4ZRIA

Crystal structure of merlin-ferm and lats2
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
293
structure length
293
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merlin
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
total genus 87
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zriA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zriA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zriA01
3ML9A 4CO7A 2I1KA 1WH3A 4G3XB 4IWPA 2LI5A 3DDCB 2N9EB 4M0WB 3RULA 3VDZA 4NJ6A 4AP4C 3EPYA 1P0RA 5DHAB 1LFDA 2BKRB 3ZVRA 3VOQA 1KZ7A 3HHMA 3VFKA 1VCBA 1FAOA 3T06A 3R7RA 3WALA 1DYNA 3H6NA 1WJ4A 2FIDA 2Y7BA 3RT3B 4GDLA 3A8PA 2DHZA 5J2RA 4MK0A 1XQQA 2RR9A 2YS3A 3SDLC 1P6SA 1YJ1A 4KZ0A 1V61A 2QHOA 2MBEA 2KDBA 5D6JB 4EZKA 3ZUNA 3OANA 5DH9B 2R0DA 1ZC4B 4FJYA 2VRRB 2J0KA 2ADZA 4AWJA 4F7HA 1SIFA 2IYDB 2KX3A 3AU4A 4DBGA 3V5WA 3A4SC 3A33B 2D4QA 2DAFA 2KVRA 1V81A 2HRJA 2DKPA 1P3RA 1R4NI 3F0WA 3M63B 4HXDA 4W9IA 4EFOA 3ZDTA 3A1QA 3UIOB 2J7QB 4B95A 4RM9A 4EEWA 3M95A 1EAZA 3MJWA 4DDGD 3M62B 1H4RA 2IO2B 5CTRC 1YD8U 3JSVA 4J6IA 5FR6A 1C1YB 4NQKE 3ENEA 3V6EB 3V60A 1IYFA 2GBKA 1H10A 2JZZA 1V5PA 4TYZA 3LJ3A 2BYEA 2RLOA 2VRWB 1RFAA 5FI1A 2YSZA 2K39A 4FJVB 2ZNVB 5C16A 3VIAA 2I5FA 2LGDA 3D8EA 2BGFA 3UGBB 2NBWB 4TUUA 3AULA 1N3HA 3B0AA 4FHKA 1RRBA 4WJQA 3VH3B 4KSLC 4MGZE 3WANA 4WJ7A 2B3AA 2KDEB 2L8JA 2IFSA 3CF6E 3QA8A 4A6KA 4MY6A 4LDTD 1VD2A 3UZTA 1MPHA 3WAPA 2D10A 5CHWA 5L81A 3AU5A 3L08A 4WVFB 3PSEB 2YVCA 4HAUB 5DCNA 2YT1A 4GZUA 2L0FA 4HAVB 5D94A 2KFKB 2MSED 3DBRI 2BPSA 2FNJB 2CR5A 3DOWA 4HWIB 4XC2A 3VHTC 2L05A 2N1VA 2XK5A 2MBOA 2JWZA 5J3YA 3ML8A 4DX8A 2LASA 1WVHA 1DROA 1NU2A 4K7WA 2DX5B 5J3TA 4D0NB 4JL9A 4W9LA 3QHTA 2KLGA 3DXDA 1L2NA 4TKNA 1TXDA 5DHFB 3ONSA 2KQSA 1X1MA 4PYZA 3RUIB 1P98A 1UBQA 3KUZA 2UZRA 2JY6A 4CHJA 5DI9B 3TJPA 2MBQA 5LOPB 4CHMA 2CU1A 2N4FA 3JVZX 2BWES 2YF0A 2G35A 2KQ7A 4YL8A 3Q3FA 4DHZE 4GDKA 4HHVA 1GC7A 2KMCA 1NTIA 2XQNM 3MPXA 2L7RA 3NOBA 3V61A 2LG1A 4HCNB 2OOBB 2LKOA 1QZEA 3H7PA 1FHXA 1JRUA 5D3WA 2NMBA 2PE6B 4PS7A 2FCQA 4GMXB 2R2OA 1K5GB 3SO6A 2HTHB 1WXSA 1UZXB 4F7UP 2KOXA 5GOWB 5JHBA 1WX9A 4W9HA 2KLCA 2M17A 2W2XD 2Q13A 4K7UA 3ULCA 1WR1A 1WJNA 2KFJA 2DA0A 4HB0B 3A9JA 2OTXA 4XX5A 3KYDD 1E7VA 3ZNHB 1FXTB 5IA7A 3KUDB 3PV1A 4HB3B 2FDQA 2ABDA 3QJZA 2IY1B 2KUPA 1V88A 2BYFA 4HB2B 3TFMA 1L7YA 2MWNB 1V49A 5AZFA 4GMVA 3R7QA 2MLBA 2OJRA 4DK5A 2EMTA 4GN1A 1XD3B 1XT9B 1WJUA 5HE3A 4ANUA 2CKHB 2GBJA 1ST7A 3W1SA 1J0WA 1W1GA 2KHWB 1GC6A 4GDLB 3PHXB 1WZ3A 5DPWA 2KKCA 2RPQA 1Q67A 2NR2A 1X86A 3PGEA 3QARA 2DYOA 1XODA 2D3GA 2D9YA 2X18A 3PEGA 1WF9A 2LULA 3GZNI 5CLQB 4ICVA 4KVGB 2WWZA 2C7MB 1XR0B 2Y8FA 3ZLZA 2MBBB 4EOYA 1I2HA 1EO6A 2V1YA 3B08A 4DHJD 1RLFA 2PZ1A 1YQBA 3TBLD 3CXBB 1V80A 1M94A 4GU2A 3VUXA 2I5CA 3SD5A 2MCNB 2P0HA 1PFJA 1ISNA 3D8FA 3DQVA 4DHJB 1BT0A 3UQAA 1T0YA 4ASWC 2GJYA 4BOZB 2R2QA 1HB6A 3PT2B 3L17A 3QIJA 4KDIC 2IY0B 3A1QB 3APFA 1LQBA 3B1LX 4EUTA 1EUVB 3NZUA 2LOXA 4FBJB 1QC6A 4GGQA 4GB9A 5JZEB 1WE6A 2CB8A 4URKA 3JSVB 5C23A 5EDSA 1WIAA 1WYWB 2LD9A 1IPGA 1HE8A 1KZGA 2N23A 1P1AA 3FEHA 4MJSA 3DVNV 4K2PA 1XKEA 3F5RA 1RRPB 2DTCA 4YONA 3PS6A 1MK7B 4P7IA 3VTUA 1LXDA 2JXXA 2KK8A 2DAJA 1DDMA 2FAZA 3PLUA 2LBBA 4DX90 1KJTA 1Y8RC 3ALBA 3A8QA 4RM8A 4BBNC 2KTRA 5G55A 3SYXA 4MGKE 2LGYA 1PQSA 1FGYA 3NHEB 2KX0A 1U5EA 2LVOA 4HPMB 2D9VA 2M0XA 2G3QB 2RD0A 2E2XA 4A6FA 4GXBA 3ZNGC 3U8ZA 3QX1A 3HQCA 2MDXA 1OQNA 2XK5B 2WX0A 3VQIA 3I3TB 1WJ1A 1WR6E 2REXA 2D07B 3TL5A 5JHHA 2G4SA 4MH0E 3SHQA 2CY4A 1BAKA 2DZMA 5HKHA 2EKEC 4NPNA 1KOTA 4NSWA 1WZ0A 2OQBA 4FJZA 2FCMA 5J3QA 4RMAA 1W1HA 4FADA 2IBIB 4IFSA 2COAA 3PVLA 1GUAB 3NY5A 4LJPB 4C0AA 3DXCA 1WI1A 4CYEA 1LM8B 2KTFA 1NDDA 1EF1A 1ZSQA 4GDKB 1V6EA 1F9JA 5DPTA 2K8CA 3ZNZB 3PG7A 4OVUA 1GJZA 3PSCA 4F7ZA 3UINB 3H7PB 3IBEA 1KLVA 3RD2A 1OY2A 1LB1A 4GPTB 2AEHA 2KN5A 3PHWB 3P2BA 1GG3A 4HATB 2I1JA 2ELAA 3SNHA 2KDIA 2MQJA 1ZKHA 1IP9A 2FUHB 3QWMA 3W1YA 2KC2A 4MEMA 5AZGA 4WSFA 1SE9A 3HIZA 4BKSD 1XD4A 3K9PB 2D9XA 1V86A 2KWUB 3A9JB 3UIPB 5HE2A 3ODOA 1WJ6A 2MX2A 3QBVB 2M8SA 2N7DA 1XX0A 2LRUA 2K1FA 3EECA 4HB4B 3PRZA 4EMOA 1YIWA 4HDQA 4KSKC 3FP5A 2M4NA 2PEAA 4GOCA 2ZCCA 2H7DA 4NY0A 4HAWB 3TMPB 5CLLB 4W9CA 1WXAA 2JVCA 3HM6X 3SV1A 3RCPA 4AJYB 2LGXA 4II3B 2KXJA 4DHZB 1D3ZA 2P0FA 2FJLA 3KVFB 3LDZE 2ROZB 3QK0A 1UELA 1E8XA 4IUMB 4N9F4 2BF8B 2K2UA 1S3SG 4CHKA 4DWFA 3PRPB 3AI5A 4HK2A 3N7CA 3WIMA 2ZZPB 1UBIA 1NTVA 2KWCA 2Z0DB 4M8MA 2JT4B 2ZCBA 2C7HA 5C1ZA 2GCJA 4LDTB 3C0RB 3IHPC 3NS8A 3TO1A 4LJOB 3DVGX 4K17A 3KYCD 1WGYA 3VTWA 4HJKA 1FHWA 5LXHA 1DDVA 2NS5A 1Q1OA 2CHZA 4W9KA 3FLVA 4NNJB 1EF5A 4A3PA 3LJUX 2CHXA 1WI0A 3KRWA 2XEWA 2DHJA 4FA6A 1E8WA 5J18A 1Q0WB 1V89A 1AWEA 2CAYA 4BBNF 1DBHA 1WMHA 2MW5A 4WJOA 2DHKA 3VUYA 4MJSB 3IVFA 3JYUA 5BO4B 2IZVB 4W9FA 2N1WA 2WH5A 4DXAB 1OMWA 1RAXA 1U2BA 4ZYNA 2DHIA 1YX6B 4EKUA 4KV2A 2J0JA 1BTKA 1Z5SB 2KGXB 2KTRB 2UZSA 3PRMB 2WDTB 3TVVA 3GYOA 3PPAA 3MDBC 3ML4A 5E6OA 2FCSA 5KQ1A 4K7SA 1FGZA 3VVWB 1H8CA 1NI2A 4A6FB 2MWSB 4IC7B 4HAXB 2HJ8A 2HD5B 4XZ4A 2KDFB 2JF5A 5D2MB 1ZW7A 3ZKJC 5HE0A 3Q3JA 1UEFA 4BKSA 3TIXA 4PNKA 4I6LB 3CSTA 1NVLA 3APCA 1X1GA 5DIFB 2Y5BB 2AL3A 2CQUA 2CS4A 4AOFA 3P7ZA 2H7EA 2GCLA 4PS3A 4EZLA 4M8NA 1FB8A 3O96A 2MA9B 4A3OA 2LXCA 2UYZB 5KQ4A 2D9WA 4ZRJA 2DYNA 1UH6A 3IG3A 2RNRB 4L6EA 3WYFB 1J0GA 2IO1B 5HE1A 4MM3A 2Z0QA 1E8ZA 5DPSA 2ZEQA 5FI0A 4H8SA 3OJ3A 3QAQA 2DYQA 5KCVA 3EFUA 2K6QA 1V5MA 4ZDVA 2ZPNA 1WM3A 1HBKA 1MK9B 4JQWC 3KW5B 4IAPA 3PREA 5IAAC 2GBNA 1RJ2A 3ODWA 1MIXA 4TQ0A 2M38A 4A6HA 4KHAA 1J8CA 1ZVRA 1B55A 2C5LC 2KO3A 4K1RB 2ZPYA 3MTNB 3HK0A 2BYVE 4JLCA 2LUEA 1Z87A 4G0NB 3HW2B 2DENB 1OEYJ 3ZO5B 2FJ9A 2FCNA 3WA0A 3BINA 4HCPB 1M7EA 2RGNB 4FN2A 2C60A 2ZJDA 2KC1A 3M1IB 1S1QB 1SGHA 5LLIA 2D2QA 4KHOA 3L54A 4WAAA 1J19A 5E6PA 2VSZA 1OQYA 4EZJA 1UNQA 2D9ZA 4KDLB 1TQZA 2L2IA 4IM2A 1ZGUB 2K8HA 2PPHA 4B6HA 5LONB 3M3JA 3N32A 1U27A 2M14A 4MT7A 4WJPA 3IFWB 2UWQA 5JHAA 3CMMB 2K00A 5C5BA 3JW0X 4I6PA 4ZRIA 1WJMA 1ZM0A 4LCDE 4G50A 5J17A 2M1MA 2NVUI 1TBEA 1WGQA 1E7UA 4KAXB 1EVHA 4ANVA 2EJ8A 4IWOA 4MGIE 1WG7A 4F8CB 2HE7A 2G4DB 2QKLA 2K2JA 2G45B 1WGHA 4F7GA 2RUKB 1WGDA 2W9NA 2R09A 1Q5WB 3DBLI 1I35A 2KANA 3BY4B 1FHOA 3P6AA 3VTVA 3A9KA 3L10B 4FULA 4II2B 2GBRA 4KIKB 3AXCA 4TQ1A 3R3MA 2N0YA 3VH4B 2NZ8B 2FIFA 5D27A 3U7DA 2O6VD 3KUCB 2O2VB 1P5TA 4JGHB 1YX5B 2L76A 1U5FA 1QQGA 1TTNA 5TR5A 5CHFA 2GS0A 2DZJA 4NAWB 2O6VB 2K25A 3SUZA 4BFRA 3H1UA 2KCJA 1BWNA 2W2XC 1WMHB 5G2NA 3RCZA 2J59M 4FHJA 3PLVA 2JZ3B 3T9LA 2LJ5A 4IW0A 2KMAA 2ELBA 2MBHA 2LWPA 4IWQA 1U5DA 2PJHA 2RVBB 1A5RA 3PZDA 2C7NB 4IM0A 5E6NA 3OAWA 4WQOB 4BKGA 1AARA 4IM3A 5DPRA 4EJNA 2N7EA 1IRSA 1R4MI 5JP4A 4KHBB 2XBBC 2V3SA 1WX7A 4WWNA 4A20A 5L83A 5KHQA 4MGYE 2BWFA 2COFA 2BCJA 2YRYA 4Z2NA 2DKQA 4B9KA 1AQCA 4W9GA 2RGFA 3L13A 1WGUA 1TJ6A 2KJ6A 3EC8A 4W9JA 1WXMA 3AJ4A 1MAIA 4K81A 4JIOU 2DX1A 2CODA 3O65B 1OTRB 1WGRA 2A4ZA 2AYOB 5LXIB 2MP2A 1XCGA 4HAYB 2L1CA 1V2YA 1LW3A 3DXEA 3D32A 2EMSA 4MELA 2AWTA 2K8BA 2RQ1A 2GMIC 3SU8X 2WX1A 4B6WA 1WX8A 2N9PC 2DLWA 2Z0PA 1Y19B 2DZIA 1Z2MA 2A5UA 3L0WB 1WY8A 1E90A 4ICUA 1CMXB 2P8VA 4OVVA 1BTNA 3BJIA 3A4RA 1PMSA 5AZHA 1WXVA 5GMVA 3GOEA 1MKEA 3UF8A 1G6JA 2NPTA 1WFYA 5C79A 1WE7A 2LXAA 3D8DA 4F1SA 3DVNU 4KIKA 4HAZB 2Y8GA 3ZW3A 3VXWA 4GSWA 3PVWA 3PP2A 3APDA 2O2VA 4PS8A 1SHCA 5CX3A 2NBVB 4HVBA 5AEKB 1MIZB 4E71A 2L0TA 4MDKE 3RZWC 2JRIB 4NAWA 2O6VA 3S2AA 2KZRA 2KWVB 3FM8C 2LVQA 1DDWA 2DN6A 1UNRA 2LYDA 3ODXA 1I42A 2PE9A 3WAOA 4ZRKA 2JP2A 4PQ0A 2ROVA 2NBUA 3ZNID 5C5BB 3DCGA 1HB8A 2ZVNA 4BVUC 2CY5A 1E8YA 3X23A 2L00B 1EGXA 3QC8B 3ZVVA 2YT0A 4FLHA 2DYBA 4GIVA 3DBHI 3G9WA 4Y94A 5D3XA 2KJRA 1NBFC 2JRHA 1OEYA 3OJ4B 1UNPA 2RSUA 4NQLB 2COPA 3ZDMC 3TCAA 1P9DU 4BKTA 4W9EA 2C9WB 4G11A 2YS1A 1GNUA 2DYMA 3A9KB 1W1DA 3GYPA 4NJ7A 2DFKA 3K9OB 3KZ1A 2JUOA 4DBBA 2N9XA 3ZTDA 3ZRFA 3WAMA 2LRWA 4K2OA 3QCAA 1WRDB 2EC1A 2COCA 2MRPA 3N3KB 3HM3A 3V6CB 2JPHA 3X0WA 2UVMA 1E5WA 1X05A 1U4AA 3PVUA 2LZ6A 3CSFA 1X11A 2Z0OA 3A98B 3FSSA 2CHWA 3ULBA 2CRFA 1P3QU 3CIKA 1V5OA 2GOWA 3DBSA 1Y5OA 4A5KA 1UGMA 5IJMA 2MKRA 1ACAA 3UQBA 3VAWA 4PYUA 3KY9A 1I7AA 3R66C 3V62A 3QWZB 2DZKA 3T8MA 3W1SC 3NZSA 2J0MA 1WM2A 3TW1A 3U30A 2W2WA 4E74A 1UD7A 4Z2MB 2YLMA 4AUQC 4BOSC 2D11A 2ZNVC 2VKIA 5JHGA 5JLJB 1ZC3B 4HPLB 5JH5C 5D7GA 2NCNA 3H9DA 4ANWA 3H7SA 3VUWA 5CHVC 2LOZA 3NSUA 1NTYA 5KHOA 4WWOA 3KRXA 2K6DB 4WJNA 4X57B 2KFKA 5C6RA 2IO3B 2ASQA 3ZRCA 4KZCA 1V5UA 1U29A 2ZVOA 2LVPA 4XWXA 3ECIA 2QKMA 3KH0A 4BBKA 5EFXA 4WWPA 4TV3A 2Z0EB 2L3ZA 3MHSD 4ANXA 3OLMD 4IOYX 1C3TA 2DX5A 1TZ1A 2IYBA 3DPDA 2MP2B 3DVGY 2KJHB 2AL6A 1V5TA 4HDOA 2Z59B 3PTFC 1M7RA 2P0DA 1PLSA 1OGWA 4AJWA 3EHVA 1UPQA 4E3CA 4W9DA 4MSQB 3RYTA 4I6NB 1KI1B 1K5DB 2V4LA 3KSYA 3ZIMA 5L95C 4DDID 1U5GA 1MG8A 2GBMA 2IO0B 3ZTCA 2YS5A 1K8RB 1KM7A 5D3VA 3L16A 2RSGA 2V76A 2WYQA 2KNBA 1UPRA 2MFQA 1X1FA 1TGZB 3QQ8B 1WGGA 1V9JA 5D3YA 2NPTB 4MSMB 3RZFA 2BKFA 3N30A 4IG7B 1FOEA 4HLEA 2HTHA 2KD0A
chains in the Genus database with same CATH superfamily
2K3UA 3ML9A 4CO7A 3E9PA 5IN7A 5JVLA 2I1KA 1WH3A 4G3XB 4IWPA 2LI5A 4HJGE 3DDCB 1PYWD 1RWSA 2N9EB 2WLBA 1WYGA 3H8HA 4M0WB 3RULA 3VDZA 4NJ6A 1QQRA 3EUB2 4AP4C 3EPYA 1D5MC 5DHAB 1P0RA 2TSSA 2L52A 1LFDA 1YN3A 2BKRB 5IKCM 3ZVRA 3VOQA 1KZ7A 3HHMA 3VFKA 1HTOA 3MC8A 2JZPA 2RPVA 3CIRB 2WXPA 1MHHE 1TS4A 1UWXA 1R4NB 1KRHA 1VCBA 1FAOA 3T06A 3R7RA 3WALA 1DYNA 3VRAB 3H6NA 1WJ4A 2FIDA 1C78A 4AS1A 2Y7BA 3RT3B 3BVMA 4GDLA 3RN9C 1FCLA 3A8PA 4YWGG 2DHZA 5J2RA 4MK0A 1XQQA 3VR8B 2D3AA 2RR9A 2WXKA 1IGDA 2YS3A 1OFFA 3SDLC 2QMTA 2EELA 1P6SA 1YJ1A 1TZOA 2K49A 4KZ0A 1V61A 2QHOA 2MBEA 2KDBA 4RFBA 5D6JB 4EZKA 3ZUNA 3OANA 5DH9B 2R0DA 1C4CA 1ZC4B 1YN4A 1E6EB 4FJYA 4UDUC 2VRRB 2M56B 2J0KA 2ADZA 1YQ4B 1R7SA 4AWJA 1K50A 3SFEB 2L83A 4F7HA 2RMMA 1SIFA 1TKEA 2IYDB 3HIEA 2KX3A 3AU4A 4DBGA 1J7CA 3V5WA 1JWAD 3A4SC 3NWAA 3A33B 2D4QA 2VZKD 2DAFA 3LXFA 2KVRA 1V81A 2HRJA 2DKPA 1JWSD 1P3RA 1R4NI 5FR3A 3I9V1 1CK1A 3F0WA 4BAXA 2LGIA 3M63B 3DWGC 1YMHE 2NTSA 4TSSA 4HXDA 4W9IA 4J3OD 2VZKB 4EFOA 2OJWA 3ZDTA 1HXYD 3MP9A 1JWBD 3A1QA 3UIOB 2J7QB 4B95A 4WURA 4RM9A 4EEWA 1IBXB 4N59A 3EFCA 3M95A 1EAZA 1DGJA 3MJWA 2G1EA 4DDGD 3M62B 1H4RA 2IO2B 5CTRC 3AMZA 4US8A 1YD8U 3JSVA 4J6IA 5FR6A 1C1YB 4NQKE 3ENEA 1YJJA 2LMCA 3V6EB 3V60A 1OQRA 2PIAA 1IYFA 2GBKA 4M01A 3DBRB 3RPFC 1H10A 1PFDA 2JZZA 1L6VA 2INDC 1V5PA 4TYZA 3LJ3A 2BYEA 4XE0A 3BYTB 2RLOA 2VRWB 4KGRA 3V05A 2BS2B 1RFAA 5FI1A 2YSZA 3Q8CA 4JK7A 4GLSC 2K0PA 2K39A 4FJVB 1JWMD 2ZNVB 5C16A 4L1RA 2I5FA 3VIAA 2LGDA 2KR0A 3D8EA 2BGFA 3UGBB 2MEKA 2NBWB 2H88B 4TUUA 1N63A 3AULA 1N3HA 3B0AA 2DLBA 4FHKA 1RRBA 3U52E 4HRSA 4WJQA 3VH3B 4C7YA 4KSLC 3W2DA 4MGZE 2ACZB 5HHDG 2PTLA 3WANA 4WJ7A 2B3AA 2KDEB 1JQ4A 2L8JA 2XNAC 2IFSA 3CF6E 2DNFA 3QA8A 4XWTA 4A6KA 4MY6A 4LDTD 1VD2A 3UZTA 4JKAA 1MPHA 1ACCA 3WAPA 2D10A 3LB8C 5CHWA 5L81A 2K8EA 2KVZA 3AU5A 3L08A 4WVFB 1EU3A 3PSEB 1GAQB 2YVCA 4HAUB 5DCNA 2YT1A 4GZUA 3AH7A 2L0FA 4HAVB 4YTNB 4MH8A 5D94A 1T3QA 4K3BA 2KFKB 2MSED 2LHDA 3DBRI 5G5GA 2BPSA 3SBTA 2FNJB 3Q3MC 2CR5A 4M0WA 3MC9A 3DOWA 4HWIB 5C3JB 4XC2A 3VHTC 2L05A 2N1VA 2XK5A 2MBOA 2JWZA 4KGSA 5J3YA 3ML8A 4IOIE 1SJHD 4DX8A 4A6QA 2LASA 3E9SA 5IP4D 3FAHA 1WVHA 1DROA 1NU2A 4K7WA 1YQ3B 1Y56A 2DX5B 4ZYSA 2GLSA 2V9HA 3AN1A 5J3TA 3NS1A 4D0NB 3R2IA 4JL9A 4W9LA 3QHTA 2KLGA 3DXDA 5GXGB 3HUIA 1C4PA 1L2NA 4TKNA 3DCXA 1TXDA 5DHFB 5AUIA 3ONSA 2FUG1 1KFYB 2KQSA 1X1MA 4PYZA 3RUIB 1P98A 1UBQA 3KUZA 2UZRA 2JY6A 1ROEA 4CHJA 5DI9B 3TJPA 2MBQA 5LOPB 2KIGA 4XGAB 4CHMA 1PGBA 2CU1A 2N4FA 3JVZX 1EU4A 2BWES 2YF0A 3UI3A 2G35A 2KQ7A 3VR9B 4YL8A 3Q3FA 4CQNA 4DHZE 4GDKA 4HHVA 4LNNA 1GC7A 3E9LA 1UNSA 1FO4A 2KMCA 3B2GA 4RGOS 1NTIA 2XQNM 3MPXA 2L7RA 2Y3AA 5H92C 1I4HA 3NOBA 1QOAA 3V61A 2LG1A 4HCNB 4OSNA 2OOBB 2LKOA 1QZEA 3H7PA 1FHXA 1JRUA 5D3WA 2NMBA 2PE6B 4PS7A 1J7BA 2FCQA 4GMXB 2R2OA 3N1YC 3NRZA 1K5GB 1JMLA 3SO6A 2HTHB 4DXFA 1WXSA 4D2KA 1UZXB 3N1XC 4F7UP 2KOXA 3FVCA 5GOWB 5JHBA 2Z14A 1WX9A 4W9HA 2KLCA 2M17A 2W2XD 2Q13A 4K7UA 3ULCA 1WR1A 1WJNA 1VRAB 2KFJA 4B0EA 2DA0A 2KUQA 1TYGB 4HB0B 3A9JA 2OTXA 4XX5A 3KYDD 2W3SA 1E7VA 3ZNHB 1FXTB 5IA7A 3KUDB 3PV1A 4HB3B 4L2YA 2FDQA 3Q8EA 2ABDA 3QJZA 1B1ZA 2IY1B 2KUPA 1V88A 2BYFA 4HB2B 2D5GA 1RFKA 3TFMA 1L7YA 2LFIA 2MWNB 4RGMA 1TS5A 1V49A 5AZFA 3W9CB 4GMVA 1QOGA 3R7QA 2MLBA 1KF6B 2OJRA 4DK5A 2EMTA 4GN1A 1NEKB 1XD3B 2BBCA 1XT9B 1WJUA 5HE3A 1F2RI 4ANUA 4ARIA 2CKHB 2GBJA 2QIEB 4OZAA 1ST7A 3W1SA 1J0WA 1W1GA 1L0VB 2KHWB 4HEA1 1GC6A 4GDLB 3PHXB 1HEZE 4GNKB 1WZ3A 1ZUD2 1T0SC 5DPWA 2KKCA 2RPQA 1Q67A 4LNOA 2NR2A 1X86A 2QDFA 3PGEA 3QARA 2DYOA 4PT5A 1XODA 2D3GA 2WXOA 3TEYA 2D9YA 2X18A 1XF5L 4JE3B 3PEGA 2EKIA 1WF9A 2WS3B 2LULA 3GZNI 1QOBA 3AE7B 3RNGC 5CLQB 3I5JC 1I4GA 4ICVA 4KVGB 4A8XC 2WWZA 1ZE3D 1KTKA 2C7MB 1XR0B 4JKDA 2Y8FA 4QJ4B 3ZLZA 2MBBB 2KYWA 4EOYA 1I2HA 1EO6A 2V1YA 3B08A 2OHFA 1RLFA 4DHJD 2PZ1A 3P4SB 1YQBA 3RNFC 3TBLD 3CXBB 2FE8A 3NWDA 1V80A 1M94A 4GU2A 3VUXA 2I5CA 3SD5A 1IGCA 2MCNB 4JKHA 2P0HA 1F0ZA 4P1CC 2WHIA 1PFJA 1ISNA 3D8FA 3DQVA 4DHJB 3BZDB 1BT0A 3W5UB 3FILA 2JU6X 3RNAC 3UQAA 1T0YA 4WWMA 5BYSA 4ASWC 4ILGB 1F1HA 2GJYA 1UF0A 4XYCA 4BOZB 2R2QA 1HB6A 4LK0M 3HRDD 2JX5A 2INPE 2KN4A 3PT2B 3L17A 3QIJA 4WIPA 3PZ8A 4KDIC 3AE9B 3B9JA 2IY0B 3A1QB 3APFA 1LQBA 3B1LX 2V0GA 4EUTA 1EUVB 3NZUA 4A55A 2LOXA 4KKJA 4FBJB 1QC6A 4GGQA 4GB9A 5JZEB 1WE6A 1FCCC 1YN5A 2CB8A 4URKA 3JSVB 3RI7C 5C23A 2Z13A 5EDSA 1WIAA 1WYWB 2IGDA 2LD9A 3AV8A 1V97A 3LYYA 3Q8AA 4KX6B 1IPGA 1HE8A 1KZGA 2BS3B 2WNMA 1PGAA 2N23A 4C00A 1UUPA 1JCKB 4ILJA 1P1AA 2WXRA 3FEHA 2WXIA 4MJSA 2INNE 4LTUA 3DVNV 4L23A 4K2PA 1XKEA 2AX5A 1ET9A 3F5RA 1RRPB 1F52A 2DTCA 4YONA 3IXSA 3PS6A 1MK7B 4P7IA 3VTUA 3NZ3A 1FNUA 1LXDA 2JXXA 2KK8A 1ZXHA 2DAJA 1DDMA 4R3DA 2E6XA 1T6BX 2FAZA 3AEBB 3PLUA 2LBBA 4DX90 1KJTA 1Y8RC 3ALBA 1N61A 3NVWA 3A8QA 5BMGA 4RM8A 3AEEB 4BBNC 2KTRA 4LNIA 4JKBA 5G55A 3SYXA 4MGKE 2W54A 2LGYA 2KMMA 1PQSA 1FGYA 3NHEB 1FIQA 2KX0A 1U5EA 2W82A 2LVOA 4HPMB 2D9VA 1STEA 2M0XA 2G3QB 1MI1A 2RD0A 2OEDA 2MJ3A 2E2XA 2X0SA 2LEKA 4A6FA 2GI9A 1SB3C 3KWLA 1D4BA 4GXBA 3ZNGC 3U8ZA 3QX1A 2W3RA 3HQCA 2MDXA 1N60A 1OQNA 2XK5B 3KWVA 2WX0A 3VQIA 4L1BA 3I3TB 2WDRB 1MFWA 2WDQB 4O1NA 1WJ1A 1WR6E 2REXA 2CU3A 3GE3C 2D07B 2XN9C 2J52A 1WSPA 3TL5A 5JHHA 1VZ7A 4RF1A 3N20C 2G4SA 3PZ7A 3SEBA 4MH0E 3SHQA 2CY4A 4C7ZA 2JQRB 1C76A 1BAKA 1TY2A 2DZMA 5HKHA 2EKEC 2LJIA 4NPNA 1KOTA 4NSWA 1WZ0A 3RFZB 2OQBA 4FJZA 2FCMA 1VJKA 5J3QA 3T3OA 4RMAA 2RRFA 4CSQA 1W1HA 4FADA 2IBIB 4IFSA 3IAM1 2COAA 3PVLA 1VBHA 1XLOA 1GUAB 3AE3B 4HKQA 1I4PA 4K3CA 3NY5A 4LJPB 4C0AA 1V1OA 1VZ6A 2WQYB 3Q8FA 3DXCA 1WI1A 1RYJA 4CYEA 1LM8B 2KTFA 1SE2A 1NDDA 4WH4A 3IT6B 1C79A 4OHJA 1EF1A 2SAKA 1ZSQA 4GDKB 1V6EA 3URYA 1D6EC 1F9JA 5DPTA 2K8CA 3ZNZB 1KH0A 3PG7A 1L5PA 4OVUA 1GOZA 1GJZA 3PSCA 4F7ZA 3UINB 3H7PB 3IBEA 1KLVA 3RD2A 2V3PA 1OY2A 1LB1A 3B77A 2Y5PA 4GPTB 2AEHA 2KN5A 3PHWB 1AN8A 3TEWA 3P2BA 2ZW0A 3AEDB 1GG3A 4HATB 2I1JA 2ELAA 3SNHA 2KDIA 1PGXA 3BVGA 2RDGA 2MQJA 1ZKHA 1IP9A 2FUHB 3QWMA 3W1YA 2FBWB 2KC2A 4WSFA 1SE9A 4MEMA 5AZGA 3HIZA 4BKSD 1XD4A 4PK1A 3K9PB 2D9XA 1V86A 1MJDA 3DHIC 2KWUB 3A9JB 2ONQA 3UIPB 5HE2A 3ODOA 1WJ6A 2MX2A 3QBVB 1QT9A 2M8SA 2N7DA 1XX0A 3NJTA 2LRUA 3ABVB 2K1FA 3O13A 4N58A 4RGNA 4REZA 3EECA 4HB4B 3PRZA 2PMVA 1WXQA 4A9AA 4EMOA 3E66A 1YIWA 2UU7A 4HDQA 4KSKC 3FP5A 2M4NA 2PEAA 4AQ7A 4GOCA 4JKGB 2ZCCA 2H7DA 4NY0A 4HAWB 3TMPB 2WDVB 5CLLB 1ENFA 1NVID 4W9CA 1WXAA 3I57A 2JVCA 2ON8A 3HM6X 3SV1A 3RCPA 1N5XA 4AJYB 2LGXA 1ESFA 4II3B 4HSIA 1YNTE 2KXJA 1PDXA 2BB6A 4MM3B 3J9CA 4NZLB 3ZJVA 4DHZB 1D3ZA 3VRBB 3AE1B 1AW7A 2P0FA 4YSZB 2FJLA 3KVFB 3LDZE 2ROZB 4OT1A 1MI0A 2MHJA 3QK0A 1XCTL 2K22A 1UELA 2I38A 1E8XA 4IUMB 4N9F4 5FKAC 5LG4B 1SEBD 1SXTA 2BF8B 2K2UA 1S3SG 4ACFA 4CHKA 4DWFA 3PRPB 3AI5A 4HK2A 3N7CA 3WIMA 2ZZPB 3GP7A 2QEJC 1UBIA 1NTVA 2KWCA 2Z0DB 1SBBB 4M8MA 2JT4B 2ZCBA 2C7HA 3C19A 5C1ZA 3U12A 3DHHC 2GCJA 4LDTB 2N0SB 2KAJA 3FILB 1K53A 3B2FA 4H2AA 2WP9B 3C0RB 2K5PA 2KACA 3IHPC 3NS8A 3TO1A 4LJOB 3DVGX 4K17A 3KYCD 1I4QA 2R2YA 4WAFA 1WGYA 4HROA 2WXJA 1TT5B 3VTWA 4HJKA 4JKCA 1FHWA 1RM6C 5LXHA 1DDVA 2NS5A 1Q1OA 2CHZA 1KLGD 4W9KA 3FLVA 4NNJB 1EF5A 4A3PA 3LJUX 1FRDA 3R8BA 1HQRD 1XLQA 2CHXA 1WI0A 2NTTA 3KRWA 1MVKA 2XEWA 2DHJA 4FA6A 2WXGA 1E8WA 2E3TA 4C80A 5J18A 1Q0WB 1V89A 1AWEA 2CAYA 4BBNF 1DBHA 1WMHA 1LO5D 2MW5A 2DHKA 4WJOA 1C9FA 3VUYA 4JWSC 4MJSB 4LNKA 2PVOD 3IVFA 2WU2B 3JYUA 5BO4B 4OW0A 1YOVB 1NENB 1C4AA 2IZVB 4W9FA 2YEPF 2N1WA 2WH5A 4DXAB 1OMWA 1RAXA 4USAA 2WGSA 5JXVA 1U2BA 1XO3A 4ZYNA 2DHIA 2GB1A 1SJED 1YX6B 4EKUA 4KV2A 5MPOA 4XWWA 5HI1A 3T3NA 5D3IB 4NAMA 1DYQA 2J0JA 1ET6A 1BTKA 2YEPB 1Z5SB 3W5VB 2KGXB 2KTRB 2UZSA 1V8CA 3PRMB 2WDTB 3TVVA 4D6WA 3GYOA 3PPAA 3MDBC 2R82A 3ML4A 5E6OA 2JXTA 1ZYIA 2FCSA 4KHBA 1TY0A 5KQ1A 4K7SA 1FGZA 3VVWB 1QOFA 3GZNB 3P4QB 1H8CA 1NI2A 4A6FB 1HZ6A 2LGSA 2MWSB 4IC7B 4HAXB 2HJ8A 1CQVA 2HD5B 4DXGA 4XZ4A 1EWYC 2KDFB 2JF5A 1DIKA 5D2MB 1WRIA 2WXNA 1ZW7A 2MH7A 3ZKJC 5HE0A 3Q3JA 1UEFA 3RNCC 4BKSA 3TIXA 4PNKA 4I6LB 2RDBC 3CSTA 1NVLA 3APCA 1X1GA 5DIFB 2Y5BB 1FD6A 2AL3A 4S0RA 2CQUA 4QXAB 1VR9A 2CS4A 4AOFA 3P7ZA 2H7EA 4JKGA 2GCLA 4PS3A 1IUEA 3WCQA 4EZLA 4QJ3B 2R61A 4M8NA 3P1MA 1FB8A 3O96A 2MA9B 4LNFA 2LXCA 4A3OA 2UYZB 5I4DA 5KQ4A 1GB4A 4JK8A 2D9WA 4ZRJA 2DYNA 1UH6A 3IG3A 4YTPB 2RNRB 4L6EA 3WYFB 5BMHA 1J0GA 2IO1B 5HE1A 4MM3A 2Z0QA 4WQMA 1E8ZA 5DPSA 1DOYA 2ZEQA 5FI0A 4H8SA 4JPSA 3OJ3A 3QAQA 2DYQA 5KCVA 2JWUA 3EFUA 2K6QA 4DQOC 4OVZA 1V5MA 4ZDVA 2ZPNA 1WM3A 4C4VA 1HBKA 2X38A 5AUKA 4C56C 1K52A 1MK9B 4JQWC 3KW5B 4IAPA 3PREA 5IAAC 2GBNA 5IOIA 1RJ2A 3ODWA 3MFGA 1MIXA 3AM9A 4BZAA 1JALA 4ZOHC 4TQ0A 2M38A 3SR6A 3ENBA 4A6HA 4KHAA 1J8CA 1ZVRA 3SBGA 2Z4DA 1SE3A 1QILA 1B55A 1FNVA 2C5LC 2KO3A 4ZRPA 2V4IB 4K1RB 1L6UA 2ZPYA 1SSNA 3MTNB 3HK0A 1MHXA 2M0AA 2BYVE 3EGRA 4JLCA 2LUEA 3NW8A 1Z87A 4G0NB 3HW2B 2DENB 1OEYJ 3ZO5B 2AQ3B 2FJ9A 2FCNA 2SEBD 3WA0A 3BINA 1P7FA 4HCPB 1M7EA 3P4RB 2RGNB 1CZPA 2BB5A 4FN2A 2C60A 3ZQ4A 3AE5B 2ZJDA 2KC1A 3M1IB 1S1QB 1SGHA 5LLIA 2NMQA 3FC4A 3DBLB 2D2QA 4KHOA 3ZXRA 3L54A 4WAAA 3GB1A 1J19A 5E6PA 2VSZA 1OQYA 4EZJA 1UNQA 1FFUA 2D9ZA 1MPEA 4KDLB 3Q3OC 1TQZA 3Q6BA 2L2IA 1FEHA 4M00A 2BTEA 4IM2A 1ZGUB 1TJEA 2K8HA 2PPHA 4B6HA 5LONB 3M3JA 3N32A 1U27A 2M14A 1V1PA 4MT7A 4WJPA 3IFWB 2UWQA 5EE9A 5C2TB 5HFYA 5JHAA 3CMMB 2K00A 5C5BA 3JW0X 4I6PA 2D3BA 1A70A 4ZRIA 1WJMA 1ZM0A 4LCDE 3NUHB 2DBYA 4G50A 5J17A 2M1MA 3KLSX 2NVUI 4RF0A 1TBEA 1WGQA 1E7UA 4KAXB 1EVHA 4ANVA 2EJ8A 3MJ5A 4IWOA 4MGIE 1WG7A 4F8CB 2HE7A 2G4DB 2QKLA 3V3XA 2GRIA 2K2JA 2G45B 1WGHA 4F7GA 2RUKB 3BK1A 1WGDA 2W9NA 2R09A 1AWDA 1Q5WB 3DBLI 3I63C 1XLPA 2N7JA 1I35A 2KANA 5FK9C 4DIXA 3AEGB 2QSDA 3BY4B 1Q10A 1FHOA 3P6AA 3VTVA 3A9KA 1I4RA 3L10B 2KQ4X 4FULA 4II2B 2I2YA 2GBRA 1LGRA 1F2RC 4KIKB 2K9XA 3AXCA 1FNWA 4TQ1A 3R3MA 1UWMA 5I2SA 4HKZE 2N0YA 3VH4B 1QKZA 2PKOA 4IKGA 2NZ8B 1QF6A 5D3DA 2FIFA 3ZJTA 2JSVX 5D27A 3U7DA 2O6VD 3KUCB 2O2VB 1FPYA 1P5TA 1R4MB 4JGHB 1YX5B 2L76A 1NI3A 1T0RC 1U5FA 1QQGA 1TTNA 3KQ4A 1HTQA 5TR5A 4Q2JA 2BW2A 5CHFA 1E10A 2GS0A 2DZJA 4NAWB 2O6VB 5EE0A 2K25A 3SUZA 1N6ZA 4BFRA 3H1UA 3TEXA 2VH2A 5E6JA 3FKYA 1FFVA 2KCJA 1BWNA 3NWFA 2W2XC 1WMHB 5G2NA 3RCZA 2J59M 1ZPSA 2N9LA 4OZCA 3DHGC 4FHJA 3PLVA 1JW9D 2HTME 2JZ3B 3T9LA 2LJ5A 1I4XA 4JWUC 5T8IA 5H8YE 4RH6A 4IW0A 2PVGC 1CJEA 1JROA 2KMAA 3HVZA 2ELBA 4KGTA 3AE6B 1B9RA 3P4PB 1MG4A 5EE1A 2MBHA 2LWPA 2B76B 4IWQA 1U5DA 2PJHA 2RVBB 2L32A 1A5RA 1NYRA 3PZDA 1FMAD 2C7NB 3Q8BA 4IM0A 1ZOYB 5E6NA 2KWDA 3OAWA 3AE2B 5BMIA 4WQOB 4BKGA 1AARA 4IM3A 5DPRA 4EJNA 1TS3A 3DWMA 1EWCA 3AB5A 1VBGA 2N7EA 2INCC 1IRSA 3AE4B 5IRSA 4A90A 1R4MI 3TUOA 5JP4A 4KHBB 2XBBC 4M02A 2V3SA 4RGTA 2Q5WD 1WX7A 1P7EA 4WWNA 3E56A 4A20A 5TSSA 5L83A 5KHQA 4MGYE 2BWFA 1TKYA 1TS2A 1SIJA 2VH1A 2COFA 2BCJA 2YRYA 3IT4B 5M4YB 4Z2NA 2ZKMX 4NJCA 3BWUD 2DKQA 1BMLC 3BVZA 4B9KA 1AQCA 4W9GA 2RGFA 3L13A 1N5WA 1NYQA 2J4XA 1PUTA 5BYQA 1WGUA 1TJ6A 2KJ6A 3ZGZA 3EC8A 4W9JA 1WXMA 3AJ4A 1MAIA 4K81A 4JIOU 1BXTA 4FXCA 2DX1A 2CODA 3O65B 1ZXIA 1OTRB 4JX1C 1WGRA 2A4ZA 2AYOB 2H89B 3C8YA 4ILHA 5LXIB 2BS4B 2MP2A 4N6EB 1XCGA 4HAYB 1HA5A 2Z59A 2L1CA 4QAYA 1V2YA 3CWIA 1BUIC 1LW3A 3DXEA 3D32A 2EMSA 1EM7A 4MELA 2AWTA 2K8BA 2RQ1A 2GMIC 4S17A 3SU8X 2WX1A 4B6WA 1WX8A 1AYFA 2N9PC 2DLWA 2Z0PA 4JKFA 1Y19B 4C4VB 4LLGM 2DZIA 1Z2MA 4ZRQA 2A5UA 3L0WB 4EE2A 1WY8A 1E90A 3P42A 4ICUA 3BYYB 1CMXB 2P8VA 3P63A 4OVVA 1BTNA 3BJIA 2QCZA 2CJOA 3A4RA 5BYRA 3EA6A 3GS2A 1PMSA 2L1AA 1KBLA 5AZHA 1WXVA 5GMVA 3GOEA 1MKEA 3UF8A 1G6JA 3ZYYX 2NPTA 1WFYA 5C79A 1WE7A 1FRRA 2LXAA 5EE3A 3D8DA 4F1SA 2WXFA 3DVNU 2IGGA 4KIKA 2LHEA 2MJEA 2M19A 4HAZB 2Y8GA 3DBHB 2LUMA 3ZW3A 3TEZA 3VXWA 1E7PB 4GSWA 3PVWA 3PP2A 2ZW1A 3APDA 2O2VA 4PS8A 1SHCA 3Q2AC 5CX3A 2NBVB 4HVBA 1VLBA 1ZDXA 2RDHA 3R2TA 2BYTA 5AEKB 2BVCA 4YTMB 1E0ZA 1MIZB 4E71A 1XXGA 1J7AA 2L0TA 4MDKE 2FJUB 4MT5A 1VZ8A 1E9MA 2JRIB 4NAWA 3RZWC 2O6VA 3S2AA 2KZRA 2PW9A 2KWVB 3FM8C 2LVQA 1DDWA 2DN6A 2WXQA 2IPKD 1UNRA 2LYDA 2W55A 3ODXA 1TKGA 1I42A 1V1PB 2PE9A 2WXLA 3WAOA 4ZRKA 2JP2A 1YJIA 2BQQA 4PQ0A 1UGJA 2ROVA 2NBUA 3ZNID 5C5BB 3DCGA 1HB8A 2KT7A 2ZVNA 4BVUC 3NG0A 2DIKA 3NVYA 2CY5A 1E8YA 3X23A 2L00B 1EGXA 3QC8B 3ZVVA 2YT0A 2CJNA 1D5XC 4FLHA 2DYBA 4GIVA 3DBHI 3G9WA 4Y94A 5D3XA 2KJRA 4US9A 1K51A 1NBFC 2JRHA 1OEYA 3OJ4B 1UNPA 2RSUA 2HDEA 2QILA 2WXMA 4NQLB 2COPA 3IAS1 2IJ0A 2Y5CA 3ZDMC 3TCAA 1SF0A 1P9DU 3MC0B 4BKTA 4W9EA 2C9WB 1XEEA 2KIEA 2WU5B 4G11A 2YS1A 1GNUA 2DYMA 3A9KB 3TSSA 1SE4A 2PLPA 1W1DA 3GYPA 2WXHA 4NJ7A 2DFKA 2GUMA 3K9OB 3KZ1A 2X8XX 4P6VF 2JUOA 4IDIA 4DBBA 2QJLA 2N9XA 3ZTDA 1L0YB 4JKEA 3ZRFA 3WAMA 3HVDA 2LRWA 4K2OA 3QCAA 3Q14C 1WRDB 4JK9A 2EC1A 2MJDA 3OG5A 4YSYB 2COCA 2MRPA 3BIID 3N3KB 3HM3A 3Q3NC 4ZHPA 1WGKA 1N62A 3V6CB 1HZ5A 1IBXA 2JPHA 2ICIA 1I7HA 3X0WA 2UVMA 1E5WA 1X05A 1U4AA 4ITKA 3AE8B 3PVUA 2AQ2B 2LZ6A 3CSFA 3N9YC 1X11A 2Z0OA 3A98B 5IO9A 1VDVA 3FSSA 1FXIA 2CHWA 1FM0D 3ULBA 1TIFA 3L4PA 2CRFA 3HSAA 1P3QU 4RNAA 3N1ZC 3CIKA 1T5XD 1ZP0B 1V5OA 2GOWA 3DBSA 1Y5OA 3OWEB 1M4VA 1D5ZC 4A5KA 1UGMA 1T0QC 2J53A 5IJMA 2MKRA 1ACAA 3UQBA 3VAWA 1XCQL 4PYUA 2J42A 4KKIA 3KY9A 4XDDA 1I7AA 3R66C 4OZBA 3V62A 3QWZB 2DZKA 3ZXVA 4YXDB 5HG2A 1KLUD 3T8MA 3W1SC 3NZSA 2J0MA 2QC8A 1WM2A 3TW1A 3U30A 2W2WA 4E74A 1UD7A 4Z2MB 2YLMA 4XDCA 4RCOA 2JYEA 4AUQC 1XLNA 4BOSC 2D11A 1DOXA 2ZNVC 2VKIA 5JHGA 2YT2A 1L4ZB 5JLJB 1ZC3B 2V3NA 3Q69A 4HPLB 5JH5C 3U7ZA 5D7GA 1JRPA 2NCNA 3H9DA 4ANWA 3H7SA 1F77A 3VUWA 5CHVC 4TMAB 1DOIA 4HPPA 2LOZA 3NVVA 3U2SC 1T77A 1WWTA 3NSUA 1NTYA 5KHOA 1L4DB 4WWOA 3KRXA 2K6DB 4WJNA 2IDYA 3RMKC 4X57B 1KC7A 3OHMB 3AEFB 3NVZA 3ZJUA 2KFKA 3A58A 5C6RA 2IO3B 2ASQA 3ZRCA 4KZCA 2NBVA 1V5UA 1GPXA 4P16A 1JWUD 1C77A 1U29A 2ZVOA 2LVPA 4XWXA 2G9HD 3ECIA 2QKMA 1OQQA 3KH0A 2IGHA 4BBKA 4QJ5B 2HJ1A 5EFXA 4WWPA 4TV3A 2Z0EB 2L3ZA 3MHSD 4YSXB 4ANXA 2BT6A 2AQ1B 3OLMD 3AECB 4IOYX 1C3TA 4ARCA 2DX5A 1TZ1A 2IYBA 3DPDA 4B0MA 1ZDVA 2MP2B 3DVGY 3ETRA 3RNEC 2KJHB 2AL6A 1JDEA 1V5TA 4HDOA 2Z59B 3PTFC 1M7RA 2P0DA 1PLSA 1OGWA 4AJWA 3EHVA 2KDMA 1UPQA 4E3CA 4W9DA 4MSQB 3RYTA 1GGOA 4I6NB 1KI1B 1L0XB 1K5DB 2V4LA 4YT0B 1GB1A 3KSYA 3ZIMA 5L95C 4DDID 1U5GA 1MG8A 2GBMA 2IO0B 3ZTCA 3AEAB 2YS5A 1K8RB 1KM7A 5D3VA 3L16A 2JYTA 2RSGA 2V76A 2WYQA 2Z8LA 3GE8C 3U4EG 2KNBA 1UPRA 3RNBC 4ZHOA 2MFQA 2D3CA 3E9OA 2N9KA 3BK2A 1X1FA 1TGZB 3QQ8B 1WGGA 4P1BC 3MHZA 1V9JA 5D3YA 2NPTB 5G5HA 4MSMB 3RZFA 3SFDB 5LNK1 2BKFA 4GOUA 1FXAA 3N30A 4IG7B 5I2MA 1FOEA 4HLEA 1QLBB 2HTHA 3PO0A 2DWQA 4MACA 2KD0A
chains in the Genus database with same CATH topology
3ML9A 4CO7A 3E9PA 5JVLA 2I1KA 1WH3A 4G3XB 4IWPA 2LI5A 3DDCB 2N9EB 4M0WB 3RULA 3VDZA 4NJ6A 4AP4C 3EPYA 1P0RA 5DHAB 1LFDA 2BKRB 3ZVRA 3VOQA 1KZ7A 3HHMA 3VFKA 1VCBA 1FAOA 3T06A 3R7RA 3WALA 1DYNA 3H6NA 1WJ4A 2FIDA 2Y7BA 3RT3B 4GDLA 3A8PA 2DHZA 5J2RA 4MK0A 1XQQA 2RR9A 2YS3A 3SDLC 1P6SA 1YJ1A 4KZ0A 1V61A 2QHOA 2MBEA 2KDBA 5D6JB 4EZKA 3ZUNA 3OANA 5DH9B 2R0DA 1ZC4B 4FJYA 2VRRB 2J0KA 2ADZA 4AWJA 4F7HA 1SIFA 2IYDB 2KX3A 3AU4A 4DBGA 3V5WA 3A4SC 3A33B 2D4QA 2DAFA 2KVRA 1V81A 2HRJA 2DKPA 1P3RA 1R4NI 3F0WA 3M63B 4HXDA 4W9IA 4EFOA 3ZDTA 3A1QA 3UIOB 2J7QB 4B95A 4RM9A 4EEWA 3M95A 1EAZA 3MJWA 4DDGD 3M62B 1H4RA 2IO2B 5CTRC 1YD8U 3JSVA 4J6IA 5FR6A 1C1YB 4NQKE 3ENEA 3V6EB 3V60A 1IYFA 2GBKA 1H10A 2JZZA 1V5PA 4TYZA 3LJ3A 2BYEA 2RLOA 2VRWB 1RFAA 5FI1A 2YSZA 4JK7A 2K39A 4FJVB 2ZNVB 5C16A 3VIAA 2I5FA 2LGDA 3D8EA 2BGFA 3UGBB 2NBWB 4TUUA 3AULA 1N3HA 3B0AA 4FHKA 1RRBA 4WJQA 3VH3B 4KSLC 4MGZE 3WANA 4WJ7A 2B3AA 2KDEB 2L8JA 2IFSA 3CF6E 3QA8A 4A6KA 4MY6A 4LDTD 1VD2A 3UZTA 4JKAA 1MPHA 3WAPA 2D10A 5CHWA 5L81A 3AU5A 3L08A 4WVFB 3PSEB 2YVCA 4HAUB 5DCNA 2YT1A 4GZUA 2L0FA 4HAVB 5D94A 2KFKB 2MSED 3DBRI 2BPSA 3SBTA 2FNJB 2CR5A 3DOWA 4HWIB 4XC2A 3VHTC 2L05A 2N1VA 2XK5A 2MBOA 2JWZA 5J3YA 3ML8A 4DX8A 2LASA 1WVHA 1DROA 1NU2A 4K7WA 2DX5B 5J3TA 4D0NB 4JL9A 4W9LA 3QHTA 2KLGA 3DXDA 1L2NA 4TKNA 1TXDA 5DHFB 3ONSA 2KQSA 1X1MA 4PYZA 3RUIB 1P98A 1UBQA 3KUZA 2UZRA 2JY6A 4CHJA 5DI9B 3TJPA 2MBQA 5LOPB 4CHMA 2CU1A 2N4FA 3JVZX 2BWES 2YF0A 2G35A 2KQ7A 4YL8A 3Q3FA 4DHZE 4GDKA 4HHVA 1GC7A 3E9LA 2KMCA 1NTIA 2XQNM 3MPXA 2L7RA 3NOBA 3V61A 2LG1A 4HCNB 2OOBB 2LKOA 1QZEA 3H7PA 1FHXA 1JRUA 5D3WA 2NMBA 2PE6B 4PS7A 2FCQA 4GMXB 2R2OA 1K5GB 3SO6A 2HTHB 1WXSA 1UZXB 4F7UP 2KOXA 5GOWB 5JHBA 1WX9A 4W9HA 2KLCA 2M17A 2W2XD 2Q13A 4K7UA 3ULCA 1WR1A 1WJNA 2KFJA 2DA0A 4HB0B 3A9JA 2OTXA 4XX5A 3KYDD 1E7VA 3ZNHB 1FXTB 5IA7A 3KUDB 3PV1A 4HB3B 2FDQA 2ABDA 3QJZA 2IY1B 2KUPA 1V88A 2BYFA 4HB2B 3TFMA 1L7YA 2MWNB 1V49A 5AZFA 4GMVA 3R7QA 2MLBA 2OJRA 4DK5A 2EMTA 4GN1A 1XD3B 1XT9B 1WJUA 5HE3A 4ANUA 2CKHB 2GBJA 1ST7A 3W1SA 1J0WA 1W1GA 2KHWB 1GC6A 4GDLB 3PHXB 1WZ3A 5DPWA 2KKCA 2RPQA 1Q67A 2NR2A 1X86A 3PGEA 3QARA 2DYOA 1XODA 2D3GA 2D9YA 2X18A 3PEGA 1WF9A 2LULA 3GZNI 5CLQB 4ICVA 4KVGB 2WWZA 2C7MB 1XR0B 4JKDA 2Y8FA 3ZLZA 2MBBB 4EOYA 1I2HA 1EO6A 2V1YA 3B08A 4DHJD 1RLFA 2PZ1A 1YQBA 3TBLD 3CXBB 1V80A 1M94A 4GU2A 3VUXA 2I5CA 3SD5A 2MCNB 4JKHA 2P0HA 1PFJA 1ISNA 3D8FA 3DQVA 4DHJB 1BT0A 3UQAA 1T0YA 4ASWC 4ILGB 2GJYA 4BOZB 2R2QA 1HB6A 3PT2B 3L17A 3QIJA 4KDIC 2IY0B 3A1QB 3APFA 1LQBA 3B1LX 4EUTA 1EUVB 3NZUA 2LOXA 4FBJB 1QC6A 4GGQA 4GB9A 5JZEB 1WE6A 2CB8A 4URKA 3JSVB 5C23A 5EDSA 1WIAA 1WYWB 2LD9A 1IPGA 1HE8A 1KZGA 2N23A 4ILJA 1P1AA 3FEHA 4MJSA 3DVNV 4K2PA 1XKEA 3F5RA 1RRPB 2DTCA 4YONA 3PS6A 1MK7B 4P7IA 3VTUA 1LXDA 2JXXA 2KK8A 2DAJA 1DDMA 2FAZA 3PLUA 2LBBA 4DX90 1KJTA 1Y8RC 3ALBA 3A8QA 4RM8A 4BBNC 2KTRA 4JKBA 5G55A 3SYXA 4MGKE 2LGYA 1PQSA 1FGYA 3NHEB 2KX0A 1U5EA 2LVOA 4HPMB 2D9VA 2M0XA 2G3QB 2RD0A 2E2XA 2X0SA 4A6FA 4GXBA 3ZNGC 3U8ZA 3QX1A 3HQCA 2MDXA 1OQNA 2XK5B 2WX0A 3VQIA 3I3TB 1WJ1A 1WR6E 2REXA 2D07B 3TL5A 5JHHA 2G4SA 4MH0E 3SHQA 2CY4A 1BAKA 2DZMA 5HKHA 2EKEC 4NPNA 1KOTA 4NSWA 1WZ0A 2OQBA 4FJZA 2FCMA 5J3QA 4RMAA 1W1HA 4FADA 2IBIB 4IFSA 2COAA 3PVLA 1VBHA 1GUAB 3NY5A 4LJPB 4C0AA 3DXCA 1WI1A 4CYEA 1LM8B 2KTFA 1NDDA 1EF1A 1ZSQA 4GDKB 1V6EA 1F9JA 5DPTA 2K8CA 3ZNZB 3PG7A 4OVUA 1GJZA 3PSCA 4F7ZA 3UINB 3H7PB 3IBEA 1KLVA 3RD2A 1OY2A 1LB1A 4GPTB 2AEHA 2KN5A 3PHWB 3P2BA 1GG3A 4HATB 2I1JA 2ELAA 3SNHA 2KDIA 2MQJA 1ZKHA 1IP9A 2FUHB 3QWMA 3W1YA 2KC2A 4MEMA 5AZGA 4WSFA 1SE9A 3HIZA 4BKSD 1XD4A 3K9PB 2D9XA 1V86A 2KWUB 3A9JB 3UIPB 5HE2A 3ODOA 1WJ6A 2MX2A 3QBVB 2M8SA 2N7DA 1XX0A 2LRUA 2K1FA 3EECA 4HB4B 3PRZA 4EMOA 3E66A 1YIWA 4HDQA 4KSKC 3FP5A 2M4NA 2PEAA 4GOCA 4JKGB 2ZCCA 2H7DA 4NY0A 4HAWB 3TMPB 5CLLB 4W9CA 1WXAA 2JVCA 3HM6X 3SV1A 3RCPA 4AJYB 2LGXA 4II3B 2KXJA 4DHZB 1D3ZA 2P0FA 2FJLA 3KVFB 3LDZE 2ROZB 3QK0A 1UELA 1E8XA 4IUMB 4N9F4 2BF8B 2K2UA 1S3SG 4CHKA 4DWFA 3PRPB 3AI5A 4HK2A 3N7CA 3WIMA 2ZZPB 1UBIA 1NTVA 2KWCA 2Z0DB 4M8MA 2JT4B 2ZCBA 2C7HA 5C1ZA 2GCJA 4LDTB 3C0RB 3IHPC 3NS8A 3TO1A 4LJOB 3DVGX 4K17A 3KYCD 1WGYA 3VTWA 4HJKA 4JKCA 1FHWA 5LXHA 1DDVA 2NS5A 1Q1OA 2CHZA 4W9KA 3FLVA 4NNJB 1EF5A 4A3PA 3LJUX 2CHXA 1WI0A 3KRWA 2XEWA 2DHJA 4FA6A 1E8WA 5J18A 1Q0WB 1V89A 1AWEA 2CAYA 4BBNF 1DBHA 1WMHA 2MW5A 4WJOA 2DHKA 3VUYA 4MJSB 3IVFA 3JYUA 5BO4B 2IZVB 4W9FA 2N1WA 2WH5A 4DXAB 1OMWA 1RAXA 1U2BA 4ZYNA 2DHIA 1YX6B 4EKUA 4KV2A 2J0JA 1BTKA 1Z5SB 2KGXB 2KTRB 2UZSA 3PRMB 2WDTB 3TVVA 3GYOA 3PPAA 3MDBC 2R82A 3ML4A 5E6OA 2FCSA 5KQ1A 4K7SA 1FGZA 3VVWB 1H8CA 1NI2A 4A6FB 2MWSB 4IC7B 4HAXB 2HJ8A 2HD5B 4XZ4A 2KDFB 2JF5A 1DIKA 5D2MB 1ZW7A 3ZKJC 5HE0A 3Q3JA 1UEFA 4BKSA 3TIXA 4PNKA 4I6LB 3CSTA 1NVLA 3APCA 1X1GA 5DIFB 2Y5BB 2AL3A 2CQUA 2CS4A 4AOFA 3P7ZA 2H7EA 4JKGA 2GCLA 4PS3A 4EZLA 4M8NA 1FB8A 3O96A 2MA9B 4A3OA 2LXCA 2UYZB 5KQ4A 4JK8A 2D9WA 4ZRJA 2DYNA 1UH6A 3IG3A 2RNRB 4L6EA 3WYFB 1J0GA 2IO1B 5HE1A 4MM3A 2Z0QA 1E8ZA 5DPSA 2ZEQA 5FI0A 4H8SA 3OJ3A 3QAQA 2DYQA 5KCVA 3EFUA 2K6QA 1V5MA 4ZDVA 2ZPNA 1WM3A 1HBKA 1MK9B 4JQWC 3KW5B 4IAPA 3PREA 5IAAC 2GBNA 1RJ2A 3ODWA 1MIXA 4TQ0A 2M38A 3ENBA 4A6HA 4KHAA 1J8CA 1ZVRA 3SBGA 1B55A 2C5LC 2KO3A 4K1RB 2ZPYA 3MTNB 3HK0A 2BYVE 4JLCA 2LUEA 1Z87A 4G0NB 3HW2B 2DENB 1OEYJ 3ZO5B 2FJ9A 2FCNA 3WA0A 3BINA 4HCPB 1M7EA 2RGNB 4FN2A 2C60A 2ZJDA 2KC1A 3M1IB 1S1QB 1SGHA 5LLIA 2D2QA 4KHOA 3L54A 4WAAA 1J19A 5E6PA 2VSZA 1OQYA 4EZJA 1UNQA 2D9ZA 4KDLB 1TQZA 2L2IA 4IM2A 1ZGUB 2K8HA 2PPHA 4B6HA 5LONB 3M3JA 3N32A 1U27A 2M14A 4MT7A 4WJPA 3IFWB 2UWQA 5JHAA 3CMMB 2K00A 5C5BA 3JW0X 4I6PA 4ZRIA 1WJMA 1ZM0A 4LCDE 4G50A 5J17A 2M1MA 2NVUI 1TBEA 1WGQA 1E7UA 4KAXB 1EVHA 4ANVA 2EJ8A 4IWOA 4MGIE 1WG7A 4F8CB 2HE7A 2G4DB 2QKLA 2K2JA 2G45B 1WGHA 4F7GA 2RUKB 1WGDA 2W9NA 2R09A 1Q5WB 3DBLI 1I35A 2KANA 3BY4B 1FHOA 3P6AA 3VTVA 3A9KA 3L10B 4FULA 4II2B 2GBRA 4KIKB 3AXCA 4TQ1A 3R3MA 2N0YA 3VH4B 2NZ8B 2FIFA 5D27A 3U7DA 2O6VD 3KUCB 2O2VB 1P5TA 4JGHB 1YX5B 2L76A 1U5FA 1QQGA 1TTNA 5TR5A 5CHFA 2GS0A 2DZJA 4NAWB 2O6VB 2K25A 3SUZA 4BFRA 3H1UA 2KCJA 1BWNA 2W2XC 1WMHB 5G2NA 3RCZA 2J59M 4FHJA 3PLVA 2JZ3B 3T9LA 2LJ5A 4IW0A 2KMAA 2ELBA 2MBHA 2LWPA 4IWQA 1U5DA 2PJHA 2RVBB 1A5RA 3PZDA 2C7NB 4IM0A 5E6NA 3OAWA 4WQOB 4BKGA 1AARA 4IM3A 5DPRA 4EJNA 1VBGA 2N7EA 1IRSA 1R4MI 5JP4A 4KHBB 2XBBC 2V3SA 1WX7A 4WWNA 4A20A 5L83A 5KHQA 4MGYE 2BWFA 2COFA 2BCJA 2YRYA 4Z2NA 2DKQA 4B9KA 1AQCA 4W9GA 2RGFA 3L13A 1WGUA 1TJ6A 2KJ6A 3EC8A 4W9JA 1WXMA 3AJ4A 1MAIA 4K81A 4JIOU 2DX1A 2CODA 3O65B 1OTRB 1WGRA 2A4ZA 2AYOB 4ILHA 5LXIB 2MP2A 1XCGA 4HAYB 2L1CA 1V2YA 1LW3A 3DXEA 3D32A 2EMSA 4MELA 2AWTA 2K8BA 2RQ1A 2GMIC 3SU8X 2WX1A 4B6WA 1WX8A 2N9PC 2DLWA 2Z0PA 4JKFA 1Y19B 2DZIA 1Z2MA 2A5UA 3L0WB 1WY8A 1E90A 4ICUA 1CMXB 2P8VA 4OVVA 1BTNA 3BJIA 3A4RA 1PMSA 1KBLA 5AZHA 1WXVA 5GMVA 3GOEA 1MKEA 3UF8A 1G6JA 2NPTA 1WFYA 5C79A 1WE7A 2LXAA 3D8DA 4F1SA 3DVNU 4KIKA 4HAZB 2Y8GA 3ZW3A 3VXWA 4GSWA 3PVWA 3PP2A 3APDA 2O2VA 4PS8A 1SHCA 5CX3A 2NBVB 4HVBA 5AEKB 1MIZB 4E71A 2L0TA 4MDKE 3RZWC 2JRIB 4NAWA 2O6VA 3S2AA 2KZRA 2KWVB 3FM8C 2LVQA 1DDWA 2DN6A 1UNRA 2LYDA 3ODXA 1I42A 2PE9A 3WAOA 4ZRKA 2JP2A 4PQ0A 2ROVA 2NBUA 3ZNID 5C5BB 3DCGA 1HB8A 2ZVNA 4BVUC 2DIKA 2CY5A 1E8YA 3X23A 2L00B 1EGXA 3QC8B 3ZVVA 2YT0A 4FLHA 2DYBA 4GIVA 3DBHI 3G9WA 4Y94A 5D3XA 2KJRA 1NBFC 2JRHA 1OEYA 3OJ4B 1UNPA 2RSUA 4NQLB 2COPA 3ZDMC 3TCAA 1P9DU 4BKTA 4W9EA 2C9WB 4G11A 2YS1A 1GNUA 2DYMA 3A9KB 1W1DA 3GYPA 4NJ7A 2DFKA 3K9OB 3KZ1A 2JUOA 4DBBA 2N9XA 3ZTDA 4JKEA 3ZRFA 3WAMA 2LRWA 4K2OA 3QCAA 1WRDB 4JK9A 2EC1A 2COCA 2MRPA 3N3KB 3HM3A 3V6CB 2JPHA 3X0WA 2UVMA 1E5WA 1X05A 1U4AA 3PVUA 2LZ6A 3CSFA 1X11A 2Z0OA 3A98B 3FSSA 2CHWA 3ULBA 2CRFA 1P3QU 3CIKA 1V5OA 2GOWA 3DBSA 1Y5OA 4A5KA 1UGMA 5IJMA 2MKRA 1ACAA 3UQBA 3VAWA 4PYUA 3KY9A 1I7AA 3R66C 3V62A 3QWZB 2DZKA 3T8MA 3W1SC 3NZSA 2J0MA 1WM2A 3TW1A 3U30A 2W2WA 4E74A 1UD7A 4Z2MB 2YLMA 4AUQC 4BOSC 2D11A 2ZNVC 2VKIA 5JHGA 5JLJB 1ZC3B 4HPLB 5JH5C 5D7GA 2NCNA 3H9DA 4ANWA 3H7SA 3VUWA 5CHVC 2LOZA 3NSUA 1NTYA 5KHOA 4WWOA 3KRXA 2K6DB 4WJNA 4X57B 1KC7A 2KFKA 5C6RA 2IO3B 2ASQA 3ZRCA 4KZCA 1V5UA 1U29A 2ZVOA 2LVPA 4XWXA 3ECIA 2QKMA 3KH0A 4BBKA 5EFXA 4WWPA 4TV3A 2Z0EB 2L3ZA 3MHSD 4ANXA 3OLMD 4IOYX 1C3TA 2DX5A 1TZ1A 2IYBA 3DPDA 2MP2B 3DVGY 2KJHB 2AL6A 1JDEA 1V5TA 4HDOA 2Z59B 3PTFC 1M7RA 2P0DA 1PLSA 1OGWA 4AJWA 3EHVA 1UPQA 4E3CA 4W9DA 4MSQB 3RYTA 1GGOA 4I6NB 1KI1B 1K5DB 2V4LA 3KSYA 3ZIMA 5L95C 4DDID 1U5GA 1MG8A 2GBMA 2IO0B 3ZTCA 2YS5A 1K8RB 1KM7A 5D3VA 3L16A 2RSGA 2V76A 2WYQA 2KNBA 1UPRA 2MFQA 3E9OA 1X1FA 1TGZB 3QQ8B 1WGGA 1V9JA 5D3YA 2NPTB 4MSMB 3RZFA 2BKFA 3N30A 4IG7B 1FOEA 4HLEA 2HTHA 2KD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML9 A;  4CO7 A;  2I1K A;  1WH3 A;  4G3X B;  4IWP A;  2LI5 A;  3DDC B;  2N9E B;  4M0W B;  3RUL A;  3VDZ A;  4NJ6 A;  4AP4 C;  3EPY A;  1P0R A;  5DHA B;  1LFD A;  2BKR B;  3ZVR A;  3VOQ A;  1KZ7 A;  3HHM A;  3VFK A;  1VCB A;  1FAO A;  3T06 A;  3R7R A;  3WAL A;  1DYN A;  3H6N A;  1WJ4 A;  2FID A;  2Y7B A;  3RT3 B;  4GDL A;  3A8P A;  2DHZ A;  5J2R A;  4MK0 A;  1XQQ A;  2RR9 A;  2YS3 A;  3SDL C;  1P6S A;  1YJ1 A;  4KZ0 A;  1V61 A;  2QHO A;  2MBE A;  2KDB A;  5D6J B;  4EZK A;  3ZUN A;  3OAN A;  5DH9 B;  2R0D A;  1ZC4 B;  4FJY A;  2VRR B;  2J0K A;  2ADZ A;  4AWJ A;  4F7H A;  1SIF A;  2IYD B;  2KX3 A;  3AU4 A;  4DBG A;  3V5W A;  3A4S C;  3A33 B;  2D4Q A;  2DAF A;  2KVR A;  1V81 A;  2HRJ A;  2DKP A;  1P3R A;  1R4N I;  3F0W A;  3M63 B;  4HXD A;  4W9I A;  4EFO A;  3ZDT A;  3A1Q A;  3UIO B;  2J7Q B;  4B95 A;  4RM9 A;  4EEW A;  3M95 A;  1EAZ A;  3MJW A;  4DDG D;  3M62 B;  1H4R A;  2IO2 B;  5CTR C;  1YD8 U;  3JSV A;  4J6I A;  5FR6 A;  1C1Y B;  4NQK E;  3ENE A;  3V6E B;  3V60 A;  1IYF A;  2GBK A;  1H10 A;  2JZZ A;  1V5P A;  4TYZ A;  3LJ3 A;  2BYE A;  2RLO A;  2VRW B;  1RFA A;  5FI1 A;  2YSZ A;  2K39 A;  4FJV B;  2ZNV B;  5C16 A;  3VIA A;  2I5F A;  2LGD A;  3D8E A;  2BGF A;  3UGB B;  2NBW B;  4TUU A;  3AUL A;  1N3H A;  3B0A A;  4FHK A;  1RRB A;  4WJQ A;  3VH3 B;  4KSL C;  4MGZ E;  3WAN A;  4WJ7 A;  2B3A A;  2KDE B;  2L8J A;  2IFS A;  3CF6 E;  3QA8 A;  4A6K A;  4MY6 A;  4LDT D;  1VD2 A;  3UZT A;  1MPH A;  3WAP A;  2D10 A;  5CHW A;  5L81 A;  3AU5 A;  3L08 A;  4WVF B;  3PSE B;  2YVC A;  4HAU B;  5DCN A;  2YT1 A;  4GZU A;  2L0F A;  4HAV B;  5D94 A;  2KFK B;  2MSE D;  3DBR I;  2BPS A;  2FNJ B;  2CR5 A;  3DOW A;  4HWI B;  4XC2 A;  3VHT C;  2L05 A;  2N1V A;  2XK5 A;  2MBO A;  2JWZ A;  5J3Y A;  3ML8 A;  4DX8 A;  2LAS A;  1WVH A;  1DRO A;  1NU2 A;  4K7W A;  2DX5 B;  5J3T A;  4D0N B;  4JL9 A;  4W9L A;  3QHT A;  2KLG A;  3DXD A;  1L2N A;  4TKN A;  1TXD A;  5DHF B;  3ONS A;  2KQS A;  1X1M A;  4PYZ A;  3RUI B;  1P98 A;  1UBQ A;  3KUZ A;  2UZR A;  2JY6 A;  4CHJ A;  5DI9 B;  3TJP A;  2MBQ A;  5LOP B;  4CHM A;  2CU1 A;  2N4F A;  3JVZ X;  2BWE S;  2YF0 A;  2G35 A;  2KQ7 A;  4YL8 A;  3Q3F A;  4DHZ E;  4GDK A;  4HHV A;  1GC7 A;  2KMC A;  1NTI A;  2XQN M;  3MPX A;  2L7R A;  3NOB A;  3V61 A;  2LG1 A;  4HCN B;  2OOB B;  2LKO A;  1QZE A;  3H7P A;  1FHX A;  1JRU A;  5D3W A;  2NMB A;  2PE6 B;  4PS7 A;  2FCQ A;  4GMX B;  2R2O A;  1K5G B;  3SO6 A;  2HTH B;  1WXS A;  1UZX B;  4F7U P;  2KOX A;  5GOW B;  5JHB A;  1WX9 A;  4W9H A;  2KLC A;  2M17 A;  2W2X D;  2Q13 A;  4K7U A;  3ULC A;  1WR1 A;  1WJN A;  2KFJ A;  2DA0 A;  4HB0 B;  3A9J A;  2OTX A;  4XX5 A;  3KYD D;  1E7V A;  3ZNH B;  1FXT B;  5IA7 A;  3KUD B;  3PV1 A;  4HB3 B;  2FDQ A;  2ABD A;  3QJZ A;  2IY1 B;  2KUP A;  1V88 A;  2BYF A;  4HB2 B;  3TFM A;  1L7Y A;  2MWN B;  1V49 A;  5AZF A;  4GMV A;  3R7Q A;  2MLB A;  2OJR A;  4DK5 A;  2EMT A;  4GN1 A;  1XD3 B;  1XT9 B;  1WJU A;  5HE3 A;  4ANU A;  2CKH B;  2GBJ A;  1ST7 A;  3W1S A;  1J0W A;  1W1G A;  2KHW B;  1GC6 A;  4GDL B;  3PHX B;  1WZ3 A;  5DPW A;  2KKC A;  2RPQ A;  1Q67 A;  2NR2 A;  1X86 A;  3PGE A;  3QAR A;  2DYO A;  1XOD A;  2D3G A;  2D9Y A;  2X18 A;  3PEG A;  1WF9 A;  2LUL A;  3GZN I;  5CLQ B;  4ICV A;  4KVG B;  2WWZ A;  2C7M B;  1XR0 B;  2Y8F A;  3ZLZ A;  2MBB B;  4EOY A;  1I2H A;  1EO6 A;  2V1Y A;  3B08 A;  4DHJ D;  1RLF A;  2PZ1 A;  1YQB A;  3TBL D;  3CXB B;  1V80 A;  1M94 A;  4GU2 A;  3VUX A;  2I5C A;  3SD5 A;  2MCN B;  2P0H A;  1PFJ A;  1ISN A;  3D8F A;  3DQV A;  4DHJ B;  1BT0 A;  3UQA A;  1T0Y A;  4ASW C;  2GJY A;  4BOZ B;  2R2Q A;  1HB6 A;  3PT2 B;  3L17 A;  3QIJ A;  4KDI C;  2IY0 B;  3A1Q B;  3APF A;  1LQB A;  3B1L X;  4EUT A;  1EUV B;  3NZU A;  2LOX A;  4FBJ B;  1QC6 A;  4GGQ A;  4GB9 A;  5JZE B;  1WE6 A;  2CB8 A;  4URK A;  3JSV B;  5C23 A;  5EDS A;  1WIA A;  1WYW B;  2LD9 A;  1IPG A;  1HE8 A;  1KZG A;  2N23 A;  1P1A A;  3FEH A;  4MJS A;  3DVN V;  4K2P A;  1XKE A;  3F5R A;  1RRP B;  2DTC A;  4YON A;  3PS6 A;  1MK7 B;  4P7I A;  3VTU A;  1LXD A;  2JXX A;  2KK8 A;  2DAJ A;  1DDM A;  2FAZ A;  3PLU A;  2LBB A;  4DX9 0;  1KJT A;  1Y8R C;  3ALB A;  3A8Q A;  4RM8 A;  4BBN C;  2KTR A;  5G55 A;  3SYX A;  4MGK E;  2LGY A;  1PQS A;  1FGY A;  3NHE B;  2KX0 A;  1U5E A;  2LVO A;  4HPM B;  2D9V A;  2M0X A;  2G3Q B;  2RD0 A;  2E2X A;  4A6F A;  4GXB A;  3ZNG C;  3U8Z A;  3QX1 A;  3HQC A;  2MDX A;  1OQN A;  2XK5 B;  2WX0 A;  3VQI A;  3I3T B;  1WJ1 A;  1WR6 E;  2REX A;  2D07 B;  3TL5 A;  5JHH A;  2G4S A;  4MH0 E;  3SHQ A;  2CY4 A;  1BAK A;  2DZM A;  5HKH A;  2EKE C;  4NPN A;  1KOT A;  4NSW A;  1WZ0 A;  2OQB A;  4FJZ A;  2FCM A;  5J3Q A;  4RMA A;  1W1H A;  4FAD A;  2IBI B;  4IFS A;  2COA A;  3PVL A;  1GUA B;  3NY5 A;  4LJP B;  4C0A A;  3DXC A;  1WI1 A;  4CYE A;  1LM8 B;  2KTF A;  1NDD A;  1EF1 A;  1ZSQ A;  4GDK B;  1V6E A;  1F9J A;  5DPT A;  2K8C A;  3ZNZ B;  3PG7 A;  4OVU A;  1GJZ A;  3PSC A;  4F7Z A;  3UIN B;  3H7P B;  3IBE A;  1KLV A;  3RD2 A;  1OY2 A;  1LB1 A;  4GPT B;  2AEH A;  2KN5 A;  3PHW B;  3P2B A;  1GG3 A;  4HAT B;  2I1J A;  2ELA A;  3SNH A;  2KDI A;  2MQJ A;  1ZKH A;  1IP9 A;  2FUH B;  3QWM A;  3W1Y A;  2KC2 A;  4MEM A;  5AZG A;  4WSF A;  1SE9 A;  3HIZ A;  4BKS D;  1XD4 A;  3K9P B;  2D9X A;  1V86 A;  2KWU B;  3A9J B;  3UIP B;  5HE2 A;  3ODO A;  1WJ6 A;  2MX2 A;  3QBV B;  2M8S A;  2N7D A;  1XX0 A;  2LRU A;  2K1F A;  3EEC A;  4HB4 B;  3PRZ A;  4EMO A;  1YIW A;  4HDQ A;  4KSK C;  3FP5 A;  2M4N A;  2PEA A;  4GOC A;  2ZCC A;  2H7D A;  4NY0 A;  4HAW B;  3TMP B;  5CLL B;  4W9C A;  1WXA A;  2JVC A;  3HM6 X;  3SV1 A;  3RCP A;  4AJY B;  2LGX A;  4II3 B;  2KXJ A;  4DHZ B;  1D3Z A;  2P0F A;  2FJL A;  3KVF B;  3LDZ E;  2ROZ B;  3QK0 A;  1UEL A;  1E8X A;  4IUM B;  4N9F 4;  2BF8 B;  2K2U A;  1S3S G;  4CHK A;  4DWF A;  3PRP B;  3AI5 A;  4HK2 A;  3N7C A;  3WIM A;  2ZZP B;  1UBI A;  1NTV A;  2KWC A;  2Z0D B;  4M8M A;  2JT4 B;  2ZCB A;  2C7H A;  5C1Z A;  2GCJ A;  4LDT B;  3C0R B;  3IHP C;  3NS8 A;  3TO1 A;  4LJO B;  3DVG X;  4K17 A;  3KYC D;  1WGY A;  3VTW A;  4HJK A;  1FHW A;  5LXH A;  1DDV A;  2NS5 A;  1Q1O A;  2CHZ A;  4W9K A;  3FLV A;  4NNJ B;  1EF5 A;  4A3P A;  3LJU X;  2CHX A;  1WI0 A;  3KRW A;  2XEW A;  2DHJ A;  4FA6 A;  1E8W A;  5J18 A;  1Q0W B;  1V89 A;  1AWE A;  2CAY A;  4BBN F;  1DBH A;  1WMH A;  2MW5 A;  4WJO A;  2DHK A;  3VUY A;  4MJS B;  3IVF A;  3JYU A;  5BO4 B;  2IZV B;  4W9F A;  2N1W A;  2WH5 A;  4DXA B;  1OMW A;  1RAX A;  1U2B A;  4ZYN A;  2DHI A;  1YX6 B;  4EKU A;  4KV2 A;  2J0J A;  1BTK A;  1Z5S B;  2KGX B;  2KTR B;  2UZS A;  3PRM B;  2WDT B;  3TVV A;  3GYO A;  3PPA A;  3MDB C;  3ML4 A;  5E6O A;  2FCS A;  5KQ1 A;  4K7S A;  1FGZ A;  3VVW B;  1H8C A;  1NI2 A;  4A6F B;  2MWS B;  4IC7 B;  4HAX B;  2HJ8 A;  2HD5 B;  4XZ4 A;  2KDF B;  2JF5 A;  5D2M B;  1ZW7 A;  3ZKJ C;  5HE0 A;  3Q3J A;  1UEF A;  4BKS A;  3TIX A;  4PNK A;  4I6L B;  3CST A;  1NVL A;  3APC A;  1X1G A;  5DIF B;  2Y5B B;  2AL3 A;  2CQU A;  2CS4 A;  4AOF A;  3P7Z A;  2H7E A;  2GCL A;  4PS3 A;  4EZL A;  4M8N A;  1FB8 A;  3O96 A;  2MA9 B;  4A3O A;  2LXC A;  2UYZ B;  5KQ4 A;  2D9W A;  4ZRJ A;  2DYN A;  1UH6 A;  3IG3 A;  2RNR B;  4L6E A;  3WYF B;  1J0G A;  2IO1 B;  5HE1 A;  4MM3 A;  2Z0Q A;  1E8Z A;  5DPS A;  2ZEQ A;  5FI0 A;  4H8S A;  3OJ3 A;  3QAQ A;  2DYQ A;  5KCV A;  3EFU A;  2K6Q A;  1V5M A;  4ZDV A;  2ZPN A;  1WM3 A;  1HBK A;  1MK9 B;  4JQW C;  3KW5 B;  4IAP A;  3PRE A;  5IAA C;  2GBN A;  1RJ2 A;  3ODW A;  1MIX A;  4TQ0 A;  2M38 A;  4A6H A;  4KHA A;  1J8C A;  1ZVR A;  1B55 A;  2C5L C;  2KO3 A;  4K1R B;  2ZPY A;  3MTN B;  3HK0 A;  2BYV E;  4JLC A;  2LUE A;  1Z87 A;  4G0N B;  3HW2 B;  2DEN B;  1OEY J;  3ZO5 B;  2FJ9 A;  2FCN A;  3WA0 A;  3BIN A;  4HCP B;  1M7E A;  2RGN B;  4FN2 A;  2C60 A;  2ZJD A;  2KC1 A;  3M1I B;  1S1Q B;  1SGH A;  5LLI A;  2D2Q A;  4KHO A;  3L54 A;  4WAA A;  1J19 A;  5E6P A;  2VSZ A;  1OQY A;  4EZJ A;  1UNQ A;  2D9Z A;  4KDL B;  1TQZ A;  2L2I A;  4IM2 A;  1ZGU B;  2K8H A;  2PPH A;  4B6H A;  5LON B;  3M3J A;  3N32 A;  1U27 A;  2M14 A;  4MT7 A;  4WJP A;  3IFW B;  2UWQ A;  5JHA A;  3CMM B;  2K00 A;  5C5B A;  3JW0 X;  4I6P A;  4ZRI A;  1WJM A;  1ZM0 A;  4LCD E;  4G50 A;  5J17 A;  2M1M A;  2NVU I;  1TBE A;  1WGQ A;  1E7U A;  4KAX B;  1EVH A;  4ANV A;  2EJ8 A;  4IWO A;  4MGI E;  1WG7 A;  4F8C B;  2HE7 A;  2G4D B;  2QKL A;  2K2J A;  2G45 B;  1WGH A;  4F7G A;  2RUK B;  1WGD A;  2W9N A;  2R09 A;  1Q5W B;  3DBL I;  1I35 A;  2KAN A;  3BY4 B;  1FHO A;  3P6A A;  3VTV A;  3A9K A;  3L10 B;  4FUL A;  4II2 B;  2GBR A;  4KIK B;  3AXC A;  4TQ1 A;  3R3M A;  2N0Y A;  3VH4 B;  2NZ8 B;  2FIF A;  5D27 A;  3U7D A;  2O6V D;  3KUC B;  2O2V B;  1P5T A;  4JGH B;  1YX5 B;  2L76 A;  1U5F A;  1QQG A;  1TTN A;  5TR5 A;  5CHF A;  2GS0 A;  2DZJ A;  4NAW B;  2O6V B;  2K25 A;  3SUZ A;  4BFR A;  3H1U A;  2KCJ A;  1BWN A;  2W2X C;  1WMH B;  5G2N A;  3RCZ A;  2J59 M;  4FHJ A;  3PLV A;  2JZ3 B;  3T9L A;  2LJ5 A;  4IW0 A;  2KMA A;  2ELB A;  2MBH A;  2LWP A;  4IWQ A;  1U5D A;  2PJH A;  2RVB B;  1A5R A;  3PZD A;  2C7N B;  4IM0 A;  5E6N A;  3OAW A;  4WQO B;  4BKG A;  1AAR A;  4IM3 A;  5DPR A;  4EJN A;  2N7E A;  1IRS A;  1R4M I;  5JP4 A;  4KHB B;  2XBB C;  2V3S A;  1WX7 A;  4WWN A;  4A20 A;  5L83 A;  5KHQ A;  4MGY E;  2BWF A;  2COF A;  2BCJ A;  2YRY A;  4Z2N A;  2DKQ A;  4B9K A;  1AQC A;  4W9G A;  2RGF A;  3L13 A;  1WGU A;  1TJ6 A;  2KJ6 A;  3EC8 A;  4W9J A;  1WXM A;  3AJ4 A;  1MAI A;  4K81 A;  4JIO U;  2DX1 A;  2COD A;  3O65 B;  1OTR B;  1WGR A;  2A4Z A;  2AYO B;  5LXI B;  2MP2 A;  1XCG A;  4HAY B;  2L1C A;  1V2Y A;  1LW3 A;  3DXE A;  3D32 A;  2EMS A;  4MEL A;  2AWT A;  2K8B A;  2RQ1 A;  2GMI C;  3SU8 X;  2WX1 A;  4B6W A;  1WX8 A;  2N9P C;  2DLW A;  2Z0P A;  1Y19 B;  2DZI A;  1Z2M A;  2A5U A;  3L0W B;  1WY8 A;  1E90 A;  4ICU A;  1CMX B;  2P8V A;  4OVV A;  1BTN A;  3BJI A;  3A4R A;  1PMS A;  5AZH A;  1WXV A;  5GMV A;  3GOE A;  1MKE A;  3UF8 A;  1G6J A;  2NPT A;  1WFY A;  5C79 A;  1WE7 A;  2LXA A;  3D8D A;  4F1S A;  3DVN U;  4KIK A;  4HAZ B;  2Y8G A;  3ZW3 A;  3VXW A;  4GSW A;  3PVW A;  3PP2 A;  3APD A;  2O2V A;  4PS8 A;  1SHC A;  5CX3 A;  2NBV B;  4HVB A;  5AEK B;  1MIZ B;  4E71 A;  2L0T A;  4MDK E;  3RZW C;  2JRI B;  4NAW A;  2O6V A;  3S2A A;  2KZR A;  2KWV B;  3FM8 C;  2LVQ A;  1DDW A;  2DN6 A;  1UNR A;  2LYD A;  3ODX A;  1I42 A;  2PE9 A;  3WAO A;  4ZRK A;  2JP2 A;  4PQ0 A;  2ROV A;  2NBU A;  3ZNI D;  5C5B B;  3DCG A;  1HB8 A;  2ZVN A;  4BVU C;  2CY5 A;  1E8Y A;  3X23 A;  2L00 B;  1EGX A;  3QC8 B;  3ZVV A;  2YT0 A;  4FLH A;  2DYB A;  4GIV A;  3DBH I;  3G9W A;  4Y94 A;  5D3X A;  2KJR A;  1NBF C;  2JRH A;  1OEY A;  3OJ4 B;  1UNP A;  2RSU A;  4NQL B;  2COP A;  3ZDM C;  3TCA A;  1P9D U;  4BKT A;  4W9E A;  2C9W B;  4G11 A;  2YS1 A;  1GNU A;  2DYM A;  3A9K B;  1W1D A;  3GYP A;  4NJ7 A;  2DFK A;  3K9O B;  3KZ1 A;  2JUO A;  4DBB A;  2N9X A;  3ZTD A;  3ZRF A;  3WAM A;  2LRW A;  4K2O A;  3QCA A;  1WRD B;  2EC1 A;  2COC A;  2MRP A;  3N3K B;  3HM3 A;  3V6C B;  2JPH A;  3X0W A;  2UVM A;  1E5W A;  1X05 A;  1U4A A;  3PVU A;  2LZ6 A;  3CSF A;  1X11 A;  2Z0O A;  3A98 B;  3FSS A;  2CHW A;  3ULB A;  2CRF A;  1P3Q U;  3CIK A;  1V5O A;  2GOW A;  3DBS A;  1Y5O A;  4A5K A;  1UGM A;  5IJM A;  2MKR A;  1ACA A;  3UQB A;  3VAW A;  4PYU A;  3KY9 A;  1I7A A;  3R66 C;  3V62 A;  3QWZ B;  2DZK A;  3T8M A;  3W1S C;  3NZS A;  2J0M A;  1WM2 A;  3TW1 A;  3U30 A;  2W2W A;  4E74 A;  1UD7 A;  4Z2M B;  2YLM A;  4AUQ C;  4BOS C;  2D11 A;  2ZNV C;  2VKI A;  5JHG A;  5JLJ B;  1ZC3 B;  4HPL B;  5JH5 C;  5D7G A;  2NCN A;  3H9D A;  4ANW A;  3H7S A;  3VUW A;  5CHV C;  2LOZ A;  3NSU A;  1NTY A;  5KHO A;  4WWO A;  3KRX A;  2K6D B;  4WJN A;  4X57 B;  2KFK A;  5C6R A;  2IO3 B;  2ASQ A;  3ZRC A;  4KZC A;  1V5U A;  1U29 A;  2ZVO A;  2LVP A;  4XWX A;  3ECI A;  2QKM A;  3KH0 A;  4BBK A;  5EFX A;  4WWP A;  4TV3 A;  2Z0E B;  2L3Z A;  3MHS D;  4ANX A;  3OLM D;  4IOY X;  1C3T A;  2DX5 A;  1TZ1 A;  2IYB A;  3DPD A;  2MP2 B;  3DVG Y;  2KJH B;  2AL6 A;  1V5T A;  4HDO A;  2Z59 B;  3PTF C;  1M7R A;  2P0D A;  1PLS A;  1OGW A;  4AJW A;  3EHV A;  1UPQ A;  4E3C A;  4W9D A;  4MSQ B;  3RYT A;  4I6N B;  1KI1 B;  1K5D B;  2V4L A;  3KSY A;  3ZIM A;  5L95 C;  4DDI D;  1U5G A;  1MG8 A;  2GBM A;  2IO0 B;  3ZTC A;  2YS5 A;  1K8R B;  1KM7 A;  5D3V A;  3L16 A;  2RSG A;  2V76 A;  2WYQ A;  2KNB A;  1UPR A;  2MFQ A;  1X1F A;  1TGZ B;  3QQ8 B;  1WGG A;  1V9J A;  5D3Y A;  2NPT B;  4MSM B;  3RZF A;  2BKF A;  3N30 A;  4IG7 B;  1FOE A;  4HLE A;  2HTH A;  2KD0 A; 
#chains in the Genus database with same CATH topology
 2K3U A;  3ML9 A;  4CO7 A;  3E9P A;  5IN7 A;  5JVL A;  2I1K A;  1WH3 A;  4G3X B;  4IWP A;  2LI5 A;  4HJG E;  3DDC B;  1PYW D;  1RWS A;  2N9E B;  2WLB A;  1WYG A;  3H8H A;  4M0W B;  3RUL A;  3VDZ A;  4NJ6 A;  1QQR A;  3EUB 2;  4AP4 C;  3EPY A;  1D5M C;  5DHA B;  1P0R A;  2TSS A;  2L52 A;  1LFD A;  1YN3 A;  2BKR B;  5IKC M;  3ZVR A;  3VOQ A;  1KZ7 A;  3HHM A;  3VFK A;  1HTO A;  3MC8 A;  2JZP A;  2RPV A;  3CIR B;  2WXP A;  1MHH E;  1TS4 A;  1UWX A;  1R4N B;  1KRH A;  1VCB A;  1FAO A;  3T06 A;  3R7R A;  3WAL A;  1DYN A;  3VRA B;  3H6N A;  1WJ4 A;  2FID A;  1C78 A;  4AS1 A;  2Y7B A;  3RT3 B;  3BVM A;  4GDL A;  3RN9 C;  1FCL A;  3A8P A;  4YWG G;  2DHZ A;  5J2R A;  4MK0 A;  1XQQ A;  3VR8 B;  2D3A A;  2RR9 A;  2WXK A;  1IGD A;  2YS3 A;  1OFF A;  3SDL C;  2QMT A;  2EEL A;  1P6S A;  1YJ1 A;  1TZO A;  2K49 A;  4KZ0 A;  1V61 A;  2QHO A;  2MBE A;  2KDB A;  4RFB A;  5D6J B;  4EZK A;  3ZUN A;  3OAN A;  5DH9 B;  2R0D A;  1C4C A;  1ZC4 B;  1YN4 A;  1E6E B;  4FJY A;  4UDU C;  2VRR B;  2M56 B;  2J0K A;  2ADZ A;  1YQ4 B;  1R7S A;  4AWJ A;  1K50 A;  3SFE B;  2L83 A;  4F7H A;  2RMM A;  1SIF A;  1TKE A;  2IYD B;  3HIE A;  2KX3 A;  3AU4 A;  4DBG A;  1J7C A;  3V5W A;  1JWA D;  3A4S C;  3NWA A;  3A33 B;  2D4Q A;  2VZK D;  2DAF A;  3LXF A;  2KVR A;  1V81 A;  2HRJ A;  2DKP A;  1JWS D;  1P3R A;  1R4N I;  5FR3 A;  3I9V 1;  1CK1 A;  3F0W A;  4BAX A;  2LGI A;  3M63 B;  3DWG C;  1YMH E;  2NTS A;  4TSS A;  4HXD A;  4W9I A;  4J3O D;  2VZK B;  4EFO A;  2OJW A;  3ZDT A;  1HXY D;  3MP9 A;  1JWB D;  3A1Q A;  3UIO B;  2J7Q B;  4B95 A;  4WUR A;  4RM9 A;  4EEW A;  1IBX B;  4N59 A;  3EFC A;  3M95 A;  1EAZ A;  1DGJ A;  3MJW A;  2G1E A;  4DDG D;  3M62 B;  1H4R A;  2IO2 B;  5CTR C;  3AMZ A;  4US8 A;  1YD8 U;  3JSV A;  4J6I A;  5FR6 A;  1C1Y B;  4NQK E;  3ENE A;  1YJJ A;  2LMC A;  3V6E B;  3V60 A;  1OQR A;  2PIA A;  1IYF A;  2GBK A;  4M01 A;  3DBR B;  3RPF C;  1H10 A;  1PFD A;  2JZZ A;  1L6V A;  2IND C;  1V5P A;  4TYZ A;  3LJ3 A;  2BYE A;  4XE0 A;  3BYT B;  2RLO A;  2VRW B;  4KGR A;  3V05 A;  2BS2 B;  1RFA A;  5FI1 A;  2YSZ A;  3Q8C A;  4JK7 A;  4GLS C;  2K0P A;  2K39 A;  4FJV B;  1JWM D;  2ZNV B;  5C16 A;  4L1R A;  2I5F A;  3VIA A;  2LGD A;  2KR0 A;  3D8E A;  2BGF A;  3UGB B;  2MEK A;  2NBW B;  2H88 B;  4TUU A;  1N63 A;  3AUL A;  1N3H A;  3B0A A;  2DLB A;  4FHK A;  1RRB A;  3U52 E;  4HRS A;  4WJQ A;  3VH3 B;  4C7Y A;  4KSL C;  3W2D A;  4MGZ E;  2ACZ B;  5HHD G;  2PTL A;  3WAN A;  4WJ7 A;  2B3A A;  2KDE B;  1JQ4 A;  2L8J A;  2XNA C;  2IFS A;  3CF6 E;  2DNF A;  3QA8 A;  4XWT A;  4A6K A;  4MY6 A;  4LDT D;  1VD2 A;  3UZT A;  4JKA A;  1MPH A;  1ACC A;  3WAP A;  2D10 A;  3LB8 C;  5CHW A;  5L81 A;  2K8E A;  2KVZ A;  3AU5 A;  3L08 A;  4WVF B;  1EU3 A;  3PSE B;  1GAQ B;  2YVC A;  4HAU B;  5DCN A;  2YT1 A;  4GZU A;  3AH7 A;  2L0F A;  4HAV B;  4YTN B;  4MH8 A;  5D94 A;  1T3Q A;  4K3B A;  2KFK B;  2MSE D;  2LHD A;  3DBR I;  5G5G A;  2BPS A;  3SBT A;  2FNJ B;  3Q3M C;  2CR5 A;  4M0W A;  3MC9 A;  3DOW A;  4HWI B;  5C3J B;  4XC2 A;  3VHT C;  2L05 A;  2N1V A;  2XK5 A;  2MBO A;  2JWZ A;  4KGS A;  5J3Y A;  3ML8 A;  4IOI E;  1SJH D;  4DX8 A;  4A6Q A;  2LAS A;  3E9S A;  5IP4 D;  3FAH A;  1WVH A;  1DRO A;  1NU2 A;  4K7W A;  1YQ3 B;  1Y56 A;  2DX5 B;  4ZYS A;  2GLS A;  2V9H A;  3AN1 A;  5J3T A;  3NS1 A;  4D0N B;  3R2I A;  4JL9 A;  4W9L A;  3QHT A;  2KLG A;  3DXD A;  5GXG B;  3HUI A;  1C4P A;  1L2N A;  4TKN A;  3DCX A;  1TXD A;  5DHF B;  5AUI A;  3ONS A;  2FUG 1;  1KFY B;  2KQS A;  1X1M A;  4PYZ A;  3RUI B;  1P98 A;  1UBQ A;  3KUZ A;  2UZR A;  2JY6 A;  1ROE A;  4CHJ A;  5DI9 B;  3TJP A;  2MBQ A;  5LOP B;  2KIG A;  4XGA B;  4CHM A;  1PGB A;  2CU1 A;  2N4F A;  3JVZ X;  1EU4 A;  2BWE S;  2YF0 A;  3UI3 A;  2G35 A;  2KQ7 A;  3VR9 B;  4YL8 A;  3Q3F A;  4CQN A;  4DHZ E;  4GDK A;  4HHV A;  4LNN A;  1GC7 A;  3E9L A;  1UNS A;  1FO4 A;  2KMC A;  3B2G A;  4RGO S;  1NTI A;  2XQN M;  3MPX A;  2L7R A;  2Y3A A;  5H92 C;  1I4H A;  3NOB A;  1QOA A;  3V61 A;  2LG1 A;  4HCN B;  4OSN A;  2OOB B;  2LKO A;  1QZE A;  3H7P A;  1FHX A;  1JRU A;  5D3W A;  2NMB A;  2PE6 B;  4PS7 A;  1J7B A;  2FCQ A;  4GMX B;  2R2O A;  3N1Y C;  3NRZ A;  1K5G B;  1JML A;  3SO6 A;  2HTH B;  4DXF A;  1WXS A;  4D2K A;  1UZX B;  3N1X C;  4F7U P;  2KOX A;  3FVC A;  5GOW B;  5JHB A;  2Z14 A;  1WX9 A;  4W9H A;  2KLC A;  2M17 A;  2W2X D;  2Q13 A;  4K7U A;  3ULC A;  1WR1 A;  1WJN A;  1VRA B;  2KFJ A;  4B0E A;  2DA0 A;  2KUQ A;  1TYG B;  4HB0 B;  3A9J A;  2OTX A;  4XX5 A;  3KYD D;  2W3S A;  1E7V A;  3ZNH B;  1FXT B;  5IA7 A;  3KUD B;  3PV1 A;  4HB3 B;  4L2Y A;  2FDQ A;  3Q8E A;  2ABD A;  3QJZ A;  1B1Z A;  2IY1 B;  2KUP A;  1V88 A;  2BYF A;  4HB2 B;  2D5G A;  1RFK A;  3TFM A;  1L7Y A;  2LFI A;  2MWN B;  4RGM A;  1TS5 A;  1V49 A;  5AZF A;  3W9C B;  4GMV A;  1QOG A;  3R7Q A;  2MLB A;  1KF6 B;  2OJR A;  4DK5 A;  2EMT A;  4GN1 A;  1NEK B;  1XD3 B;  2BBC A;  1XT9 B;  1WJU A;  5HE3 A;  1F2R I;  4ANU A;  4ARI A;  2CKH B;  2GBJ A;  2QIE B;  4OZA A;  1ST7 A;  3W1S A;  1J0W A;  1W1G A;  1L0V B;  2KHW B;  4HEA 1;  1GC6 A;  4GDL B;  3PHX B;  1HEZ E;  4GNK B;  1WZ3 A;  1ZUD 2;  1T0S C;  5DPW A;  2KKC A;  2RPQ A;  1Q67 A;  4LNO A;  2NR2 A;  1X86 A;  2QDF A;  3PGE A;  3QAR A;  2DYO A;  4PT5 A;  1XOD A;  2D3G A;  2WXO A;  3TEY A;  2D9Y A;  2X18 A;  1XF5 L;  4JE3 B;  3PEG A;  2EKI A;  1WF9 A;  2WS3 B;  2LUL A;  3GZN I;  1QOB A;  3AE7 B;  3RNG C;  5CLQ B;  3I5J C;  1I4G A;  4ICV A;  4KVG B;  4A8X C;  2WWZ A;  1ZE3 D;  1KTK A;  2C7M B;  1XR0 B;  4JKD A;  2Y8F A;  4QJ4 B;  3ZLZ A;  2MBB B;  2KYW A;  4EOY A;  1I2H A;  1EO6 A;  2V1Y A;  3B08 A;  2OHF A;  1RLF A;  4DHJ D;  2PZ1 A;  3P4S B;  1YQB A;  3RNF C;  3TBL D;  3CXB B;  2FE8 A;  3NWD A;  1V80 A;  1M94 A;  4GU2 A;  3VUX A;  2I5C A;  3SD5 A;  1IGC A;  2MCN B;  4JKH A;  2P0H A;  1F0Z A;  4P1C C;  2WHI A;  1PFJ A;  1ISN A;  3D8F A;  3DQV A;  4DHJ B;  3BZD B;  1BT0 A;  3W5U B;  3FIL A;  2JU6 X;  3RNA C;  3UQA A;  1T0Y A;  4WWM A;  5BYS A;  4ASW C;  4ILG B;  1F1H A;  2GJY A;  1UF0 A;  4XYC A;  4BOZ B;  2R2Q A;  1HB6 A;  4LK0 M;  3HRD D;  2JX5 A;  2INP E;  2KN4 A;  3PT2 B;  3L17 A;  3QIJ A;  4WIP A;  3PZ8 A;  4KDI C;  3AE9 B;  3B9J A;  2IY0 B;  3A1Q B;  3APF A;  1LQB A;  3B1L X;  2V0G A;  4EUT A;  1EUV B;  3NZU A;  4A55 A;  2LOX A;  4KKJ A;  4FBJ B;  1QC6 A;  4GGQ A;  4GB9 A;  5JZE B;  1WE6 A;  1FCC C;  1YN5 A;  2CB8 A;  4URK A;  3JSV B;  3RI7 C;  5C23 A;  2Z13 A;  5EDS A;  1WIA A;  1WYW B;  2IGD A;  2LD9 A;  3AV8 A;  1V97 A;  3LYY A;  3Q8A A;  4KX6 B;  1IPG A;  1HE8 A;  1KZG A;  2BS3 B;  2WNM A;  1PGA A;  2N23 A;  4C00 A;  1UUP A;  1JCK B;  4ILJ A;  1P1A A;  2WXR A;  3FEH A;  2WXI A;  4MJS A;  2INN E;  4LTU A;  3DVN V;  4L23 A;  4K2P A;  1XKE A;  2AX5 A;  1ET9 A;  3F5R A;  1RRP B;  1F52 A;  2DTC A;  4YON A;  3IXS A;  3PS6 A;  1MK7 B;  4P7I A;  3VTU A;  3NZ3 A;  1FNU A;  1LXD A;  2JXX A;  2KK8 A;  1ZXH A;  2DAJ A;  1DDM A;  4R3D A;  2E6X A;  1T6B X;  2FAZ A;  3AEB B;  3PLU A;  2LBB A;  4DX9 0;  1KJT A;  1Y8R C;  3ALB A;  1N61 A;  3NVW A;  3A8Q A;  5BMG A;  4RM8 A;  3AEE B;  4BBN C;  2KTR A;  4LNI A;  4JKB A;  5G55 A;  3SYX A;  4MGK E;  2W54 A;  2LGY A;  2KMM A;  1PQS A;  1FGY A;  3NHE B;  1FIQ A;  2KX0 A;  1U5E A;  2W82 A;  2LVO A;  4HPM B;  2D9V A;  1STE A;  2M0X A;  2G3Q B;  1MI1 A;  2RD0 A;  2OED A;  2MJ3 A;  2E2X A;  2X0S A;  2LEK A;  4A6F A;  2GI9 A;  1SB3 C;  3KWL A;  1D4B A;  4GXB A;  3ZNG C;  3U8Z A;  3QX1 A;  2W3R A;  3HQC A;  2MDX A;  1N60 A;  1OQN A;  2XK5 B;  3KWV A;  2WX0 A;  3VQI A;  4L1B A;  3I3T B;  2WDR B;  1MFW A;  2WDQ B;  4O1N A;  1WJ1 A;  1WR6 E;  2REX A;  2CU3 A;  3GE3 C;  2D07 B;  2XN9 C;  2J52 A;  1WSP A;  3TL5 A;  5JHH A;  1VZ7 A;  4RF1 A;  3N20 C;  2G4S A;  3PZ7 A;  3SEB A;  4MH0 E;  3SHQ A;  2CY4 A;  4C7Z A;  2JQR B;  1C76 A;  1BAK A;  1TY2 A;  2DZM A;  5HKH A;  2EKE C;  2LJI A;  4NPN A;  1KOT A;  4NSW A;  1WZ0 A;  3RFZ B;  2OQB A;  4FJZ A;  2FCM A;  1VJK A;  5J3Q A;  3T3O A;  4RMA A;  2RRF A;  4CSQ A;  1W1H A;  4FAD A;  2IBI B;  4IFS A;  3IAM 1;  2COA A;  3PVL A;  1VBH A;  1XLO A;  1GUA B;  3AE3 B;  4HKQ A;  1I4P A;  4K3C A;  3NY5 A;  4LJP B;  4C0A A;  1V1O A;  1VZ6 A;  2WQY B;  3Q8F A;  3DXC A;  1WI1 A;  1RYJ A;  4CYE A;  1LM8 B;  2KTF A;  1SE2 A;  1NDD A;  4WH4 A;  3IT6 B;  1C79 A;  4OHJ A;  1EF1 A;  2SAK A;  1ZSQ A;  4GDK B;  1V6E A;  3URY A;  1D6E C;  1F9J A;  5DPT A;  2K8C A;  3ZNZ B;  1KH0 A;  3PG7 A;  1L5P A;  4OVU A;  1GOZ A;  1GJZ A;  3PSC A;  4F7Z A;  3UIN B;  3H7P B;  3IBE A;  1KLV A;  3RD2 A;  2V3P A;  1OY2 A;  1LB1 A;  3B77 A;  2Y5P A;  4GPT B;  2AEH A;  2KN5 A;  3PHW B;  1AN8 A;  3TEW A;  3P2B A;  2ZW0 A;  3AED B;  1GG3 A;  4HAT B;  2I1J A;  2ELA A;  3SNH A;  2KDI A;  1PGX A;  3BVG A;  2RDG A;  2MQJ A;  1ZKH A;  1IP9 A;  2FUH B;  3QWM A;  3W1Y A;  2FBW B;  2KC2 A;  4WSF A;  1SE9 A;  4MEM A;  5AZG A;  3HIZ A;  4BKS D;  1XD4 A;  4PK1 A;  3K9P B;  2D9X A;  1V86 A;  1MJD A;  3DHI C;  2KWU B;  3A9J B;  2ONQ A;  3UIP B;  5HE2 A;  3ODO A;  1WJ6 A;  2MX2 A;  3QBV B;  1QT9 A;  2M8S A;  2N7D A;  1XX0 A;  3NJT A;  2LRU A;  3ABV B;  2K1F A;  3O13 A;  4N58 A;  4RGN A;  4REZ A;  3EEC A;  4HB4 B;  3PRZ A;  2PMV A;  1WXQ A;  4A9A A;  4EMO A;  3E66 A;  1YIW A;  2UU7 A;  4HDQ A;  4KSK C;  3FP5 A;  2M4N A;  2PEA A;  4AQ7 A;  4GOC A;  4JKG B;  2ZCC A;  2H7D A;  4NY0 A;  4HAW B;  3TMP B;  2WDV B;  5CLL B;  1ENF A;  1NVI D;  4W9C A;  1WXA A;  3I57 A;  2JVC A;  2ON8 A;  3HM6 X;  3SV1 A;  3RCP A;  1N5X A;  4AJY B;  2LGX A;  1ESF A;  4II3 B;  4HSI A;  1YNT E;  2KXJ A;  1PDX A;  2BB6 A;  4MM3 B;  3J9C A;  4NZL B;  3ZJV A;  4DHZ B;  1D3Z A;  3VRB B;  3AE1 B;  1AW7 A;  2P0F A;  4YSZ B;  2FJL A;  3KVF B;  3LDZ E;  2ROZ B;  4OT1 A;  1MI0 A;  2MHJ A;  3QK0 A;  1XCT L;  2K22 A;  1UEL A;  2I38 A;  1E8X A;  4IUM B;  4N9F 4;  5FKA C;  5LG4 B;  1SEB D;  1SXT A;  2BF8 B;  2K2U A;  1S3S G;  4ACF A;  4CHK A;  4DWF A;  3PRP B;  3AI5 A;  4HK2 A;  3N7C A;  3WIM A;  2ZZP B;  3GP7 A;  2QEJ C;  1UBI A;  1NTV A;  2KWC A;  2Z0D B;  1SBB B;  4M8M A;  2JT4 B;  2ZCB A;  2C7H A;  3C19 A;  5C1Z A;  3U12 A;  3DHH C;  2GCJ A;  4LDT B;  2N0S B;  2KAJ A;  3FIL B;  1K53 A;  3B2F A;  4H2A A;  2WP9 B;  3C0R B;  2K5P A;  2KAC A;  3IHP C;  3NS8 A;  3TO1 A;  4LJO B;  3DVG X;  4K17 A;  3KYC D;  1I4Q A;  2R2Y A;  4WAF A;  1WGY A;  4HRO A;  2WXJ A;  1TT5 B;  3VTW A;  4HJK A;  4JKC A;  1FHW A;  1RM6 C;  5LXH A;  1DDV A;  2NS5 A;  1Q1O A;  2CHZ A;  1KLG D;  4W9K A;  3FLV A;  4NNJ B;  1EF5 A;  4A3P A;  3LJU X;  1FRD A;  3R8B A;  1HQR D;  1XLQ A;  2CHX A;  1WI0 A;  2NTT A;  3KRW A;  1MVK A;  2XEW A;  2DHJ A;  4FA6 A;  2WXG A;  1E8W A;  2E3T A;  4C80 A;  5J18 A;  1Q0W B;  1V89 A;  1AWE A;  2CAY A;  4BBN F;  1DBH A;  1WMH A;  1LO5 D;  2MW5 A;  2DHK A;  4WJO A;  1C9F A;  3VUY A;  4JWS C;  4MJS B;  4LNK A;  2PVO D;  3IVF A;  2WU2 B;  3JYU A;  5BO4 B;  4OW0 A;  1YOV B;  1NEN B;  1C4A A;  2IZV B;  4W9F A;  2YEP F;  2N1W A;  2WH5 A;  4DXA B;  1OMW A;  1RAX A;  4USA A;  2WGS A;  5JXV A;  1U2B A;  1XO3 A;  4ZYN A;  2DHI A;  2GB1 A;  1SJE D;  1YX6 B;  4EKU A;  4KV2 A;  5MPO A;  4XWW A;  5HI1 A;  3T3N A;  5D3I B;  4NAM A;  1DYQ A;  2J0J A;  1ET6 A;  1BTK A;  2YEP B;  1Z5S B;  3W5V B;  2KGX B;  2KTR B;  2UZS A;  1V8C A;  3PRM B;  2WDT B;  3TVV A;  4D6W A;  3GYO A;  3PPA A;  3MDB C;  2R82 A;  3ML4 A;  5E6O A;  2JXT A;  1ZYI A;  2FCS A;  4KHB A;  1TY0 A;  5KQ1 A;  4K7S A;  1FGZ A;  3VVW B;  1QOF A;  3GZN B;  3P4Q B;  1H8C A;  1NI2 A;  4A6F B;  1HZ6 A;  2LGS A;  2MWS B;  4IC7 B;  4HAX B;  2HJ8 A;  1CQV A;  2HD5 B;  4DXG A;  4XZ4 A;  1EWY C;  2KDF B;  2JF5 A;  1DIK A;  5D2M B;  1WRI A;  2WXN A;  1ZW7 A;  2MH7 A;  3ZKJ C;  5HE0 A;  3Q3J A;  1UEF A;  3RNC C;  4BKS A;  3TIX A;  4PNK A;  4I6L B;  2RDB C;  3CST A;  1NVL A;  3APC A;  1X1G A;  5DIF B;  2Y5B B;  1FD6 A;  2AL3 A;  4S0R A;  2CQU A;  4QXA B;  1VR9 A;  2CS4 A;  4AOF A;  3P7Z A;  2H7E A;  4JKG A;  2GCL A;  4PS3 A;  1IUE A;  3WCQ A;  4EZL A;  4QJ3 B;  2R61 A;  4M8N A;  3P1M A;  1FB8 A;  3O96 A;  2MA9 B;  4LNF A;  2LXC A;  4A3O A;  2UYZ B;  5I4D A;  5KQ4 A;  1GB4 A;  4JK8 A;  2D9W A;  4ZRJ A;  2DYN A;  1UH6 A;  3IG3 A;  4YTP B;  2RNR B;  4L6E A;  3WYF B;  5BMH A;  1J0G A;  2IO1 B;  5HE1 A;  4MM3 A;  2Z0Q A;  4WQM A;  1E8Z A;  5DPS A;  1DOY A;  2ZEQ A;  5FI0 A;  4H8S A;  4JPS A;  3OJ3 A;  3QAQ A;  2DYQ A;  5KCV A;  2JWU A;  3EFU A;  2K6Q A;  4DQO C;  4OVZ A;  1V5M A;  4ZDV A;  2ZPN A;  1WM3 A;  4C4V A;  1HBK A;  2X38 A;  5AUK A;  4C56 C;  1K52 A;  1MK9 B;  4JQW C;  3KW5 B;  4IAP A;  3PRE A;  5IAA C;  2GBN A;  5IOI A;  1RJ2 A;  3ODW A;  3MFG A;  1MIX A;  3AM9 A;  4BZA A;  1JAL A;  4ZOH C;  4TQ0 A;  2M38 A;  3SR6 A;  3ENB A;  4A6H A;  4KHA A;  1J8C A;  1ZVR A;  3SBG A;  2Z4D A;  1SE3 A;  1QIL A;  1B55 A;  1FNV A;  2C5L C;  2KO3 A;  4ZRP A;  2V4I B;  4K1R B;  1L6U A;  2ZPY A;  1SSN A;  3MTN B;  3HK0 A;  1MHX A;  2M0A A;  2BYV E;  3EGR A;  4JLC A;  2LUE A;  3NW8 A;  1Z87 A;  4G0N B;  3HW2 B;  2DEN B;  1OEY J;  3ZO5 B;  2AQ3 B;  2FJ9 A;  2FCN A;  2SEB D;  3WA0 A;  3BIN A;  1P7F A;  4HCP B;  1M7E A;  3P4R B;  2RGN B;  1CZP A;  2BB5 A;  4FN2 A;  2C60 A;  3ZQ4 A;  3AE5 B;  2ZJD A;  2KC1 A;  3M1I B;  1S1Q B;  1SGH A;  5LLI A;  2NMQ A;  3FC4 A;  3DBL B;  2D2Q A;  4KHO A;  3ZXR A;  3L54 A;  4WAA A;  3GB1 A;  1J19 A;  5E6P A;  2VSZ A;  1OQY A;  4EZJ A;  1UNQ A;  1FFU A;  2D9Z A;  1MPE A;  4KDL B;  3Q3O C;  1TQZ A;  3Q6B A;  2L2I A;  1FEH A;  4M00 A;  2BTE A;  4IM2 A;  1ZGU B;  1TJE A;  2K8H A;  2PPH A;  4B6H A;  5LON B;  3M3J A;  3N32 A;  1U27 A;  2M14 A;  1V1P A;  4MT7 A;  4WJP A;  3IFW B;  2UWQ A;  5EE9 A;  5C2T B;  5HFY A;  5JHA A;  3CMM B;  2K00 A;  5C5B A;  3JW0 X;  4I6P A;  2D3B A;  1A70 A;  4ZRI A;  1WJM A;  1ZM0 A;  4LCD E;  3NUH B;  2DBY A;  4G50 A;  5J17 A;  2M1M A;  3KLS X;  2NVU I;  4RF0 A;  1TBE A;  1WGQ A;  1E7U A;  4KAX B;  1EVH A;  4ANV A;  2EJ8 A;  3MJ5 A;  4IWO A;  4MGI E;  1WG7 A;  4F8C B;  2HE7 A;  2G4D B;  2QKL A;  3V3X A;  2GRI A;  2K2J A;  2G45 B;  1WGH A;  4F7G A;  2RUK B;  3BK1 A;  1WGD A;  2W9N A;  2R09 A;  1AWD A;  1Q5W B;  3DBL I;  3I63 C;  1XLP A;  2N7J A;  1I35 A;  2KAN A;  5FK9 C;  4DIX A;  3AEG B;  2QSD A;  3BY4 B;  1Q10 A;  1FHO A;  3P6A A;  3VTV A;  3A9K A;  1I4R A;  3L10 B;  2KQ4 X;  4FUL A;  4II2 B;  2I2Y A;  2GBR A;  1LGR A;  1F2R C;  4KIK B;  2K9X A;  3AXC A;  1FNW A;  4TQ1 A;  3R3M A;  1UWM A;  5I2S A;  4HKZ E;  2N0Y A;  3VH4 B;  1QKZ A;  2PKO A;  4IKG A;  2NZ8 B;  1QF6 A;  5D3D A;  2FIF A;  3ZJT A;  2JSV X;  5D27 A;  3U7D A;  2O6V D;  3KUC B;  2O2V B;  1FPY A;  1P5T A;  1R4M B;  4JGH B;  1YX5 B;  2L76 A;  1NI3 A;  1T0R C;  1U5F A;  1QQG A;  1TTN A;  3KQ4 A;  1HTQ A;  5TR5 A;  4Q2J A;  2BW2 A;  5CHF A;  1E10 A;  2GS0 A;  2DZJ A;  4NAW B;  2O6V B;  5EE0 A;  2K25 A;  3SUZ A;  1N6Z A;  4BFR A;  3H1U A;  3TEX A;  2VH2 A;  5E6J A;  3FKY A;  1FFV A;  2KCJ A;  1BWN A;  3NWF A;  2W2X C;  1WMH B;  5G2N A;  3RCZ A;  2J59 M;  1ZPS A;  2N9L A;  4OZC A;  3DHG C;  4FHJ A;  3PLV A;  1JW9 D;  2HTM E;  2JZ3 B;  3T9L A;  2LJ5 A;  1I4X A;  4JWU C;  5T8I A;  5H8Y E;  4RH6 A;  4IW0 A;  2PVG C;  1CJE A;  1JRO A;  2KMA A;  3HVZ A;  2ELB A;  4KGT A;  3AE6 B;  1B9R A;  3P4P B;  1MG4 A;  5EE1 A;  2MBH A;  2LWP A;  2B76 B;  4IWQ A;  1U5D A;  2PJH A;  2RVB B;  2L32 A;  1A5R A;  1NYR A;  3PZD A;  1FMA D;  2C7N B;  3Q8B A;  4IM0 A;  1ZOY B;  5E6N A;  2KWD A;  3OAW A;  3AE2 B;  5BMI A;  4WQO B;  4BKG A;  1AAR A;  4IM3 A;  5DPR A;  4EJN A;  1TS3 A;  3DWM A;  1EWC A;  3AB5 A;  1VBG A;  2N7E A;  2INC C;  1IRS A;  3AE4 B;  5IRS A;  4A90 A;  1R4M I;  3TUO A;  5JP4 A;  4KHB B;  2XBB C;  4M02 A;  2V3S A;  4RGT A;  2Q5W D;  1WX7 A;  1P7E A;  4WWN A;  3E56 A;  4A20 A;  5TSS A;  5L83 A;  5KHQ A;  4MGY E;  2BWF A;  1TKY A;  1TS2 A;  1SIJ A;  2VH1 A;  2COF A;  2BCJ A;  2YRY A;  3IT4 B;  5M4Y B;  4Z2N A;  2ZKM X;  4NJC A;  3BWU D;  2DKQ A;  1BML C;  3BVZ A;  4B9K A;  1AQC A;  4W9G A;  2RGF A;  3L13 A;  1N5W A;  1NYQ A;  2J4X A;  1PUT A;  5BYQ A;  1WGU A;  1TJ6 A;  2KJ6 A;  3ZGZ A;  3EC8 A;  4W9J A;  1WXM A;  3AJ4 A;  1MAI A;  4K81 A;  4JIO U;  1BXT A;  4FXC A;  2DX1 A;  2COD A;  3O65 B;  1ZXI A;  1OTR B;  4JX1 C;  1WGR A;  2A4Z A;  2AYO B;  2H89 B;  3C8Y A;  4ILH A;  5LXI B;  2BS4 B;  2MP2 A;  4N6E B;  1XCG A;  4HAY B;  1HA5 A;  2Z59 A;  2L1C A;  4QAY A;  1V2Y A;  3CWI A;  1BUI C;  1LW3 A;  3DXE A;  3D32 A;  2EMS A;  1EM7 A;  4MEL A;  2AWT A;  2K8B A;  2RQ1 A;  2GMI C;  4S17 A;  3SU8 X;  2WX1 A;  4B6W A;  1WX8 A;  1AYF A;  2N9P C;  2DLW A;  2Z0P A;  4JKF A;  1Y19 B;  4C4V B;  4LLG M;  2DZI A;  1Z2M A;  4ZRQ A;  2A5U A;  3L0W B;  4EE2 A;  1WY8 A;  1E90 A;  3P42 A;  4ICU A;  3BYY B;  1CMX B;  2P8V A;  3P63 A;  4OVV A;  1BTN A;  3BJI A;  2QCZ A;  2CJO A;  3A4R A;  5BYR A;  3EA6 A;  3GS2 A;  1PMS A;  2L1A A;  1KBL A;  5AZH A;  1WXV A;  5GMV A;  3GOE A;  1MKE A;  3UF8 A;  1G6J A;  3ZYY X;  2NPT A;  1WFY A;  5C79 A;  1WE7 A;  1FRR A;  2LXA A;  5EE3 A;  3D8D A;  4F1S A;  2WXF A;  3DVN U;  2IGG A;  4KIK A;  2LHE A;  2MJE A;  2M19 A;  4HAZ B;  2Y8G A;  3DBH B;  2LUM A;  3ZW3 A;  3TEZ A;  3VXW A;  1E7P B;  4GSW A;  3PVW A;  3PP2 A;  2ZW1 A;  3APD A;  2O2V A;  4PS8 A;  1SHC A;  3Q2A C;  5CX3 A;  2NBV B;  4HVB A;  1VLB A;  1ZDX A;  2RDH A;  3R2T A;  2BYT A;  5AEK B;  2BVC A;  4YTM B;  1E0Z A;  1MIZ B;  4E71 A;  1XXG A;  1J7A A;  2L0T A;  4MDK E;  2FJU B;  4MT5 A;  1VZ8 A;  1E9M A;  2JRI B;  4NAW A;  3RZW C;  2O6V A;  3S2A A;  2KZR A;  2PW9 A;  2KWV B;  3FM8 C;  2LVQ A;  1DDW A;  2DN6 A;  2WXQ A;  2IPK D;  1UNR A;  2LYD A;  2W55 A;  3ODX A;  1TKG A;  1I42 A;  1V1P B;  2PE9 A;  2WXL A;  3WAO A;  4ZRK A;  2JP2 A;  1YJI A;  2BQQ A;  4PQ0 A;  1UGJ A;  2ROV A;  2NBU A;  3ZNI D;  5C5B B;  3DCG A;  1HB8 A;  2KT7 A;  2ZVN A;  4BVU C;  3NG0 A;  2DIK A;  3NVY A;  2CY5 A;  1E8Y A;  3X23 A;  2L00 B;  1EGX A;  3QC8 B;  3ZVV A;  2YT0 A;  2CJN A;  1D5X C;  4FLH A;  2DYB A;  4GIV A;  3DBH I;  3G9W A;  4Y94 A;  5D3X A;  2KJR A;  4US9 A;  1K51 A;  1NBF C;  2JRH A;  1OEY A;  3OJ4 B;  1UNP A;  2RSU A;  2HDE A;  2QIL A;  2WXM A;  4NQL B;  2COP A;  3IAS 1;  2IJ0 A;  2Y5C A;  3ZDM C;  3TCA A;  1SF0 A;  1P9D U;  3MC0 B;  4BKT A;  4W9E A;  2C9W B;  1XEE A;  2KIE A;  2WU5 B;  4G11 A;  2YS1 A;  1GNU A;  2DYM A;  3A9K B;  3TSS A;  1SE4 A;  2PLP A;  1W1D A;  3GYP A;  2WXH A;  4NJ7 A;  2DFK A;  2GUM A;  3K9O B;  3KZ1 A;  2X8X X;  4P6V F;  2JUO A;  4IDI A;  4DBB A;  2QJL A;  2N9X A;  3ZTD A;  1L0Y B;  4JKE A;  3ZRF A;  3WAM A;  3HVD A;  2LRW A;  4K2O A;  3QCA A;  3Q14 C;  1WRD B;  4JK9 A;  2EC1 A;  2MJD A;  3OG5 A;  4YSY B;  2COC A;  2MRP A;  3BII D;  3N3K B;  3HM3 A;  3Q3N C;  4ZHP A;  1WGK A;  1N62 A;  3V6C B;  1HZ5 A;  1IBX A;  2JPH A;  2ICI A;  1I7H A;  3X0W A;  2UVM A;  1E5W A;  1X05 A;  1U4A A;  4ITK A;  3AE8 B;  3PVU A;  2AQ2 B;  2LZ6 A;  3CSF A;  3N9Y C;  1X11 A;  2Z0O A;  3A98 B;  5IO9 A;  1VDV A;  3FSS A;  1FXI A;  2CHW A;  1FM0 D;  3ULB A;  1TIF A;  3L4P A;  2CRF A;  3HSA A;  1P3Q U;  4RNA A;  3N1Z C;  3CIK A;  1T5X D;  1ZP0 B;  1V5O A;  2GOW A;  3DBS A;  1Y5O A;  3OWE B;  1M4V A;  1D5Z C;  4A5K A;  1UGM A;  1T0Q C;  2J53 A;  5IJM A;  2MKR A;  1ACA A;  3UQB A;  3VAW A;  1XCQ L;  4PYU A;  2J42 A;  4KKI A;  3KY9 A;  4XDD A;  1I7A A;  3R66 C;  4OZB A;  3V62 A;  3QWZ B;  2DZK A;  3ZXV A;  4YXD B;  5HG2 A;  1KLU D;  3T8M A;  3W1S C;  3NZS A;  2J0M A;  2QC8 A;  1WM2 A;  3TW1 A;  3U30 A;  2W2W A;  4E74 A;  1UD7 A;  4Z2M B;  2YLM A;  4XDC A;  4RCO A;  2JYE A;  4AUQ C;  1XLN A;  4BOS C;  2D11 A;  1DOX A;  2ZNV C;  2VKI A;  5JHG A;  2YT2 A;  1L4Z B;  5JLJ B;  1ZC3 B;  2V3N A;  3Q69 A;  4HPL B;  5JH5 C;  3U7Z A;  5D7G A;  1JRP A;  2NCN A;  3H9D A;  4ANW A;  3H7S A;  1F77 A;  3VUW A;  5CHV C;  4TMA B;  1DOI A;  4HPP A;  2LOZ A;  3NVV A;  3U2S C;  1T77 A;  1WWT A;  3NSU A;  1NTY A;  5KHO A;  1L4D B;  4WWO A;  3KRX A;  2K6D B;  4WJN A;  2IDY A;  3RMK C;  4X57 B;  1KC7 A;  3OHM B;  3AEF B;  3NVZ A;  3ZJU A;  2KFK A;  3A58 A;  5C6R A;  2IO3 B;  2ASQ A;  3ZRC A;  4KZC A;  2NBV A;  1V5U A;  1GPX A;  4P16 A;  1JWU D;  1C77 A;  1U29 A;  2ZVO A;  2LVP A;  4XWX A;  2G9H D;  3ECI A;  2QKM A;  1OQQ A;  3KH0 A;  2IGH A;  4BBK A;  4QJ5 B;  2HJ1 A;  5EFX A;  4WWP A;  4TV3 A;  2Z0E B;  2L3Z A;  3MHS D;  4YSX B;  4ANX A;  2BT6 A;  2AQ1 B;  3OLM D;  3AEC B;  4IOY X;  1C3T A;  4ARC A;  2DX5 A;  1TZ1 A;  2IYB A;  3DPD A;  4B0M A;  1ZDV A;  2MP2 B;  3DVG Y;  3ETR A;  3RNE C;  2KJH B;  2AL6 A;  1JDE A;  1V5T A;  4HDO A;  2Z59 B;  3PTF C;  1M7R A;  2P0D A;  1PLS A;  1OGW A;  4AJW A;  3EHV A;  2KDM A;  1UPQ A;  4E3C A;  4W9D A;  4MSQ B;  3RYT A;  1GGO A;  4I6N B;  1KI1 B;  1L0X B;  1K5D B;  2V4L A;  4YT0 B;  1GB1 A;  3KSY A;  3ZIM A;  5L95 C;  4DDI D;  1U5G A;  1MG8 A;  2GBM A;  2IO0 B;  3ZTC A;  3AEA B;  2YS5 A;  1K8R B;  1KM7 A;  5D3V A;  3L16 A;  2JYT A;  2RSG A;  2V76 A;  2WYQ A;  2Z8L A;  3GE8 C;  3U4E G;  2KNB A;  1UPR A;  3RNB C;  4ZHO A;  2MFQ A;  2D3C A;  3E9O A;  2N9K A;  3BK2 A;  1X1F A;  1TGZ B;  3QQ8 B;  1WGG A;  4P1B C;  3MHZ A;  1V9J A;  5D3Y A;  2NPT B;  5G5H A;  4MSM B;  3RZF A;  3SFD B;  5LNK 1;  2BKF A;  4GOU A;  1FXA A;  3N30 A;  4IG7 B;  5I2M A;  1FOE A;  4HLE A;  1QLB B;  2HTH A;  3PO0 A;  2DWQ A;  4MAC A;  2KD0 A; 
#chains in the Genus database with same CATH homology
 3ML9 A;  4CO7 A;  3E9P A;  5JVL A;  2I1K A;  1WH3 A;  4G3X B;  4IWP A;  2LI5 A;  3DDC B;  2N9E B;  4M0W B;  3RUL A;  3VDZ A;  4NJ6 A;  4AP4 C;  3EPY A;  1P0R A;  5DHA B;  1LFD A;  2BKR B;  3ZVR A;  3VOQ A;  1KZ7 A;  3HHM A;  3VFK A;  1VCB A;  1FAO A;  3T06 A;  3R7R A;  3WAL A;  1DYN A;  3H6N A;  1WJ4 A;  2FID A;  2Y7B A;  3RT3 B;  4GDL A;  3A8P A;  2DHZ A;  5J2R A;  4MK0 A;  1XQQ A;  2RR9 A;  2YS3 A;  3SDL C;  1P6S A;  1YJ1 A;  4KZ0 A;  1V61 A;  2QHO A;  2MBE A;  2KDB A;  5D6J B;  4EZK A;  3ZUN A;  3OAN A;  5DH9 B;  2R0D A;  1ZC4 B;  4FJY A;  2VRR B;  2J0K A;  2ADZ A;  4AWJ A;  4F7H A;  1SIF A;  2IYD B;  2KX3 A;  3AU4 A;  4DBG A;  3V5W A;  3A4S C;  3A33 B;  2D4Q A;  2DAF A;  2KVR A;  1V81 A;  2HRJ A;  2DKP A;  1P3R A;  1R4N I;  3F0W A;  3M63 B;  4HXD A;  4W9I A;  4EFO A;  3ZDT A;  3A1Q A;  3UIO B;  2J7Q B;  4B95 A;  4RM9 A;  4EEW A;  3M95 A;  1EAZ A;  3MJW A;  4DDG D;  3M62 B;  1H4R A;  2IO2 B;  5CTR C;  1YD8 U;  3JSV A;  4J6I A;  5FR6 A;  1C1Y B;  4NQK E;  3ENE A;  3V6E B;  3V60 A;  1IYF A;  2GBK A;  1H10 A;  2JZZ A;  1V5P A;  4TYZ A;  3LJ3 A;  2BYE A;  2RLO A;  2VRW B;  1RFA A;  5FI1 A;  2YSZ A;  4JK7 A;  2K39 A;  4FJV B;  2ZNV B;  5C16 A;  3VIA A;  2I5F A;  2LGD A;  3D8E A;  2BGF A;  3UGB B;  2NBW B;  4TUU A;  3AUL A;  1N3H A;  3B0A A;  4FHK A;  1RRB A;  4WJQ A;  3VH3 B;  4KSL C;  4MGZ E;  3WAN A;  4WJ7 A;  2B3A A;  2KDE B;  2L8J A;  2IFS A;  3CF6 E;  3QA8 A;  4A6K A;  4MY6 A;  4LDT D;  1VD2 A;  3UZT A;  4JKA A;  1MPH A;  3WAP A;  2D10 A;  5CHW A;  5L81 A;  3AU5 A;  3L08 A;  4WVF B;  3PSE B;  2YVC A;  4HAU B;  5DCN A;  2YT1 A;  4GZU A;  2L0F A;  4HAV B;  5D94 A;  2KFK B;  2MSE D;  3DBR I;  2BPS A;  3SBT A;  2FNJ B;  2CR5 A;  3DOW A;  4HWI B;  4XC2 A;  3VHT C;  2L05 A;  2N1V A;  2XK5 A;  2MBO A;  2JWZ A;  5J3Y A;  3ML8 A;  4DX8 A;  2LAS A;  1WVH A;  1DRO A;  1NU2 A;  4K7W A;  2DX5 B;  5J3T A;  4D0N B;  4JL9 A;  4W9L A;  3QHT A;  2KLG A;  3DXD A;  1L2N A;  4TKN A;  1TXD A;  5DHF B;  3ONS A;  2KQS A;  1X1M A;  4PYZ A;  3RUI B;  1P98 A;  1UBQ A;  3KUZ A;  2UZR A;  2JY6 A;  4CHJ A;  5DI9 B;  3TJP A;  2MBQ A;  5LOP B;  4CHM A;  2CU1 A;  2N4F A;  3JVZ X;  2BWE S;  2YF0 A;  2G35 A;  2KQ7 A;  4YL8 A;  3Q3F A;  4DHZ E;  4GDK A;  4HHV A;  1GC7 A;  3E9L A;  2KMC A;  1NTI A;  2XQN M;  3MPX A;  2L7R A;  3NOB A;  3V61 A;  2LG1 A;  4HCN B;  2OOB B;  2LKO A;  1QZE A;  3H7P A;  1FHX A;  1JRU A;  5D3W A;  2NMB A;  2PE6 B;  4PS7 A;  2FCQ A;  4GMX B;  2R2O A;  1K5G B;  3SO6 A;  2HTH B;  1WXS A;  1UZX B;  4F7U P;  2KOX A;  5GOW B;  5JHB A;  1WX9 A;  4W9H A;  2KLC A;  2M17 A;  2W2X D;  2Q13 A;  4K7U A;  3ULC A;  1WR1 A;  1WJN A;  2KFJ A;  2DA0 A;  4HB0 B;  3A9J A;  2OTX A;  4XX5 A;  3KYD D;  1E7V A;  3ZNH B;  1FXT B;  5IA7 A;  3KUD B;  3PV1 A;  4HB3 B;  2FDQ A;  2ABD A;  3QJZ A;  2IY1 B;  2KUP A;  1V88 A;  2BYF A;  4HB2 B;  3TFM A;  1L7Y A;  2MWN B;  1V49 A;  5AZF A;  4GMV A;  3R7Q A;  2MLB A;  2OJR A;  4DK5 A;  2EMT A;  4GN1 A;  1XD3 B;  1XT9 B;  1WJU A;  5HE3 A;  4ANU A;  2CKH B;  2GBJ A;  1ST7 A;  3W1S A;  1J0W A;  1W1G A;  2KHW B;  1GC6 A;  4GDL B;  3PHX B;  1WZ3 A;  5DPW A;  2KKC A;  2RPQ A;  1Q67 A;  2NR2 A;  1X86 A;  3PGE A;  3QAR A;  2DYO A;  1XOD A;  2D3G A;  2D9Y A;  2X18 A;  3PEG A;  1WF9 A;  2LUL A;  3GZN I;  5CLQ B;  4ICV A;  4KVG B;  2WWZ A;  2C7M B;  1XR0 B;  4JKD A;  2Y8F A;  3ZLZ A;  2MBB B;  4EOY A;  1I2H A;  1EO6 A;  2V1Y A;  3B08 A;  4DHJ D;  1RLF A;  2PZ1 A;  1YQB A;  3TBL D;  3CXB B;  1V80 A;  1M94 A;  4GU2 A;  3VUX A;  2I5C A;  3SD5 A;  2MCN B;  4JKH A;  2P0H A;  1PFJ A;  1ISN A;  3D8F A;  3DQV A;  4DHJ B;  1BT0 A;  3UQA A;  1T0Y A;  4ASW C;  4ILG B;  2GJY A;  4BOZ B;  2R2Q A;  1HB6 A;  3PT2 B;  3L17 A;  3QIJ A;  4KDI C;  2IY0 B;  3A1Q B;  3APF A;  1LQB A;  3B1L X;  4EUT A;  1EUV B;  3NZU A;  2LOX A;  4FBJ B;  1QC6 A;  4GGQ A;  4GB9 A;  5JZE B;  1WE6 A;  2CB8 A;  4URK A;  3JSV B;  5C23 A;  5EDS A;  1WIA A;  1WYW B;  2LD9 A;  1IPG A;  1HE8 A;  1KZG A;  2N23 A;  4ILJ A;  1P1A A;  3FEH A;  4MJS A;  3DVN V;  4K2P A;  1XKE A;  3F5R A;  1RRP B;  2DTC A;  4YON A;  3PS6 A;  1MK7 B;  4P7I A;  3VTU A;  1LXD A;  2JXX A;  2KK8 A;  2DAJ A;  1DDM A;  2FAZ A;  3PLU A;  2LBB A;  4DX9 0;  1KJT A;  1Y8R C;  3ALB A;  3A8Q A;  4RM8 A;  4BBN C;  2KTR A;  4JKB A;  5G55 A;  3SYX A;  4MGK E;  2LGY A;  1PQS A;  1FGY A;  3NHE B;  2KX0 A;  1U5E A;  2LVO A;  4HPM B;  2D9V A;  2M0X A;  2G3Q B;  2RD0 A;  2E2X A;  2X0S A;  4A6F A;  4GXB A;  3ZNG C;  3U8Z A;  3QX1 A;  3HQC A;  2MDX A;  1OQN A;  2XK5 B;  2WX0 A;  3VQI A;  3I3T B;  1WJ1 A;  1WR6 E;  2REX A;  2D07 B;  3TL5 A;  5JHH A;  2G4S A;  4MH0 E;  3SHQ A;  2CY4 A;  1BAK A;  2DZM A;  5HKH A;  2EKE C;  4NPN A;  1KOT A;  4NSW A;  1WZ0 A;  2OQB A;  4FJZ A;  2FCM A;  5J3Q A;  4RMA A;  1W1H A;  4FAD A;  2IBI B;  4IFS A;  2COA A;  3PVL A;  1VBH A;  1GUA B;  3NY5 A;  4LJP B;  4C0A A;  3DXC A;  1WI1 A;  4CYE A;  1LM8 B;  2KTF A;  1NDD A;  1EF1 A;  1ZSQ A;  4GDK B;  1V6E A;  1F9J A;  5DPT A;  2K8C A;  3ZNZ B;  3PG7 A;  4OVU A;  1GJZ A;  3PSC A;  4F7Z A;  3UIN B;  3H7P B;  3IBE A;  1KLV A;  3RD2 A;  1OY2 A;  1LB1 A;  4GPT B;  2AEH A;  2KN5 A;  3PHW B;  3P2B A;  1GG3 A;  4HAT B;  2I1J A;  2ELA A;  3SNH A;  2KDI A;  2MQJ A;  1ZKH A;  1IP9 A;  2FUH B;  3QWM A;  3W1Y A;  2KC2 A;  4MEM A;  5AZG A;  4WSF A;  1SE9 A;  3HIZ A;  4BKS D;  1XD4 A;  3K9P B;  2D9X A;  1V86 A;  2KWU B;  3A9J B;  3UIP B;  5HE2 A;  3ODO A;  1WJ6 A;  2MX2 A;  3QBV B;  2M8S A;  2N7D A;  1XX0 A;  2LRU A;  2K1F A;  3EEC A;  4HB4 B;  3PRZ A;  4EMO A;  3E66 A;  1YIW A;  4HDQ A;  4KSK C;  3FP5 A;  2M4N A;  2PEA A;  4GOC A;  4JKG B;  2ZCC A;  2H7D A;  4NY0 A;  4HAW B;  3TMP B;  5CLL B;  4W9C A;  1WXA A;  2JVC A;  3HM6 X;  3SV1 A;  3RCP A;  4AJY B;  2LGX A;  4II3 B;  2KXJ A;  4DHZ B;  1D3Z A;  2P0F A;  2FJL A;  3KVF B;  3LDZ E;  2ROZ B;  3QK0 A;  1UEL A;  1E8X A;  4IUM B;  4N9F 4;  2BF8 B;  2K2U A;  1S3S G;  4CHK A;  4DWF A;  3PRP B;  3AI5 A;  4HK2 A;  3N7C A;  3WIM A;  2ZZP B;  1UBI A;  1NTV A;  2KWC A;  2Z0D B;  4M8M A;  2JT4 B;  2ZCB A;  2C7H A;  5C1Z A;  2GCJ A;  4LDT B;  3C0R B;  3IHP C;  3NS8 A;  3TO1 A;  4LJO B;  3DVG X;  4K17 A;  3KYC D;  1WGY A;  3VTW A;  4HJK A;  4JKC A;  1FHW A;  5LXH A;  1DDV A;  2NS5 A;  1Q1O A;  2CHZ A;  4W9K A;  3FLV A;  4NNJ B;  1EF5 A;  4A3P A;  3LJU X;  2CHX A;  1WI0 A;  3KRW A;  2XEW A;  2DHJ A;  4FA6 A;  1E8W A;  5J18 A;  1Q0W B;  1V89 A;  1AWE A;  2CAY A;  4BBN F;  1DBH A;  1WMH A;  2MW5 A;  4WJO A;  2DHK A;  3VUY A;  4MJS B;  3IVF A;  3JYU A;  5BO4 B;  2IZV B;  4W9F A;  2N1W A;  2WH5 A;  4DXA B;  1OMW A;  1RAX A;  1U2B A;  4ZYN A;  2DHI A;  1YX6 B;  4EKU A;  4KV2 A;  2J0J A;  1BTK A;  1Z5S B;  2KGX B;  2KTR B;  2UZS A;  3PRM B;  2WDT B;  3TVV A;  3GYO A;  3PPA A;  3MDB C;  2R82 A;  3ML4 A;  5E6O A;  2FCS A;  5KQ1 A;  4K7S A;  1FGZ A;  3VVW B;  1H8C A;  1NI2 A;  4A6F B;  2MWS B;  4IC7 B;  4HAX B;  2HJ8 A;  2HD5 B;  4XZ4 A;  2KDF B;  2JF5 A;  1DIK A;  5D2M B;  1ZW7 A;  3ZKJ C;  5HE0 A;  3Q3J A;  1UEF A;  4BKS A;  3TIX A;  4PNK A;  4I6L B;  3CST A;  1NVL A;  3APC A;  1X1G A;  5DIF B;  2Y5B B;  2AL3 A;  2CQU A;  2CS4 A;  4AOF A;  3P7Z A;  2H7E A;  4JKG A;  2GCL A;  4PS3 A;  4EZL A;  4M8N A;  1FB8 A;  3O96 A;  2MA9 B;  4A3O A;  2LXC A;  2UYZ B;  5KQ4 A;  4JK8 A;  2D9W A;  4ZRJ A;  2DYN A;  1UH6 A;  3IG3 A;  2RNR B;  4L6E A;  3WYF B;  1J0G A;  2IO1 B;  5HE1 A;  4MM3 A;  2Z0Q A;  1E8Z A;  5DPS A;  2ZEQ A;  5FI0 A;  4H8S A;  3OJ3 A;  3QAQ A;  2DYQ A;  5KCV A;  3EFU A;  2K6Q A;  1V5M A;  4ZDV A;  2ZPN A;  1WM3 A;  1HBK A;  1MK9 B;  4JQW C;  3KW5 B;  4IAP A;  3PRE A;  5IAA C;  2GBN A;  1RJ2 A;  3ODW A;  1MIX A;  4TQ0 A;  2M38 A;  3ENB A;  4A6H A;  4KHA A;  1J8C A;  1ZVR A;  3SBG A;  1B55 A;  2C5L C;  2KO3 A;  4K1R B;  2ZPY A;  3MTN B;  3HK0 A;  2BYV E;  4JLC A;  2LUE A;  1Z87 A;  4G0N B;  3HW2 B;  2DEN B;  1OEY J;  3ZO5 B;  2FJ9 A;  2FCN A;  3WA0 A;  3BIN A;  4HCP B;  1M7E A;  2RGN B;  4FN2 A;  2C60 A;  2ZJD A;  2KC1 A;  3M1I B;  1S1Q B;  1SGH A;  5LLI A;  2D2Q A;  4KHO A;  3L54 A;  4WAA A;  1J19 A;  5E6P A;  2VSZ A;  1OQY A;  4EZJ A;  1UNQ A;  2D9Z A;  4KDL B;  1TQZ A;  2L2I A;  4IM2 A;  1ZGU B;  2K8H A;  2PPH A;  4B6H A;  5LON B;  3M3J A;  3N32 A;  1U27 A;  2M14 A;  4MT7 A;  4WJP A;  3IFW B;  2UWQ A;  5JHA A;  3CMM B;  2K00 A;  5C5B A;  3JW0 X;  4I6P A;  4ZRI A;  1WJM A;  1ZM0 A;  4LCD E;  4G50 A;  5J17 A;  2M1M A;  2NVU I;  1TBE A;  1WGQ A;  1E7U A;  4KAX B;  1EVH A;  4ANV A;  2EJ8 A;  4IWO A;  4MGI E;  1WG7 A;  4F8C B;  2HE7 A;  2G4D B;  2QKL A;  2K2J A;  2G45 B;  1WGH A;  4F7G A;  2RUK B;  1WGD A;  2W9N A;  2R09 A;  1Q5W B;  3DBL I;  1I35 A;  2KAN A;  3BY4 B;  1FHO A;  3P6A A;  3VTV A;  3A9K A;  3L10 B;  4FUL A;  4II2 B;  2GBR A;  4KIK B;  3AXC A;  4TQ1 A;  3R3M A;  2N0Y A;  3VH4 B;  2NZ8 B;  2FIF A;  5D27 A;  3U7D A;  2O6V D;  3KUC B;  2O2V B;  1P5T A;  4JGH B;  1YX5 B;  2L76 A;  1U5F A;  1QQG A;  1TTN A;  5TR5 A;  5CHF A;  2GS0 A;  2DZJ A;  4NAW B;  2O6V B;  2K25 A;  3SUZ A;  4BFR A;  3H1U A;  2KCJ A;  1BWN A;  2W2X C;  1WMH B;  5G2N A;  3RCZ A;  2J59 M;  4FHJ A;  3PLV A;  2JZ3 B;  3T9L A;  2LJ5 A;  4IW0 A;  2KMA A;  2ELB A;  2MBH A;  2LWP A;  4IWQ A;  1U5D A;  2PJH A;  2RVB B;  1A5R A;  3PZD A;  2C7N B;  4IM0 A;  5E6N A;  3OAW A;  4WQO B;  4BKG A;  1AAR A;  4IM3 A;  5DPR A;  4EJN A;  1VBG A;  2N7E A;  1IRS A;  1R4M I;  5JP4 A;  4KHB B;  2XBB C;  2V3S A;  1WX7 A;  4WWN A;  4A20 A;  5L83 A;  5KHQ A;  4MGY E;  2BWF A;  2COF A;  2BCJ A;  2YRY A;  4Z2N A;  2DKQ A;  4B9K A;  1AQC A;  4W9G A;  2RGF A;  3L13 A;  1WGU A;  1TJ6 A;  2KJ6 A;  3EC8 A;  4W9J A;  1WXM A;  3AJ4 A;  1MAI A;  4K81 A;  4JIO U;  2DX1 A;  2COD A;  3O65 B;  1OTR B;  1WGR A;  2A4Z A;  2AYO B;  4ILH A;  5LXI B;  2MP2 A;  1XCG A;  4HAY B;  2L1C A;  1V2Y A;  1LW3 A;  3DXE A;  3D32 A;  2EMS A;  4MEL A;  2AWT A;  2K8B A;  2RQ1 A;  2GMI C;  3SU8 X;  2WX1 A;  4B6W A;  1WX8 A;  2N9P C;  2DLW A;  2Z0P A;  4JKF A;  1Y19 B;  2DZI A;  1Z2M A;  2A5U A;  3L0W B;  1WY8 A;  1E90 A;  4ICU A;  1CMX B;  2P8V A;  4OVV A;  1BTN A;  3BJI A;  3A4R A;  1PMS A;  1KBL A;  5AZH A;  1WXV A;  5GMV A;  3GOE A;  1MKE A;  3UF8 A;  1G6J A;  2NPT A;  1WFY A;  5C79 A;  1WE7 A;  2LXA A;  3D8D A;  4F1S A;  3DVN U;  4KIK A;  4HAZ B;  2Y8G A;  3ZW3 A;  3VXW A;  4GSW A;  3PVW A;  3PP2 A;  3APD A;  2O2V A;  4PS8 A;  1SHC A;  5CX3 A;  2NBV B;  4HVB A;  5AEK B;  1MIZ B;  4E71 A;  2L0T A;  4MDK E;  3RZW C;  2JRI B;  4NAW A;  2O6V A;  3S2A A;  2KZR A;  2KWV B;  3FM8 C;  2LVQ A;  1DDW A;  2DN6 A;  1UNR A;  2LYD A;  3ODX A;  1I42 A;  2PE9 A;  3WAO A;  4ZRK A;  2JP2 A;  4PQ0 A;  2ROV A;  2NBU A;  3ZNI D;  5C5B B;  3DCG A;  1HB8 A;  2ZVN A;  4BVU C;  2DIK A;  2CY5 A;  1E8Y A;  3X23 A;  2L00 B;  1EGX A;  3QC8 B;  3ZVV A;  2YT0 A;  4FLH A;  2DYB A;  4GIV A;  3DBH I;  3G9W A;  4Y94 A;  5D3X A;  2KJR A;  1NBF C;  2JRH A;  1OEY A;  3OJ4 B;  1UNP A;  2RSU A;  4NQL B;  2COP A;  3ZDM C;  3TCA A;  1P9D U;  4BKT A;  4W9E A;  2C9W B;  4G11 A;  2YS1 A;  1GNU A;  2DYM A;  3A9K B;  1W1D A;  3GYP A;  4NJ7 A;  2DFK A;  3K9O B;  3KZ1 A;  2JUO A;  4DBB A;  2N9X A;  3ZTD A;  4JKE A;  3ZRF A;  3WAM A;  2LRW A;  4K2O A;  3QCA A;  1WRD B;  4JK9 A;  2EC1 A;  2COC A;  2MRP A;  3N3K B;  3HM3 A;  3V6C B;  2JPH A;  3X0W A;  2UVM A;  1E5W A;  1X05 A;  1U4A A;  3PVU A;  2LZ6 A;  3CSF A;  1X11 A;  2Z0O A;  3A98 B;  3FSS A;  2CHW A;  3ULB A;  2CRF A;  1P3Q U;  3CIK A;  1V5O A;  2GOW A;  3DBS A;  1Y5O A;  4A5K A;  1UGM A;  5IJM A;  2MKR A;  1ACA A;  3UQB A;  3VAW A;  4PYU A;  3KY9 A;  1I7A A;  3R66 C;  3V62 A;  3QWZ B;  2DZK A;  3T8M A;  3W1S C;  3NZS A;  2J0M A;  1WM2 A;  3TW1 A;  3U30 A;  2W2W A;  4E74 A;  1UD7 A;  4Z2M B;  2YLM A;  4AUQ C;  4BOS C;  2D11 A;  2ZNV C;  2VKI A;  5JHG A;  5JLJ B;  1ZC3 B;  4HPL B;  5JH5 C;  5D7G A;  2NCN A;  3H9D A;  4ANW A;  3H7S A;  3VUW A;  5CHV C;  2LOZ A;  3NSU A;  1NTY A;  5KHO A;  4WWO A;  3KRX A;  2K6D B;  4WJN A;  4X57 B;  1KC7 A;  2KFK A;  5C6R A;  2IO3 B;  2ASQ A;  3ZRC A;  4KZC A;  1V5U A;  1U29 A;  2ZVO A;  2LVP A;  4XWX A;  3ECI A;  2QKM A;  3KH0 A;  4BBK A;  5EFX A;  4WWP A;  4TV3 A;  2Z0E B;  2L3Z A;  3MHS D;  4ANX A;  3OLM D;  4IOY X;  1C3T A;  2DX5 A;  1TZ1 A;  2IYB A;  3DPD A;  2MP2 B;  3DVG Y;  2KJH B;  2AL6 A;  1JDE A;  1V5T A;  4HDO A;  2Z59 B;  3PTF C;  1M7R A;  2P0D A;  1PLS A;  1OGW A;  4AJW A;  3EHV A;  1UPQ A;  4E3C A;  4W9D A;  4MSQ B;  3RYT A;  1GGO A;  4I6N B;  1KI1 B;  1K5D B;  2V4L A;  3KSY A;  3ZIM A;  5L95 C;  4DDI D;  1U5G A;  1MG8 A;  2GBM A;  2IO0 B;  3ZTC A;  2YS5 A;  1K8R B;  1KM7 A;  5D3V A;  3L16 A;  2RSG A;  2V76 A;  2WYQ A;  2KNB A;  1UPR A;  2MFQ A;  3E9O A;  1X1F A;  1TGZ B;  3QQ8 B;  1WGG A;  1V9J A;  5D3Y A;  2NPT B;  4MSM B;  3RZF A;  2BKF A;  3N30 A;  4IG7 B;  1FOE A;  4HLE A;  2HTH A;  2KD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...