4ZRDA

Crystal structure of smg1 f278n mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
278
structure length
278
Chain Sequence
RGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNNDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIP1, secretory lipase (Family 3)
publication title Structure of product-bound SMG1 lipase: active site gating implications.
pubmed doi rcsb
source organism Malassezia globosa (strain atcc mya-4612 / cbs 7966)
molecule tags Hydrolase
total genus 95
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zrdA00
2DCMA 4UFNA 5AIAA 2RONA 4CG3A 2HL6A 3W2TA 1YR2A 4DTCA 2Z8XA 1X70A 3WK4A 4UHHA 1BN6A 2WIJA 2VAXA 2VJDA 1USWA 2XMQA 1IZ7A 3T52A 1CUFA 1CEXA 5AI0A 2BCEA 2GYWA 3DLTA 2DSNA 2GBIA 3RKSA 2OQIA 1MTZA 1UKBA 4BDSA 3H19A 4U2EA 5CRIA 1CUCA 1U8EA 4JNCA 3QM1A 4J0CA 2CKMA 5HQ3B 1KU0A 4JEIA 2PPLA 5JALA 2FUKA 1TK3A 1ZI8A 4UUQA 1VA5A 3I2HA 7YASA 3FYUB 2OPHA 2JGFA 3WK8A 3JWEA 3W06A 3I2JA 4HZGA 4UBMA 4BZZA 2YH2A 1NU8A 1VE7A 4AO7A 2HDWA 2WUGA 5EIHA 3IULA 4NZZA 3DYIA 4AZ3A 1Q0ZA 2O2GA 4WY5A 2RGUA 4EZIA 4J0IA 3I6MA 3A70A 1O6FA 4KE6A 4A23A 5FV4A 2GZSA 2H9YA 3D0KA 4BZWA 1PFQA 4PQEA 2ROQA 1QIFA 1CUGA 5ALDA 4LYDA 3FLBA 1CQWA 3FLAA 5ALIA 3C70A 5A7FA 4DNQA 3ZPXA 4J03A 5D3KA 3N0TA 1EXWA 4BDTA 4WFKA 5ALVA 4D9JA 3U0VA 5K3BA 4MYSA 4CFSA 2JGIA 1ZJ5A 5ALNA 2XMGA 3C6BA 5LZ7A 1R9NA 3I6ZA 4EUSA 1CUWA 2XUHA 3VJLA 3WK5A 2J4CA 5JAHA 3ZLVA 2VQ6A 5F4ZA 4E11A 3A2MA 3H2IA 1CIJA 4CCYB 1ZIXA 2OXEA 1XLUA 3QZUA 1XZKA 5ALYA 3QMVA 2WQZA 2P8SA 3LIPA 4GWLA 3ESCA 3GA7A 1JJBA 3D2CA 3LCRA 3WZMA 3WL7A 1Q0RA 1IUOA 1UOPA 1WHTA 1G4HA 2PX6A 2RHTA 1LPBB 1LPMA 4E14A 1EI9A 3H04A 5HQ3A 1QE3A 2XMSA 5SYMA 5HK9A 3E0XA 1EDBA 3D7RA 3FYUA 4EY4A 1ZD2P 3DJYA 1TAHA 3V48A 5JD4A 1R3DA 4OUKX 4RPCA 5C8VA 1HL7A 5EHQA 4HVTA 2J4FA 1WHSA 1YB7A 3DCNA 3UUEA 4HS9A 3G0DA 1Y7IA 4H77A 1ZD3A 2WFZA 2CJPA 1BU8A 4F60A 1RYYA 2ZYRA 1ODTC 4QWMA 4N5HX 3IBTA 3GELA 2QOEA 2Z3ZA 1YB6A 2WIDA 1J1IA 5JZBA 5AO9A 4K6HA 4WJLA 3H17A 4DNPA 4X00A 4PNZA 1XZLA 1CUYA 3G9TA 3SX4A 4LXIA 4A16A 4H7EA 5T4BA 2Z5GA 1BRTA 4AO6A 5T4EA 4P93A 2GBFA 2WJ4A 1MNAA 1TKRA 1DWQA 3OURA 3ICWA 3A2LA 5LYYA 4CCYA 1XZJA 4LXGA 2DR0A 3DOHA 3VVLA 5ALTA 1XQWA 2VT7A 5HF9A 2FX5A 5CH3A 4G8DA 4G5XA 1CUDA 2D5LA 5AM0A 4BYMA 3JW8A 5BV7A 1H2YA 4C89A 3PICA 1PJAA 3QMMA 5ALLA 4IH9A 3C8DA 1XLWA 2VEOA 3R40A 1JMYA 4OSEA 4FOLA 4B9EA 3FCYA 5I8PA 4AXBA 1HPLA 3GUUA 1YAHA 1NX9A 3M83A 1A8QA 3BXPA 2QTBA 4XWGA 2PUHA 3G9UA 2QT9A 4F21A 2XMDA 2PSHA 3I2GA 1DQYA 3V1KA 1U2EA 1PV1A 3E3AA 1CPYA 1NU6A 2HA2A 2HFJA 3HRHA 4MQMA 3IDAA 4PSUA 4KRYA 1K5PA 1CUXA 2FJ0A 1QJ4A 2HA7A 4ZREA 1GGVA 2B4KA 2AJ8A 4KACA 3RLIA 3R3UA 1MPXA 4KRXA 4B84A 1R50A 1VLQA 1CQZA 3IVMA 2BUAA 2RHWA 1ODCA 3I1YA 1Q84A 3A2NA 4P92A 3W05A 4ZV7A 3GFFA 5AI8A 1FJ2A 2V98A 1YSCA 5K3DA 5AOCA 3GROA 4DYHA 1E5TA 5FUMA 5A71A 3SC2A 1BEZA 3WYNA 4ZXFA 1W76A 4YASA 3HLKA 5HK8A 1FFDA 3OOSA 1CUHA 4H7IA 3I6YA 2HRRA 1XRRA 1GKKA 2QR5A 3PUHA 3EQ9A 4G1FA 4MWTA 1N8SA 2GYVA 2HADA 4BVJA 3CXUA 2V97A 2WG1A 1GZ7A 4BRSA 3AZOA 5LZ5A 2ACEA 4B81A 5I9IA 4MEBA 2WIKA 3D4LA 5AM5A 3QVMA 5EHNA 5A7GA 2QZPA 5EI5A 1XRNA 2K2QB 5KWJA 4CG2A 3OG9A 4KAFA 4BAGA 2HIHA 4UBOA 1QOZA 4INZA 3HZOA 2OLEA 4U2FA 5K3AA 2I03A 4I4CA 3CCCA 1ZI9A 1ODSA 3QBJA 4AMYA 1XRPA 2JGLA 1BCRA 5AP9A 1UT6A 1WPRA 5AOAA 5ALQA 3G0BA 5C8ZA 1THTA 2YXPX 4UHCA 3ZI7A 3R3VA 1Y7HA 2H7CA 4BATA 1XZHA 4HRXA 3R3ZA 4L72A 4N8EA 6YASA 5DNVA 5C8XA 2DHDA 5AKYA 3PFBA 3WWPA 2CBGA 2ZYHA 1LPAB 3AILA 4Y2PA 5ALZA 4B0PA 2XQJA 2OCIA 2O7RA 4UBLA 5I7UA 1TQHA 4BVLA 1GQRA 1BS9A 2JEZA 5LKRA 4MXDA 1QO7A 3BIWA 2XQFA 2ZSIA 3AIOA 4H7JA 3RM3A 3STVA 3PE6A 1YAJA 4LIPD 4E46A 2PSEA 4AQDA 4DGQA 1EB8A 4IHAA 3WK9A 4H35A 4C4XA 4G4IA 5D7BA 4FDMA 1MJ5A 3IUNA 3A6ZA 4G8CA 2VJAA 1BROA 2WHRA 5JANA 2DHCA 3B12A 5CT5A 5CURA 2OGSA 5BWBA 3TJMA 2O7VA 1K4YA 1UK6A 3PDCA 5LIPA 4YK7A 2OQVA 2JBWA 2G4LA 5BWCA 4UFPA 1B41A 1JT2A 4H7KA 3CN7A 2XMRA 4BP8A 3F8SA 3V1MA 3U1TA 3M82A 5J3JA 5AK3A 2I78A 2QXUA 3BF7A 4JYMA 2QJRA 4X71A 4C4ZA 2ZSHA 4GEGA 1K6EA 5AHXA 1N5MA 4ZI5A 1QIGA 4X6YA 1W4LA 5CXXA 2ZJFA 3HXKA 4K5QA 4UBNA 4X93A 3PI6A 5ALSA 1CUBA 2DQYA 4I3FA 1QIHA 4H0CA 1OILA 4KE9A 3ZWQA 5AK6A 4X7BA 5AKLA 4JH0A 5AOBA 5C7YA 2XMCA 3OM8A 2WSLA 3BF8A 1YASA 1MX1A 5T4HA 3BJMA 2ACKA 2BGNA 3STWA 4KE8A 3ANTA 1ZGCA 1DQZA 5HKBA 3PFCA 4FBMA 1ZICA 4P08A 4HTAA 3MVEA 3HYSA 3DKRA 2XI4A 1JJFA 3O9MA 1B6GA 4Y2QA 1YS1X 4ITVA 5DNWA 4P9NA 3G0GA 2HA0A 3K9BA 1EH5A 3D2BA 3C45A 2EDAA 1AZWA 1BN7A 4X95A 5ALFA 4KAJA 3DD5A 3HSSA 4MEAA 1F6WA 1QO9A 3KSRA 3I28A 3WL5A 4OU5A 5IVHA 3VDXA 4CIBA 3F98A 4L9AA 2HA6A 1QIDA 1QLWA 5CH5A 3AFIA 1ORVA 5C81A 2XUJA 1MNQA 1K8QA 4CIAA 1THGA 3ZLUA 4AZ0A 1LBTA 1XQXA 4PF1A 3AINA 4AMZA 1CFJA 4QLOA 3WJ1A 4FMPA 3R41A 3PF8A 4DMCA 2UZ0A 2JGKA 2QVBA 3BWXA 4QDZA 1R1DA 4OCZA 4QDUA 2WJ6A 5A7HA 2GZRA 2CZQA 2WM2A 4CG1A 4N8DA 2AJCA 4AB1A 1XZMA 5ALOA 3MUOA 2WIGA 4W1RA 1D07A 1EHYA 4YX9A 1GT6A 4EY6A 5EIEA 1TIBA 3H2HA 5JADA 1E8DA 1WOMA 4B82A 3C6XA 4J0HA 4DMFA 1XZAA 5ALRA 5A62A 4H18A 2WLSA 3M81A 4Q34A 5ALUA 2V96A 3MGAA 1H22A 4KYVA 2XLCA 3IB3A 1M33A 5E4YA 1Y37A 1MU0A 1J06A 3WLAA 1CUEA 4X3CA 3QYJA 1CUIA 1BCSA 5CXUA 5HZGA 5FLKA 1QFMA 2BJHA 4GXNA 4DMHA 4U2CA 4PO3X 4MJ3A 1AURA 3WKCA 2O2HA 4IQ4A 3EQ7A 1QTIA 4BTLA 3FAKA 1LPOA 5JATA 2ONCA 4C87A 3WA6A 1DINA 4RE6A 2OAGA 4KR0A 1ETHA 2XUGA 4QNNA 5FOQA 2JEYA 1FFEA 5DTIA 1CUUA 4EY8A 4EB0A 2V9ZA 3DL4A 2WG2A 1SCIA 5E4JA 5CT8A 4MWSA 2XUFA 1GPNA 4DNFA 1WB6A 3HEAA 4WFJA 1DU4A 2IIVA 4LXHA 4W1PA 4J0JA 4U2BA 5ALGA 2ZYSA 1UWCA 2OCGA 1N1MA 5K3CA 2ZVDA 4LKOA 1QTRA 2CMFA 3IUJA 2QXTA 5AKJA 5IVDA 3S2ZA 3WWOA 2QS9A 3G0CA 5FKJA 4Y2VA 5JARA 4FKBA 4KAAA 3NGMA 4WFIA 1J07A 1A7UA 4BBZA 3AIKA 3I2IA 4W1QA 1P0PA 3QPAA 2NW6A 1I6WA 2VSQA 2PU7A 4BC0A 4OYLA 2PKYX 1W75A 3ESAA 3WL6A 4WCVA 1A88A 4RNCA 2C0QA 2VJBA 4OB7A 5FXMA 2B61A 2XUAA 2QUAA 2IITA 4Y2UA 4UHDA 3L1JA 1C4XA 2XUOA 3JYHA 4Y9SA 2H7YA 3VISA 1QIKA 4IO0A 3K2IA 1MO2A 3PUIA 3WZLA 5JD6A 1U4NA 4H7HA 4QDTA 2HM7A 5H3HA 2VAVA 3ED1A 5AM4A 5AKXA 2B20A 2HA5A 4B80A 1K63A 2XUPA 3BJRA 3WKBA 3WIOA 3NWOA 1XZBA 1VE6A 4N8SA 4PV7A 5CT4A 3AJAA 4GHWA 1E3QA 1EB9A 4GECA 2OG1A 1P0IA 4ARAA 5CT6A 3SK0A 1YA8A 4L0CA 3K6KA 1OXMA 3WWCA 3C43A 2Y2UA 3G7NA 4B0OA 4DSZA 1ZIYA 5HF5A 4EBBA 4Q3KA 1TCBA 2WILA 4Q82A 2VA9A 1AC5A 2QJWA 1QIIA 3AIMA 3WL8A 4B9AA 1CV2A 1QZ3A 1VXOA 1JU4A 1R88A 2ECFA 2Y2VA 1JMKC 2XB6A 4QA9A 3Q8WA 1S8OA 1LZKA 3LS2A 1U65A 1CRLA 1JFRA 1ORWA 2J3DA 1IVYA 2BUBA 2RI6A 1XROA 1DX4A 1IUPA 2OCLA 5DWDA 3D59A 3H18A 3G9XA 1SOMA 4B6GA 3P2MA 4U2GA 1W1IA 2PL5A 2JIDA 1KU6A 4QE3A 1ACJA 2JGMA 3B5EA 1CUJA 1VZ3A 4CI9A 1C7IA 1WB5A 2DQZA 1QGED 2X8BA 5AKHA 3G0IA 4HXEB 1XZFA 3Q0TA 1CUZA 2J3QA 5JAPA 1ZD4A 5AJHA 1E89A 4PW0A 1EVEA 3V1NA 3DDUA 3QPCA 2DHEA 1VJ5A 5HFNA 1UKCA 2XUDA 5ESRA 2PU5A 4C88A 1QIMA 1AUOA 1CUAA 2WUFA 1EDDA 4BCCA 4W1SA 3WI7A 1CLEA 4J0GA 2WU4A 2GBCA 4G4JA 1MAHA 1QIEA 3ZLTA 1WPXA 4QDOA 4KJXA 5LZ9A 3O4HA 4QLAA 3DKKA 1HQDA 3IURA 2WUEA 2QKYA 5CMLA 3H2GA 2HU7A 5AI9A 1KEZA 5AK4A 1HLGA 2PBLA 1LZLA 4J3JA 4BP9A 5T4FA 2WFLB 2XT0A 5EGNA 3O95A 4XJVA 4RGYA 3QMWA 4MYDA 3WYDA 3D3NA 3H2KA 2WJ3A 5E4TA 2XQIA 1WM1A 2O2IA 1LPSA 2XUKA 3C6ZA 3L1IA 3R0VA 1G42A 3IUMA 4ETWA 1MN6A 3S8YA 3F97A 4Y2JA 5K3FB 5KREA 4C4YA 1VOTA 3KWJA 4DM7A 4M0MA 2YYSA 3VKFA 3F67A 3M3DA 4EA6A 1L7QA 1E66A 1TCCA 5ALEA 1LPNA 4Y7DA 2JGEA 4NS4A 1EDEA 4HAIA 5AICA 4KE7A 5AM2A 4E15A 3H2JA 4X90A 3O4GA 3ILSA 1FFBA 2HA4A 5DYTA 3V1LA 3WWEA 3IUQA 1DTEA 3STXA 3FWHA 4YPVA 1UZAA 3H0CA 3VXKA 4RE5A 1UOOA 1MX9A 3DS8A 1BEEA 2OGTA 4X6UA 1LBSA 3H1BA 2VT6A 3LLCA 4W63A 4Q1VA 1EK1A 3FCXA 5AKGA 5HCUA 2OCKA 1QFSA 3VJMA 2G5PA 3X3HA 3IA2A 4G9EA 2D0DA 1XKTA 3QH4A 5HFAA 2WTNA 1CR6A 4OB6A 5EIAA 5ALHA 2W6CX 4ZGBA 2JGJA 3WKAA 1E8NA 4U2DA 1EVQA 4FNMA 4BE9A 1ZOIA 2HU8A 4OD0A 5D6OA 4QEKA 3TGLA 4EY5A 2PM8A 4X92A 5HKAA 4Y2YA 3FYTA 2AJBA 4M0EA 5LLSA 1UK7A 4B83A 1G5FA 2WFLA 4K2AA 2WFMA 2Y6UA 1ZI6A 3T4UA 1WB4A 4B85A 4BTVA 4F0JA 5JZSA 1LPPA 2OGZA 3FNBA 2ES4A 2WIFA 4DSAA 5AK5A 5JD5A 5AKIA 1P0MA 4H7FA 3FVRA 3W04A 2WHQA 3EBLA 5K3FA 3WIBA 5CBKA 3G9ZA 3FLEA 1A8UA 4XVCA 4F5ZA 1FFAA 1XZGA 1CUSA 5AKZA 1HDEA 4H7DA 3WMRA 1W6RA 4ZV9A 1Q83A 3KOOA 5DJ5A 2EEPA 3C5WP 1H2XA 2VF2A 4EHBA 4K6KA 2BAGA 4I19A 4GBGA 5JAUA 4EY7A 4UFOA 3AZPA 4DLNA 4DIUA 2C58A 4FFWA 1WCYA 4NVRA 2XMZA 4GW3A 5ALXA 3C87A 1HKHA 5DYWA 5A6VA 3W9BA 1DX6A 1JKMA 2PSFA 3GZJA 5JYCA 2HA3A 2XUQA 4UHFA 1L7AA 3ANSA 5JZ9A 5A2GA 4X85A 1MX5A 4Q3LA 1XZCA 2QRUA 4ROTA 2I3DA 1W52X 1EK2A 3KWFA 5FP0A 2Z8ZA 3FSGD 1R9MA 3RK4A 4IH1A 5DTJA 3KDAA 1XKLA 1T4MA 3RARA 3BIXA 4XIIA 2H7XA 3V9AA 2CEKA 4ZRDA 2BGRA 5AI5A 3WKDA 4BB0A 3OPMA 4LHEA 3FBWA 2QUBA 1TRHA 3WJ2A 4UBIA 2HU5A 2E3JA 2X5XA 3FSGA 4FNGA 4QZVA 5DYYA 4Y2XA 5JASA 3OTQA 5AKEA 3WK7A 4CCWA 1EA5A 3HJUA 5KBYA 3R3XA 1QIJA 5YASA 5IKXA 1VXRA 3UUFA 3ESDA 5AIBA 3O4IA 4K6GA 3F9CA 1RWQA 4Y2TA 2BFNA 4HXFB 2VJCA 1AX9A 5SYNA 1IMJA 4IH4A 4Q3OA 1JU3A 1HBJA 3CCBA 3IIIA 4AN1A 1XQYA 3O9VA 3D2AA 1LGYA 3STYA 4DMKA 4G4GA 1YA4A 1ZGBA 1H2WA 1XRQA 5D3ZA 3L1HA 4BE4A 3E1GA 2WUDA 5AI6A 3BE8A 1ACLA 5BOVA 1F8UA 2I3ZA 4KEAA 4MQLA 3BL8A 2C4HA 4OPMA 1CUVA 4ZWNA 3C8HA 1UXOA 4J0KA 1A8SA 1BE0A 1ISPA 3I2FA 1GQSA 3O4JA 2BKLA 3W9UA 5LKAA 1FSSA 1XLVA 4BAZA 1AGYA 1UKAA 4QWWA 5E2IA 3G8YA 2XUIA 4PSDA 1ZJ4A 3LP5A 4FHZA 4FFVA 5EFZA 2WHPB 3G02A 2AXEA 4UBJA 2AJDA 5DLPA 3ESBA 1YS2X 4AO8A 2G63A 3QITA 2XLBA 4UPDA 4FBLA 4QDXA 5LZ2A 4XX1A 1DWOA 1XQVA 4FWBA 3OC0A 4HRYA 4UBKA 4W9RA 2ZJ7A 2EDCA 1JI3A 1MAAA 1QONA 2XQKA 1X2EA 5LZ4A 2Y6VA 3R3YA 2G5TA 3WQHA 3NUZA 3CN9A 1O6GA 3EIOA 3AUKA 1FFCA 2ZYIA 3DNMA 3GBSA 3I1IA 4L3WA 4GDMA 3TRDA 5CW2A 4A5SA 1Z68A 4ARBA 3NOXA 4BCBA 4NMWA 3VVMA 5DNUA 4BC1A 3KD2A 1T2NA 2R11A 3HI4A 2B9VA 3PF9A 1AQLA 2XMBA 1AKNA 4G9GA 3O0DA 1DT5A 3HACA 2R8BA 1TCAA 2RIPA 2OAEA 3KXPA 2C7BA 1J2EA 2RAUA 3C6YA 4G8BA 2AJLI 4HXGA 4PSCA 1GXSA 4OYYA 2CUTA 3I2KA 1SCQA 5HF6A 1ZD5A 1SCKA 4JUIA 1YCDA 3F96A 4WDRA 1LLFA 5HF8A 4FTWA 4M0FA 3ZV7A 1F0PA 4FLFA 4J0DA 1XRLA 3LIIA 5KWIA 1EINA 2PUJA 2Y1KA 1SFRA 1OCEA 3WA7A 4TPKA 2C5FA 1UK8A 1GPLA 4Q05A 2GYUA 1XRMA 2WHPA 3STTA 5ISMA 4TGLA 3N2ZB 2WU3A 2ORYA 3R3WA 2QM0A 3B3QA 4Y2SA 5LZ8A 5FDFA 4BAUA 2PVSA 1L7RA 2DFPA 5ALKA 4C6HA 4X6XA 1UFOA 5ALJA 4X91A 2GBGA 1XFDA 1N5RA 3FOBA 3DYVA 5CH8A 5EHZA 2XE4A 4DNOA 5EHXA 2PSJA 3FVTA 4O08A 1EX9A 3VJKA 1DWPA 5ALWA 4N5IX 5K5EA 2ZJ6A 4FLMA 1XZIA 2WTMA 4LYEA 4TVKA 5FPQA 4B7ZA 5IH7A 3BDIA 4Z49A 1MT3A 2LIPA 1RP1A 1VA4A 2PSDA 2WG0A 4UHBA 4V2IA 2W22A 3H1AA 1CVLA 3WKEA 1G66A 1H2ZA 2BUCA 4BVKA 3HABA 3SWWA 5JIBA 5CT9A 1AMNA 4X94A 2JF0A 2CB9A 3E4DA 2VTVA 5ALMA 1UK9A 3EF3A 5IVKA 2FJPA 2C5GA 4Y2RA 3D5EA 4BRZA 4GI1A 2H1IA 2Z3WA 5AM3A 2HRQA 3TEJA 3WK6A 2C0PA 3ICVA 1XZEA 4WDQA 1VKHA 3QPDA 2X76A 3EQ8A 3UMJA 2Q0XA 1IUNA 5AH0A 1LNSA 3DQZA 5FPPA 1JJIA 5K3EA 1XZDA 3BDVA 1GKLA 1C7JA 2HFKA 1X2BA 2VATA 3DL7A 4JYPA 3STUA 1SC9A 1E8MA 4X97A 3FYUC 4BCDA 5AI4A 5ALPA 1DT3A 1VZ2A 3DOIA 3MUNA 4S0XA 1P0QA 4C01A 4GLBA 3DEAA 2XQGA 4AN0A 2YASA 1H23A 3HC7A 1F0NA 3YASA 4OU4A 5LP1A 2QMQA 2WKWA 4AX4A 5JAOA 5AM1A 1IZ8A 4WY8A 5AKKA 2XDWA 3C5VA 3AZQA 4J7AA 1R4ZA 2HHAA 4OB8A 5CTAA 4FLEA 4UHEA 2IX9A 1GPKA 1UOQA 3WWDA 5IVIA 5FRDA
chains in the Genus database with same CATH superfamily
4UFNA 1VLMA 2RONA 2JGNA 2VNIA 4C30A 3W4JA 1NQUA 3ZKWA 1U8XX 3WGQA 3P5BA 4N03A 2EFYA 1EFPB 1K08A 2DJIA 4EL0A 5ADHA 3EQ2A 4BNLA 2XEXA 1PNQA 2H1SA 5P8WA 3R75A 3UWKA 2V7EA 4DLKA 2RHDA 3QVLA 5AJTA 1B14A 2I2WA 1M2OB 2QLLA 4QGFA 2Q2WA 2WM8A 2XRFA 3FNFA 5F3RA 4CM9D 4MI9A 2C04A 2VJDA 5E4FA 1KMQA 3BXHA 1GPWB 1USWA 3PNBA 2ATCA 2XMQA 3QFRA 5F4BA 1KSHA 4DDKA 1YS4A 3SE0A 4Z4CA 5H0IA 3OTHA 2O0MA 4OP1A 1AU9A 3C41J 2Q62A 4HUQA 4IFEA 2CLOB 1CEXA 3EIQA 3IQZA 4HX9A 3MM4A 4FHGA 4DCVA 4PIPA 5A5FA 2NUTB 1JAYA 2EIXA 2ZJOA 1Z88A 3PNQA 3OQOA 3AO0B 4Z4EA 2QY6A 3WMXA 2HHLA 1QLJA 2H5JA 1XD2B 2BR5A 2GJSA 3ZE9A 4MV3A 5CAEB 2YW2A 5GADl 2DLDA 3HN6A 4BY9E 3BQMB 3PGLA 4KNWA 1E0JA 1V7ZA 5KDLA 1XB2A 3ES9A 2CZCA 2P77A 4WXPA 2I1QA 4JNCA 5DU2A 4J0CA 3TB6A 4ZN6A 5HQ3B 3MCVA 2IH5A 2NZ2A 3CE6A 1C3XA 4US0R 5JCJD 4EKIA 2YTZA 2W2NA 2G1JA 5JALA 1H85A 4LQCA 4PRYA 1DCTA 2FUKA 2HT1A 1DEXA 2YOFA 3LKBA 4C9BA 1NAIA 1VA5A 4O2BF 3LF2A 4MVJG 4C5BA 4TYYA 4YJ2B 4L1KA 1IOWA 5ER6A 2HNBA 4LJ6A 5EJ2A 4DUPA 4X24A 2PT5A 2IU4A 3JWEA 3LCCA 4P35A 2HJGA 1RVV1 5EWLA 1OWMA 5AJXA 4FFLA 4MLPA 4WUVA 3PNKA 1CCWA 2OAQ1 1SH7A 4UNSA 2OA0A 2IZOA 5KTYA 2CXOA 5KYXA 2P1RA 1FTSA 2YH2A 5DHUA 3OPXA 2O7SA 4A0GA 2P4EA 1ZHHA 2JLBA 3LK6A 4XWAA 4PFQA 2D1YA 2V3VA 3ZW8A 1G8FA 1U8CB 2WVGA 3EXEB 3UJHA 2Q2VA 2IBTA 5KOHA 2C96A 4PSKA 5HE8A 4L0DA 1KP2A 1YQ9A 1XXHB 2JLRA 3DYIA 3BCUA 1UWKA 4G0ZA 4EWLA 2BFDA 4XRRA 5KYWA 1DIOB 3DCYA 4KFUA 2ZIAA 4CF5A 1MVOA 3ND5A 1QGOA 1DZIA 2BW0A 1GAJA 2O2GA 4OQLA 4AP5A 1C9MA 4ASUD 1W0JD 3BHIA 4ZVSA 3T5GA 3ZDAA 1OZFA 1NMYA 4MMXB 1K6JA 3I6MA 3L04A 4C76A 3WYCA 1JB9A 1O6FA 4AY2A 3SQDA 3BCSA 4EI7A 4FN5A 1UBTS 1OAKA 4A23A 5FV4A 1U6IA 3VX4A 2XYRA 3DDNA 3FHJA 4ZYUA 621PA 4PQEA 2VNAA 4RWEA 1XEFA 1Y98A 2WD7B 4C6SA 3ZGLA 3HBJA 1QDUA 3PS9A 3DVLA 3ZQ6A 4OHKA 2ZS8A 3FLAA 3FLBA 2VXOA 3MT8A 3K72B 3OJ0A 4DNQA 4DA7A 3L0IB 4GPEA 2JH9A 4LS3A 2VHZA 3BH7A 3S29A 2CDRA 4J3FA 1Z7BA 3GLIB 4L95C 1CZNA 1E2NA 3NO4A 4DQKA 4LK3A 1T9CA 1BS2A 4FONA 1DEOA 1MB3A 3T3GA 3TOSA 4I66A 4Q4HA 2PYIA 4BNDB 4C7XA 2CMHA 2QYOA 1ZXBA 4H59A 2VOEA 2EQBA 4MV1A 4MYCA 4RABA 2C3YA 1X9GA 4XQ0A 1E79A 4NS1A 2FFBA 4JFAA 4ZRNA 1GPUA 1TPYA 3UJ9A 4B31A 5EUMA 1N9KA 2JGIA 2P68A 2YIDA 3DPIA 3IXLA 3M1YA 1OMOA 5ALNA 5TIIA 4ZTZB 4WKGA 1EGVB 4J2OA 1L5MA 4MK4A 3VTZA 5KX5A 3NBUA 5L53A 2LE0A 5KJCA 1XU7A 5I47A 1I7DA 2JW5A 4JVSB 1ST3A 4IGAA 4Q1EA 4RSHA 3BAZA 3JWIA 3NATA 4R0MA 3WLTA 1PFWA 2Y68A 4MCJA 2B92A 5D87A 3NT2A 2WOOA 1YVPA 3AQIA 3F5QA 3IBCA 1M2NA 3ZCUA 4E11A 3ZCQA 1R64A 4J43A 4PLVA 4ZCRA 3SZOA 3UMCA 4PQFA 3E4CA 3H2IA 2BCJQ 1C1XA 1M67A 2AOVA 2PV0A 4PZEA 1CZHA 1LDMA 1ZIXA 3AR7A 3HR8A 3THRA 1XLUA 4R8RA 6REQA 1T1JA 2ABWA 3DR3A 2C7VA 3FSRA 3QZUA 3PHGA 4QBFA 3RJZA 4CMIA 4EKYA 1S9HA 5BUSA 1BVYF 2GR9A 4QKQA 3JD2A 3QMVA 4WMLA 5IDQA 3KUXA 3A6HA 3BKWA 3LIPA 1GA4A 1RLJA 1X1BA 2NGRA 4HQNA 4IV0A 1N2CB 3AM4A 4GWLA 4KN6A 3RAEC 4FDVA 2P5SA 3W1WA 1EK6A 2B8NA 1E6CA 3MUFA 3TVDA 3ZCTA 1YVRA 3NAGA 3PJGA 4QODA 5COBA 4CTJA 3LVQE 3SVTA 3HZHA 1Q0RA 2AEFA 2J85A 3HVIA 3TNFA 4IZ6A 4I3HA 4ENWA 3VSCA 5A4IS 1WHTA 1E3WB 2P9GA 3B13B 3INGA 1OR8A 1A9YA 4GVLA 3AKDA 4DIFA 1RJGA 3I9KA 5JTTA 4HWOA 4E14A 3H04A 4RTNA 5L51A 3USCS 1NMXA 1QE3A 2XMSA 5H70A 3DE2X 3LRPA 3QEKA 4NYIR 1KF0A 3E0XA 1EDBA 4Y30A 3WRYA 2OV6A 3L4BA 2CK3D 4F6CA 1NN3A 1CJKC 1NHWA 3DP7A 3PFWO 1HNNA 3TVYA 4P2BA 2XNSA 3W9YA 4J6EA 3S99A 2IZ7A 4TKUB 4BKRA 2DT5A 3BSYA 2IJGX 1VKRA 1U8FO 3GEIA 3V48A 1R3DA 4CNBA 4D4IA 1V6SA 1W73A 4MV9A 5KDDA 4EQ6B 1UINA 2GKGA 3CRVA 5FHRA 3BHMA 1JG1A 1XD9A 4OUKX 4LZPA 1PYOA 3WB0A 5TPZD 2FWNA 2JAUA 3AV3A 3PZBA 3M6UA 4ZAGA 5G0WA 4HSEA 5HA5A 5EP4A 4DANA 1Z4IA 5CM2Z 5EHQA 4HVTA 1AK1A 1KGDA 3AW8A 3MJDA 3NM6B 4LOJA 3TH5A 3VO2A 2OECA 3K31A 4L4SA 1HT1E 3H2ZA 2HNAA 4JQOA 4YP9A 4HS9A 4MUIA 1BXRA 3VV2A 3IHWA 3RYCA 3O8QB 4E03A 4H77A 1ZD3A 2FSPA 1PZNA 4C0JA 8GPBA 2RSLA 4LN1A 5COAA 3DZHA 4QTTB 2QQ0A 3CW9A 3EXHC 4JBYA 1YKGA 3ENZA 4WZBA 5KAPA 3TZ6A 4F60A 1RYYA 3CISA 2OZLB 3GHHA 2V0NA 3NDPA 1HRKA 1FBNA 1PFYA 3Q6MA 4W5RA 3QLTA 4W99A 1DG1G 4YHHB 3TLGA 1PZFA 2FW1A 3TCNA 1KJQA 3GELA 3H83A 3W4KA 3WBFA 1U80A 3NYWA 3SQXA 2XTAA 1FVOA 1S8FA 2QOEA 3GRFA 2H1WA 4ZOEA 4DQXA 4EG4A 4OJKA 3NUGA 2OZEA 1MOZA 2XTZA 3IOEA 4NV3A 4XAQA 3SP1A 2DC1A 2XW6A 3O6VA 4N9WA 2C2KA 3KKQA 1FNNA 2MR5A 3R24A 4H7PA 4CNQA 1O96B 3L7DA 4JC4A 4DNPA 3JRWA 5JQWA 3WGYA 2HZ7A 2J5XA 4PNZA 1KGSA 1MC1A 2PKWA 4XXHA 5EXEA 1PJZA 1ZL2A 2Y8EA 3DAHA 2JGDA 3ASUA 3GFPA 2WJIA 3IHKA 3UTDA 1A2BA 3T5PA 3G9TA 2ZU0C 5CW1A 4V3CA 5KQSA 3I0NA 2NU9A 4JLWA 2VSFA 1OAOC 1SUBA 2I7DA 2WSSA 3NDIA 4I5DA 5CBPB 3NIWA 3NTQA 4HB3A 1TLLA 3SC2B 3PBKA 2QX4A 4ZI7B 3CQ9A 5CITA 5H4GA 2CJWA 2H1VA 4FX5A 1UKZA 1IATA 3U44B 5DO9A 1TT5B 3T0IA 3EYAA 3HZRA 2WEKA 2IPMA 4ARIA 1JZTA 1KEEA 5HUJA 5FLXA 4M9CA 2K5UA 2G82A 4BL5A 4CEHA 2P3QA 2ISSD 1JR6A 4OY3A 3OX4A 1J9EA 1XA3A 5KX5F 2J9FB 1SKAA 3ZE1B 1K7XB 2W9XA 4CLOA 4UC0A 4WKBA 3PHHA 5KYGA 3D8SA 1II8A 3QI2A 5ITZB 3UTCA 2G7ZA 1SCUA 2PUVA 1YJCA 4DKJA 3Q9SA 2KBFA 1ZQ1A 1W0CA 4WACA 4C0SA 2NG1A 3OVMA 5ER9A 2QPLA 4C3OB 1TTTA 3OIFA 1JIJA 1VSTA 1WEKA 1GAQA 3P52A 1QE5A 4PPNA 4V0NA 4WD3A 5GP1A 3HN7A 3H8JA 4J0FA 4YAWA 3VVLA 3BC1A 3IP1A 4QHTA 4TS9A 1T2EA 3KTFA 5HM8A 4QU9A 5D2CA 4JB2A 5HF9A 3EEYA 2FX5A 3DBRA 4XSVA 3VZRA 1KEKA 3E3NA 4G8DA 3HP1A 4D6YA 1LDGA 3VO8A 1J5PA 3GJTA 2FPXA 1KO1A 4FGZA 4GYKA 2PT7A 1ABEA 1XKXA 1XNQB 2YKGA 2BFBA 5FTKA 2A5YB 2NUPB 1Y34E 2P35A 4EG5A 3ADBA 4DA9A 3JW8A 4RD1A 5BV7A 4KWCA 1EFUA 3RTCA 1JBEA 1I7LA 2REOA 1X8KA 1M6VA 3PWTA 4ZCIA 3PTAA 3WO1A 2VKTA 2XVXA 4NTZA 3QX8A 4C89A 4INPA 1PQUA 5ALLA 4WEOA 5CR9A 3KZNA 3ZU3A 4DCGA 4FHFA 2C94A 4GOND 1MFPA 1XLWA 1M5UA 3C5CA 3ND8A 2D1RA 3R40A 1JMYA 5FNVF 5T64A 3FHTA 1TQDA 2XDAA 3GGPA 4CM4A 3OKCA 5DI3B 4B9EA 5AVWA 2XZDA 3FCYA 4N40A 5I4IA 1RXWA 3RV4A 1W25A 4AXBA 3A9UA 3Q2KA 4GMDA 4QXOA 3CXRA 1J33A 3UJ6A 4OQXA 3M83A 5E9WA 2NXNA 2PKXA 5JR3A 4XWGA 4ZVVA 1F2UB 1RNLA 2PUHA 3G9UA 2QT9A 2YJ4A 3EA4A 3ZIUA 1A8IA 2E4AA 1UKYA 2GZDA 3BMOB 1FYEA 1AKTA 1SVNA 4FYMA 1N7JA 2VFAA 1V5FA 5CIYA 4IIEA 3BK2A 2RGCA 1U7PA 1SUIA 1DC4A 3IDOA 4M9UA 4LK2A 2II6A 2OUIA 2YX1A 4TKZA 5DW3A 3RS0A 2AG6A 3E3AA 2X0FA 3DOEA 1YZYA 4MWGA 2HA2A 2KX7A 3HRHA 3N86A 4KRFA 3WV4A 1W6UA 2ZTUA 3JYNA 4MQ5A 4LXIA 5J4KA 4GX0A 4RL4A 4UTOA 1HDZA 1TNDA 1F1JA 4KRYA 4MP3A 4UXHA 3K0SA 2ZRAA 4K28A 1CUXA 1OSNA 2FJ0A 4P4SB 2HA7A 3NBYC 1GGVA 4QYMA 3A25A 1KRWA 5IAJA 4Z7OB 4NOKA 1IJEA 1YFJA 1QTQA 2IW1A 2R4UA 5EINA 3KT0A 1JFFA 2X0IA 3TTSA 3E8XA 4MWOA 3W7BA 1JL3A 3C14C 5MGNA 2H51A 1SBCA 4TTJA 3UKJA 3INNA 3WRWA 1TMKA 3EAQA 1R50A 1L8XA 5I7RA 1H93A 1CQZA 3CX6A 2I1VB 4FGJA 4QRIA 1RWOA 2BUAA 3LC0A 3WAGA 2Y4NA 2ZE8A 4PPQA 2QNIA 1P3Y1 1Q0SA 2G5GX 3I1YA 5TMEA 3VNSA 1RKBA 2F59A 1SMKA 5H59A 5B4TA 5CLJA 1HUQA 1JHVA 1P7VA 2GD1O 3CW8X 4A6PA 4CMCA 4P92A 1BFUA 1LV8A 4K6OA 1TUGA 4QARA 1RXIA 3ZS9A 1YFLA 2W6MA 1G4AE 5FOTA 4ZV7A 1AJEA 1ZNZA 3MRSA 2V98A 1YSCA 2EAUA 2Q1XA 3EIUA 2DUJA 2G80A 5JS7A 1ZK1A 2AF3C 3EYWA 1BEZA 3AK4A 2W2MA 3VAZA 4OXIA 4ZXFA 4KIJA 1I7NA 1A9TA 1W76A 1R6TA 5GQSA 3DO5A 4HAYA 5E6SA 1FFDA 1OBOA 3DEHA 4OJQA 3OOSA 4RPLA 2JAOA 3OT5A 5DFAA 5JYDA 1G2QA 1NJGA 4JLKA 4OSPA 1U81A 4H7IA 1ZHFA 2O2JA 1BDMA 2B69A 3I6YA 3H9GA 3KHSA 4OUDA 1XRRA 5KOYA 1QH1A 4RJJA 2COKA 3TZEA 4JP1A 4JIGA 3ZEIA 3AHGA 3FR7A 4HI0E 3NLLA 1W35A 1P1FA 4HBGA 4XCVA 1DCKA 2OHXA 3L8HA 2R79A 3QJYA 5GONF 5TQ0A 3NOQA 1UEIA 4D9IA 2JLUA 4TZTA 2C95A 5JI2E 3L6BA 1E5QA 1RI4A 2VXYA 1A9RA 5AJWA 4NAUA 2PZ8A 4DLAA 4AS2A 3EQ9A 5EJ5A 4MWTA 4UTXA 3S28A 1HT3A 1ZMTA 4V0ME 1I0ZA 2WT4A 3JQ7A 4JZKA 4WOKA 3DKPA 1SXIA 2V97A 3EG9A 2WG1A 2ZLBA 5KNBD 2NO6A 4BRSA 4L74A 3RS2A 4AUKA 1NQVA 2J9RA 4Y6RA 2JEOA 1TTQB 3KAJA 4KQMA 3ONNA 5I9IA 4KTTE 5EIWA 5L6MB 3GVXA 1RRKA 3QVMA 3WGOA 1N2GA 5EHNA 4B6EA 4P38A 4FFNA 3ND6A 5DRTA 4I8XA 3FGZA 2GZ3A 4HPWA 1XRNA 4DEXA 5EFOA 2FXIA 4NG5A 1M5RA 3GN2A 4IV5A 3AVQA 3BA1A 2DMRA 5DBOA 1G5QA 2ZWOA 5A02A 1LI4A 1KH2A 5JXIA 4ETMA 5CVUA 4A92A 4BAGA 2HIHA 5T3YA 1DKMA 1XJ5A 3HVRA 1DRWA 3K15A 1QCCA 2AZMA 1I5OA 3BSSA 3DBLB 4RVOA 3W5HA 3WFJA 5BN4B 3HVUA 1RAGA 2R0QC 1V11B 3G59A 1DAFA 3CCCA 2C57A 3I34X 4BGUA 1ZI9A 1SHTX 3QF4A 4DLBA 1QVZA 2IQ5A 3QBJA 2F1JA 4OJYA 1JXOA 2IYXA 1XRPA 3DE4X 3DL0A 4GI7A 1SWWA 4IIXA 2QZ9A 2UZ3A 5AP9A 1T8UA 4TLMB 1G64A 2GFHA 1NZDA 1RQPA 2GS9A 3CNOA 4Q4JB 1YHZA 1R6BX 1GLNA 5KVAA 1O97C 2DFKB 4TLLB 3ZI7A 4Z8XA 2XCIA 5FLEX 1YZHA 3EXHA 5IDXA 2FGJA 1Z5NA 2BHLA 2QTVB 2AJTA 4XWKA 4GKKB 1C41A 2IUEA 3GMSA 3NCTA 2J7PA 2WA1A 4LYHA 3P2KA 2JBAA 1EP9A 2Z6VA 3B6JA 3IAS1 3KT6A 3H5OA 3OJEA 3NNDA 3LQFA 1K3FA 4NYMQ 5DNVA 3UVEA 1BRMA 5JJKA 4JYZA 4KNYA 2VRBA 4DXHA 2W6JD 3B51X 1Y4SA 1E3SA 4RKRA 2ZVJA 1WPGA 1GYRA 2P1DA 2VNKA 3CLRD 5AW2A 3KCQA 1LPAB 4WLVA 4PZDA 3KYIB 4ENRA 1LBQA 3O03A 2QD4A 4Y2PA 5ALZA 1XSEA 2XQJA 1Z4NA 3NORA 3V8MA 2WP0A 2SHKA 1U2GA 4L0QA 1FLAA 3TQQA 1L5HA 5CVJA 4DIEA 5IKMA 4A8JB 3CRW1 2G72A 3EGEA 4AC9A 2IGTA 1VCHA 4Q5IA 1DKQA 1TQHA 3HCNA 3I4CA 3PPIA 1ZK0A 3L6EA 4J0QA 1FL9A 4G65A 3GJ4A 3OJWA 5C8DA 1KYIA 2O3QA 3WYEA 1OAOA 1SK9A 1QO7A 3T4EA 4RDXA 1E2BA 4DA0A 1J09A 4K8OA 3E5RA 1EZ1A 3SJBA 3LUPA 3DR5A 2FKAA 4PTYA 4KPEC 2ZE7A 2BMWA 3SVLA 1NVAA 4C7OA 2R66A 2ZYWX 4WGFA 5IAGA 1XX6A 3AIOA 4PSAA 1OZHA 4RJKA 2DPGA 1F2TA 2J9YB 4B5LA 4ZK2A 4EEZA 2IIQA 2IYZA 4QXMA 4G5SA 4LJ4A 5J2TA 1UDXA 1K9SA 2GDZA 1Z2OX 4QJ3A 4AKGA 3K8YA 2J5RA 1G6HA 1HXHA 3V4FA 1M76A 2FPWA 2NO1A 1PF7E 2RH5A 5EG5A 3DG9A 1JHZA 3D6HA 3BMNA 1MRZA 1EB8A 2EZ4A 4IHAA 2CW5A 5BQ3A 1JJAA 2C92A 3NONA 4BO4A 5IU6A 3ER8A 3FOFC 5KOJA 1Z6PA 4C4XA 2VL7A 2EJWA 2WNHA 5D7BA 4YRKA 1MJ5A 3M6XA 1EUZA 1JG4A 2CVOA 1CQJA 2Y1OA 3A6ZA 3HWWA 3EVFA 4OAQA 3AEQA 4OJNA 5G0TA 1JAXA 3BKXA 3PTLA 3HR4A 1BO6A 2QG9A 5CU7A 1KTIA 4LQDA 3R0XA 1XF1A 1YHNA 2F3UA 1OU4A 1IHOA 2DHCA 1E3DA 3B12A 4P53A 3K0KA 4F5WA 5CURA 2N1MA 1ADJA 1BJRE 3GLHE 2VUSA 4C14A 1YRAA 4YWJA 4Y1RB 5M29A 1VFPA 3TL3A 1TLTA 3DPUA 2PWAA 2D62A 1GZ4A 3AUXA 3PDCA 5B4VA 5IC6A 1IU9A 3OO0A 3L07A 1CZLA 4FUQA 3K2QA 4KITB 4BYGA 1WXGA 2DWUA 2KS6A 2ZOSA 3JQBC 4H27A 1NF8A 1QHSA 1E60A 3MS4A 4TV8A 5K99A 1P6XA 3SEFA 4V1CI 1UPFA 4D3DA 3T38A 1UDWA 2X5OA 3VNQA 5KTRA 2Q6OA 3DEFA 4H7KA 1M73E 3PHIA 2XMRA 1P39A 1NP3A 1A77A 2RGYA 3U1TA 2QORA 3PWZA 1LLDA 1WUIS 2XE7A 5FI3A 3NGXA 5AK3A 3OY7A 3JASA 5KQMA 1TAQA 4DR6B 2D5BA 2AR0A 2CXHA 4JI6B 4X71A 4YUXA 3VSDA 4RXTA 1K6EA 1N5MA 5THXA 4D2IA 1QIGA 2GM3A 2F64A 2A9RA 3OU6A 1K6MA 1W4LA 4FOPA 4ILEA 3JQ6A 3HXKA 4UBNA 3ROFA 5C5EA 3PI6A 3WLHA 1ENZA 5FULA 4URXR 1D4ZA 3TR0A 2DQYA 4I3FA 2P5YA 3GMIA 1K97A 1OILA 2P4QA 4L6CA 3FPFA 3QXGA 3RVLA 3ZWQA 1KY3A 4D4HA 2E55A 1MB9A 1L3CA 1JDPA 3HPQA 5IM5A 4FT2A 5B55A 1E5VA 3JQGB 2H2AA 2GM4A 4UCFA 2FRVA 3FFTA 1YOVB 2COEA 4UVDA 2W98A 4AF7A 1YF3A 2NU6B 4FFRA 1GGMA 2EJTA 2PCLA 1NRIA 5LXTF 1I9GA 3OHSX 1MX1A 3Q0IA 1Q5PA 3C8UA 1LDYA 1JEQB 2HD4A 1RYMA 1SUSA 4PYRA 4NBLA 4EVSA 2ACKA 4ZTUB 4N3CA 4NYIQ 4EUEA 3L0CA 5HJ2A 1ISMA 5EIFA 4IUCS 4YCBA 4IHJB 1ZW1A 2JI9A 3BH0A 5DKFA 2JLSA 3CBQA 1BCSB 5I48A 1O9HA 3L9XA 1W46A 2JI6A 4LVOA 2D0OB 3PFCA 3FWKA 4RHXA 4UAVA 4X60A 1TU3A 4CHTA 4EGSA 4YUYA 1IJFA 4GDFA 4HATA 3GVHA 3VU0A 2Q27A 1IJKA 1OXTA 5LDDC 2K7FA 4B40A 4MB6A 3DKRA 2CHFA 3OY2A 4FR2A 3H5VA 4A0SA 1TVKB 1JEEA 1CT9A 1NZFA 2C3PA 5IYZB 1XTKA 4P4TA 5A9RA 1B6GA 2MINA 2IY9A 3LT1A 2G77B 2ZRKA 5FWXA 1JX6A 1GWNA 4R1LA 1SCDA 1VL1A 2MTBA 4XWYA 2ET6A 2YWRA 5E7IA 3I9V6 2IYNA 3EW9A 4AX8A 5A3JA 2VP2A 2WWGA 3SR4A 4F4HA 3I09A 4X20B 4P9NA 5J9FA 1A3CA 3G0GA 2FN7A 1LK0A 4QAJA 1B1CA 2P6UA 4PGFA 2NSJA 2GDJA 3LFTA 3PC3A 1N5LA 3WYGA 3GEGA 2OO3A 4IVNA 3SI7A 1GCIA 5JWOA 1LFAA 3C45A 3DOCA 2DWCA 1T4CA 2HSEA 2B8WA 3LH5A 1L4UA 3IR5A 3NAZA 3QYAA 4Y9RA 1TO1E 4HWSA 4CV1A 1AHNA 3VU8A 5ALFA 4XQGA 3RBAA 3FSJX 5FTLA 2O8FB 1F6WA 5J2TF 1QO9A 3T1OA 5L7WA 1XEAA 1IXYA 1NW7A 3PQ7A 4O5AA 4C29A 3QENA 3QEBZ 1QNFA 1MDFA 2AC7A 2FLKA 1CIVA 3Q7RA 5FUYA 1TTHA 2CNBA 4PG4A 4QM6A 1W59A 1ZCZA 2CCKA 3L3BA 3IAS6 2J6CA 3UW1A 1PTJA 3ZWKA 3T61A 3Q7TA 4L5AA 2RGRA 4JJKA 2ONYA 3RC8A 1V1RB 3HY3A 5EMMA 2CHEA 3COPA 4IMPA 2RHRA 4U7TB 3CR7A 3KSBC 2DQ4A 2AI3A 1K8QA 4H6WA 3UCEA 4CIAA 3ZLUA 3PYXA 3EXG2 3A9CA 4UMFA 4AZ0A 3RUAA 3T99A 1CFJA 1YIOA 3HYRA 4QLOA 5B37A 1WY5A 1UWVA 3UWOA 1V16A 3HL0A 3WJ1A 4A0RA 4CKCA 4F06A 4IDEA 4EYOA 3A26A 1E98A 3I5MA 2EBHX 3JQAD 3R41A 4W5NA 4D57A 3KB6A 2Q9AA 4FDTA 1UMKA 1T9HA 2MWMA 2YZ7A 3LXXA 3SFTA 2NUAA 4WBNB 3GLQA 3CUEF 2VPWA 2FVXA 1S2IA 2Y27A 3DUFA 2A5FA 4GGOA 2IOYA 4M0PA 4PXAA 3BWXA 4UVIA 2VDUE 5EKUA 3AT1A 1VPLA 2GWRA 2R6GA 3RRYA 3W2EA 4AD8A 1Q7RA 1Q6ZA 2W37A 1U5BA 1XI2A 4TV8F 2VJNA 3DHYA 1OH6A 5EY5B 2AOTA 4MI6A 4LQLA 4MS3A 2GZRA 3AJDA 2AN1A 1X0VA 3W8DA 5IBCA 5JAMA 4L5IA 3GPLA 2CWWA 1XHLA 2ANBA 2GTPA 3EWNA 3MUOA 4J8PA 3TLBA 5HHTA 1NJ2A 2A59A 2WNIA 5FOVA 4CE6A 1KYQA 2WIGA 1D07A 3NASA 1EJBA 4QPZA 3UFXB 4MNTA 4ALIA 2WAOA 3IE0A 5DP2A 3TXAA 4AJJA 3CB2A 4E5MA 1USUA 3ESZA 2ZYDA 4BX8A 1J2YA 3I9LA 5K2OA 1N6RA 4HC4A 4Q9KA 4YONB 4JODA 2EFCB 4XWOA 3VYTB 1GT6A 3LXRA 2CVPA 3PD1A 1LD3A 2PT9A 5EIEA 5KZMB 3QWHA 3VA7A 4HN2A 4PAOA 3H2HA 3DOFA 4WECA 5KYVA 3ZJYA 3UGTA 1AQUA 5EXPA 2X1HA 3K9NA 5JADA 5TQJA 4J0HA 1CETA 1V3UA 1N78A 1NBHA 1SG0A 3X1WA 3FFXA 3QQPA 4H18A 3VFDA 3OZUA 1ZMRA 3TCXB 2WLSA 3BGIA 3M81A 5ALUA 1WBBA 4RIEA 1NMEA 3CLSC 2AG1A 3D43A 2QU7A 3FHOA 1CR1A 4BMNA 1E6LA 3Q3JB 4NR0A 2QYTA 2W71A 4L8GA 1E2JA 4G5OA 1UOEA 1V96A 1L6RA 4GX2A 5BVGB 3OFKA 4RNDB 5DSTA 5KVQA 3TKYA 5EJMA 1CUEA 4J1NA 2ZCJA 3KXDA 3GUHA 2GK4A 1CUIA 4DQUA 4QXAA 1TD9A 1E2HA 3MA0A 3BA6A 1JEOA 1X7GA 1ECFA 2OWEA 3HG7A 3DAOA 4ALJA 5TGTA 2V1UA 2WYUA 4OKSA 2BJHA 4GXNA 1NYRA 3UBTA 3FETA 4DMHA 1VI2A 1AURA 3JX9A 2O2HA 3EQ7A 5KHLB 2ZB3A 4BTLA 4ZPXA 2HJWA 5JATA 1RYFA 3BRWA 1IXRC 1J6UA 2IOHA 2ADFA 2PWPA 2ONCA 3LSYA 4H1UA 4MR9A 2P2ZA 4RYDA 2EX0A 5FIUA 3S7ZA 4MGEA 4C87A 1OC2A 3K70B 2F8TA 3AERB 2YJGA 4CT0A 4CBVA 4RE6A 1JKIA 4ZP1A 5G2OA 4BVBA 1MG5A 5EMKA 4BNVA 2W93A 4JLMA 2J0VA 5BVHA 3GJZA 2Q5EA 1KDPA 2ECKA 1ZGJA 4YMHA 4KR0A 1TZ2A 2ZSBA 1XCOA 2X0JA 4OQZA 1XXHA 1DPFA 2ZAOA 5FOQA 2BKXA 2CT8A 4EHIA 3I3OA 4GBJA 3TZKA 5DTIA 4D26A 2W6OA 3QV1A 2DPYA 3HKCA 4KQKA 4XM1A 4A2WA 4UTRA 3TRFA 4X64B 4Q1AA 5LDHA 4BNTA 2QV0A 3SBEA 2FPOA 1XPJA 4S2UA 1D2HA 3OPYB 4KWIA 3TZHA 1HFWA 5IZCC 5KTMA 2NO5A 1P9RA 1EX7A 1CZOA 3ZYZA 4E5YA 2FUG1 2AZTA 4MWSA 3E70C 4TTIA 3PA6A 3U7QA 3W0LB 2FE1A 4F1KA 4DNFA 4AY6A 3QVSA 1B6SA 3G2KA 1AKUA 2QAGB 3HEAA 2IUTA 3RS4A 4HDSA 3SNKA 2ZR8A 2J5QA 4LXHA 4D79A 3TZQA 3PQ3A 4RPHA 3RVBA 4IVPA 1YDWA 3AESB 5REQA 2ZJZA 3JQBA 3Q4GA 3OCUA 4XD2A 1GG2A 1LSJA 2BGIA 1QTRA 3OMXA 1NLFA 1YO6A 3CVVA 4NV0A 4NWIA 1G21B 1DB3A 3RHSA 2R00C 1K88A 1D0VA 4HAWA 1HL3A 1EWKA 4IS2A 2DTEA 4XPZA 5I3CA 2FPPB 3VPHA 2QS9A 4WN9A 5LFAA 2W2KB 1AS2A 1J8YF 3G89A 3LBHA 4QJIA 5FKJA 2C88A 5DM1A 3I64A 4H1VA 3K20A 5DMHA 5FB3A 2QQEA 1GZVA 1K0FA 3SYRA 4B35A 3IVAA 5JH7A 2F9MA 3QEJA 4MKIA 4EUFA 1T1SA 3X43A 5BOSB 3SNHA 1UR5A 2GFQA 1F6BA 5JARA 4XYLA 4BVAA 4C0QC 4M8IA 3UV6A 4L8VA 1ADCA 3NGMA 4IUDS 2YYZA 3H86A 4YLEA 3UT6A 3LY8A 1Z8NA 2IPLA 3USZA 3MWJA 3EGDA 3I2IA 3HJCA 1G21E 2AH5A 2RC6A 5K6TA 2QN9A 3N2GA 1T5IA 1GLGA 1YZKA 2IPNA 2X7XA 3WJAA 1YRWA 2V58A 2XNKA 4GOOD 5C9ZA 5KNCA 1AMOA 1XJCA 3E5NA 1QGDA 4JL6A 3IQDB 5BR1A 5GZ1A 1ZVQA 4OYLA 2BV3A 2PSSA 3OICA 1W75A 2YHUA 2VHXA 3WL6A 3M6WA 4WCVA 4MROA 1RQLA 1HQCA 3NT5A 4S0ZA 5F1YA 3IPYA 2J9GA 4EZBA 1L0BA 2VJBA 3NU1A 1D2RA 1WDKA 4OIFA 1G6Q1 4NSNA 3EDOA 4U0JA 2B61A 3O5AA 1F5SA 3H6KA 1MDBA 2JCXA 4FZJA 4P5DA 3WAKA 1NXOA 2NV6A 4D3YA 1QB7A 2GHTA 2H7VA 4PYOA 1N2CA 3OE7A 2ZBDA 4YRRA 1N2BA 1DKRA 1H66A 3EGCA 2AXNA 4PLHA 2QE6A 4Y9SA 5JV5A 2CJFA 4JKOA 4MP6A 3OQIA 3TLYA 2FNAA 5HS4A 1MO2A 1TPZA 3PUIA 3FRHA 4JUAA 3PE3A 4ZOLB 3WZLA 2NX2A 5CLGA 2BHNA 1U4NA 5CDFA 3D1VA 2G09A 2MOKA 1E4OA 2GBLA 1N1DA 3OUZA 2LP4Y 1UWLA 4QDTA 3AF6A 2E82A 1E3WA 1H0KA 4QDKA 4MLZA 5JJBA 1T15A 4XCQA 1DFIA 3CUKA 4RH3A 5AM4A 2H2FA 1VHTA 5IZ4A 3R4CA 4YJ3A 1U5AA 3PQFA 2FE4A 4H31A 4KI0A 4P54A 3D1LA 1MGPA 2XUPA 1B0UA 4G1VA 3IL2A 3I4FA 4MRMB 4HWTA 4MV0A 2WA2A 5DTMA 2BGWA 2Z3VA 2NWQA 5IBRA 4EJ6A 2QM7A 2R6FA 1VE6A 4LDPA 1CWUA 2I99A 3TQTA 2DR3A 3IJRA 4N8SA 5ESDA 3CWCA 5JPDA 2HF7A 3EK2A 1EE9A 3OPVA 3MIIA 3TD6A 5LXTB 4JUFA 1A1VA 3JQEA 3KQYA 4WOCA 1EFTA 5EKSA 2IEAA 2B6NA 4LZNA 3RR2A 4RMGA 3B1ZA 1QSGA 2JB9A 4N54A 2BF7A 2IWHA 4IXNA 3WMEA 4JYAB 3FCSB 2XYPA 3DYBA 1EJ0A 3CUYA 3HJGA 4Q9JA 1U2QA 2BONA 3EVCA 4ARAA 1Y5RA 1YH3A 3OLYA 2CLKB 2CLSA 3LBFA 2JFZA 5IKPA 2ADMA 3FPLA 3OJXA 2JS7A 2HLNA 3KR2A 3IB6A 5TGDA 2I34A 4MPDA 6PFKA 4JR0A 3G7NA 5TGZA 4DLSA 4MOWA 4DSZA 5HF5A 2ZSEA 1KIAA 3PFIA 4BKQA 3K5WA 2XKAA 1Z73A 3AFHA 4GZ6A 4LDZA 5BUZA 4X66B 3ITEA 2I54A 1MP0A 3RADC 1EFCA 5KSOA 4LHWA 4GI2A 3TJZA 1CV2A 4R7ZA 1K7FB 1QZ3A 4F4UA 1JU4A 2PUWA 1R88A 3BEDA 5DCWA 1NWCA 4DJDC 10MHA 1A8HA 5EJFA 1KHHA 1G7RA 1KIMA 1WDMA 5DX0A 5DZSA 3ADOA 1E69A 2WD8A 2Y2VA 2XB6A 1SN7A 3AKYA 3C3DA 4QA9A 3AUYA 5SZKB 3UT5B 5FBVB 4AYWA 5A5EA 5I7HA 2Q3CA 1Y3BE 2PRIA 1DEAA 1HFJA 1ZN7A 4KPUA 5E95A 4ZVMA 2WWVD 5TQ2A 2AS0A 1DUSA 7REQA 1WSBA 4KSCA 2VQ3A 4PZLA 5BNWA 3G7SA 2V6BA 1UBGA 3VH3A 2SECE 2B94A 1N7GA 2IE0A 3DE3X 3CS3A 2VYND 3MJEA 1R0BA 1SM4A 2AUNA 1U02A 2X8WA 3L7MA 5K09A 1AKRA 1TEHA 2VDWA 4ONEA 3KO8A 4RFLA 3QKUA 2QJTA 3L7BA 1EIWA 1U0OC 1JR3D 1ZOPA 3IEKA 3ZGVA 1QX3A 1RM3A 2BUBA 5CBPA 3E1SA 1N0VC 4EW3A 2LCIA 4I1RA 1ATIA 3H18A 4JI1B 3QWBA 5EJEA 4BS9A 4QYIB 3AB8A 2Z9DA 1BWQA 2ZI5A 2HC9A 4E5NA 4WXMA 1ENPA 2JARA 3AFNA 3CEAA 1ACMA 1VSQA 2H1RA 4Q18A 3DNFA 2GILA 2PGJA 3DBIA 4GP6A 5AUQA 3S2GA 5HP4A 5JFGA 1C9KA 1ZMOA 3NMUF 1E2DA 2CYCA 3WFZA 2UYHA 3M4JA 2VNSA 4GRAA 1JHYA 3E81A 1WB5A 3C3MA 1OI7A 1QGED 2NNLD 2X8BA 3O1LA 4OGFA 2QTZA 5AVRA 1C14A 3G0IA 4G9BA 2JCVA 2C97A 5DGHA 1J39A 4XW2A 1UXGA 3BFPA 5AJHA 4PW0A 1EVEA 4B3DA 1UZLA 1ZH2A 3RVKA 4MLCA 3OZSA 1ZAYA 1B7GO 5JC1A 4G1CA 4GVXA 2DHEA 1AM4D 1SQ5A 5A5VA 3ZDCA 3BIJA 4Y1EA 5HFNA 2XUDA 3EHDA 1WCIB 3G88A 1YQUA 1SG6A 2PU5A 3B9BA 4G3XA 3THSA 2CN1A 4PFSA 2WUFA 1ADYA 1F2VA 4QFBA 4WA7A 1SO8A 2EU8A 2YDYA 4X8HA 3S1SA 5IT0A 2QMEA 1WSDA 3K8QA 1R74A 5K0LA 3ZE7A 3IIJA 2QLBA 1P33A 3G2NA 4MQ6A 5L45A 5IX8A 4BCCA 1KY4A 2JFYA 2W2VA 3K35A 3UKDA 4G1BA 4PTZA 1VB5A 2H5EA 2JZOA 5JS8A 1CLEA 1XRSB 2XNHA 1PS8A 4J0GA 5EMJA 5FPHA 3HO1A 5DLQC 1MAHA 2A9QA 1JAZA 3EEBA 3OMWA 5DSXA 3H5LA 4IKOA 3ZLTA 3KBOA 1N9GA 1UDAA 4MUNA 3PUZA 1QYDA 2APJA 3O92A 3PXEA 1N5DA 3DKKA 2BP7A 2X0DA 3GA0A 1ESDA 1KVRA 1PHPA 3E18A 4F7WA 1HE3A 2C2YA 2RJ3A 1T0BA 3IURA 4MUBA 2ZW9A 4GRDA 3DJFA 2IW3A 3DT9A 4ENQA 2WLTA 1A96A 2CNNA 3GJYA 3OFNA 5CYOA 3ROQA 4BJ1A 1GUBA 4FCCA 4YJ3F 4HH3C 1RRCA 1Q1BA 1OFUA 2JFVA 2PLAA 2JIPA 5AK4A 3JZMA 5K0JA 4QASA 1CDDA 3LECA 5DM4A 1KS2A 2FOXA 4ZT5A 3RUDA 6NULA 5MN5A 2WFLB 4FBGA 2HRDA 2YIJA 2YHAA 1V1MB 1PS0A 4DV2B 3U4QA 3IDZA 1K66A 3DB1A 3NTXA 2BZGA 4Y18A 1JHXA 3P2YA 2C3MA 3Q3VA 3WNCA 5KVCA 4TZ0A 3ZWBA 2WJ3A 2N0SA 3BYZA 3FUCA 4EG3A 5K45A 3AVWA 2LWIA 4RHCA 3WGLA 1KOFA 3RO7A 4IHQA 4MARA 2W0MA 1QRUA 4AS1A 4QQRA 4BMDA 2GN8A 2KLBA 3DHVA 2X5JO 3R0VA 3NBAA 3AIIA 2PZEA 4YDHB 1OLOA 3H2SA 4DSUA 3OTOB 2O2XA 1P9WA 2R8XA 4N6OA 2NVUB 3MXOA 5K3FB 4FFPA 1SXJB 3C7TA 3QBVA 2OWDA 3H5RA 2ZQ5A 4AYXA 2CXQA 1VOTA 2QPTA 2R48A 5CVTA 1QPZA 1Q1NA 4DM7A 4M0MA 4BNJA 5DULA 3PPXA 3PC4A 3E82A 2VJOA 4EYEA 1C2TA 1JQ5A 2R00A 3S7TA 4EA6A 4YMUA 2ATIA 2QD1A 2Z57A 2C29D 1KKLA 3DOJA 1E3MA 1E66A 1FZQA 1GILA 1XQ1A 4EMBA 1LW6E 1E2EA 2O8EB 3QRWA 5IBPA 4E51A 1XGKA 1H3EA 3SS8A 2FF7A 4RY8A 1RACA 2YV1A 3HDVA 4PCAA 4V39A 3KQLA 1V5GA 4L7QA 1JKJA 3LHFA 4NMXB 2DPXA 4QATA 5DCUA 1SPXA 3DD1A 3GNSA 4RIGA 2AOUB 1VECA 2Q5HA 2BZSA 4KE7A 2P0AA 1Z2EA 3HI6A 4CDMA 1NQTA 4XQ9A 4F12A 5AM2A 4M9RA 1KVTA 1SU4A 3LKDA 1JA0A 1EG7A 1MO4A 2JLQA 4O4IB 1B16A 1WX1A 4PZUA 3PC7A 3MMZA 4KO8A 1I2CA 1L7DA 3SIWA 3TQCA 4UMDA 5B64A 2Q7OE 3ILSA 2OR3A 1R0WA 1RJFA 2J3LA 4A8PA 2RDMA 3RVMA 4QVIA 2ACVA 3H8SA 1GUAA 1I4DD 2OXRA 3T9AA 3V1LA 1ZINA 3WWEA 2NV0A 3KKZA 3KU1A 3DCIA 3U56A 3AW9A 3BREA 2HSWA 3FWHA 4MRRA 4EK9A 4YPVA 4DRXA 1Z26A 4AJHA 3HLYA 3HCWA 4FSHA 4ZYLA 4BLTA 3PLNA 4I4TA 2R62A 1JHDA 3GT0A 3QXJA 5MF6A 1E6EA 4MUEA 1OTHA 2EJVA 1DJPA 2FW0A 3D0QA 2M6LA 3ZDDA 5I9TA 3QEOA 3N0WA 3E9EA 5BNFA 2H59A 2ZI7A 1L5OA 3IMCA 4LRSB 1OC4A 3EZNA 4HJRA 3H1BA 5C7LO 4YRQA 4BNNA 3B60A 2WT8A 1LVGA 1JLMA 3I6BA 3KEGA 5T8KC 4PYQA 4JP2A 1ZL0A 2WMYA 1EK1A 3DWFA 1E5XA 1U7WA 3FCXA 3LKZA 3WNZA 4FFSA 3VJMA 1RYDA 3GLRA 3PLAE 5E3IA 3A4NA 3NKFA 4G9EA 4ZZ3A 3DDSA 2EXXA 1XKTA 3OOYA 3EVAA 3KKKA 1ZUNB 2IDZA 2J48A 3HE3A 4OB6A 2ZXEA 1PWXA 3WADA 1T6BY 5IKOA 5GVSA 2B2NA 1T6NA 3FPEA 3RU7A 4TZ6A 3EVDA 3JSAA 1LDNA 3VTFA 2AA3A 2OMEA 3LX4A 1TA9A 4FW9A 2F00A 2VJYA 3H11B 3OAAA 3A3KA 3EXG1 1XYGA 3SEAA 2BFWA 5KB3A 3ZDBA 2C2GA 1XU9A 3LOQA 3TIGA 3WKAA 2NQ8A 1K06A 2W2XA 2WF7A 3M9LA 1S5PA 4NL4H 5E3JA 5A4FS 1SB9A 3L7CA 4MA0A 4NBNA 3DFUA 1EQAA 1DCMA 5FPKA 5EJGA 3ZWAA 5LWHA 4P7GA 1NIPA 4M49A 4FNMA 4BE9A 1TA4A 4JBXA 4OD0A 5IJWA 1XYVA 3U3OA 1Q74A 4QEKA 1MO6A 2HRBA 3DKVA 1H2AS 2MSDB 3LOPA 5C4IA 4G01B 4BWYA 2PIDA 4OO3A 1TGVA 4ZZ0A 1RYNA 2Y3IA 4P81A 1EGAA 2C5SA 2AJBA 2CVQA 3CF4G 2CNLA 3D3WA 1QP4A 1UK7A 2DFDA 2IEDA 1G5FA 1KK2A 4IIYA 4BNXA 2CY0A 2XB9A 4G0PA 1PZEA 1ICIA 4K2AA 4WKOA 3LXMA 3BMCB 3IDQA 2WFMA 1P7ZA 1M1NA 4TMXA 2JLYA 1CF9A 1AZSC 2O2DA 3NHMA 1E1RD 1WB4A 3DLAA 4B85A 3WHLA 4OX9Y 1WR8A 2AN4A 1UBSB 3ONFA 2FF5A 3QKWA 2UUBB 4HXYA 4B3IA 1GZUA 2JHGA 2DFNA 5SZHB 3KETA 3GG2A 2Q3FA 3B85A 3ZEAA 1Z6GA 3OE1A 1P2VA 1WMEA 2O8NA 1L1FA 4GIBA 2V6FA 2DJ5A 5JD5A 3E1KA 4HQ6A 4UE3S 1OJLA 1BH6A 2I2FA 4H7FA 2DWPA 3BQ9A 4CI0B 3FVRA 1QCZA 1FC0A 4L6AA 3W04A 1PL6A 3EBLA 2WR8A 3LOUA 4RA9B 3WIBA 2ORWA 3A36A 3NT4A 2PBFA 3P0IA 4CM9A 5JAZA 1DOHA 4PNEA 421PA 1KPIA 5IBQA 1QHYA 1YR7A 2VDLB 4XVCA 3LNCA 1C3EA 3W6OA 3T1HB 5A3SA 4MICA 3ANXA 4O2AF 1XZGA 3L43A 2PZAA 3PPVA 3T9FA 5JWRA 4BRWA 4CTNA 1Y6FA 2RK3A 2VDQB 1U4OA 5JRZA 1B23P 4U6QA 3DV0A 3WMRA 4ITRC 1T13A 2XXJA 3BFXA 3KPUA 3NBFA 2IHNA 1FDOA 1W6RA 4F9EA 3MGBA 1M1ZA 5TMBA 4HNHA 3G1UA 1QHEA 5T6MA 1XMIA 3ZHTA 4ZV9A 1KYXA 1I32A 2ZJ2A 3CVWA 1Q83A 2WWHA 3EH1A 4TSFA 2ODBA 2EEPA 3C5WP 3O2SB 2VF4X 3AUUA 3PGVA 3PDUA 2EARA 1FVFA 1PQYA 3DMDA 4IDAA 3QFTA 4MGYR 1Y6ZA 5CIQA 4JI3B 4DG5A 4JQZA 5K8LA 2Y9PB 4M6WB 3HVHA 3GZNA 3GAAA 1UBFA 1DBIA 4WV3A 3D7SA 4EY7A 1GPJA 2VXBA 4UFOA 5KI6A 3WISA 3BD7A 4E1VA 3G2JA 2BEVA 4NE2A 1L5KA 2EFGA 2JJQA 5P21A 1EFKA 4RK4A 3U7GA 1VPTA 4DIUA 2C9CA 3VKVA 5JS6A 2CV1A 3OZBA 3IP7A 3V3KA 5ALXA 3RLFA 1HKHA 2RGEA 3ZX4A 3M6LA 3WS7A 3CGGA 1S8NA 2PSFA 3BWMA 3MCTA 4PLCA 4Q47A 1HV8A 1CHDA 2PUAA 2HA3A 4XDGA 4MCIA 3ZBQA 5IG2A 1MZVA 3PFGA 3IYLW 9LDTA 3INYA 4WE3A 5ANRB 1CNMA 3CNNA 4UHFA 1JDZA 2NQ2C 1K89A 2J33A 3MILA 4I4TF 2A9JA 4MJLA 1Q7BA 1RQNA 5TT1A 4EM6A 2ARKA 4X85A 5A2GA 1SKBA 4DWJA 4HH4A 4UUPA 4WERA 5BNIA 1Y4AE 4JGIA 2E7ZA 4LKRA 2QRUA 5B57C 3QHAA 3S44A 5ESXA 1FK8A 2JBHA 5BT8A 1W52X 1W36D 2ZI9A 1MJHA 3B2QA 2QN1A 1PG2A 3CB4A 4M1YA 3NHBA 4RD4A 3VPSA 1RQ2A 2VYVD 4HVLA 1IZ0A 2Z8ZA 3ODGA 4NDNE 3UG6A 1GUYA 5LB2A 4KO1S 3DVSX 4AAYA 1Z34A 1UJMA 3TFQA 5AHRA 3WDSA 3EVZA 1QFZA 3ZWVA 1OA0A 3R4VA 4HRVA 3H6GA 3AG5A 1AV7A 4RLHA 4KYIB 1NP7A 5EKDA 4JROA 2R7KA 2QTGA 2FN9A 4PLPA 4Q9HA 1XXLA 4K9KA 5LP6B 4WLOA 1C7ZA 2O54A 1KQPA 1OFVA 4JLNA 2UYGA 3BULA 4BB0A 3EULA 3OPMA 5FOXA 2ZT5A 3FBWA 4LHEA 4RFVA 2G40A 1E1DA 3IP9A 5DGIA 2I7CA 3FCCA 3T1VA 3V8EA 2HU5A 1O9GA 2E3JA 3DC7A 3TMAA 1V8FA 7ADHA 4B3JA 2LIVA 4TZKA 5K4AA 4AKTA 2I71A 4HDRB 4R68A 3OTQA 4MP8A 4PC3A 5AKEA 2FA9A 4IVRA 1P72A 4TYMA 4D02A 5L3RA 3RVSA 1OBVA 3FWPA 3IMEA 3JAWA 3L8EA 2V5UA 3HDYA 3P20A 3R3XA 1BOFA 4ID3A 4WK2B 2B7CA 3SEZA 5HUHA 4H4EA 3CKKA 4KMRA 1Z4OA 2DX7A 1H9AA 1NNI1 3LDHA 3TW8A 3PEVA 3N07A 3UUFA 2R87A 3ABSB 1KJ8A 1DI0A 1J8FA 3G6WA 2ZJ3A 4G41A 4LWPA 5AIBA 1PW5A 1V8DA 3UGQA 4UU1A 4OTZA 4OI4A 1H0RA 1T2FA 3NRBA 3E22B 3O4IA 4XM0A 3FG9A 3A6KA 1VG0B 2A4KA 1X7YB 5C7OO 2G9QA 3B1WA 3NTUA 1E63A 1YDMA 3Q40A 1JIIA 1GA1A 1MJNA 2LCQA 3N8KA 3T7JA 1IBCA 2BFNA 5DBFA 1EM8A 2RK6A 4EX6A 3PUJA 5SYNA 4HYQA 4OHBA 4GI3A 1WA5A 1OREA 1XMJA 3BD9A 3RRFA 2FZVA 1OTYA 3VR4A 2A5JA 4X41A 3VAAA 5CDFE 1QFYA 1RLMA 4HWPA 5AVTA 3O1IC 1FFYA 2Q4OA 3U0BA 1VLZA 1HBJA 2VQSA 4DG9A 2VHJA 1RP7A 4W9MC 4AZSA 3I52A 5J47A 3STYA 3FBGA 3FD8A 1TQ4A 4MKFA 2YRXA 5JO9A 1F4PA 2VDRB 4CWAA 3MTEA 1QCDA 1B3RA 4ANFA 1Y6RA 3MCUA 5DHRA 1OXUA 2BISA 3Q3GE 1O5OA 1F8FA 2GETA 4PX5A 2AUTA 1ZGBA 4F4FA 3T7SA 4AKSA 2QD3A 1L4NA 3SQOA 2GI4A 4U39A 1UF9A 1XRQA 3STHA 5BN5A 1YR9A 4IY1A 5D3ZA 4A0HA 3ZE8A 1NVMB 2Q0SA 3A7DA 4GM4A 5BSGA 1IRIA 1MT0A 2F4NA 1JDBB 4LVCA 3E1GA 2HJSA 3ABRB 4H2DA 2JK0A 5M04A 2QD5A 5DT2A 5IXJA 3O3MB 3FNGA 1CJUC 1NHGA 1P18A 2H85A 4MS1B 2I4MA 5AI6A 5FOSA 4DLYA 4FQ7A 1WVIA 2VIIA 1ECPA 3IAHA 4WCFC 3BWVA 3RI3A 1IHPA 2I3ZA 3NP9A 1V7CA 1G8AA 2R6ZA 1HYGA 2M9MA 1EGQA 2B1IA 5BR4A 2ACWA 4S35A 3NDRA 4MQLA 4PYNA 2BYTA 1G5IA 2OXFA 4HB0A 2C1XA 4F3TA 2HCJB 2I6XA 3DEJA 3L49A 2C5EA 2C4HA 4RQUA 4OPMA 1DDIA 1JXMA 2KLHA 3GYBA 3DH0A 4ZWNA 3MOGA 4CDNA 1U8UA 2AE2A 2VJMA 4YUVA 1A8SA 4N5DA 2P3OA 3PXGA 1V95A 2JAQA 1C3JA 2OL4A 4TL6A 4ZCQA 3T15A 1KNQA 2AYXA 1Y1QA 5D5PA 4NMHA 4HADA 1M2VB 4MRSA 2I4RA 4RPKA 4K0KB 4P3YA 4IGKA 4LFBB 1BFDA 4BAZA 4Y0NA 4WK4B 5A9SB 1CERA 2AN5A 2FZCA 4PAWA 2HGZA 4JI8B 2HI0A 4XSHA 2CMGA 2R25B 3H1PA 4D0LB 5DN6D 2QL6A 1WBJB 3G8YA 3DULA 2YMPA 1IEXA 1TKBA 3F73A 1QHHA 1RBYA 2EFHB 2F3PA 4PNPA 1M1YA 1J90A 3AEKB 1ZJ4A 2ZRGA 3V55A 5BV2P 2O0HA 5A0FA 5CJJA 3QSYA 2CCJA 3OZEA 2ZSKA 4IJMA 2NO7A 3ELUA 1O08A 3HDTA 3OIWA 4WXEA 2C61A 3B1FA 1YMQA 4NPAA 4K8RB 3NVDA 1PSDA 2FMUA 3IUBA 3ESBA 2OP0A 1GZDA 2G63A 2JFUA 3HN2A 1EK5A 4GL2A 3U7JA 4NPCA 1AB5A 4RORA 1NR5A 3CLRC 2IOFK 2Q4EA 2W4MA 4UPDA 3L4SO 3RWMB 3ZUPA 4EYSA 3HP7A 3IT0A 3C15C 4YROA 3U40A 3UFXA 4ZFNA 3WDLA 3D81A 2F1RA 3U9LA 4A82A 2YZMA 1FS4A 2LW7A 4WK6A 5L4LA 1DQSA 3CW2A 4GVPA 5KJ6A 4HRYA 4TXNA 4UBKA 1Z6QA 4W9RA 2ZRFA 3KJFA 4FOTA 4M87A 1P4SA 4EIWA 4JI4B 1HM5A 3TLXA 1JI3A 1MAAA 1FYDA 1QONA 2HIAA 2QMHA 1RQRA 4WEQA 5HILA 2IP2A 4JYCA 4D43A 5I6DA 1ES9A 4JYBA 3M89A 4OM8A 3R9XB 4YRDA 4KXVA 4BQQA 1GA6A 3L8MA 3UYKA 5LZ4A 3R3YA 2GA9A 1XVUA 2IUSA 3ND9A 2X0EA 1TU4A 4E09A 4PCLA 4EH1A 3CVJA 2QIOA 4H1HA 1C9YA 4EOGA 3AY3A 3CN9A 1I3OA 4HAVA 1BWSA 4Z8YA 2AB0A 3AUKA 2J3JA 1PVDA 2QTTA 4LOAA 3MWEA 4ZCSA 2QT0A 1CQIB 2BHRA 3E9YA 1QH9A 3AHIA 2BHTA 3LXUX 2W2PA 1RXEA 2O5VA 5L3SA 1QWSA 1IAVA 1QZXA 5H5JA 1MA3A 1KZHA 1S7GA 2J9XB 3ZJTA 2JHFA 5CM8B 3NBMA 4K9DA 4PS0A 4R6XA 3VVMA 4EENA 3DZKA 3RC7A 2QTFA 2XIJA 4U8HA 3U3RA 3AETB 3KD2A 1T2NA 5KVVA 3VI4B 2OSVA 4RAQA 5DDIP 3HI4A 4YDSA 2YXEA 2DG2A 5IJ0B 1XCBA 2XTMA 3U17A 2B9VA 2XJ9A 3OCVA 5EP2A 2YS6A 4FYHA 3CY6A 4CQMD 4HFNA 3B52X 1WS6A 1OASA 1KTVA 1BXKA 1TFRA 2XMBA 1ZM4A 2EC5A 2FQWA 3EGOA 3BIOA 1JYFA 1XJ0A 2W2LD 1VJGA 2I4NA 1T9AA 2Z6AA 3HACA 2BPOA 1O8CA 3K5IA 3FKSD 3MELA 4JB0A 4KLNA 4J9VA 4RKWA 1DADA 2Y0EA 3GLFB 1I2MA 3CVOA 2FGKA 5DLDA 3S55A 2CZGA 3GJXC 4Z7QB 1VLLA 3A1SA 1S4MA 1UZUA 3H3FA 3PGXA 2GSWA 4PSCA 5J58A 3VZDA 3WVNA 3C1TA 2ZRMA 3OKAA 4ND7A 3LHSA 4ATNA 4PBSA 2FLVA 5KHAA 5I7FA 1T29A 3EF1A 5EYPA 1MJGA 1KI7A 4QAQA 3GX1A 2A2ZA 3VC2A 2AEEA 2ID7A 4L4UA 2GUWA 1ZD5A 1LWOA 4DWVA 4HL6A 1JG6A 2V7QD 2C20A 2DFVA 4OHRA 3ZJ5A 4WDRA 5ADWA 3JYLA 3BHNA 4INOA 3ZHOA 1UANA 1IULA 3BAFA 4HDMB 3DZCA 3QEMB 4FLFA 4ZU6X 4RACA 4Y6QA 5J5VA 3RSZA 2AW5A 4M21A 1UQRA 5HJ7A 3KVRA 1FBTA 4MKRA 4MAFA 3IO5A 5FWAA 2IPAB 1RS0A 1VJTA 4KUGA 2Q7DA 3IT1A 1G8GA 1N7IA 1YMVA 1LRLA 2X6TA 4TWZA 1TIPA 5EWJA 4MINA 4KXUA 3FNHA 4LJ8A 4U2KA 4XYBA 1O94D 5JNUA 2NP6A 1SFRA 1TW3A 3IEIA 4BECA 5HKLA 4GU5A 1BOOA 5C5DA 5IDYA 3HFSA 5COQA 1GPLA 3VMFA 1YZLA 3E84A 2GYUA 3K1AA 3STTA 1R0ZA 5ISMA 1P5FA 1EUCB 3C3CA 3N2ZB 3QTTA 1G19A 5ECWA 3D5TA 4E7PA 1M8KA 5EZ6B 3EMKA 1TFUA 4Q7EA 1O77A 4L4RA 1QRSA 1CS0B 1D2MA 1PX2A 3I0ZA 3L0YA 4LUCA 3UMGA 4EECA 4URVR 3K4PA 2Z5FA 2OC9A 4JHXA 4R8VA 4B75A 3KJEA 5EIBD 1LRKA 4HN4B 2X22A 1AXGA 2PVSA 4W5HA 3ZTWA 1TM2A 4ZD6A 1VLHA 4BFSA 2A78A 4PX9A 3AHHA 4OK3A 1TGYA 2CF5A 5KMGA 5G4KB 2DFPA 5FLYA 1DC7A 1JEAA 1IB6A 1R6AA 3NWJA 4TT8A 2Q8PA 3TSOA 4X6XA 4C07A 4YUAA 2GF0A 3IELA 3O3NB 4R3WA 2B1JA 2IA5A 4YQYA 5HPYB 5T5QA 5IWAB 3NFRA 4NEGA 3CX7A 3ZHSA 2AFVA 2GBGA 1GSOA 3OQJA 4XJXA 1COWA 3P9XA 4L8YA 2M6KA 2O5CA 1B00A 3QKTA 2ZJ4A 1AUVA 3CUVA 4MO9A 2ZCVA 3F3YA 3QFFA 3GGCA 1SG9A 2DY0A 4P3KA 4QNRA 3ZNNA 2VHWA 4AF8A 5KUTA 3M6VA 1PEDA 3GLGA 1IWPB 1Y5MA 3RU3A 2E1RA 4PO1A 3VJKA 5LLTA 4QG3A 2FV8A 3RVRA 3NCHA 3SKXA 1XTJA 1EX1A 1WQ3A 2FPSA 5ALWA 2HCFA 3S3TA 2IU3A 1FP1D 1XCGB 4ND3A 4CKYA 1C8BA 1K6IA 4DW8A 2AC2A 4JDPA 1T3HA 3QOYA 1SUEA 3MWDA 1ZUWA 4I9HA 2IX3A 3TF5A 3C5HA 3LWNA 4RD0A 4LYEA 4YJHB 1N9ZA 1JPNA 3EZ6A 1LH0A 5IH7A 5JI3E 3V80A 5LYJB 4B76A 2MYTA 1RP1A 2C2HA 1N8TA 2MDTA 2H0QA 4WCFA 4CM5A 5KNBA 4JBWA 4UHBA 4I50A 5EJAA 4CKWB 4OQQA 1AUPA 2AT1A 1NF9A 3AEXA 1R4NB 3P4YA 3QTLA 4MQFA 2KSQA 5G3ZA 1HDRA 3AQ4A 4HEHA 1H2ZA 2AWNA 2BUCA 2EGHA 5KIAA 1H4VB 4XR4A 1NUTA 1KETA 4X94A 4XEUA 5SV2A 3CUWA 3E4DA 5ALMA 3ROZA 2C5GA 3BXFA 3ZZ0A 3N9IA 3D5EA 4DBZA 3UMFA 1DTSA 1M34B 2OESA 1RXYA 2X19A 3JRNA 3NIBA 4R0NA 4BZPA 2G83A 1YR8A 1Q92A 3ETGA 2Z56A 4BRZA 1P61B 3HJFA 1O89A 4BXOA 2Z3WA 4HYTA 1HH4A 1P4RA 1OZGA 1DKPA 2P9ZA 2YNMD 3E8MA 2RG1A 3WK6A 2C0PA 1Y9DA 1P6QA 4N9QA 4EJ0A 1ZUIA 3ZY6A 4LCBA 3D6UA 2I80A 3BGSA 3EXFA 4ER7A 1XVIA 3K09C 1CEYA 4Q1FA 5CCXA 3NETA 5DX8A 1VKHA 1KA9H 1S3IA 2Q0QA 4B47A 1EAYA 1HYHA 3A32A 3A6FA 3QPDA 4MPJA 1M34E 1XCPA 4IFTA 2VH1A 3KJXA 5FI1B 3WHKA 4ETIA 1FXWA 1C29B 5L3ZA 2Q0XA 1IUNA 4P3XA 3KTDA 5AH0A 3WGGA 4R2JA 5ENZA 1CSEE 1HSOA 3HLTA 3MAGA 4FVTA 5I7AA 3NC4A 3BXXA 5C3UA 3DQZA 1U2ZA 1L1QA 2OXTA 1BQEA 1L4LA 3IP5A 1C4WA 4IZHA 4JMLA 4R05A 5FPPA 5K3EA 5LMCA 1QGUB 1C7JA 2HFKA 2OGUA 2WF9A 3IQFA 2J3MA 1JHPA 1KR2A 4BLRA 4DARA 1WF3A 2FR0A 3D4IA 4Q9NA 4RKQA 4D81A 2W6JA 3G1WA 4HX5A 2JAHA 2TECE 3STUA 2ECPA 1LF5A 3PFFA 4CLHA 4DADA 1DBVO 3BE4A 4F2GA 5AXBA 4F86A 3NKVA 3BH6A 3FYUC 3FGOA 2QV7A 1F8YA 3N76A 4PXSA 2GT1A 3AOEC 3QP9A 2XOXA 1S2OA 2HAEA 4OHUA 4RPIA