB 1B16A 2AXNA 4I9GA 3ROTA 3ML1A 5T6MA 4NPCA 4QXOA 6REQB 4D42A 1NVVQ 1OI7A 2XDAA 1N5DA 4IHQA 3JD3A 1I01A 1WW2A 2ZI7A 4PBSA 3FFAA 2O0LA 2W6OA 3OWOA 4PLGA 4EKIA 3SQXA 2DQYA 3G88A 1KGDA 1U1DA 2G4CA 3H2YA 4I1UA 4IGAA 3C7TA 4JXJA 4KO1S 2XKBA 4XZ3A 4IF6A 3HZRA 1NN1A 4NFHA 5BUSA 2XNKA 4OHKA 1LV8A 3DJFA 4HMPA 3VBEA 2OCYC 3N2LA 4R71A 5C1BA 4EFLA 4I1OA 2HRDA 5K6AC 3CB4A 4Q21A 2I29A 5LPNA 1N92A 3EBPA 2IW1A 4JZYA 1PO7A 1TQHA 2F9MA 4Q0MA 2FRXA 2ONCA 2PFGA 4UDYX 3EXAA 3ZQKA 3T34A 3SF8A 5L4NA 5IS2A 2C4WA 5AUPB 3KYDA 1AGYA 2GSWA 3RUCA 4HWTA 4CEIB 4HVLA 1K5PA 1NLMA 1QH0A 1Y1LA 3KT8A 4DNFA 3ELYA 3TI7A 3O0TA 3SHOA 4Q9AA 2DERA 2HSWA 2G0NA 3KQOA 2D2VA 4BNDA 4GOLD 2VRWA 2P9CA 1J2RA 2DHQA 4Y2JA 3ITNA 1WCXA 3VR4H 1KYTA 3GLUA 3N05A 3EFEA 1J9EA 4HYYA 5HTKA 1U7XA 3HWRA 2IH4A 3SEQA 5SY4A 5ESDA 1PLJA 3H9CA 3ZCRA 4RENA 5BQ5A 5A5FA 4V03A 2BGTA 4M8NE 5FI0B 4M0FA 4BNMA 1NLYA 4QJ5A 3TAXA 2Q46A 1Z4IA 2P4QA 2PRJA 1G8MA 4C21A 4MH0R 4WLVA 1XRSB 3RVQA 2PSSA 1VG0B 3PDCA 4UHJA 1Z13A 6LDHA 3RHZA 4DR4B 4GL2A 4IDEA 1UT5A 3DV2A 3FCEA 4FZJA 5PGMA 4C1NA 3BAZA 3DT8A 3EWNA 4E2FA 2IEYA 2RHGB 3NASA 1QS0A 1KK3A 2OORC 5TT1A 1GAQA 2C9YA 1XEXA 3IULA 4J75A 4UAVA 1EQAA 3PB3A 1TK2A 4LJLA 2AEEA 3HGQA 4WZBE 4DV6B 3SP1A 5FTWA 2VQ3A 3GHYA 3U16A 2EL9A 5LNK1 5FOUA 3DQZA 4HR7A 2XA1A 4BGUA 2W6JD 4Z7JA 1TYAE 5JSQA 1EGQA 3N70A 4Q1AA 3W1VA 4FBGA 5B12A 1LDBA 3GJSA 1G3IA 1W5BA 2MYTA 3H6KA 4JC0A 1FSGA 2JH8A 1TZCA 4QFBA 4KX5A 3VSBA 4B48A 2H2GA 1WXDA 1XK7A 3DKVA 3BJMA 1O54A 1PNTA 4QTYA 4CLRA 5JSHA 3OC0A 2IZOA 2R84A 5G0TA 5BSFA 4AXXA 3CWCA 3KKKA 2XXBA 4MUEA 4QUIA 2X1MA 4EUKA 3EE6A 1QYWA 1BO6A 2NU7B 3FUCA 3EUEA 3KJNA 5CH8A 1SVUA 1HQDA 1M6NA 2C2MA 2F67A 1CHNA 1P8AA 2QAJA 4MV0A 4OM7A 2MYNA 4KR9A 4ZTUB 1PL7A 3RJMA 2VP5A 1MX3A 4RADA 3OTQA 1D2GA 4EEXA 1YWGO 1BE8A 1REQA 2QVLA 2ZJ6A 4UTOA 1PR5A 1PGQA 2CJXA 1CEQA 2R86A 4MK4A 1L5KA 3ZH9B 4R0VA 3HWSA 2ZIUB 2JL1A 1EWTA 1B6TA 1QH8A 3DZFA 1O6BA 2OBYA 1S1CA 1K5HA 2QKYA 3GEPA 4JHXA 3EAQA 3T7IA 3A4MA 3BB3A 4GKKB 4ETNA 2QVXX 2Z9CA 2ZRHA 3G8BA 4Z8XA 4E03A 5DT2A 5I01A 5BPFA 2FN7A 4H3SA 1QLJA 1IY8A 3PXCX 2OB1A 1SOWA 4ON9A 3SHFA 1UDRA 1Y1RA 4X8OA 4EVQA 4W5RA 3FVWA 2ZM6B 3E70C 3L92A 4LWPA 2OHOA 4WY2A 4N0PA 4ZCMA 4GR4A 3L5KA 3PC3A 1CR0A 2Y9PB 4MKGA 5KYUA 5JTUA 4ZJUA 2QMHA 2EBWA 3EPJA 2ACKA 1AGNA 3ABZA 2XUIA 3IBTA 4AX4A 1S2LA 1KIMA 2VJBA 4DV4B 3GWZA 1G1AA 4JC4A 4RSHA 1EGAA 2ACEA 2M2IA 5KQSA 5A3JA 3A2NA 5E4YA 3DD1A 4K46A 1DAPA 4BYGA 2NO7A 1PD0A 3KYCA 5GONB 5KUTA 3HBNA 3F73A 4UDNA 1E9BA 2H1VA 2IFTA 4H7IA 5F7OA 2X1LA 3MLBA 4PWZA 4ZO4A 4KE6A 1ZM7A 3T5CA 1QFJA 3PQEA 4W5TA 2ZYHA 3GD5A 2O7NA 1O96A 3BTUA 5CVCA 2F3UA 4UUNA 3T54A 3ENQA 4MUMA 3VYSB 2R6ZA 4GPAA 2YJ5A 4J07A 4HAWA 3KBBA 5B64A 1IQRA 3UY4A 4B2PA 2VHWA 3R24A 5BW8A 4LHSA 3CINA 3SZ3A 3RK1A 2WD9A 3JWHA 2WA2A 3L3BA 1VPVA 3HYLA 2O2XA 3GLIA 5GJCA 5D87A 1IZ8A 4RXTA 1AV7A 1U7TA 1UXHA 3W3AA 4QBHA 3TRIA 2YL2A 5SZIA 3JPWA 3GB9A 1SA0A 3A1NA 3LT4A 4GZ6A 5JV5A 3AEQA 3F6SA 5T3YA 4WOKA 3BS4A 1RP7A 4PSCA 2W22A 2XMGA 2I6TA 3JQFC 4Q05A 8MHTA 1GU1A 2QTMA 4CQJA 3KOWA 3NWEA 2DUNA 1SZCA 3ZE9A 3CW9A 5KHAA 1FUYB 5TF4A 3WRVA 4LRXA 2VL7A 4BO3A 2OAEA 2XD9A 1GJRA 2OSBA 4I2VA 4W6ZA 2XBUA 3OHSX 1Y6FA 1Y8ZA 2ODNA 2FUG6 5JNTA 3GFBA 4FLMA 1M9NA 3FZGA 2ZUUA 4GP6A 4A82A 3RSHA 1Y3AA 3UMVA 3O93A 4UULA 1OXVA 2FJUA 4HLNA 3EGDA 3FDFA 1OAOC 2HF9A 4RDCA 4FDLA 4TMKA 1KO5A 5KJCA 1NYQA 2H7VA 3DEJA 5CJ2A 3UJ3X 3PHJA 1E2KA 4A0HA 2XYHA 3JATB 3BUSA 4KHZA 3GEBA 1MQ9A 5K8UA 1N3BA 2EEZA 3GVIA 1L8AA 4Q4AB 4X45A 2XEXA 4BJ6A 2LPMA 5FA5A 1HMPA 1MGPA 3EEIA 4MWGA 3B3FA 5TQ0A 4Y3UA 4W9NA 1C3EA 1KC3A 2DP4E 2Q07A 3Q41A 4TYNA 1MR3F 1S8NA 1DBPA 3AI2A 3C43A 3K0AB 4OP2A 4W1RA 3R7SA 2I4RA 2UUCB 1KVUA 1FVFA 3DQQA 3HKEA 3QLVC 5J2UA 2FLVA 2ZRAA 3THYA 5CA0A 2IKQA 1J6UA 4Y0AA 1KJIA 4HAZA 1FEZA 3OE7D 1OUMA 3OOHA 5REQA 4AQ7A 1D1QA 2OLKA 2WWIA 2C96A 2CXXA 4ALJA 1LXCA 2CMGA 2I91A 2BCEA 2Q5JA 3TZLA 3KTAB 4AZSA 3UVEA 5HRUA 3I04A 5JJCA 1E9SA 2SKDA 4HDRB 3WDKA 4C6TA 1T1RA 1HYBA 2P2YA 1O08A 3K5PA 1MW8X 5KHLB 1OLSA 3BMOA 6ABPA 1GTVA 2F7SA 2JFBA 4G5XA 4GPBA 2HK7A 2VRBA 3DAOA 3F8TA 1ZRNA 2D0IA 3JD2A 4PPNA 3ZJUA 3M89A 4KIJA 2W83A 3LUDA 4ZQIA 1OWOA 3WAGA 2DPXA 4FMDF 2WP0A 2FR1A 3IT2A 4R1QA 3NGLA 3AFOA 4K0RA 1ULZA 2A94A 5GINE 3K6JA 1R88A 1VXOA 2ZT8A 3ZXXA 2C1EA 5JZSA 2AJLI 2HPZA 1UEIA 1A1VA 4FNAA 3EOAI 2Z2ZA 3IIEA 3C6MA 4WIAA 1UQTA 3ZE0B 5F9HA 4ZARA 5LQJA 2MTBA 4JB3A 4RQAA 1O94C 2P4HX 3QVVA 2HIHA 1R8YA 4CN9A 2PPLA 2F3PA 4J0CA 3UANA 2UUOA 2WZDA 3HMKA 4TXLA 1I9GA 1BTOA 1W88B 3WJ1A 1Z4PX 1XRQA 3NP7A 3ZD8A 4A3SA 1LJUA 4X3OA 2NO1A 5LZ8A 1SCAA 1S8OA 4EJSA 3GLHA 3HYTA 4RY0A 3SZRA 4F56A 3JWPA 3WI7A 4CM3A 4F2DA 3CLRD 5KBYA 3STYA 4E46A 3F49S 2QT1A 4IYRA 2JCGA 2R8EA 2RGGA 2BKXA 1HE4A 1Z7YA 1YIDA 3D8TA 1O8BA 1T5BA 4FP9A 4CL3A 3O83A 1AB6A 5K4AA 4CM9D 3PFFA 3OM9A 1QGED 1BGXT 3DB2A 3K9LA 4BAZA 4UUMA 5DN9A 5F98A 2HX1A 1SC4A 4G9EA 3C7AA 5ICSA 3LOQA 2HAEA 2CXNA 4N7MA 3K53A 1L7VC 3RBVA 4B3JA 2PXXA 4LZPA 3I0ZA 3TNJA 3UPTA 3F78A 3KKNA 1CEYA 4BJ1A 3TQTA 2RGEA 2O9JA 1PEAA 2B3DA 1CZLA 5THXA 2FCRA 3SJZA 1PIWA 2I5PO 4DLUA 4E6EA 1V6AA 3IAXA 1XDZA 2GHIA 1NDUA 1HQKA 2YWGA 1JBQA 2I4MA 4CIWA 5KDDA 3QKTA 2G9ZA 2YIMA 1SMKA 4QNNA 4WLOA 3UCFA 5F2NA 1JQ3A 1EP2B 1UPXA 3GZNA 4MR9A 5DBOA 1GNLA 3F5SA 1MH9A 4I1PA 4IDFA 4IILA 3PXAA 5LKAA 1ELOA 2IPOA 1U7HA 1C7ZA 3KB8A 1RC0A 2AYZA 2HPHA 3FYUC 3NBZC 3LSYA 1KC1A 3P8ZA 5AI6A 3O8QB 4NOMA 5HILA 1FY2A 2REOA 2AW3A 1QCZA 1O4WA 2VPWA 3KOMA 2GPAA 4IVQA 4MA5A 1H8ED 1O97C 1ZWKA 2MU1A 1OAOA 2ZATA 2ZVJA 1M2EA 4P36A 4UUAA 1I8TA 4XFDA 2J0VA 3RABA 3WJ2A 4Q3BA 4C0XA 4P81A 4N01A 4PG8A 2PGJA 2QAGB 5LQSA 3AUKA 1LS6A 1J23A 3D0RA 1ODTC 4ZOAA 3HVKA 1EX1A 4I46A 3WMEA 4B80A 2F43A 3ZDAA 5FORA 1OT5A 2YVAA 2QUAA 3QLUC 4FFLA 4RABA 5C9ZA 3ES9A 1QZUA 1RXCA 2H18A 2NSJA 2X2PA 3EVZA 4QVIA 2DOKA 1BMFD 1P0CA 2JZOA 1ZNXA 3Q3GE 4NMLA 2C8JA 1PYOA 1RZUA 1GPDG 1WSWA 3IV6A 1A7KA 1OKKD 2PGIA 1P2GA 1WSDA 1SCDA 5I7VA 3UJCA 1E63A 2E4UA 4LOHA 1JI3A 2A3NA 2JJ2D 1IH8A 5LA6F 4A91A 3TQHA 5KPJA 2DJIA 5H4GA 4KQ9A 4R0MA 4DREA 1QRAA 2FFBA 4L95C 4PG7A 4F8YA 5I9MA 2PXCA 4MB2A 4MR8A 1W46A 2FDXA 2HY7A 3R44A 4K3VA 4RPKA 2A2ZA 5DASA 1RXWA 1D2NA 4CHTA 1DADA 3WL7A 5A0TA 3IQIX 4ZVVA 3SYMA 2UZ3A 3OO1A 4A6XA 4X95A 4AWAA 4Q01A 2W70A 4JJGA 3VH4A 2EIHA 4EUEA 4ZI2A 4F4HA 5ITVA 1MA0A 1U0HC 4X24A 3DVAB 1RXEA 5CGZA 4D0LB 4QOFA 3ZVMA 1K9VF 3DZIA 3SC3A 2GF2A 3A1UA 4LYGA 4HDCA 1U5BA 3LNCA 3TJMA 2C88A 3ZY2A 3G9XA 1RLMA 4KR6A 4HQ0A 5KTPA 4XVUA 2OC4A 4KXLA 2V9CA 5EE3A 4DR7B 2AZTA 1X8JA 1TO2E 3TFWA 1FDTA 1OFUX 3HRHA 3S81A 3WOVA 4PICA 2WUDA 1LKZA 1YB2A 5JEEA 3W4IA 3E8MA 1YDEA 2GZRA 2HIMA 1FMCA 1Z33A 2VNIA 3G89A 3QLJA 2CXRA 2HK9A 4KPFC 1Z68A 3O0DA 2IHBA 2WF6A 4Z3KA 3Q7SA 2IVFA 2ZJ2A 4GPZA 1J7JA 3LLCA 4G0QA 1SAYA 1ZKMA 1G5FA 1TA9A 2C03A 3V8PA 1ZR2A 5EQDA 2O5RA 2PA0A 1NU6A 3H84A 4YREA 2R6HA 1AO3A 2UZ0A 3NHBA 2AYXA 4AJ4A 3R7NA 4DG8A 7REQA 2J3MA 1Q11A 3OEEA 1JFSA 4NPAA 1FVXA 1U0FA 1U0EA 2EYQA 3H05A 5JARA 1IHUA 1Q16A 1I7NA 4Y1GA 1KMCA 4AXBA 4OSEA 4QVKA 4YT2A 3NXKA 4YLYA 3K6RA 1PSWA 1FXWF 3HP7A 4G1UC 1E1NA 3D7NA 4LDNA 5EWMB 4CM8A 1CIVA 1XALA 5AP9A 2GEBA 3UWOA 2H0RA 4QU9A 3DWEX 1WJGA 1NC1A 1MB4A 4W4TA 2PRKA 2I3ZA 3D8BA 4H59A 2YJGA 1TAHA 4RDHA 5AJVB 1IOWA 5G0WA 1MHTA 1D1PA 4EMBA 4KGXA 3W9YA 2ZQYA 4MS4A 1NFQA 3P4XA 1G1MA 3UHPA 2ATXA 2K7ZA 4D4MA 4HRVA 4MI3A 4BGIA 1E7RA 1XTJA 3L1JA 3N58A 4DA8A 3A4VA 5F77A 3KZNA 3BMOB 3QG5A 5B58C 2P2SA 2E4AA 2XHEA 3TK1A 3N7AA 5EP3A 2JHAA 2HEGA 4CM9A 1MEJA 3NJ4A 4A2CA 1SBNE 1VIDA 4Q1CA 1SQ5A 1NBMA 3OLWA 1E5QA 4FKZA 4M86A 2WWRA 1QQAA 4C43A 2BT4A 3KYIB 5D85A 2R7KA 1JA9A 4AL4A 3IP5A 2HU2A 1JPUA 1P80A 1M6VA 1YR2A 3L1KA 3Q2OA 2Y92A 4LJSA 4N41A 2ZYIA 1Y42X 4FS3A 1GPMA 4WUVA 4C7MA 3N8HA 3CJRA 2WFZA 4UVDA 5A3RA 4Q9DA 5FKJA 3NW9A 2F3RA 3M6UA 5GGXA 3FWZA 1VM6A 1Y3IA 1KDTA 1QDUA 2ZWOA 1QHXA 2WPDD 4QDXA 2JFXA 5DSZA 5K3SA 5TQVA 2HXYA 5JQWA 3GVCA 3SLGA 1EK5A 5DGTA 2HI0A 3OZAA 3N7UA 4LPKA 2PJUA 4BDTA 2VH2A 3KUKA 1OYOA 4RD0A 3T3OA 3HH8A 2QL5A 1GITA 3VTFA 5LZ7A 4YECA 3FSRA 1S3SA 3C87A 5FEUA 4KWHA 4FYVA 4XWKA 4PCVA 5BV1A 4GXTA 1UM8A 4BUZA 2WG2A 5JBNA 4KXMA 2FPIB 3KXLA 4MQEA 2EARA 1Z6ZA 3PC8A 3WVNA 2PUFA 3OWHA 4L4YA 4NMWA 5BWBA 4H16A 1Y8RA 2WKPA 3A8TA 3P45A 5AKZA 4G81A 5IABA 4AU1A 3OMWA 4W99A 2H1WA 5AJUA 5AM2A 3FKQA 4V3BA 16PKA 5AI4A 2XVMA 3SHQA 1IN8A 3RR2A 4DA6A 2WJ3A 1FFWA 3CB2A 1DJQA 3K31A 3RAJA 1A88A 1NHWA 3GUYA 4BE9A 1N32B 4WINA 1K4MA 4WRRA 1SVSA 5FQNA 1VJ5A 2XT6A 2HWWA 1QHSA 2QRGA 2WFLB 5CRIA 3IUBA 5KIAA 4M21A 2DWQA 4MV6A 1KE2A 3FCCA 1YJAA 1G8KA 3GY0A 1T5LA 2O6LA 2X6RA 3I6MA 1JFTA 1FDUA 4UMDA 1T4BA 1A8UA 3CKKA 1GR0A 2H65A 3A1EA 1P2TA 4G65A 2R6JA 3AEQB 3BWDD 4X6XA 1HEYA 3ENNA 4CKBB 4RTNA 1JB9A 2DH5A 1S2IA 5CJPA 5IJ0B 1GTRA 1J0XO 1Q1ZA 2BMVA 2AF3C 2YRXA 3K2EA 4H0CA 1UR5A 3TNYA 3VNQA 5KNDD 5LWHA 3LWZA 1USKA 4BRWA 2VF5X 2ZYWX 3G2MA 5JS1A 3H11A 2OD2A 1E9CA 2HCFA 3LK6A 4DJFC 1Q3TA 1IHPA 3T3NA 5F9FA 2FFQA 2QTAA 5CB0A 3ZIAA 1G3RA 1M1YA 3DOUA 3PPVA 5IBQA 2UYYA 4HNSA 5ED0A 2B82A 3NBMA 1DINA 1S2NA 1H2WA 5JCPA 5DISB 1FBNA 1MC8A 1RU3A 4AJEA 5A06A 2IP1A 4C6SA 3HM2A 2C2WA 4WX2B 4M99A 3VKVA 2FKAA 3ZYZA 1FP4B 1R4NA 2WDPA 3LYAA 3VHRA 4HVAA 5DTMA 3WFZA 3VPAA 2W2TA 3QMMA 1YZUA 3IHKA 3M5PA 4X1IB 3UAWA 2RK4A 3EPRA 3I2KA 4YRDA 1JNYA 3IMCA 3KKQA 1VG1A 4DCGA 1XDBA 3C1OA 3LZCA 4UFOA 2NUAA 4XTRA 1EDDA 1Q22A 4RQTA 4ZOQI 3JQRA 4JFAA 4UBNA 3U1BA 1J1UA 3A6ZA 1JHXA 4M9XA 3W5JA 4ZPJA 2ODAA 2W6ZA 1XF9A 2XVZA 5DYIA 1ZEMA 3RC1A 1RTTA 5B2ZA 2WIDA 5A0FA 3HA2A 2AR0A 1E2JA 3NUGA 2JGKA 2Z2XA 4C6TB 1YVUA 3OZXA 1T3ZA 2H92A 2C84A 3AJAA 4CFYA 1M8JA 1XF1A 3TUIC 3UWPA 3V55A 4BN5A 2VF4X 3LFTA 3PPYA 4N0MA 4AJIA 2O0MA 4BOYA 2VR1A 1KMNA 1HO3A 3D4OA 4UVIA 2HJVA 1K8XB 2B9EA 4QODA 2AWNA 2QN8A 5JYDA 3CZ5A 1C2YA 3GBPA 4HFRA 1FTNA 1XNJA 1W581 4TOIA 2V4UA 2Y77A 2QR5A 3C3JA 3VPFA 1B8PA 2X5XA 1URPA 5FFNA 3HLYA 1L8XA 5LOVA 3AETA 4D5EA 1M2FA 2A5FA 3O8OA 3D6UA 1M34B 3M82A 4GGPA 4PLVA 5AFSA 1G18A 3JQ8A 4OQMA 2UUBB 4US2R 1I2CA 1V3UA 2CJWB 2TSYB 1N6HA 1GUZA 2G0TA 1ZNZA 3I30X 1OBHA 3DFKA 2ZTHA 3OPMA 4UE3S 1B00A 1I33A 3EH1A 2ODEA 1L9XA 2Y1CA 4RVUA 4TYQA 4YT5A 3U48A 5TGTA 4E3ZA 4DNPA 4ECAA 4S0XA 1SC3A 3MB5A 4ALLA 5IUNC 3EXEB 4CIAA 3CPJB 1EXWA 3B3QA 3C2QA 4A5SA 3Q3HA 2XXJA 3U62A 1YL5A 2P2NA 5D5QA 2AFRA 5L95A 1R16A 1XRMA 3CURA 1P7YA 3JX9A 1EB8A 2CYBA 1GG2A 2IYOA 4NYJR 1AO0A 4MO2A 4MVJG 3SVZA 1W6UA 2K5UA 2FN3A 4LSMA 4A0GA 4ZFNA 4CIDA 4OB8A 3AB8A 4MCJA 3VR3A 3BD7A 1BXRB 2X40A 3MT9A 2AKEA 2QEQA 2JIDA 3RRJA 2Q6LA 4BBZA 4DR1B 4YP7A 1SHTX 4MGHA 2FI1A 2HQSA 1U63A 3MERA 1T29A 2YWJA 4ZCQA 2FMXA 1ADYA 1Z75A 1VSVA 4NYMR 4CM5A 3FDIA 2QRHA 2VZ9A 1W73A 2BIFA 4MUJA 2GPSA 3NQ41 5AI5A 4EMSA 7GPBA 4XPZA 1RAIA 4ZVTA 3CSSA 3OI7A 1XNRB 2KWIA 1L6IA 3P94A 3JQDA 3AR8A 3UV6A 1A9XB 2OAP1 1V25A 4ZV4A 3DGFC 1LWOA 3CZ4A 1TVKA 2ZBQA 1XQVA 4K05A 1RHUA 4PZEA 2V5AA 4ILKA 2RIRA 4QULA 4TQUS 4YLEA 5MGNA 5IX8A 4ABYA 4NE2A 2II6A 3ZGNA 2EXXA 2FK8A 2NSHA 1K4KA 4IIHA 2FOLA 4MROA 1IRIA 3E4DA 4YCDA 1D07A 3WRYC 4ENTA 4ENVA 4JR1A 4RGVA 5B7NA 5AW8A 4JI5B 1LSJA 3GIWA 1QGUB 1VJ1A 2CFSA 5CVDA 4PO8A 3VR0A 3P52A 3WYCA 4L5JA 3WMFA 3LQRA 1V2GA 1CJUC 5AKEA 3C4VA 3O1IC 4L6CA 4ZA2A 2Q4EA 1R8SA 1OREA 4YALA 1JIJA 3W5VA 2IUSA 1MG5A 3F3MA 4NZZA 2PV0A 4AN1A 5E7JA 2FSVA 2OV1A 4L8FA 1Q3KA 1Y82A 1R0KA 1AIPA 2J41A 2NU8A 4BVKA 5I8WA 3U4DA 3P2EA 4HYQA 4Q9IA 3G1TA 3PFWO 4CMEC 4U4AA 1OWPA 4V0ME 3BWEA 4W8HA 3NDIA 3OT1B 5GY7A 2QTWB 5FRDA 3AT1A 4NV1A 1UKYA 4GOOD 1S8FA 3ABRB 3Q7IA 1L5LA 1IPEA 4ZRNA 3L1IA 4I4TA 1PT5A 3BG5A 4S2UA 2JGAA 3Q0TA 3NB0A 4MW7A 2B9VA 3JYOA 4PINA 3AG6A 4REQB 4ASUA 3OLZA 4BJ5A 4J1SA 2I3AA 2FWJA 1T9ZA 4AIIA 1XEAA 1DIGA 2EQ5A 2BC9A 2Z6QA 3SQDA 3TIFA 3JQ6A 3V4ZA 2VDOB 4GMXA 3HACA 5IU6A 2Q6VA 5JXIA 4AKTA 3MTJA 4YRPA 3M5DA 3MLEA 1XUOA 3JALA 5BOSA 2R1TA 2X77A 4JROA 3VHQA 3LGXA 3ORQA 1UOOA 3ZW7A 2ZIEA 4C03A 1GU0A 5I9LA 3EGXB 4EVRA 4I1SA 4HAYA 3C97A 1SUBA 4AROA 1HXHA 2OCDA 4XCVA 5ALQA 1JJ7A 2B4QA 3K70C 3Q3VA 4CFSA 1T5IA 5LXTA 1ZHFA 1PU2A 4O1IA 1ZPDA 5B6PA 1BMTA 2FQXA 2R8OA 1KTIA 2AR7A 1OHHD 1HDOA 3I8SA 3WZLA 4L2IA 5H80A 2COKA 1GL3A 3PKIA 2WT9A 4D0SA 1ADFA 4TT3A 5F2OA 1LX7A 3TZCA 4MYCA 4R7TA 1FP6A 1IXKA 2LRHA 2I3GA 1Z6PA 3FTPA 4JP1A 4E5DA 1SBIA 4NV0A 3Q6IA 4EGQA 1IY2A 2CF6A 3PXXA 5BNIA 1ZD8A 1OXXK 2FNAA 4QYIB 1RQNA 5C52B 1VHWA 3JYNA 1QORA 4MIOA 3UJ7A 4R5MA 4KRYA 1SVNA 2PXHA 2PTGA 2Q0HA 3L1UA 4ZT4A 4DF3A 1O57A 1ZLXA 2H1HA 1YI1A 1AU9A 3M49A 5K3FA 3LT0A 4PX2A 1X7XB 2X8JA 2JVJA 3MM4A 3BH7A 5LP6C 4X6UA 2DLNA 1WULS 1TVCA 2JGRA 1XAHA 3BX1A 3A9TA 3TMYA 1IZ7A 3N2ZB 2OYRA 1L5OA 1OWMA 2PX4A 2HWYA 1KR2A 4V0OA 3S1LA 3HCWA 2OXRA 3U7GA 2ZVPX 1ZHOA 4RY8A 1YL7A 4RM3A 3W5DA 1T2VA 1ODLA 1PV1A 2YFQA 4GKJB 1GQQA 1HFKA 3GGSA 3M4NA 2AA3A 5DSTA 3RO7A 3RSGA 1YKSA 1YK0A 4BRUA 5JQGF 5U9CA 1OH5A 4JT2A 1K8ZB 3O7MA 2Q5HA 4B3MB 1EJ6A 1WMDA 4PLFA 3OZUA 3IX7A 2BKEA 2HUPA 4WOPA 3GNLA 4PNZA 4IF4A 4XTCS 4CR6A 2VNKA 3VPGA 4OUDB 4EIWA 1G7RA 2P9FA 3G5TA 1UF9A 2F9LA 5KDLA 2B7BA 2R1VA 4JOSA 4ZEOA 3UXYA 2YV5A 3DBLB 4HB4A 1NBIA 5KX5B 5DHFA 3WLFA 3NVKI 2BRUA 3FNRA 2XIJA 2JVKA 4CZ2A 4R1SA 2HK6A 1W0JA 3TSWA 1EFHA 2L19A 3WLJA 4GDMA 4B5LA 1G8FA 1YBFA 4R2LA 4OQLA 5CT4A 1ISSA 5DX1A 3PLAE 3I34X 4F5YA 1UM9A 2RAPA 4BNTA 1G2PA 2C2YA 3A1WA 3SIRA 4GR9A 4WLUA 3GPLA 1QG6A 3KKPA 3Q7PA 3BD6A 5JAZA 1F2TB 2W2QA 4KL8S 1UM9B 1LSUA 2YUTA 1VKZA 2PX6A 4F2WA 4JQSA 4PIVA 3DKRA 1QC5A 1G5RA 3MOIA 1SOAA 1D0SA 4MTLA 5CU7A 1K75A 2JNWA 5JRDS 3EPLA 2WMOB 1UANA 3JW8A 1E2NA 1QTIA 4QE3A 1P9OA 3X44A 4PANA 1MC5A 1NX9A 3BSWA 3X1WA 4TMXA 3JZAA 2QMUA 3TTTA 3SXJA 1SG9A 4BQEA 3W9UA 1WDKA 2PKRA 4K2AA 2DTEA 4NZPA 3FGZA 1CNMA 1DQSA 1E9RA 2QVZX 4WCFB 5F4BA 1NLFA 1PX0A 2Y0BA 2BVNA 3CZRA 3GJQA 3HDJA 1VIYA 2GYUA 4ITUA 1D5CA 4LBYA 4JVLA 1CNFA 2OCKA 2HCJB 3BTOA 4OI4A 5CVUA 4DPKA 4Y9RA 5D5PA 4O6VA 4PX5A 1GKUB 5J1TB 2GPTA 4QRDA 4IL5A 5LN1A 2PJZA 5FOTA 3GARA 2C9ZA 2YN2A 5CBKA 2ORYA 1BCSA 2BELA 3TLJA 4HB3A 1XCMA 1ZITA 3LXRA 3I2JA 1YOBA 3USZA 3PF9A 1X1SA 2A5LA 1E9VA 1RZ3A 4GE0A 1DXQA 1WPRA 1JXMA 2GN0A 3M34A 3TUJC 1WHSA 4Q4LA 1ENYA 2A9OA 4YJHA 4Y9TA 3F9CA 4ESOA 1QLWA 5IBPA 1DUVG 1E66A 1DAHA 4X97A 4DW8A 1JTVA 3IMKA 5BR4A 3W5HA 1YF3A 1ULTA 4DLNA 5M5BA 1MOSA 3A4NA 5AXAA 5FWYA 5ICEA 1Z5PA 1O96B 1QGYA 1XA0A 5LOVF 2FX5A 4L8GA 3FUUA 4O5AA 4JITA 1T4DA 3ZKAA 1SUIA 2AOUA 3VZDA 1IZ9A 1CY0A 1A98A 4ZI7A 3EGOA 2O8CA 3ZQJA 5ENZA 4LC1A 2XVXA 2IXBA 2O8DB 4II2A 2QGZA 4UHHA 3FZYA 1YE3A 3D8UA 3OE4A 1DXYA 3M4YA 3B5EA 2DM6A 4V0KA 2P11A 5TPWA 1UJCA 2D8AA 1SKYB 3I9V1 4YP9A 5BW6B 3K32A 1FYVA 1HURA 3W34A 4YEDA 3DEAA 4B4VA 4BVEA 2H31A 3MWLA 3QPWA 1W94A 2I7VA 2QMZA 1J0BA 2CUZA 2VZLA 3OE7A 2AQIA 4G0XA 3BKXA 3QJYA 3S55A 3RHTA 4KQKA 2GD2A 2VTEA 3D81A 4HSEA 2JASA 4MW4A 2FV8A 4UHEA 3RVRA 2FZEA 1M2HA 1M1YE 1Y37A 4DPMA 4DCJA 4N4AA 4PQYA 5C4MA 3O4IA 3V46A 5L3SA 2PLNA 2V7PA 4HRXA 3BTSA 3H5LA 1M76A 3SWWA 1EVJA 3DVRX 4ED9A 3CRNA 3CCFA 5CGQB 4YQZA 2A7XA 3EVEA 1VLHA 2VUSA 2HOQA 1TYEB 2IYAA 4H6PA 2GPBA 1XZEA 2N1BA 2PZFA 3MTQA 4PNPA 4EZEA 1AS0A 2HRRA 3PXEA 1IN6A 2XSZD 1IN1A 1CUSA 4PGHA 1H3NA 4WXPA 5IMSA 1QV6A 5EIWA 3FBGA 1LDYA 5HQJA 1Y9JA 2XRMA 4AUKA 4DC9A 3KYDB 3I6BA 1EE2A 5LBTA 1C1XA 1CSEE 4B71A 3QVTA 2ZK7A 3LQ2A 4YCNA 4UTNA 1VB3A 5DI3B 3UJPA 1SVKA 4GPTA 2PKYX 3QUSA 1HT2E 3IS3A 4GFDA 3I3OA 2XITA 3VV2A 2NYUA 1H2RS 1ZU5A 1E0DA 1FDRA 3MWDA 3N2KB 1PTKA 2P2CA 1GPWB 4URFA 2RI0A 4YK7A 5AH0A 1TF5A 4DLSA 2OCGA 4AMVA 2HGSA 3ZD9A 3M9WA 4IJKA 3G2JA 4U6QA 2ECFA 4MVXA 3ER9A 1UPBA 4U1RA 5IKEA 4WN9B 3ZK8A 1EWKA 4D96A 4CV1A 2DLDA 5E8RA 5BR1A 5C1OA 3LUKA 5A03A 2XWBF 3KOZA 3TOCA 4HC4A 2R4QA 2C2XA 1P81A 4N82A 3DOFA 4L15A 4DTCA 2C58A 4RESA 3PUYA 1BX3A 1JEEA 3N8KA 2PCLA 4CXMA 4PYKA 4B7UA 5KTOA 5AM0A 4J2OA 4LKOA 3UKJA 3CR3C 1TQDA 4A6DA 1XAGA 3AINA 3HV2A 3PVCA 1I2ZA 3HO6A 4L78A 4XRRA 2OXIA 2I4NA 4C2AA 2I1QA 3WDMA 1E3QA 1FDOA 3TBHA 2FDCA 1IOZA 3VNAA 2PUDA 4BPBA 4BNFA 5JXGA 4IRXA 3OPYI 3PNYA 3A1VA 3RIEA 4OYRA 2Q41A 5JC8A 1NVWQ 2I2XB 3VR5D 1M72A 2H4JA 4ZRMA 4IJVA 1YE8A 4ZHQA 3WMXA 4YJ2A 1A97A 5A71A 2C7VA 4E70A 1PEKE 2EFEB 1VIMA 3NC0C 3TD2A 3UOWA 5KTSA 3KOOA 4M7RA 1VMIA 3CRVA 2F48A 3ZDCA 3OJ0A 1JE0A 2UXCB 2A8YA 5ARCA 2FEMA 1HKUA 5M2QA 3REOA 1O77A 2VZ8A 1ODIA 2ERYA 4TKVB 3ZLVA 4DL9A 3CLTD 5AW7A 3E15A 3ZVKA 2YXNA 3V42A 3GPCA 4E07A 1UXOA 1OHHA 3AUYA 1HZZC 2EW2A 1ZA2A 3LO8A 4XX0A 3KE9A 3RHSA 4OMDA 3VV3A 1DTEA 1LQTA 3HYRA 2BUBA 3ILSA 3D6HA 2EF1A 4NCHA 3OTGA 5B7PA 3HB5X 3MYRA 1V26A 3EB9A 3TRFA 2OAGA 3ROKA 2OQRA 3PQ7A 2VBFA 3BWYA 1BS9A 2DWCA 1ZSVA 2GKGA 5JI3E 3ENZA 2ZQ5A 2GRJA 2VT6A 4Q15A 1L7XA 2IOYA 3UB4A 2YX1A 1TU3A 2YXPX 3O26A 5EXXA 2VTKA 5L53A 1IHDA 4E2WA 3VR6A 5TEWA 2Y8EA 1R50A 4I5FA 1E60A 3TB4A 1X3SA 2KMLA 4F2GA 2CLLB 1TJNA 3MEQA 3VZQA 3NX4A 1NLUA 4KR0A 1MRZA 3SHTA 3VR3D 5K03A 4ZO6A 1EHCA 5DVZA 1GGEA 3DKPA 3V2UA 3K35A 3RROA 2BF7A 1LBHA 4XPIA 4B4UA 4CG3A 4EG8A 2M32A 1UBSB 3ZVLA 4IX9A 2F3SA 2JVIA 3R9KA 1AKUA 1EAMA 1JEQB 4OXIA 521PA 3W6UA 2VK8A 4DN6A 3N3AC 2LCFA 1Z8DA 2ZQZA 3UAGA 3ABQB 1YFLA 4URZR 1Y8AA 3L41A 1MJHA 1UWVA 3R5JA 5HCUA 4EATA 3OFND 1XLTC 4KQJA 2A1TR 1EUZA 1BFUA 2H4XA 4YJ3F 3BMQA 5JSKA 3TW8A 3ZWCA 4BZXA 3I45A 1F2UB 2PH1A 2J8ZA 3EXIA 3K20A 4R1NA 1H3FA 1XQXA 2QZ4A 4DIKA 4YRZA 3LC1O 2ZYAA 1TEHA 1BWRA 4RVFA 3AJ9A 1KO1A 2CXHA 3P7MA 1IJEA 2AWOA 3EG5A 3QNWA 1TM3E 5KO2A 1DZIA 4N3BA 5L40A 4DSTA 5JWRA 4CT5A 4ZCRA 5JANA 1R0ZA 1T6ZA 1SOVA 1WP9A 4I19A 3DBLA 3AEKB 2CBZA 1UH5A 3BTVA 3DNMA 3GT4A 3FOAA 4FNGA 1W29A 1RYMA 3EQ6A 3USES 2HK8A 3JQCA 2WF9A 3MT7A 1CUWA 4U7FA 4RD2A 1GPYA 4IAOA 4DOMA 4O4HB 1C3XA 4A4DA 1SCNE 4CKBA 3I1YA 5JFGA 1W36C 3H3XA 2BFFA 5CA1F 1U99A 2QG4A 3K1JA 2I33A 5FV4A 1ZNYA 3CLSD 3P71T 4WNAB 1B26A 4B75A 2WSIA 1UDAA 1XZCA 2XZPA 4GLJA 1A8QA 3K4HA 1L7OA 4Q12A 4M1MA 4UNPA 3SQMA 5KNBH 2BZGA 4FT4A 3KKOA 4ZTBA 1QKKA 5JI2E 5BXYA 3NHWA 3PUZA 1GCGA 3VPCA 2O7QA 3EA4A 2PMCA 3PLNA 3VPBA 4L9SA 2CEAA 1P2SA 4FDVA 1FRNA 3TKYA 4QGBA 1Q1QA 2QS9A 3PX3A 3AB7A 1U2TA 3DW3X 3KQYA 3OETA 1IEVA 5D2CA 5TARA 5TVGA 1EE1A 3MQFA 1ZU4A 1SD2A 2V7EA 1RKUA 3VPDA 1BQEA 1RSZA 1QOQB 1F8FA 2XA9A 3PJEA 4LYJA 3KT6A 2OOSA 3RV4A 5EVJA 1OYWA 5KCMA 4R3WA 1N4DA 5DHPA 4L3VA 1I14A 4DSZA 1CQZA 1W2HA 3CVOA 3K7EA 5E7IA 4DA9A 2R6CA 1PQYA 2H7CA 2RGBA 3QV1A 4K8OA 2ONKA 2V7VA 2ZYSA 1KEWA 3D9QX 3WIUA 2H11A 4WECA 4UPEA 4ZANA 4G4JA 1AOXA 2AKYA 3OEHD 2Y93A 2IKSA 4MVJM 5AW5A 1QBGA 3RJ9A 3OU7A 4NIMA 4BMZA 2XCIA 3ED5A 2YV3A 4JP3A 1QHIA 3GO4A 1J8FA 1NJ2A 2BCJQ 5A4KA 5CFPA 2OHHA 5JNSA 4GKBA 2DULA 4QGFA 5CBPA 3UOAB 1YVPA 3EW9A 3ROFA 1RP1A 2V6JA 3KSDO 4V0LA 4UMVA 1GZHB 4UNNA 3AOEC 5A3SA 5JD3A 4OIFA 4Q93A 2VP6A 1SVIA 3QGMA 1YQEA 2F8MA 4URYR 3V4FA 1DX4A 1L3IA 1X1DA 1EFVA 2Q0QA 2Q9CA 3I9KA 1PFYA 1XO1A 1K3FA 2Q2QA 1TGYA 2D5AA 4C1BA 3HJFA 5EE5B 2NNLD 2O48X 1N33B 4LPSA 3JQEA 4I3GA 5DNUA 3H1AA 4RLSA 1LVGA 3WLQA 1GA4A 3WQQA 1GOTA 5TPZD 2DF8A 3GK3A 5HA5A 3G2LA 3PC6A 3ESXA 5IVPA 1TUGA 2HHHB 3GJ4A 3BT7A 4MS3A 1PDVA 1U5AA 1GG8A 1W48A 3QRWA 3I37X 1NSYA 3DEZA 2OZLB 5B55A 2X0KA 1MB2A 1IPHA 4OHRA 3JASB 4WE3A 3SN6A 3ZWNA 5KVCA 5CB8A 1U8ZA 2F4NA 3PZRA 3AY6A 1D03A 3QWBA 4V02A 5ENVA 4BMXA 5A4FS 1NZFA 3DBIA 3ZWXA 1JPJA 4I9FA 4NBLA 4QDUA 3CPEA 3VUFA 2CZGA 4O4HF 5ERGB 5KC8A 1MU0A 3ZCVA 1DQPA 1E3WB 2GX6A 2WIFA 2WWGA 2HA2A 3EEYA 3EZYA 4NYMQ 4X90A 5J2UF 2P65A 4RGQA 3D0OA 4GBMA 4AKEA 3PHLA 5KWVA 4MNTA 3BCRA 1UKCA 1E7SA 3WGQA 4LUCA 2ZAYA 1N2XA 1WF3A 3GRCA 3EC1A 4KWIA 3F5FA 3LX5A 3T4EA 5EI5A 4UM8B 1MXHA 1S9HA 1ZD2P 2YZNA 4G9BA 3TO5A 2C57A 4MPRA 3W9BA 4E5UA 1QH1A 4WKPA 3UFBA 5AVWA 2I4TA 4ENUA 1WE2A 2B36A 3UYLA 3ZVNA 4G0VA 4FDMA 2WWTA 3QMWA 2Q7XA 3B6ZA 2ZYGA 4M87A 1T2EA 1JHOA 1A9XA 4FWTA 4MAMA 3FJ1A 5BORA 1N9GA 4N5NA 4CEHB 3UW1A 2GJ8A 2HZBA 2W6QA 3B38A 4DIEA 3ONNA 4RGBA 4Y67A 2C2HA 4NS1A 3RRZA 2WMYA 1WBJB 4W8OA 4C4XA 1T43A 3WGLA 4O3MA 3ZX5A 2KQUA 1NUHA 4MICA 4Q7KA 3GWGA 2OLJA 4O4IA 4V0RA 3JQBA 2C4TA 3M3PA 4WOCA 5EESA 5FULA 2M6KA 4BVLA 4BE7B 2EJBA 1L4BA 1BEZA 1THTA 1INLA 1I3NA 2MT9A 3OJOA 4KXNA 4UM5A 4DWOA 1W36B 2ODPA 3IQEA 4CEJA 1TYBE 1ORTA 3P9SA 3DAYA 4JUFA 2NAFA 1E59A 3BK2A 4NXNB 5BWCA 2PU5A 4WH0A 3N2IA 3UMGA 3PSAA 3UJ9A 1OX6A 3OOWA 2QD1A 4YVFA 3KM0A 4EUSA 1C9JA 4R05A 1XC7A 4UBJA 3W4JA 1AQLA 5BXQC 4ESEA 4XB1A 3ZVRA 1CP3A 1D4OA 4M88A 6ADHA 2QLFA 2TMDA 2ZWVA 3V4LA 2PJDA 5A7GA 3GJ0A 5FCDA 4LV6A 1YB1A 1HDYA 3ZHQA 1NYTA 3REQA 2IXDA 4L9RA 1OGJA 1FK8A 1G21E 1LGYA 1R0SA 3ICCA 3OPNA 2ZAMA 3QBVA 1DUSA 3LKVA 4G1VA 4MUFA 3DTYA 3WMRA 1IXYA 4BO1A 1T2CA 4DLRA 1BU5A 1Q20A 5D00A 1GKIA 3GGCA 3P9PA 3AV0B 4XXHA 4PVDA 3RUFA 4EUHA 3TWOA 2QD5A 2R66A 2HQOA 3ZE6A 4LV8B 2VOEA 2QPOA 3D3WA 1QSGA 1DB3A 3NEYA 1R12A 5F2EA 1MHPA 4NI5A 2G1UA 2J5KA 4G8JA 4WGFA 1UJ6A 1BJRE 1D8TA 1XMPA 4UCQA 3PGMA 1JG1A 5ARBA 1DAIA 1JT9A 1OLXA 1Y6GA 1NONA 4PR3A 2IXEA 4TKUA 3K2QA 4MUGA 5TF0A 4OG2A 2W0MA 3IP6A 3NAZA 3NVMB 3ZS8A 1YR6A 5FWNA 5FNZA 4NCKA 1FUIA 3B20A 1D9ZA 1QZTA 3GRAA 1NKSA 1KOJA 1ZUD1 2O8VA 1IB0A 4QA9A 5YASA