4ZRIA

Crystal structure of merlin-ferm and lats2
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
293
structure length
293
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
molecule keywords Merlin
total genus 87
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zriA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zriA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zriA01
1WF9A 3H7PB 2N9XA 2IYDB 1W1HA 2DHKA 2KX3A 3DBRI 1E7UA 2DZIA 5GOWB 3A4SC 4WJQA 3V60A 3WAOA 2D9XA 3ZNZB 5J18A 5L95C 2ZPYA 2DX5A 2MQJA 3HM3A 1Q0WB 3KZ1A 1SIFA 2RGFA 5DHFB 2LRWA 4HDQA 1OY2A 1X1FA 2LXAA 2D10A 2MP2B 2KFKA 3VUYA 1YX6B 3HM6X 2MDXA 4HAWB 5C16A 4KSKC 4NQKE 1P98A 5E6OA 3SDLC 5JHBA 1X1GA 2D9ZA 3T06A 1UNRA 3TO1A 3EC8A 1RRPB 1FAOA 4B6HA 3N32A 5KHQA 2C5LC 1N3HA 1PLSA 1AWEA 2BYEA 2MBHA 1S3SG 2LGDA 2LGXA 5CHFA 3RCPA 4NSWA 2P0HA 4F7UP 2BKRB 2KJRA 2COCA 2MKRA 4PNKA 4WQOB 2YRYA 4L6EA 2AYOB 1J0GA 2O6VB 1MPHA 4A6FA 1WRDB 3ML8A 4PS7A 3VH4B 2OOBB 4MK0A 4DDGD 1LB1A 3EECA 4DHJB 2NVUI 1W1DA 3TMPB 4K1RB 1MAIA 2ZVOA 4WJPA 4TV3A 1GG3A 4NY0A 2X18A 4MELA 1WJ1A 3DVNU 1UPRA 5CLLB 1WGHA 3A4RA 2DX1A 2R0DA 1IRSA 4PQ0A 3VIAA 1EAZA 2FCSA 4HPLB 3EPYA 2K2UA 4NAWB 2RQ1A 3H7PA 4B9KA 4FN2A 2K1FA 1Z87A 1RLFA 1BTNA 4PS8A 3TJPA 2DYQA 4G0NB 5BO4B 3WIMA 3D8DA 3ZKJC 2LWPA 4II3B 1LXDA 2MX2A 3TFMA 2W9NA 4H8SA 3RT3B 5JLJB 2G4DB 3VHTC 1UPQA 1UBQA 3RULA 3UINB 3F5RA 2MBBB 4D0NB 4GGQA 4AOFA 1BAKA 2YS5A 2ABDA 2MFQA 3RZFA 3PSCA 3V61A 4E71A 3JYUA 1C3TA 2DYMA 2KTRB 1WX8A 1NTVA 2KFKB 3APCA 3P2BA 5CHWA 5G2NA 4CHKA 5JHAA 5KHOA 2RUKB 5KCVA 4HLEA 2D9WA 2Z0OA 4TUUA 3PRZA 4Z2MB 2BYVE 3SU8X 4GN1A 2AEHA 1KM7A 1X86A 1V5TA 1WX9A 1WXAA 2ZPNA 3T8MA 3V62A 4F7ZA 1DDWA 3KH0A 2ELBA 2W2WA 1E8ZA 3VFKA 3ZO5B 4GPTB 3SUZA 2MWSB 3FSSA 1I7AA 2KWCA 4NPNA 3TCAA 1ACAA 2L0FA 1MIZB 2JZZA 4A20A 4DK5A 4HB4B 3ODXA 4A6KA 2UZSA 2IO2B 3SD5A 3PT2B 2MWNB 2L05A 1IP9A 2G4SA 2YS1A 1V81A 1ZM0A 2VKIA 4X57B 2GBKA 3WA0A 1WXMA 1Z5SB 3ECIA 2KANA 2Z59B 2J7QB 2DLWA 1WZ0A 3AXCA 1BWNA 4W9FA 3D32A 3V6EB 1GNUA 5LOPB 1UELA 1U5DA 1UZXB 3PHXB 4GDKA 4XWXA 1XD3B 1SE9A 1WIAA 2DZJA 4URKA 2OQBA 2L1CA 2ADZA 4E74A 2WX0A 2KWUB 1U2BA 1WJMA 3N7CA 4IWOA 1WJ6A 2V3SA 2FIFA 3TVVA 2MBQA 3B0AA 3DVGY 4ICVA 1GC6A 2CY4A 3DCGA 4KZ0A 1T0YA 4YONA 2GBNA 2NBVB 1FGYA 2UYZB 3DVNV 3JW0X 4FJYA 2ROVA 2EMTA 2CKHB 2N7DA 2QHOA 3B08A 3PLUA 2KDIA 1BT0A 2YT0A 2LASA 1IYFA 1XX0A 4FHJA 5HKHA 2DHIA 2D3GA 2C60A 3PS6A 4HCNB 1YQBA 3U8ZA 2MLBA 3WYFB 3A9JB 2RSUA 4MH0E 1NTYA 1VD2A 1HB8A 3AJ4A 2I5FA 5D3WA 2NCNA 4B95A 3H7SA 4WVFB 2FJ9A 1S1QB 2COPA 3PHWB 4IW0A 4IWQA 4KSLC 2HTHB 4HDOA 3VTVA 2D4QA 3DBLI 3ODOA 1FXTB 2K6DB 3PVLA 1NTIA 4FADA 1PMSA 1XKEA 5C79A 3W1SC 2FDQA 3QIJA 4E3CA 2A5UA 2GBMA 3ML4A 4W9EA 3FLVA 2LZ6A 1TTNA 4DDID 4IC7B 3L54A 2FCNA 1K5DB 2KLCA 2R2QA 1GJZA 2C7NB 4LJOB 2MBEA 2NS5A 2ZZPB 1M7EA 3ZNID 3ULCA 1RRBA 1I2HA 3V5WA 1RAXA 1RJ2A 1P1AA 2GOWA 2PJHA 2O2VB 3CMMB 3VTUA 4F8CB 5EFXA 3EHVA 2WH5A 2XEWA 4W9JA 5E6PA 4EMOA 1WMHB 1EO6A 2NR2A 3NOBA 4NJ7A 4ANVA 3OAWA 2O2VA 3FEHA 2KTRA 2EJ8A 5D3YA 5HE1A 2IBIB 2M0XA 1I35A 3P6AA 3KUZA 1V6EA 1XQQA 3Q3JA 2JWZA 3UQAA 2RLOA 2PEAA 2UVMA 4I6PA 5C5BA 1M94A 4DHZB 1WG7A 4EUTA 4K81A 2VRWB 4FJZA 4MGYE 4RM9A 3CSTA 3TW1A 4M8NA 4ZDVA 4HATB 2FCMA 2KOXA 3CF6E 2HRJA 1WM3A 1YD8U 3ZRFA 3R7RA 4A6FB 4KHAA 4KVGB 1LM8B 4F1SA 4ZRJA 4ICUA 1V49A 1V5PA 4HAUB 2GBRA 2KCJA 1Q67A 2CHZA 1GUAB 2KX0A 2M17A 1EGXA 4Z2NA 1WGUA 2UZRA 5D27A 2DYOA 2KKCA 2LUEA 2PE9A 2C7HA 3KVFB 2H7DA 5LLIA 1FHWA 4IFSA 1IPGA 3I3TB 4G50A 2BYFA 2COAA 3QARA 2KVRA 5FI1A 3PRMB 4ANXA 4GZUA 2J0KA 3UQBA 5HE0A 2IY0B 4HJKA 2BKFA 3APFA 1ZKHA 4PYZA 4CHMA 2GCJA 1WMHA 2W2XC 2OJRA 3HK0A 3PLVA 5D2MB 3WAMA 2DKQA 1D3ZA 1LQBA 1WJNA 2J0MA 2MW5A 3IVFA 2C7MB 2CHXA 2LVPA 2Z0EB 3CSFA 1E90A 3QA8A 2RNRB 3SO6A 4GIVA 2LVOA 1V5MA 3IG3A 2L3ZA 4GSWA 4W9HA 3N3KB 5IA7A 2ZCBA 2LULA 1VCBA 3A98B 5JHHA 1NU2A 1X1MA 2KXJA 2LVQA 1UH6A 1WH3A 1JRUA 1ZSQA 4FJVB 3PRPB 4DWFA 3PP2A 2DYBA 1WE6A 1NDDA 4ZRIA 4I6NB 4B6WA 2NMBA 4PYUA 2N0YA 2DHJA 1WZ3A 4HK2A 2WYQA 2LD9A 2D2QA 1ZC3B 2MRPA 3AULA 4LJPB 2KO3A 2JXXA 3HQCA 4GOCA 2AL6A 3ML9A 3ALBA 3L16A 1P3RA 4JIOU 3ZIMA 1GC7A 5EDSA 1H8CA 2L7RA 3UIOB 2E2XA 3VOQA 4AP4C 2LXCA 3K9PB 4M8MA 5D3VA 3ZVVA 2B3AA 2J59M 2YT1A 1KJTA 4DBGA 2CODA 3UZTA 1TQZA 2D9VA 1V89A 5L83A 3UIPB 3MPXA 2UWQA 5HE3A 2BPSA 3OANA 4KHBB 4C0AA 3KYDD 3L17A 3QAQA 4ASWC 2DA0A 4CYEA 2K25A 5LXHA 2FIDA 2OTXA 1OEYJ 4JGHB 4A3PA 2DHZA 2FNJB 3VUWA 4BOSC 5J3YA 2YS3A 1F9JA 3ZNHB 4KAXB 2MA9B 3W1SA 1AQCA 1KZGA 4BVUC 1E7VA 5JH5C 1K8RB 3P7ZA 2GS0A 3ONSA 4IG7B 1AARA 4ZYNA 2D11A 4ANWA 2MSED 3VVWB 2NPTB 3NHEB 4G11A 2I1KA 4BBKA 3SHQA 4MJSA 3PG7A 4A6HA 2K8HA 3JSVB 4HXDA 1QQGA 1V2YA 2Q13A 4KIKB 3RUIB 1WGGA 4RM8A 2DAJA 3M63B 1WI1A 1NBFC 1U5FA 5J3QA 1E8YA 4XC2A 3KUCB 1DYNA 2CR5A 2HJ8A 2XK5B 3M95A 4EOYA 2KK8A 2P0FA 3R7QA 3ZUNA 3HHMA 4EZLA 1Y19B 1EF5A 4WJOA 5C5BB 3N30A 3A8PA 3NZUA 2HTHA 2FUHB 2W2XD 3DPDA 3QWZB 4WAAA 5E6NA 5IJMA 4W9KA 4IWPA 5D7GA 4NNJB 2CY5A 3ODWA 3DVGX 5DCNA 3IHPC 3ZDMC 4EJNA 3F0WA 2RSGA 2RVBB 2JZ3B 4DHJD 4IM3A 3APDA 4TQ0A 2LBBA 4MGIE 3GZNI 1OQNA 4GDLA 2MCNB 2LYDA 2ZNVC 3T9LA 4GB9A 3WANA 1YJ1A 2HD5B 2XBBC 2N9EB 5AZHA 4HAZB 1HB6A 1A5RA 4IM2A 2QKLA 2KD0A 2IY1B 4OVVA 4BKSA 3BJIA 3A1QA 1FHXA 2EC1A 2VRRB 2LJ5A 4BBNF 3QHTA 1I42A 2L2IA 1WY8A 1V86A 1RFAA 1KOTA 5KQ1A 2LRUA 3ZTDA 3L0WB 4G3XB 5CHVC 3X23A 3VH3B 1FOEA 4MT7A 3NSUA 1TZ1A 2KNBA 3C0RB 2NZ8B 4DHZE 1YX5B 2DAFA 2O6VD 3DXCA 2RPQA 5HE2A 4MY6A 2K8CA 2CS4A 2JY6A 2O6VA 1K5GB 1U5EA 5DHAB 4GMVA 3O65B 4K7SA 4N9F4 3RZWC 2ZEQA 2PE6B 2V76A 3TBLD 3JVZX 2D07B 5JP4A 2N7EA 3ULBA 2N9PC 2JRIB 4HCPB 4CHJA 3PREA 1V80A 3A9KA 1NI2A 1EF1A 2KMCA 3PGEA 3WAPA 1SHCA 3R66C 4FLHA 4HAXB 4J6IA 1V88A 5AZFA 1U29A 2A4ZA 1WR6E 2NBWB 2JUOA 3WALA 1XR0B 4JLCA 3ZW3A 2M1MA 3ZRCA 2BCJA 5CLQB 2Y8FA 3PEGA 3VAWA 4HVBA 4AJWA 3AI5A 2M38A 4WSFA 5C6RA 2IO1B 1X05A 3NY5A 1UNPA 3OJ3A 2JPHA 1M7RA 1ST7A 4TYZA 3KUDB 1P9DU 5JHGA 5DH9B 4KDLB 4P7IA 3V6CB 1FGZA 2I5CA 2DFKA 2ASQA 2MBOA 4WWNA 2COFA 1V9JA 2KLGA 3ENEA 3QWMA 2DKPA 3AU5A 1UBIA 3A8QA 2JVCA 2NPTA 1UEFA 2LOZA 1J0WA 4HB0B 1WX7A 4HPMB 4WJ7A 4K2OA 1HE8A 1UD7A 1P6SA 1BTKA 1V5OA 5DI9B 5J3TA 4W9CA 4K2PA 2KN5A 3QK0A 2K2JA 4DXAB 4IUMB 3B1LX 1U27A 1WGRA 2IO0B 4MEMA 1L7YA 2XQNM 1HBKA 1XD4A 3MDBC 1P5TA 2ELAA 4IOYX 3DXEA 2LKOA 3QX1A 3GYOA 1ZGUB 5JZEB 3OJ4B 2BF8B 5FI0A 4BOZB 1WI0A 1MG8A 1OTRB 3G9WA 3H6NA 3L13A 4LDTB 2J0JA 1KI1B 3CIKA 2WDTB 2LI5A 3NZSA 3OLMD 4FA6A 1E5WA 4GU2A 2VSZA 2Y7BA 1UGMA 5G55A 2BWES 2KZRA 4K7WA 1W1GA 4HAYB 3ZVRA 2DZMA 3RYTA 1Y5OA 4W9IA 3VXWA 2DZKA 4MDKE 3PZDA 1J19A 1TXDA 2DYNA 2EMSA 1UNQA 2QKMA 2LGYA 3LJ3A 2ZCCA 1TJ6A 1DROA 2M4NA 4ZRKA 1QC6A 2KQSA 2M8SA 3LJUX 3VUXA 4HB2B 1R4MI 4MSQB 3U7DA 1PFJA 1MIXA 2FCQA 2NBUA 3W1YA 1FB8A 2PZ1A 1DDVA 1R4NI 1FHOA 2P0DA 4GMXB 1WJUA 1E8WA 2G3QB 2ZVNA 2JRHA 3GOEA 3PTFC 4M0WB 3ZDTA 4K17A 1P3QU 2IYBA 1LFDA 5KQ4A 2Z0DB 4W9LA 1QZEA 4NJ6A 4F7GA 5CTRC 2JP2A 1WXSA 5C23A 3SV1A 2BGFA 1XCGA 2DENB 1V61A 2R09A 3QBVB 1WE7A 2R2OA 3DBHI 3DOWA 4KIKA 4WWOA 4W9DA 5DPWA 2HE7A 4HB3B 4DX8A 3M3JA 3JSVA 3ZTCA 3M62B 1U5GA 1WXVA 5D94A 3A33B 3IFWB 4MM3A 1OEYA 2WWZA 4BKSD 2G35A 3O96A 1WVHA 2KFJA 3A9KB 5GMVA 1TGZB 3DBSA 1V5UA 1H10A 2RGNB 1NVLA 4PS3A 4GDLB 5J2RA 2WX1A 3TIXA 3VDZA 3L10B 2KHWB 3M1IB 2KMAA 4HWIB 3AU4A 3QCAA 2CRFA 1WGDA 1WM2A 4RMAA 4JQWC 1WJ4A 5AEKB 3H1UA 2CHWA 3KY9A 2REXA 4KHOA 4GDKB 4AWJA 2Y5BB 1L2NA 4F7HA 1WFYA 1C1YB 2G45B 4EZJA 5AZGA 1MK9B 4TKNA 1KLVA 3H9DA 3ZLZA 3R3MA 2YF0A 2ROZB 2C9WB 2ZNVB 1WYWB 4NQLB 3KW5B 3VQIA 5J17A 4HAVB 5CX3A 2DTCA 1WR1A 2FJLA 3CXBB 1ZVRA 5IAAC 2LG1A 2KJHB 3A1QB 2IFSA 3L08A 1H4RA 4MGZE 2GMIC 1MKEA 3GYPA 2KTFA 3UGBB 2AL3A 1OGWA 2KUPA 1TBEA 3NS8A 3UF8A 4BKTA 4FHKA 4WJNA 3A9JA 2GCLA 2YSZA 1YIWA 1MK7B 2K6QA 4YL8A 3PSEB 5DPSA 1DDMA 2Y8GA 4AUQC 2DN6A 2RR9A 2IZVB 3D8FA 1ISNA 2V4LA 2L00B 3PPAA 1EVHA 4JL9A 3VTWA 5DPTA 3PV1A 3SYXA 4EZKA 1DBHA 4WWPA 3QJZA 2LOXA 3D8EA 2K39A 1Z2MA 3BY4B 4AJYB 2JF5A 4A3OA 1ZC4B 5D3XA 3ZNGC 4DX90 4FBJB 2JT4B 1B55A 2D9YA 1XODA 1OMWA 1EUVB 2GJYA 2K8BA 2BWFA 2V1YA 4EKUA 3DDCB 3TL5A 1U4AA 2Z0PA 2ZJDA 4NAWA 2M14A 2EKEC 1WGYA 5LONB 4KDIC 3KRWA 5D6JB 2KQ7A 4ANUA 2IO3B 2CU1A 1KZ7A 4BBNC 1G6JA 2FAZA 3KYCD 1CMXB 3Q3FA 2KDEB 1P0RA 2KGXB 2P8VA 4EFOA 4K7UA 4MJSB 4W9GA 4IAPA 2L76A 2N1WA 2MP2A 4XX5A 3FM8C 2KWVB 3MHSD 4II2B 2N23A 4IM0A 3S2AA 4BKGA 2PPHA 5TR5A 2GBJA 3HW2B 1OQYA 3KSYA 1XT9B 1Q5WB 3HIZA 3RCZA 5LXIB 3SNHA 1PQSA 3KRXA 1Q1OA 1ZW7A 4A5KA 2CB8A 5DIFB 2CAYA 4CO7A 2L8JA 4LCDE 3EFUA 4TQ1A 4BFRA 2K00A 4GXBA 2YVCA 2L0TA 2N1VA 4XZ4A 5C1ZA 2H7EA 1WGQA 5L81A 2KDFB 2YLMA 3QQ8B 2CQUA 1LW3A 1X11A 4FULA 4MGKE 2RD0A 3X0WA 4Y94A 1E8XA 1Y8RC 3DXDA 3QC8B 4LDTD 2XK5A 3U30A 2N4FA 3DQVA 3RD2A 3PVWA 2KJ6A 3LDZE 5DPRA 2Z0QA 4I6LB 3MJWA 5FR6A 4EEWA 1SGHA 3BINA 4OVUA 3FP5A 4HHVA 2AWTA 3MTNB 3PVUA 1J8CA 4KV2A 4DBBA 2KDBA 4MSMB 2KC1A 2DX5B 2KC2A 2I1JA 4KZCA 3IBEA 3K9OB
chains in the Genus database with same CATH superfamily
3DBLB 1E7UA 2DZIA 3WAOA 1IP9A 2D9XA 3P63A 3HM3A 2MQJA 4OT1A 1OY2A 3HVDA 2D10A 1XLPA 4KSKC 2MDXA 4NQKE 5JHBA 3NVWA 1X1GA 2D9ZA 2H88B 5T8IA 3AN1A 3N32A 2D3BA 3NWFA 2YEPB 5KHQA 1N3HA 4WQOB 2BW2A 1IGDA 1C3TA 1MPHA 3VH4B 1EWCA 4JKBA 2E6XA 3EECA 4DHJB 3TEYA 2RRFA 1W1DA 1MAIA 4WJPA 1BMLC 4NY0A 3Q8AA 1UPRA 5CLLB 5AZFA 2FCSA 4PQ0A 1EAZA 4ILHA 4NAWB 1E7PB 3H7PA 4D2KA 4JKGA 3WIMA 3ZKJC 4DXGA 5JLJB 3Q8EA 4P16A 4AOFA 4GGQA 2ABDA 3RZFA 3V61A 1WX8A 5CHWA 3P2BA 5JHAA 5KCVA 4OZBA 3T8MA 1KM7A 3DBHB 3KH0A 2W2WA 3VFKA 2WXIA 1I7AA 4NPNA 3TCAA 4LNFA 4ACFA 2JZZA 2QCZA 2G4SA 1V81A 3AE9B 2GBKA 2Z59B 2DLWA 3V6EB 2IJ0A 1UELA 3PHXB 1P7EA 4XWXA 1XD3B 1SE9A 1MVKA 3BZDB 2LFIA 2ADZA 1V97A 4IWOA 1WJ6A 2FIFA 3B0AA 4PS8A 2CY4A 3DCGA 4ANWA 1VZ7A 2UYZB 1FGYA 3NWDA 2QHOA 3B08A 4YSYB 1YJIA 4RGOS 2LASA 3I63C 5GXGB 1YQ4B 2C60A 3PS6A 4HCNB 5D3DA 2XNAC 3WYFB 4MH0E 1VD2A 3Q3MC 3PHWB 4XDCA 3ODOA 1FFVA 4E3CA 2A5UA 4IC7B 3Q8CA 2KLCA 2NS5A 3ZNID 2QDFA 1RJ2A 4LTUA 2O2VB 4W9JA 5E6PA 1EO6A 4NJ7A 2WXHA 5AUIA 1SJHD 5HE1A 2M0XA 3P6AA 4QJ4B 3KUZA 1V6EA 2M56B 2RLOA 2PEAA 2UVMA 5C5BA 1MI1A 4EUTA 4FJZA 4JKHA 4RM9A 3TW1A 2D3AA 3CF6E 3TEXA 4Q2JA 4KHAA 1LM8B 1V49A 4HAUB 2GBRA 5JVLA 1ROEA 4Z2NA 4EEWA 2MJ3A 1TIFA 3DHIC 1FHWA 4IFSA 1IPGA 4RF0A 2COAA 4GZUA 1KRHA 3ABVB 1SF0A 2DKQA 2CHXA 1E90A 3SO6A 2L3ZA 3E9LA 2LULA 4BAXA 1UH6A 1JRUA 3U4EG 4DWFA 3NW8A 1NDDA 2NMBA 2N0YA 2DHJA 5IN7A 5H8YE 2WYQA 2KO3A 3L16A 1H8CA 1GC7A 2E2XA 4AP4C 1D5ZC 2YT1A 2V3PA 1ZUD2 3UZTA 1TQZA 1VJKA 2VH1A 4RFBA 1V89A 2BPSA 3QAQA 4KHBB 3FAHA 1DOXA 2W54A 5LXHA 2J53A 2OTXA 1OEYJ 2Y3AA 2YS3A 1E7VA 1K8RB 4LLGM 1IUEA 3PG7A 4A6HA 2Q13A 5FR3A 1WGGA 2DAJA 2L52A 1NBFC 2IPKD 5J3QA 1E8YA 4XC2A 5EDSA 4QXAB 4EOYA 4EZLA 3A8PA 3ZJTA 3QWZB 4OHJA 5E6NA 5IJMA 5D7GA 3ODWA 1TS2A 2SAKA 4HJGE 3ZDMC 3F0WA 2RSGA 2JZ3B 2J4XA 3APDA 4TQ0A 3GZNI 4GDLA 2MCNB 2HD5B 2N9EB 3MP9A 3PZ8A 2JSVX 2QKLA 2KD0A 4OVVA 4LK0M 1CJEA 1FHXA 2K49A 2VRRB 4BBNF 2V0GA 2L2IA 1WY8A 1T6BX 3ZXVA 4G3XB 5FKAC 3VH3B 2KNBA 3C0RB 3DXCA 4NJCA 2JY6A 4K7SA 2PE6B 1P7FA 3JVZX 1SB3C 3ULBA 2WXOA 1JWUD 3A9KA 1SHCA 4JLCA 2JZPA 1C76A 3VAWA 3AI5A 4IKGA 1Y56A 1X05A 3NY5A 5MPOA 4XGAB 4KDLB 1I4HA 3AMZA 1FGZA 2BQQA 3E66A 2BBCA 4WWNA 4JKGB 3ENEA 3QWMA 4HRSA 1FM0D 4HPMB 4K2OA 5EE9A 1BTKA 1V5OA 4W9CA 4DXAB 1U27A 1ZXHA 1L7YA 1XD4A 3MC8A 1SE4A 2ELAA 1WGKA 2K5PA 2PVGC 3DXEA 4OW0A 2BF8B 1ZOYB 2MJEA 3CIKA 1KI1B 2UU7A 1UGMA 2WHIA 3NZ3A 4W9IA 4AS1A 3PZDA 2DYNA 2LGYA 1PUTA 1DROA 2M4NA 2ZCCA 4ZRKA 2M19A 2B76B 4HB2B 5FK9C 3Q3OC 4ZRPA 1JDEA 1KTKA 1JWAD 4C56C 4RF1A 2KVZA 4M0WA 2FCQA 1FB8A 4GNKB 2PZ1A 1R4NI 4RGTA 4K17A 1P3QU 2Z0DB 3V05A 3SV1A 3MHSD 3DOWA 1WE7A 3DBHI 4DX8A 3M3JA 4LNKA 3JSVA 3M62B 1I4PA 1CK1A 2KFJA 5GMVA 3DBSA 2D3CA 1NVLA 4MH8A 3AE4B 1ZPSA 2WX1A 3GZNB 4KKIA 3ZGZA 3QCAA 1JCKB 1PFDA 4JQWC 1L2NA 4AWJA 4EZJA 1EU3A 4YSZB 4QJ3B 3R3MA 2YF0A 2C9WB 1YOVB 4HAVB 2DTCA 3L08A 2WXMA 3BYYB 2KUPA 1TBEA 1VDVA 3NS8A 3BYTB 4BKTA 4FHKA 2AQ2B 1QF6A 3A9JA 2YSZA 3PSEB 1YN4A 2RR9A 2IZVB 3D8FA 4EZKA 2LUMA 3BIID 1UF0A 1E6EB 4ZYSA 2LOXA 3BY4B 2JF5A 2JT4B 1B55A 1OMWA 1DYQA 1L6UA 3AE2B 3TL5A 3SBTA 5LONB 4KDIC 4ANUA 1N60A 2Z59A 3Q3FA 2KDEB 4W9GA 1L0VB 2L76A 3FM8C 4IM0A 2KIEA 1XT9B 3HIZA 3OG5A 3NJTA 5LXIB 1Q1OA 3U52E 2CB8A 2CAYA 4CO7A 4R3DA 2L8JA 4BFRA 1JW9D 4TQ1A 5C1ZA 1F2RI 5L81A 4MGKE 1FNWA 4FULA 1IBXA 2RD0A 4Y94A 5BMHA 1E8XA 2BVCA 3DXDA 3QC8B 2XK5A 3DQVA 3PVWA 1MJDA 5DPRA 3MJWA 1SGHA 3BINA 1J8CA 3VRBB 3KWVA 4KV2A 2N0SB 4W9DA 4B0EA 2KC2A 2I1JA 1IGCA 3K9OB 2KT7A 1MHHE 1W1HA 2KX3A 4WJQA 5GOWB 4LNIA 3RI7C 3ZNZB 5L95C 1TY0A 2DX5A 2SEBD 4O1NA 2RGFA 5DHFB 1X1FA 1ESFA 2MP2B 3VUYA 4HAWB 3T06A 1K52A 5HG2A 1S3SG 2LGDA 4F7UP 4NSWA 2KQ4X 4PNKA 4L6EA 2O6VB 4A6FA 4HEA1 4K1RB 1AYFA 3L4PA 1GG3A 2DX1A 4HPLB 3EPYA 4FN2A 1Z87A 1BTNA 4P1CC 2DYQA 2HDEA 3R8BA 1UBQA 3RULA 3ZJVA 1MFWA 3KWLA 2MBBB 2YS5A 2MFQA 4E71A 2IGGA 3JYUA 5G2NA 5KHOA 2BYVE 1WXAA 2AEHA 1WX9A 1X86A 1DDWA 1E8ZA 4A9AA 2CJOA 1ACAA 2L0FA 1MIZB 4DK5A 3ODXA 3GP7A 3SD5A 2MWNB 4WQMA 4X57B 1QKZA 4J3OD 2J7QB 4XWWA 1WZ0A 1UZXB 1U5DA 3NRZA 1JRPA 1UWMA 2DZJA 4URKA 2OQBA 3BVGA 2WX0A 1EM7A 3TVVA 2MBQA 3DVGY 5HFYA 2I38A 4YONA 1CZPA 4FJYA 2ROVA 2N7DA 3PLUA 1ET9A 2PVOD 3W5VB 1VR9A 2DHIA 2D3GA 2MLBA 3A9JB 1NTYA 3C8YA 1HB8A 2NCNA 2WS3B 2WXFA 4B95A 1OFFA 1C9FA 4IW0A 2FJ9A 4KSLC 4US9A 4HDOA 3VTVA 4ILJA 1C4AA 3DBLI 1PMSA 2FE8A 5C79A 3Q8FA 2FDQA 3ML4A 2LZ6A 4DDID 2BS2B 3L54A 2WP9B 2FCNA 1GJZA 1FNVA 1WRIA 3VTUA 1ZYIA 5EFXA 2XEWA 2NR2A 1FO4A 4WIPA 2K9XA 1TYGB 2EJ8A 3VR9B 4N58A 3Q3JA 2JWUA 4I6PA 4DHZB 1GAQB 1PGAA 2Z4DA 4MGYE 4M8NA 4HATB 1STEA 2FCMA 2HRJA 1WM3A 3R7RA 4KVGB 1UUPA 4ZRJA 5C2TB 3NVVA 5BYQA 1GUAB 3BK1A 5D27A 2LUEA 4G50A 3QARA 1K50A 3AECB 3PRMB 2INCC 2IY0B 4CHMA 5D2MB 1LQBA 1WJNA 3ZIMA 3CSFA 2Z0EB 2K8EA 2LVPA 4BOZB 3C19A 1RM6C 3N3KB 5IA7A 4ZRQA 2EKIA 1WH3A 1T0SC 3PRPB 3DWGC 5EE3A 1SXTA 1WE6A 3J9CA 1WZ3A 1HA5A 1YQ3B 1ZC3B 3AULA 5M4YB 2JXXA 1P3RA 1C4CA 4OZAA 3VOQA 2GUMA 4JPSA 3K9PB 2B3AA 2CODA 1C78A 1E0ZA 3KYDD 2UWQA 2X8XX 4C0AA 4ARCA 4ASWC 4CYEA 2WGSA 2AQ1B 4YT0B 3VUWA 4BOSC 5JH5C 4K3CA 1KZGA 3W1SA 3U7ZA 1HTQA 3ONSA 3NHEB 4BBKA 4MJSA 2QSDA 1V2YA 3R2TA 3VRAB 1WI1A 1YJJA 2CR5A 1ENFA 2LEKA 3M95A 3R7QA 3ZUNA 5C5BB 3DPDA 2W2XD 4IWPA 5JZEB 2X38A 3IHPC 4EJNA 4XE0A 4DHJD 4IM3A 4KKJA 4RNAA 3BK2A 3WANA 2ZNVC 4JKAA 2XBBC 5AZHA 1HB6A 1QOAA 1QOFA 3BJIA 2EC1A 2LJ5A 1I42A 1V86A 1FOEA 4MT7A 1YX5B 4MY6A 1L0YB 1VZ8A 4C00A 2O6VA 4XWTA 5DHAB 1U5EA 3O65B 3RZWC 2V76A 2RPVA 1J7BA 2N9PC 2JRIB 1V80A 1EF1A 2KMCA 3WAPA 2MH7A 4FLHA 1R4NB 2JYTA 2NBWB 5CLQB 1TT5B 4WSFA 2IO1B 4REZA 3OJ3A 2JPHA 1L4ZB 4P7IA 2DFKA 2MBOA 2KLGA 3ETRA 3AU5A 1I4RA 2JVCA 2NPTA 2LOZA 4RH6A 2Q5WD 1N6ZA 2QMTA 1QQRA 1ZXIA 2K2JA 4RCOA 1TZOA 1XCQL 4MEMA 1HBKA 3WCQA 5FI0A 5BMIA 4DXFA 1OTRB 1JWBD 3HVZA 1UWXA 1GB4A 3IAM1 2WU5B 2VH2A 3HUIA 3NZSA 4FA6A 4FXCA 3RNGC 2BS3B 5G55A 4C4VB 2KZRA 1B9RA 4UDUC 5JXVA 4HAYB 2INPE 3VXWA 1Y5OA 2ZKMX 4MDKE 1UNQA 3LJ3A 1YMHE 2DIKA 3AE8B 1R4MI 1QOBA 2W3SA 3U7DA 4HKZE 1ZDXA 2NBUA 2RMMA 4OSNA 1I4XA 5LG4B 1RFKA 2G3QB 1FHOA 3GOEA 2JRHA 3ZDTA 5KQ4A 1QZEA 2MEKA 1WXSA 2BGFA 3ZJUA 1FNUA 3QBVB 2R2OA 3EUB2 1NYRA 1I7HA 3ZTCA 3A58A 4WWMA 5D94A 3IFWB 1SJED 1OEYA 4BKSD 1WVHA 3RNEC 1DIKA 2NMQA 1V5UA 4PS3A 2WU2B 3TSSA 3TIXA 1AW7A 2KHWB 3M1IB 1T77A 2WDQB 3AU4A 2CRFA 1WGDA 4HWIB 5AEKB 2CHWA 2REXA 4GDKB 4KHOA 4F7HA 1VBGA 1MK9B 4TKNA 1KLVA 2RDBC 3Q8BA 2ROZB 3AE1B 3KW5B 4PT5A 2N9LA 4ITKA 3AEDB 3B2GA 3A1QB 4MGZE 2IFSA 1H4RA 3BVZA 4USAA 3GYPA 3FILB 1K53A 2AL3A 3UF8A 3V3XA 3AE7B 5G5GA 2Z13A 2IGHA 1N5WA 4WJNA 2GCLA 1YIWA 1MK7B 2K6QA 4YL8A 1MHXA 1ISNA 2K3UA 3O13A 4WWPA 2CU3A 3D8EA 4A3OA 1N61A 3GE8C 3DDCB 2K8BA 1ACCA 2BWFA 3HSAA 4YTNB 2EKEC 2WXGA 2FAZA 1VZ6A 1C77A 2N1WA 4XX5A 2KWVB 2Z8LA 4HSIA 1Q5WB 3RCZA 3SNHA 1PQSA 4M02A 1OQRA 2DBYA 4LCDE 1I4GA 3EFUA 4GXBA 2L0TA 2YVCA 4XZ4A 3W5UB 1RYJA 3QQ8B 1CQVA 1X11A 1MPEA 1K51A 3U30A 2N4FA 4GOUA 4I6LB 5FR6A 4RGNA 4OVUA 4JE3B 2V9HA 4HHVA 3PVUA 4MSMB 1VBHA 1M4VA 2BYTA 3IBEA 1WF9A 3H7PB 2N9XA 2DHKA 3A4SC 3W2DA 2ZPYA 1SEBD 2L83A 2LRWA 4HDQA 1XO3A 3HM6X 5C16A 5E6OA 1P98A 3N9YC 3E56A 1XLNA 1UNRA 3T3OA 1FAOA 2C5LC 1AWEA 2FUG1 2BYEA 2Z14A 3P4PB 4OZCA 2KR0A 2MBHA 2LGXA 3RCPA 1G6JA 2P0HA 1J0GA 1F1HA 2BTEA 3ML8A 4PS7A 2OOBB 4MK0A 4N59A 4DDGD 2NVUI 2ZVOA 1DOIA 3IXSA 4TV3A 4MELA 1WJ1A 1WGHA 2R0DA 3VIAA 1IRSA 1WWTA 2K2UA 2K1FA 3KQ4A 3Q14C 3TJPA 5BO4B 4G0NB 3D8DA 4II3B 3MHZA 2ICIA 3RT3B 4H8SA 4QJ5B 4LNNA 3UINB 3F5RA 4D0NB 3PSCA 4L2YA 3B9JA 1EWYC 2KTRB 3APCA 2KFKB 1VLBA 2RUKB 3N1XC 3PRZA 4Z2MB 2FJUB 4F7ZA 3V62A 1YN5A 3ZO5B 4GPTB 3SUZA 2MWSB 2L1AA 4A20A 4HB4B 4A6KA 2IO2B 2UZSA 2L05A 2YS1A 1MI0A 1WXMA 3ECIA 1FXAA 1GNUA 5LOPB 1WSPA 4GDKA 3LXFA 1WIAA 2MHJA 1OQQA 2KDMA 2Y5PA 2KWUB 1U2BA 1WJMA 4XYCA 4WAFA 4ICVA 4KZ0A 1T0YA 2GBNA 3JW0X 2NBVB 2CKHB 2EMTA 1BT0A 1IYFA 5HKHA 3P4RB 3U8ZA 1ZE3D 3AJ4A 4JKCA 1HQRD 2J42A 2COPA 2QIEB 2HTHB 2D4QA 4A55A 4JX1C 2K6DB 1NTIA 4FADA 4EE2A 4W9EA 3FLVA 4BZAA 1KF6B 2KIGA 1QLBB 2C7NB 4LJOB 5AUKA 1RAXA 3TEZA 2GOWA 3CMMB 3EHVA 2WH5A 4EMOA 1D6EC 1WMHB 3NOBA 1V1PA 1ZP0B 3AH7A 3OAWA 2KTRA 1QOGA 1JALA 4NZLB 1I35A 1PGBA 1XQQA 3UQAA 2V3NA 3AE5B 5IOIA 4K81A 2VRWB 2QJLA 1LGRA 2KOXA 2WDRB 1T5XD 4A6FB 4KGTA 3U12A 4ICUA 1V5PA 1Q67A 1L6VA 2UZRA 2DYOA 2KKCA 2PE9A 2C7HA 2H7DA 1FRRA 1EU4A 1PDXA 5LLIA 3I3TB 2BB5A 3MJ5A 2BYFA 4OVZA 2KVRA 5FI1A 2PMVA 2J0KA 2BKFA 3APFA 4RGMA 1WMHA 3WAMA 3NVYA 2MW5A 2R2YA 3IVFA 2C7MB 3QA8A 2RNRB 4GIVA 4W9HA 2NTTA 1V5MA 4B0MA 2ZCBA 1VCBA 5JHHA 3E9PA 3IT6B 3GE3C 4TSSA 3PP2A 1ET6A 2DYBA 3GS2A 3H8HA 4YWGG 3UI3A 4ZRIA 2D2QA 4LJPB 3BVMA 4JWSC 3SEBA 3HQCA 4GOCA 2AL6A 4JIOU 3ALBA 2L7RA 3UIOB 4M8MA 5D3VA 3ZVVA 2K0PA 4DBGA 2D9VA 2WNMA 4YTPB 3MPXA 3OANA 3L17A 2DA0A 2FIDA 3AEFB 4JGHB 3RNFC 4A3PA 2DHZA 3ZNHB 4BVUC 3ZXRA 2MA9B 2LGIA 5H92C 4XDDA 4IG7B 2GS0A 4ZYNA 2D11A 2MSED 3VVWB 2ONQA 2NPTB 1N62A 3SHQA 4A6QA 1SIJA 1FCLA 2K8HA 1QQGA 2HJ1A 3RUIB 2JU6X 4RM8A 3M63B 1U5FA 2LHEA 2RDHA 3KUCB 1DYNA 2P0FA 3HHMA 1Y19B 4WJOA 2PKOA 2FUHB 4C7ZA 4WAAA 4W9KA 4F1SA 2CY5A 1XCTL 5DCNA 2LBBA 4MGIE 1OQNA 3T9LA 2JXTA 4HAZB 4DQOC 2ZW1A 3LYYA 4IM2A 3A1QA 3PZ7A 3QHTA 4LNOA 1FRDA 5KQ1A 2LRUA 3L0WB 5CHVC 5BYRA 3X23A 3NWAA 1AWDA 2J52A 2NZ8B 2DAFA 2RPQA 4YSXB 1VRAB 2K8CA 5I2SA 1K5GB 4GMVA 2ZEQA 3TBLD 1R4MB 2D07B 2ZW0A 5JP4A 3EGRA 2N7EA 4CHJA 3PREA 1SE3A 1QT9A 3PGEA 4HKQA 3R66C 4HAXB 2PTLA 2A4ZA 3ZW3A 2JUOA 2M1MA 3I5JC 3N20C 4HVBA 4M00A 3LB8C 4JKDA 3KUDB 5DH9B 3FILA 3B77A 2ASQA 2COFA 1BUIC 1V9JA 2DKPA 1UBIA 1UEFA 1J0WA 4WH4A 4WJ7A 4CSQA 1HE8A 1UD7A 5DI9B 4JWUC 4AQ7A 4K2PA 2KN5A 3QK0A 5IP4D 4IUMB 3B1LX 2IO0B 1TKGA 2XQNM 3MDBC 2GRIA 4IOYX 2LHDA 2LKOA 1ZGUB 3OJ4B 1WI0A 1MG8A 3H6NA 3L13A 3PO0A 1E5WA 2VSZA 4K7WA 1W1GA 3ZVRA 2IGDA 5HHDG 1J19A 1C79A 1TJ6A 1QC6A 2KQSA 2M8SA 1BXTA 3VUXA 1A70A 2NBVA 4MSQB 1PFJA 1MIXA 1L0XB 2V4IB 5EE1A 3W1YA 1D4BA 1DDVA 1WJUA 2P0DA 4GMXB 3DBRB 2ZVNA 3NG0A 2IYBA 4W9LA 4NJ6A 4CHKA 1WXQA 2DENB 1V61A 2VZKD 2D5GA 2HE7A 5DPWA 3DCXA 1U5GA 4MM3A 5LNK1 1TGZB 1H10A 3CIRB 3ENBA 3VDZA 3L10B 2OJWA 2KMAA 2WXQA 4RMAA 4KHBA 1WJ4A 1L5PA 3KY9A 2Y5BB 5AZGA 3HIEA 2WXLA 3AV8A 3ZLZA 2KN4A 4NQLB 3FKYA 3VQIA 4ZOHC 2Y5CA 2FJLA 2GB1A 2LG1A 2KJHB 1XF5L 2PLPA 2W55A 3P1MA 3UGBB 2PIAA 4AUQC 5DPSA 1DDMA 2Y8GA 2DN6A 3EA6A 1TKEA 1V1OA 2L00B 1ZDVA 1FFUA 1NI3A 3VTWA 5DPTA 3PV1A 3P4SB 2ACZB 3QJZA 2K39A 3AE6B 1ZC4B 5D3XA 4S0RA 3ZNGC 4DX90 4FBJB 2D9YA 1XODA 2GJYA 3BWUD 1U4AA 4NAWA 3KRWA 2KQ7A 2IO3B 3N1YC 1P0RA 2P8VA 4EFOA 2CJNA 4WURA 4MJSB 1FPYA 2R61A 2KMMA 3S2AA 4L23A 5TR5A 2GBJA 3KSYA 4A5KA 1KLGD 5DIFB 2K00A 1WGQA 2KDFB 3RNCC 3SFEB 2CQUA 1PGXA 3P42A 1JMLA 3URYA 1GOZA 2KJ6A 3LDZE 5EE0A 3FP5A 1HEZE 2AWTA 3MTNB 4HPPA 2KDBA 4KZCA 3SFDB 3DBRI 2IYDB 3U2SC 3V60A 5IKCM 5J18A 1NENB 1V8CA 1Q0WB 3KZ1A 1SIFA 2LXAA 3KLSX 1R7SA 2KFKA 3HRDD 1YX6B 4MACA 3SDLC 3DHHC 3EC8A 3TO1A 1RRPB 4B6HA 1PLSA 2L32A 5CHFA 2KWDA 3SR6A 2BKRB 2KJRA 2COCA 2MKRA 2YRYA 2AYOB 3CWIA 1WRDB 1LB1A 1TKYA 1D5XC 3TMPB 4JK9A 1NEKB 2X18A 3DVNU 1JQ4A 3A4RA 2RQ1A 1F52A 4B9KA 1RLFA 1T0RC 3OHMB 1SE2A 2LWPA 1LXDA 2MX2A 3OWEB 3TFMA 2W9NA 2G4DB 1KH0A 4KX6B 3VHTC 1UPQA 1B1ZA 3MC9A 1BAKA 1XLOA 3IAS1 2DYMA 1NTVA 3AM9A 2JX5A 4HLEA 2D9WA 2Z0OA 4TUUA 3SU8X 4GN1A 2ZPNA 1V5TA 4IOIE 2ELBA 3TUOA 4JKEA 3AEBB 3FSSA 2KWCA 5G5HA 1HZ5A 4KGRA 4C4VA 4YTMB 3PT2B 1KBLA 3EFCA 3RMKC 1ZM0A 2VKIA 3WA0A 1Z5SB 2KANA 3AXCA 1BWNA 4W9FA 3D32A 1UGJA 5C3JB 2L1CA 1SBBB 4E74A 3AEGB 4GLSC 3AB5A 3N7CA 2V3SA 2N9KA 1J7AA 2ON8A 1GC6A 3DVNV 2X0SA 3Q3NC 1J7CA 2KDIA 2YT0A 1XX0A 3E9SA 2BB6A 4FHJA 1YQBA 2WXKA 1I4QA 5D3IB 2RSUA 2XN9C 5D3WA 2I5FA 3H7SA 1C4PA 4WVFB 1S1QB 1TJEA 4IWQA 1TS4A 1FXTB 3PVLA 1XKEA 3W1SC 2BS4B 2WQYB 3QIJA 2GBMA 1TTNA 1HTOA 2R2QA 1K5DB 1MG4A 3AEEB 2MBEA 2ZZPB 1M7EA 5BMGA 3ULCA 1RRBA 1I2HA 3V5WA 2PJHA 1P1AA 4CQNA 4F8CB 4ANVA 2FBWB 4M01A 2O2VA 3FEHA 2QC8A 5D3YA 2IBIB 5TSSA 4MM3B 2JWZA 1AN8A 1M94A 1WG7A 3AEAB 2WXRA 3CSTA 1YD8U 3ZRFA 1FCCC 1UNSA 2G9HD 4MT5A 2KUQA 2KCJA 2INDC 2KX0A 2CHZA 3ZTDA 2M17A 1EGXA 1WGUA 3KVFB 2OEDA 4ANXA 3B2FA 3UQBA 5HE0A 1KLUD 1ZKHA 4PYZA 4ZDVA 2GCJA 2OJRA 2W2XC 3PLVA 3HK0A 4JK7A 3RFZB 4TMAB 5I4DA 3RNBC 4HJKA 2J0MA 1D3ZA 2PW9A 2LVOA 3IG3A 4GSWA 1X1MA 2KXJA 3A98B 1NU2A 2LVQA 2BT6A 1QILA 1ZSQA 4FJVB 2JQRB 4I6NB 4B6WA 1JROA 4PYUA 4ARIA 3AE3B 2KYWA 4HK2A 2LD9A 2MRPA 2H89B 4DIXA 3ML9A 1KC7A 2LXCA 4QAYA 2LJIA 2J59M 2OHFA 1KJTA 1F0ZA 5L83A 3UIPB 5HE3A 1NVID 2K25A 1V1PB 2FNJB 5J3YA 1F9JA 4A8XC 4KAXB 1AQCA 1GPXA 4HROA 3P7ZA 2EELA 1AARA 4G11A 2NTSA 2I1KA 3JSVB 4HXDA 4KIKB 5IRSA 1E10A 1RWSA 5E6JA 1DGJA 1PYWD 3SBGA 2HJ8A 2XK5B 1N5XA 2KK8A 1EF5A 4C80A 3NZUA 3N30A 2HTHA 5IO9A 2K22A 3TEWA 4P1BC 4NNJB 3DVGX 2RVBB 2QEJC 2YEPF 1JWMD 2LYDA 4GB9A 2VZKB 1YJ1A 1TS3A 2QILA 1A5RA 3P4QB 3Q69A 1TS5A 3NS1A 4BKSA 2IY1B 4L1BA 3NUHB 2WLBA 1RFAA 1KOTA 3Q2AC 2WXJA 3NSUA 1TZ1A 4DHZE 1XXGA 1D5MC 2O6VD 5HE2A 2CS4A 4N9F4 1NYQA 2WXPA 4HCPB 3VR8B 2RDGA 1NI2A 2WXNA 4J6IA 1V88A 1U29A 1WR6E 3WALA 1XR0B 1F77A 1FMAD 3ZRCA 2BCJA 2Y8FA 3PEGA 1TY2A 4AJWA 2M38A 3RPFC 5C6RA 1UNPA 4N6EB 1N63A 3FVCA 1M7RA 1GGOA 1ST7A 4TYZA 3V6CB 1P9DU 5JHGA 2YT2A 1F2RC 2I5CA 4ZHPA 2DLBA 5HI1A 4H2AA 3DHGC 3A8QA 4HB0B 1WX7A 2LMCA 1P6SA 5J3TA 1WGRA 3RNAC 3R2IA 1P5TA 4D6WA 1YNTE 3GYOA 2N7JA 2DNFA 3DWMA 3QX1A 3RN9C 3E9OA 3G9WA 4LDTB 2J0JA 2M0AA 2WDTB 2LI5A 3OLMD 2JYEA 4GU2A 2Y7BA 2BWES 2DZMA 3RYTA 2DZKA 2QKMA 1TXDA 2EMSA 4NAMA 1LO5D 1JWSD 2AQ3B 5I2MA 3LJUX 2TSSA 2KACA 2W3RA 4P6VF 3Q6BA 3I9V1 4ILGB 1HZ6A 1E8WA 3I57A 3PTFC 4M0WB 4ZHOA 1LFDA 5CTRC 5C23A 4F7GA 2JP2A 1FIQA 1XCGA 2R09A 4WWOA 4KIKA 3T3NA 1IBXB 4HB3B 1WXVA 3A33B 2WWZA 2G35A 4A90A 5BYSA 3O96A 3A9KB 2KAJA 1GB1A 2RGNB 2R82A 4GDLB 1Q10A 1HXYD 2HTME 5J2RA 2GI9A 1DOYA 1KFYB 2MJDA 2GLSA 1WM2A 2INNE 3W9CB 3H1UA 1SSNA 1WFYA 1C1YB 2G45B 1WYGA 3H9DA 4L1RA 2ZNVB 5J17A 1WYWB 5CX3A 1WR1A 3CXBB 5IAAC 1ZVRA 4PK1A 2GMIC 1MKEA 3GB1A 2KTFA 1OGWA 3ZYYX 3MC0B 2AX5A 1XLQA 1FEHA 4KGSA 2V4LA 3PPAA 4K3BA 1L4DB 1EVHA 4JL9A 3SYXA 3ZQ4A 1DBHA 3FC4A 2LGSA 2I2YA 1Z2MA 2W82A 4AJYB 4YXDB 1EUVB 2V1YA 4EKUA 2Z0PA 2ZJDA 2M14A 1E9MA 1WGYA 5D6JB 2CU1A 1KZ7A 1XEEA 2G1EA 4BBNC 3KYCD 1CMXB 2KGXB 3N1ZC 4K7UA 4IAPA 2MP2A 3NVZA 4II2B 2N23A 4BKGA 2PPHA 1YN3A 3HW2B 4JKFA 1OQYA 4US8A 3MFGA 1ZW7A 3KRXA 2N1VA 4S17A 2H7EA 2YLMA 2WDVB 4JK8A 1LW3A 3X0WA 1T0QC 3IT4B 1Y8RC 4LDTD 4IDIA 2IDYA 3RD2A 2Z0QA 1FD6A 4C7YA 1T3QA 2E3TA 4DBBA 2KC1A 2DX5B 2DWQA 1FXIA
chains in the Genus database with same CATH topology
1E7UA 2DZIA 3WAOA 1IP9A 2D9XA 3HM3A 2MQJA 1OY2A 2D10A 4KSKC 2MDXA 4NQKE 5JHBA 1X1GA 2D9ZA 3N32A 5KHQA 1N3HA 4WQOB 1C3TA 1MPHA 3VH4B 4JKBA 3EECA 4DHJB 1W1DA 1MAIA 4WJPA 4NY0A 1UPRA 5CLLB 5AZFA 2FCSA 4PQ0A 1EAZA 4ILHA 4NAWB 3H7PA 4JKGA 3WIMA 3ZKJC 5JLJB 4AOFA 4GGQA 2ABDA 3RZFA 3V61A 1WX8A 5CHWA 3P2BA 5JHAA 5KCVA 3T8MA 1KM7A 3KH0A 2W2WA 3VFKA 1I7AA 4NPNA 3TCAA 2JZZA 2G4SA 1V81A 2GBKA 2Z59B 2DLWA 3V6EB 1UELA 3PHXB 4XWXA 1XD3B 1SE9A 2ADZA 4IWOA 1WJ6A 2FIFA 4PS8A 3B0AA 2CY4A 3DCGA 4ANWA 2UYZB 1FGYA 2QHOA 3B08A 2LASA 2C60A 3PS6A 4HCNB 3WYFB 4MH0E 1VD2A 3PHWB 3ODOA 4E3CA 2A5UA 4IC7B 2KLCA 2NS5A 3ZNID 1RJ2A 2O2VB 4W9JA 5E6PA 1EO6A 4NJ7A 5HE1A 2M0XA 3P6AA 3KUZA 1V6EA 2RLOA 2PEAA 2UVMA 5C5BA 4EUTA 4FJZA 4JKHA 4RM9A 3TW1A 3CF6E 4KHAA 1LM8B 1V49A 4HAUB 2GBRA 5JVLA 4Z2NA 4EEWA 1FHWA 4IFSA 1IPGA 2COAA 4GZUA 2DKQA 2CHXA 1E90A 3SO6A 2L3ZA 3E9LA 2LULA 1UH6A 1JRUA 4DWFA 1NDDA 2NMBA 2N0YA 2DHJA 2WYQA 2KO3A 3L16A 1H8CA 1GC7A 2E2XA 4AP4C 2YT1A 3UZTA 1TQZA 1V89A 2BPSA 3QAQA 4KHBB 5LXHA 2OTXA 1OEYJ 2YS3A 1E7VA 1K8RB 3PG7A 4A6HA 2Q13A 1WGGA 2DAJA 1NBFC 5J3QA 1E8YA 4XC2A 5EDSA 4EOYA 4EZLA 3A8PA 3QWZB 5E6NA 5IJMA 5D7GA 3ODWA 3ZDMC 3F0WA 2RSGA 2JZ3B 3APDA 4TQ0A 3GZNI 4GDLA 2MCNB 2HD5B 2N9EB 2QKLA 2KD0A 4OVVA 1FHXA 2VRRB 4BBNF 2L2IA 1WY8A 4G3XB 3VH3B 2KNBA 3C0RB 3DXCA 2JY6A 4K7SA 2PE6B 3JVZX 3ULBA 3A9KA 1SHCA 4JLCA 3VAWA 3AI5A 1X05A 3NY5A 4KDLB 1FGZA 3E66A 4WWNA 4JKGB 3ENEA 3QWMA 4HPMB 4K2OA 1BTKA 1V5OA 4W9CA 4DXAB 1U27A 1L7YA 1XD4A 2ELAA 3DXEA 2BF8B 3CIKA 1KI1B 1UGMA 4W9IA 3PZDA 2DYNA 2LGYA 2ZCCA 1DROA 2M4NA 4ZRKA 4HB2B 1JDEA 2FCQA 1FB8A 2PZ1A 1R4NI 4K17A 1P3QU 2Z0DB 3SV1A 3MHSD 3DOWA 1WE7A 3DBHI 4DX8A 3M3JA 3JSVA 3M62B 2KFJA 5GMVA 3DBSA 1NVLA 2WX1A 3QCAA 4JQWC 1L2NA 4AWJA 4EZJA 3R3MA 2YF0A 2C9WB 4HAVB 2DTCA 3L08A 2KUPA 1TBEA 3NS8A 4BKTA 4FHKA 3A9JA 2YSZA 3PSEB 2RR9A 2IZVB 3D8FA 4EZKA 2LOXA 3BY4B 2JF5A 2JT4B 1B55A 1OMWA 3TL5A 3SBTA 5LONB 4KDIC 4ANUA 3Q3FA 2KDEB 4W9GA 2L76A 3FM8C 4IM0A 1XT9B 3HIZA 5LXIB 1Q1OA 2CB8A 2CAYA 4CO7A 2L8JA 4BFRA 4TQ1A 5C1ZA 4MGKE 5L81A 4FULA 2RD0A 4Y94A 1E8XA 3DXDA 3QC8B 2XK5A 3DQVA 3PVWA 5DPRA 3MJWA 1SGHA 3BINA 1J8CA 4KV2A 4W9DA 2KC2A 2I1JA 3K9OB 1W1HA 2KX3A 4WJQA 5GOWB 3ZNZB 5L95C 2DX5A 2RGFA 5DHFB 1X1FA 2MP2B 3VUYA 4HAWB 3T06A 1S3SG 2LGDA 4F7UP 4NSWA 4PNKA 4L6EA 2O6VB 4A6FA 4K1RB 1GG3A 2DX1A 4HPLB 3EPYA 4FN2A 1Z87A 1BTNA 2DYQA 1UBQA 3RULA 2MBBB 2YS5A 2MFQA 4E71A 3JYUA 5G2NA 5KHOA 2BYVE 1WXAA 2AEHA 1WX9A 1X86A 1DDWA 1E8ZA 1ACAA 2L0FA 1MIZB 4DK5A 3ODXA 3SD5A 2MWNB 4X57B 2J7QB 1WZ0A 1UZXB 1U5DA 2DZJA 4URKA 2OQBA 2WX0A 3TVVA 2MBQA 3DVGY 4YONA 4FJYA 2ROVA 2N7DA 3PLUA 2DHIA 2D3GA 2MLBA 3A9JB 1NTYA 1HB8A 2NCNA 4B95A 4IW0A 2FJ9A 4KSLC 4HDOA 3VTVA 4ILJA 3DBLI 1PMSA 5C79A 2FDQA 3ML4A 2LZ6A 4DDID 3L54A 2FCNA 1GJZA 3VTUA 5EFXA 2XEWA 2NR2A 2EJ8A 3Q3JA 4I6PA 4DHZB 4MGYE 4M8NA 4HATB 2FCMA 2HRJA 1WM3A 3R7RA 4KVGB 4ZRJA 1GUAB 5D27A 2LUEA 4G50A 3QARA 3PRMB 2IY0B 4CHMA 5D2MB 1LQBA 1WJNA 3ZIMA 3CSFA 2Z0EB 2LVPA 4BOZB 3N3KB 5IA7A 1WH3A 3PRPB 1WE6A 1WZ3A 1ZC3B 3AULA 2JXXA 1P3RA 3VOQA 3K9PB 2B3AA 2CODA 3KYDD 2UWQA 4C0AA 4ASWC 4CYEA 3VUWA 4BOSC 5JH5C 3W1SA 1KZGA 3ONSA 3NHEB 4BBKA 4MJSA 1V2YA 1WI1A 2CR5A 3M95A 3R7QA 3ZUNA 5C5BB 3DPDA 2W2XD 4IWPA 5JZEB 3IHPC 4EJNA 4DHJD 4IM3A 3WANA 2ZNVC 4JKAA 2XBBC 5AZHA 1HB6A 3BJIA 2EC1A 2LJ5A 1I42A 1V86A 1FOEA 4MT7A 1YX5B 4MY6A 2O6VA 5DHAB 1U5EA 3O65B 3RZWC 2V76A 2N9PC 2JRIB 1V80A 1EF1A 2KMCA 3WAPA 4FLHA 2NBWB 5CLQB 4WSFA 2IO1B 3OJ3A 2JPHA 4P7IA 2DFKA 2MBOA 2KLGA 3AU5A 2JVCA 2NPTA 2LOZA 2K2JA 4MEMA 1HBKA 5FI0A 1OTRB 3NZSA 4FA6A 5G55A 2KZRA 4HAYB 3VXWA 1Y5OA 4MDKE 1UNQA 3LJ3A 2DIKA 1R4MI 3U7DA 2NBUA 2G3QB 1FHOA 3GOEA 2JRHA 3ZDTA 5KQ4A 1QZEA 1WXSA 2BGFA 3QBVB 2R2OA 3ZTCA 5D94A 3IFWB 4BKSD 1OEYA 1WVHA 1DIKA 1V5UA 4PS3A 3TIXA 2KHWB 3M1IB 4HWIB 3AU4A 2CRFA 1WGDA 5AEKB 2CHWA 2REXA 4GDKB 4KHOA 4F7HA 1VBGA 1MK9B 4TKNA 1KLVA 2ROZB 3KW5B 3A1QB 4MGZE 2IFSA 1H4RA 3GYPA 2AL3A 3UF8A 4WJNA 2GCLA 1YIWA 1MK7B 2K6QA 4YL8A 1ISNA 4WWPA 3D8EA 4A3OA 3DDCB 2K8BA 2BWFA 2EKEC 2FAZA 2N1WA 4XX5A 2KWVB 1Q5WB 3RCZA 3SNHA 1PQSA 4LCDE 3EFUA 4GXBA 2L0TA 2YVCA 4XZ4A 3QQ8B 1X11A 3U30A 2N4FA 4I6LB 5FR6A 4OVUA 4HHVA 3PVUA 4MSMB 1VBHA 3IBEA 1WF9A 3H7PB 2N9XA 2DHKA 3A4SC 2ZPYA 2LRWA 4HDQA 3HM6X 5C16A 5E6OA 1P98A 1UNRA 1FAOA 2C5LC 1AWEA 2BYEA 2MBHA 2LGXA 3RCPA 1G6JA 2P0HA 1J0GA 3ML8A 4PS7A 2OOBB 4MK0A 4DDGD 2NVUI 2ZVOA 4TV3A 4MELA 1WJ1A 1WGHA 2R0DA 3VIAA 1IRSA 2K2UA 2K1FA 3TJPA 5BO4B 4G0NB 3D8DA 4II3B 3RT3B 4H8SA 3UINB 3F5RA 4D0NB 3PSCA 2KTRB 3APCA 2KFKB 2RUKB 3PRZA 4Z2MB 4F7ZA 3V62A 3ZO5B 4GPTB 3SUZA 2MWSB 4A20A 4HB4B 4A6KA 2IO2B 2UZSA 2L05A 2YS1A 1WXMA 3ECIA 1GNUA 5LOPB 4GDKA 1WIAA 2KWUB 1U2BA 1WJMA 4ICVA 4KZ0A 1T0YA 2GBNA 3JW0X 2NBVB 2CKHB 2EMTA 1BT0A 1IYFA 5HKHA 3U8ZA 3AJ4A 4JKCA 2COPA 2HTHB 2D4QA 2K6DB 1NTIA 4FADA 4W9EA 3FLVA 2C7NB 4LJOB 1RAXA 2GOWA 3CMMB 3EHVA 2WH5A 4EMOA 1WMHB 3NOBA 3OAWA 2KTRA 1I35A 1XQQA 3UQAA 4K81A 2VRWB 2KOXA 4A6FB 4ICUA 1V5PA 1Q67A 2UZRA 2DYOA 2KKCA 2PE9A 2C7HA 2H7DA 5LLIA 3I3TB 2BYFA 2KVRA 5FI1A 2J0KA 2BKFA 3APFA 1WMHA 3WAMA 2MW5A 3IVFA 2C7MB 3QA8A 2RNRB 4GIVA 4W9HA 1V5MA 2ZCBA 1VCBA 5JHHA 3E9PA 3PP2A 2DYBA 4ZRIA 2D2QA 4LJPB 3HQCA 4GOCA 2AL6A 4JIOU 3ALBA 2L7RA 3UIOB 4M8MA 5D3VA 3ZVVA 4DBGA 2D9VA 3MPXA 3OANA 3L17A 2DA0A 2FIDA 4JGHB 4A3PA 2DHZA 3ZNHB 4BVUC 2MA9B 4IG7B 2GS0A 4ZYNA 2D11A 2MSED 3VVWB 2NPTB 3SHQA 2K8HA 1QQGA 3RUIB 4RM8A 3M63B 1U5FA 3KUCB 1DYNA 2P0FA 3HHMA 1Y19B 4WJOA 2FUHB 4WAAA 4W9KA 4F1SA 2CY5A 5DCNA 2LBBA 4MGIE 1OQNA 3T9LA 4HAZB 4IM2A 3A1QA 3QHTA 5KQ1A 2LRUA 3L0WB 5CHVC 3X23A 2NZ8B 2DAFA 2RPQA 2K8CA 1K5GB 4GMVA 2ZEQA 3TBLD 2D07B 5JP4A 2N7EA 4CHJA 3PREA 3PGEA 3R66C 4HAXB 2A4ZA 3ZW3A 2JUOA 2M1MA 4HVBA 4JKDA 3KUDB 5DH9B 2ASQA 2COFA 1V9JA 2DKPA 1UBIA 1UEFA 1J0WA 4WJ7A 1HE8A 1UD7A 5DI9B 4K2PA 2KN5A 3QK0A 4IUMB 3B1LX 2IO0B 2XQNM 3MDBC 4IOYX 2LKOA 1ZGUB 3OJ4B 1WI0A 1MG8A 3H6NA 3L13A 1E5WA 2VSZA 4K7WA 1W1GA 3ZVRA 1J19A 1TJ6A 1QC6A 2KQSA 2M8SA 3VUXA 4MSQB 1PFJA 1MIXA 3W1YA 1DDVA 1WJUA 2P0DA 4GMXB 2ZVNA 2IYBA 4W9LA 4NJ6A 4CHKA 2DENB 1V61A 5DPWA 2HE7A 1U5GA 4MM3A 1TGZB 1H10A 3ENBA 3VDZA 3L10B 2KMAA 4RMAA 1WJ4A 3KY9A 2Y5BB 5AZGA 3ZLZA 4NQLB 3VQIA 2FJLA 2LG1A 2KJHB 3UGBB 4AUQC 5DPSA 1DDMA 2Y8GA 2DN6A 2L00B 3VTWA 5DPTA 3PV1A 3QJZA 2K39A 1ZC4B 5D3XA 3ZNGC 4DX90 4FBJB 2D9YA 1XODA 2GJYA 1U4AA 4NAWA 3KRWA 2KQ7A 2IO3B 1P0RA 2P8VA 4EFOA 4MJSB 3S2AA 5TR5A 2GBJA 3KSYA 4A5KA 5DIFB 2K00A 1WGQA 2KDFB 2CQUA 2KJ6A 3LDZE 3FP5A 2AWTA 3MTNB 2KDBA 4KZCA 3DBRI 2IYDB 3V60A 5J18A 1Q0WB 3KZ1A 1SIFA 2LXAA 2KFKA 1YX6B 3SDLC 3EC8A 3TO1A 1RRPB 4B6HA 1PLSA 5CHFA 2BKRB 2KJRA 2COCA 2MKRA 2YRYA 2AYOB 1WRDB 1LB1A 3TMPB 4JK9A 2X18A 3DVNU 3A4RA 2RQ1A 4B9KA 1RLFA 2LWPA 1LXDA 2MX2A 3TFMA 2W9NA 2G4DB 3VHTC 1UPQA 1BAKA 2DYMA 1NTVA 4HLEA 2D9WA 2Z0OA 4TUUA 3SU8X 4GN1A 2ZPNA 1V5TA 2ELBA 4JKEA 3FSSA 2KWCA 3PT2B 1KBLA 1ZM0A 2VKIA 3WA0A 1Z5SB 2KANA 3AXCA 1BWNA 4W9FA 3D32A 2L1CA 4E74A 3N7CA 2V3SA 1GC6A 3DVNV 2X0SA 2KDIA 2YT0A 1XX0A 4FHJA 1YQBA 2RSUA 5D3WA 2I5FA 3H7SA 4WVFB 1S1QB 4IWQA 1FXTB 3PVLA 1XKEA 3W1SC 3QIJA 2GBMA 1TTNA 2R2QA 1K5DB 2MBEA 2ZZPB 1M7EA 3ULCA 1RRBA 1I2HA 3V5WA 2PJHA 1P1AA 4F8CB 4ANVA 2O2VA 3FEHA 5D3YA 2IBIB 2JWZA 1M94A 1WG7A 3CSTA 1YD8U 3ZRFA 2KCJA 2CHZA 2KX0A 3ZTDA 2M17A 1EGXA 1WGUA 3KVFB 4ANXA 3UQBA 5HE0A 1ZKHA 4PYZA 4ZDVA 2GCJA 2OJRA 2W2XC 3PLVA 3HK0A 4JK7A 1D3ZA 4HJKA 2J0MA 2LVOA 3IG3A 4GSWA 1X1MA 2KXJA 3A98B 1NU2A 2LVQA 1ZSQA 4FJVB 4I6NB 4B6WA 4PYUA 4HK2A 2LD9A 2MRPA 3ML9A 1KC7A 2LXCA 2J59M 1KJTA 5L83A 3UIPB 5HE3A 2K25A 2FNJB 5J3YA 1F9JA 4KAXB 1AQCA 3P7ZA 1AARA 4G11A 2I1KA 3JSVB 4HXDA 4KIKB 3SBGA 2HJ8A 2XK5B 2KK8A 1EF5A 3NZUA 3N30A 2HTHA 4NNJB 3DVGX 2RVBB 2LYDA 4GB9A 1YJ1A 1A5RA 4BKSA 2IY1B 1RFAA 1KOTA 3NSUA 1TZ1A 4DHZE 2O6VD 5HE2A 2CS4A 4N9F4 4HCPB 1NI2A 4J6IA 1V88A 1U29A 1WR6E 3WALA 1XR0B 3ZRCA 2BCJA 2Y8FA 3PEGA 4AJWA 2M38A 5C6RA 1UNPA 1M7RA 1GGOA 1ST7A 4TYZA 3V6CB 1P9DU 5JHGA 2I5CA 3A8QA 4HB0B 1WX7A 1P6SA 5J3TA 1WGRA 1P5TA 3QX1A 3GYOA 3E9OA 3G9WA 4LDTB 2J0JA 2WDTB 2LI5A 3OLMD 4GU2A 2Y7BA 2BWES 2DZMA 3RYTA 2DZKA 2QKMA 1TXDA 2EMSA 3LJUX 4ILGB 1E8WA 3PTFC 4M0WB 1LFDA 5CTRC 5C23A 4F7GA 2JP2A 1XCGA 2R09A 4WWOA 4KIKA 4HB3B 1WXVA 3A33B 2WWZA 2G35A 3O96A 3A9KB 2RGNB 2R82A 4GDLB 5J2RA 1WM2A 3H1UA 1WFYA 1C1YB 2G45B 3H9DA 2ZNVB 5J17A 1WYWB 5CX3A 1WR1A 3CXBB 5IAAC 1ZVRA 2GMIC 1MKEA 2KTFA 1OGWA 2V4LA 3PPAA 1EVHA 4JL9A 3SYXA 1DBHA 1Z2MA 4AJYB 1EUVB 2V1YA 4EKUA 2Z0PA 2ZJDA 2M14A 1WGYA 5D6JB 2CU1A 1KZ7A 4BBNC 3KYCD 1CMXB 2KGXB 4K7UA 4IAPA 2MP2A 4II2B 2N23A 4BKGA 2PPHA 3HW2B 4JKFA 1OQYA 1ZW7A 3KRXA 2N1VA 2H7EA 2YLMA 4JK8A 1LW3A 3X0WA 1Y8RC 4LDTD 3RD2A 2Z0QA 4DBBA 2KC1A 2DX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WF9 A;  3H7P B;  2N9X A;  2IYD B;  1W1H A;  2DHK A;  2KX3 A;  3DBR I;  1E7U A;  2DZI A;  5GOW B;  3A4S C;  4WJQ A;  3V60 A;  3WAO A;  2D9X A;  3ZNZ B;  5J18 A;  5L95 C;  2ZPY A;  2DX5 A;  2MQJ A;  3HM3 A;  1Q0W B;  3KZ1 A;  1SIF A;  2RGF A;  5DHF B;  2LRW A;  4HDQ A;  1OY2 A;  1X1F A;  2LXA A;  2D10 A;  2MP2 B;  2KFK A;  3VUY A;  1YX6 B;  3HM6 X;  2MDX A;  4HAW B;  5C16 A;  4KSK C;  4NQK E;  1P98 A;  5E6O A;  3SDL C;  5JHB A;  1X1G A;  2D9Z A;  3T06 A;  1UNR A;  3TO1 A;  3EC8 A;  1RRP B;  1FAO A;  4B6H A;  3N32 A;  5KHQ A;  2C5L C;  1N3H A;  1PLS A;  1AWE A;  2BYE A;  2MBH A;  1S3S G;  2LGD A;  2LGX A;  5CHF A;  3RCP A;  4NSW A;  2P0H A;  4F7U P;  2BKR B;  2KJR A;  2COC A;  2MKR A;  4PNK A;  4WQO B;  2YRY A;  4L6E A;  2AYO B;  1J0G A;  2O6V B;  1MPH A;  4A6F A;  1WRD B;  3ML8 A;  4PS7 A;  3VH4 B;  2OOB B;  4MK0 A;  4DDG D;  1LB1 A;  3EEC A;  4DHJ B;  2NVU I;  1W1D A;  3TMP B;  4K1R B;  1MAI A;  2ZVO A;  4WJP A;  4TV3 A;  1GG3 A;  4NY0 A;  2X18 A;  4MEL A;  1WJ1 A;  3DVN U;  1UPR A;  5CLL B;  1WGH A;  3A4R A;  2DX1 A;  2R0D A;  1IRS A;  4PQ0 A;  3VIA A;  1EAZ A;  2FCS A;  4HPL B;  3EPY A;  2K2U A;  4NAW B;  2RQ1 A;  3H7P A;  4B9K A;  4FN2 A;  2K1F A;  1Z87 A;  1RLF A;  1BTN A;  4PS8 A;  3TJP A;  2DYQ A;  4G0N B;  5BO4 B;  3WIM A;  3D8D A;  3ZKJ C;  2LWP A;  4II3 B;  1LXD A;  2MX2 A;  3TFM A;  2W9N A;  4H8S A;  3RT3 B;  5JLJ B;  2G4D B;  3VHT C;  1UPQ A;  1UBQ A;  3RUL A;  3UIN B;  3F5R A;  2MBB B;  4D0N B;  4GGQ A;  4AOF A;  1BAK A;  2YS5 A;  2ABD A;  2MFQ A;  3RZF A;  3PSC A;  3V61 A;  4E71 A;  3JYU A;  1C3T A;  2DYM A;  2KTR B;  1WX8 A;  1NTV A;  2KFK B;  3APC A;  3P2B A;  5CHW A;  5G2N A;  4CHK A;  5JHA A;  5KHO A;  2RUK B;  5KCV A;  4HLE A;  2D9W A;  2Z0O A;  4TUU A;  3PRZ A;  4Z2M B;  2BYV E;  3SU8 X;  4GN1 A;  2AEH A;  1KM7 A;  1X86 A;  1V5T A;  1WX9 A;  1WXA A;  2ZPN A;  3T8M A;  3V62 A;  4F7Z A;  1DDW A;  3KH0 A;  2ELB A;  2W2W A;  1E8Z A;  3VFK A;  3ZO5 B;  4GPT B;  3SUZ A;  2MWS B;  3FSS A;  1I7A A;  2KWC A;  4NPN A;  3TCA A;  1ACA A;  2L0F A;  1MIZ B;  2JZZ A;  4A20 A;  4DK5 A;  4HB4 B;  3ODX A;  4A6K A;  2UZS A;  2IO2 B;  3SD5 A;  3PT2 B;  2MWN B;  2L05 A;  1IP9 A;  2G4S A;  2YS1 A;  1V81 A;  1ZM0 A;  2VKI A;  4X57 B;  2GBK A;  3WA0 A;  1WXM A;  1Z5S B;  3ECI A;  2KAN A;  2Z59 B;  2J7Q B;  2DLW A;  1WZ0 A;  3AXC A;  1BWN A;  4W9F A;  3D32 A;  3V6E B;  1GNU A;  5LOP B;  1UEL A;  1U5D A;  1UZX B;  3PHX B;  4GDK A;  4XWX A;  1XD3 B;  1SE9 A;  1WIA A;  2DZJ A;  4URK A;  2OQB A;  2L1C A;  2ADZ A;  4E74 A;  2WX0 A;  2KWU B;  1U2B A;  1WJM A;  3N7C A;  4IWO A;  1WJ6 A;  2V3S A;  2FIF A;  3TVV A;  2MBQ A;  3B0A A;  3DVG Y;  4ICV A;  1GC6 A;  2CY4 A;  3DCG A;  4KZ0 A;  1T0Y A;  4YON A;  2GBN A;  2NBV B;  1FGY A;  2UYZ B;  3DVN V;  3JW0 X;  4FJY A;  2ROV A;  2EMT A;  2CKH B;  2N7D A;  2QHO A;  3B08 A;  3PLU A;  2KDI A;  1BT0 A;  2YT0 A;  2LAS A;  1IYF A;  1XX0 A;  4FHJ A;  5HKH A;  2DHI A;  2D3G A;  2C60 A;  3PS6 A;  4HCN B;  1YQB A;  3U8Z A;  2MLB A;  3WYF B;  3A9J B;  2RSU A;  4MH0 E;  1NTY A;  1VD2 A;  1HB8 A;  3AJ4 A;  2I5F A;  5D3W A;  2NCN A;  4B95 A;  3H7S A;  4WVF B;  2FJ9 A;  1S1Q B;  2COP A;  3PHW B;  4IW0 A;  4IWQ A;  4KSL C;  2HTH B;  4HDO A;  3VTV A;  2D4Q A;  3DBL I;  3ODO A;  1FXT B;  2K6D B;  3PVL A;  1NTI A;  4FAD A;  1PMS A;  1XKE A;  5C79 A;  3W1S C;  2FDQ A;  3QIJ A;  4E3C A;  2A5U A;  2GBM A;  3ML4 A;  4W9E A;  3FLV A;  2LZ6 A;  1TTN A;  4DDI D;  4IC7 B;  3L54 A;  2FCN A;  1K5D B;  2KLC A;  2R2Q A;  1GJZ A;  2C7N B;  4LJO B;  2MBE A;  2NS5 A;  2ZZP B;  1M7E A;  3ZNI D;  3ULC A;  1RRB A;  1I2H A;  3V5W A;  1RAX A;  1RJ2 A;  1P1A A;  2GOW A;  2PJH A;  2O2V B;  3CMM B;  3VTU A;  4F8C B;  5EFX A;  3EHV A;  2WH5 A;  2XEW A;  4W9J A;  5E6P A;  4EMO A;  1WMH B;  1EO6 A;  2NR2 A;  3NOB A;  4NJ7 A;  4ANV A;  3OAW A;  2O2V A;  3FEH A;  2KTR A;  2EJ8 A;  5D3Y A;  5HE1 A;  2IBI B;  2M0X A;  1I35 A;  3P6A A;  3KUZ A;  1V6E A;  1XQQ A;  3Q3J A;  2JWZ A;  3UQA A;  2RLO A;  2PEA A;  2UVM A;  4I6P A;  5C5B A;  1M94 A;  4DHZ B;  1WG7 A;  4EUT A;  4K81 A;  2VRW B;  4FJZ A;  4MGY E;  4RM9 A;  3CST A;  3TW1 A;  4M8N A;  4ZDV A;  4HAT B;  2FCM A;  2KOX A;  3CF6 E;  2HRJ A;  1WM3 A;  1YD8 U;  3ZRF A;  3R7R A;  4A6F B;  4KHA A;  4KVG B;  1LM8 B;  4F1S A;  4ZRJ A;  4ICU A;  1V49 A;  1V5P A;  4HAU B;  2GBR A;  2KCJ A;  1Q67 A;  2CHZ A;  1GUA B;  2KX0 A;  2M17 A;  1EGX A;  4Z2N A;  1WGU A;  2UZR A;  5D27 A;  2DYO A;  2KKC A;  2LUE A;  2PE9 A;  2C7H A;  3KVF B;  2H7D A;  5LLI A;  1FHW A;  4IFS A;  1IPG A;  3I3T B;  4G50 A;  2BYF A;  2COA A;  3QAR A;  2KVR A;  5FI1 A;  3PRM B;  4ANX A;  4GZU A;  2J0K A;  3UQB A;  5HE0 A;  2IY0 B;  4HJK A;  2BKF A;  3APF A;  1ZKH A;  4PYZ A;  4CHM A;  2GCJ A;  1WMH A;  2W2X C;  2OJR A;  3HK0 A;  3PLV A;  5D2M B;  3WAM A;  2DKQ A;  1D3Z A;  1LQB A;  1WJN A;  2J0M A;  2MW5 A;  3IVF A;  2C7M B;  2CHX A;  2LVP A;  2Z0E B;  3CSF A;  1E90 A;  3QA8 A;  2RNR B;  3SO6 A;  4GIV A;  2LVO A;  1V5M A;  3IG3 A;  2L3Z A;  4GSW A;  4W9H A;  3N3K B;  5IA7 A;  2ZCB A;  2LUL A;  1VCB A;  3A98 B;  5JHH A;  1NU2 A;  1X1M A;  2KXJ A;  2LVQ A;  1UH6 A;  1WH3 A;  1JRU A;  1ZSQ A;  4FJV B;  3PRP B;  4DWF A;  3PP2 A;  2DYB A;  1WE6 A;  1NDD A;  4ZRI A;  4I6N B;  4B6W A;  2NMB A;  4PYU A;  2N0Y A;  2DHJ A;  1WZ3 A;  4HK2 A;  2WYQ A;  2LD9 A;  2D2Q A;  1ZC3 B;  2MRP A;  3AUL A;  4LJP B;  2KO3 A;  2JXX A;  3HQC A;  4GOC A;  2AL6 A;  3ML9 A;  3ALB A;  3L16 A;  1P3R A;  4JIO U;  3ZIM A;  1GC7 A;  5EDS A;  1H8C A;  2L7R A;  3UIO B;  2E2X A;  3VOQ A;  4AP4 C;  2LXC A;  3K9P B;  4M8M A;  5D3V A;  3ZVV A;  2B3A A;  2J59 M;  2YT1 A;  1KJT A;  4DBG A;  2COD A;  3UZT A;  1TQZ A;  2D9V A;  1V89 A;  5L83 A;  3UIP B;  3MPX A;  2UWQ A;  5HE3 A;  2BPS A;  3OAN A;  4KHB B;  4C0A A;  3KYD D;  3L17 A;  3QAQ A;  4ASW C;  2DA0 A;  4CYE A;  2K25 A;  5LXH A;  2FID A;  2OTX A;  1OEY J;  4JGH B;  4A3P A;  2DHZ A;  2FNJ B;  3VUW A;  4BOS C;  5J3Y A;  2YS3 A;  1F9J A;  3ZNH B;  4KAX B;  2MA9 B;  3W1S A;  1AQC A;  1KZG A;  4BVU C;  1E7V A;  5JH5 C;  1K8R B;  3P7Z A;  2GS0 A;  3ONS A;  4IG7 B;  1AAR A;  4ZYN A;  2D11 A;  4ANW A;  2MSE D;  3VVW B;  2NPT B;  3NHE B;  4G11 A;  2I1K A;  4BBK A;  3SHQ A;  4MJS A;  3PG7 A;  4A6H A;  2K8H A;  3JSV B;  4HXD A;  1QQG A;  1V2Y A;  2Q13 A;  4KIK B;  3RUI B;  1WGG A;  4RM8 A;  2DAJ A;  3M63 B;  1WI1 A;  1NBF C;  1U5F A;  5J3Q A;  1E8Y A;  4XC2 A;  3KUC B;  1DYN A;  2CR5 A;  2HJ8 A;  2XK5 B;  3M95 A;  4EOY A;  2KK8 A;  2P0F A;  3R7Q A;  3ZUN A;  3HHM A;  4EZL A;  1Y19 B;  1EF5 A;  4WJO A;  5C5B B;  3N30 A;  3A8P A;  3NZU A;  2HTH A;  2FUH B;  2W2X D;  3DPD A;  3QWZ B;  4WAA A;  5E6N A;  5IJM A;  4W9K A;  4IWP A;  5D7G A;  4NNJ B;  2CY5 A;  3ODW A;  3DVG X;  5DCN A;  3IHP C;  3ZDM C;  4EJN A;  3F0W A;  2RSG A;  2RVB B;  2JZ3 B;  4DHJ D;  4IM3 A;  3APD A;  4TQ0 A;  2LBB A;  4MGI E;  3GZN I;  1OQN A;  4GDL A;  2MCN B;  2LYD A;  2ZNV C;  3T9L A;  4GB9 A;  3WAN A;  1YJ1 A;  2HD5 B;  2XBB C;  2N9E B;  5AZH A;  4HAZ B;  1HB6 A;  1A5R A;  4IM2 A;  2QKL A;  2KD0 A;  2IY1 B;  4OVV A;  4BKS A;  3BJI A;  3A1Q A;  1FHX A;  2EC1 A;  2VRR B;  2LJ5 A;  4BBN F;  3QHT A;  1I42 A;  2L2I A;  1WY8 A;  1V86 A;  1RFA A;  1KOT A;  5KQ1 A;  2LRU A;  3ZTD A;  3L0W B;  4G3X B;  5CHV C;  3X23 A;  3VH3 B;  1FOE A;  4MT7 A;  3NSU A;  1TZ1 A;  2KNB A;  3C0R B;  2NZ8 B;  4DHZ E;  1YX5 B;  2DAF A;  2O6V D;  3DXC A;  2RPQ A;  5HE2 A;  4MY6 A;  2K8C A;  2CS4 A;  2JY6 A;  2O6V A;  1K5G B;  1U5E A;  5DHA B;  4GMV A;  3O65 B;  4K7S A;  4N9F 4;  3RZW C;  2ZEQ A;  2PE6 B;  2V76 A;  3TBL D;  3JVZ X;  2D07 B;  5JP4 A;  2N7E A;  3ULB A;  2N9P C;  2JRI B;  4HCP B;  4CHJ A;  3PRE A;  1V80 A;  3A9K A;  1NI2 A;  1EF1 A;  2KMC A;  3PGE A;  3WAP A;  1SHC A;  3R66 C;  4FLH A;  4HAX B;  4J6I A;  1V88 A;  5AZF A;  1U29 A;  2A4Z A;  1WR6 E;  2NBW B;  2JUO A;  3WAL A;  1XR0 B;  4JLC A;  3ZW3 A;  2M1M A;  3ZRC A;  2BCJ A;  5CLQ B;  2Y8F A;  3PEG A;  3VAW A;  4HVB A;  4AJW A;  3AI5 A;  2M38 A;  4WSF A;  5C6R A;  2IO1 B;  1X05 A;  3NY5 A;  1UNP A;  3OJ3 A;  2JPH A;  1M7R A;  1ST7 A;  4TYZ A;  3KUD B;  1P9D U;  5JHG A;  5DH9 B;  4KDL B;  4P7I A;  3V6C B;  1FGZ A;  2I5C A;  2DFK A;  2ASQ A;  2MBO A;  4WWN A;  2COF A;  1V9J A;  2KLG A;  3ENE A;  3QWM A;  2DKP A;  3AU5 A;  1UBI A;  3A8Q A;  2JVC A;  2NPT A;  1UEF A;  2LOZ A;  1J0W A;  4HB0 B;  1WX7 A;  4HPM B;  4WJ7 A;  4K2O A;  1HE8 A;  1UD7 A;  1P6S A;  1BTK A;  1V5O A;  5DI9 B;  5J3T A;  4W9C A;  4K2P A;  2KN5 A;  3QK0 A;  2K2J A;  4DXA B;  4IUM B;  3B1L X;  1U27 A;  1WGR A;  2IO0 B;  4MEM A;  1L7Y A;  2XQN M;  1HBK A;  1XD4 A;  3MDB C;  1P5T A;  2ELA A;  4IOY X;  3DXE A;  2LKO A;  3QX1 A;  3GYO A;  1ZGU B;  5JZE B;  3OJ4 B;  2BF8 B;  5FI0 A;  4BOZ B;  1WI0 A;  1MG8 A;  1OTR B;  3G9W A;  3H6N A;  3L13 A;  4LDT B;  2J0J A;  1KI1 B;  3CIK A;  2WDT B;  2LI5 A;  3NZS A;  3OLM D;  4FA6 A;  1E5W A;  4GU2 A;  2VSZ A;  2Y7B A;  1UGM A;  5G55 A;  2BWE S;  2KZR A;  4K7W A;  1W1G A;  4HAY B;  3ZVR A;  2DZM A;  3RYT A;  1Y5O A;  4W9I A;  3VXW A;  2DZK A;  4MDK E;  3PZD A;  1J19 A;  1TXD A;  2DYN A;  2EMS A;  1UNQ A;  2QKM A;  2LGY A;  3LJ3 A;  2ZCC A;  1TJ6 A;  1DRO A;  2M4N A;  4ZRK A;  1QC6 A;  2KQS A;  2M8S A;  3LJU X;  3VUX A;  4HB2 B;  1R4M I;  4MSQ B;  3U7D A;  1PFJ A;  1MIX A;  2FCQ A;  2NBU A;  3W1Y A;  1FB8 A;  2PZ1 A;  1DDV A;  1R4N I;  1FHO A;  2P0D A;  4GMX B;  1WJU A;  1E8W A;  2G3Q B;  2ZVN A;  2JRH A;  3GOE A;  3PTF C;  4M0W B;  3ZDT A;  4K17 A;  1P3Q U;  2IYB A;  1LFD A;  5KQ4 A;  2Z0D B;  4W9L A;  1QZE A;  4NJ6 A;  4F7G A;  5CTR C;  2JP2 A;  1WXS A;  5C23 A;  3SV1 A;  2BGF A;  1XCG A;  2DEN B;  1V61 A;  2R09 A;  3QBV B;  1WE7 A;  2R2O A;  3DBH I;  3DOW A;  4KIK A;  4WWO A;  4W9D A;  5DPW A;  2HE7 A;  4HB3 B;  4DX8 A;  3M3J A;  3JSV A;  3ZTC A;  3M62 B;  1U5G A;  1WXV A;  5D94 A;  3A33 B;  3IFW B;  4MM3 A;  1OEY A;  2WWZ A;  4BKS D;  2G35 A;  3O96 A;  1WVH A;  2KFJ A;  3A9K B;  5GMV A;  1TGZ B;  3DBS A;  1V5U A;  1H10 A;  2RGN B;  1NVL A;  4PS3 A;  4GDL B;  5J2R A;  2WX1 A;  3TIX A;  3VDZ A;  3L10 B;  2KHW B;  3M1I B;  2KMA A;  4HWI B;  3AU4 A;  3QCA A;  2CRF A;  1WGD A;  1WM2 A;  4RMA A;  4JQW C;  1WJ4 A;  5AEK B;  3H1U A;  2CHW A;  3KY9 A;  2REX A;  4KHO A;  4GDK B;  4AWJ A;  2Y5B B;  1L2N A;  4F7H A;  1WFY A;  1C1Y B;  2G45 B;  4EZJ A;  5AZG A;  1MK9 B;  4TKN A;  1KLV A;  3H9D A;  3ZLZ A;  3R3M A;  2YF0 A;  2ROZ B;  2C9W B;  2ZNV B;  1WYW B;  4NQL B;  3KW5 B;  3VQI A;  5J17 A;  4HAV B;  5CX3 A;  2DTC A;  1WR1 A;  2FJL A;  3CXB B;  1ZVR A;  5IAA C;  2LG1 A;  2KJH B;  3A1Q B;  2IFS A;  3L08 A;  1H4R A;  4MGZ E;  2GMI C;  1MKE A;  3GYP A;  2KTF A;  3UGB B;  2AL3 A;  1OGW A;  2KUP A;  1TBE A;  3NS8 A;  3UF8 A;  4BKT A;  4FHK A;  4WJN A;  3A9J A;  2GCL A;  2YSZ A;  1YIW A;  1MK7 B;  2K6Q A;  4YL8 A;  3PSE B;  5DPS A;  1DDM A;  2Y8G A;  4AUQ C;  2DN6 A;  2RR9 A;  2IZV B;  3D8F A;  1ISN A;  2V4L A;  2L00 B;  3PPA A;  1EVH A;  4JL9 A;  3VTW A;  5DPT A;  3PV1 A;  3SYX A;  4EZK A;  1DBH A;  4WWP A;  3QJZ A;  2LOX A;  3D8E A;  2K39 A;  1Z2M A;  3BY4 B;  4AJY B;  2JF5 A;  4A3O A;  1ZC4 B;  5D3X A;  3ZNG C;  4DX9 0;  4FBJ B;  2JT4 B;  1B55 A;  2D9Y A;  1XOD A;  1OMW A;  1EUV B;  2GJY A;  2K8B A;  2BWF A;  2V1Y A;  4EKU A;  3DDC B;  3TL5 A;  1U4A A;  2Z0P A;  2ZJD A;  4NAW A;  2M14 A;  2EKE C;  1WGY A;  5LON B;  4KDI C;  3KRW A;  5D6J B;  2KQ7 A;  4ANU A;  2IO3 B;  2CU1 A;  1KZ7 A;  4BBN C;  1G6J A;  2FAZ A;  3KYC D;  1CMX B;  3Q3F A;  2KDE B;  1P0R A;  2KGX B;  2P8V A;  4EFO A;  4K7U A;  4MJS B;  4W9G A;  4IAP A;  2L76 A;  2N1W A;  2MP2 A;  4XX5 A;  3FM8 C;  2KWV B;  3MHS D;  4II2 B;  2N23 A;  4IM0 A;  3S2A A;  4BKG A;  2PPH A;  5TR5 A;  2GBJ A;  3HW2 B;  1OQY A;  3KSY A;  1XT9 B;  1Q5W B;  3HIZ A;  3RCZ A;  5LXI B;  3SNH A;  1PQS A;  3KRX A;  1Q1O A;  1ZW7 A;  4A5K A;  2CB8 A;  5DIF B;  2CAY A;  4CO7 A;  2L8J A;  4LCD E;  3EFU A;  4TQ1 A;  4BFR A;  2K00 A;  4GXB A;  2YVC A;  2L0T A;  2N1V A;  4XZ4 A;  5C1Z A;  2H7E A;  1WGQ A;  5L81 A;  2KDF B;  2YLM A;  3QQ8 B;  2CQU A;  1LW3 A;  1X11 A;  4FUL A;  4MGK E;  2RD0 A;  3X0W A;  4Y94 A;  1E8X A;  1Y8R C;  3DXD A;  3QC8 B;  4LDT D;  2XK5 A;  3U30 A;  2N4F A;  3DQV A;  3RD2 A;  3PVW A;  2KJ6 A;  3LDZ E;  5DPR A;  2Z0Q A;  4I6L B;  3MJW A;  5FR6 A;  4EEW A;  1SGH A;  3BIN A;  4OVU A;  3FP5 A;  4HHV A;  2AWT A;  3MTN B;  3PVU A;  1J8C A;  4KV2 A;  4DBB A;  2KDB A;  4MSM B;  2KC1 A;  2DX5 B;  2KC2 A;  2I1J A;  4KZC A;  3IBE A;  3K9O B; 
#chains in the Genus database with same CATH topology
 3DBL B;  1E7U A;  2DZI A;  3WAO A;  1IP9 A;  2D9X A;  3P63 A;  3HM3 A;  2MQJ A;  4OT1 A;  1OY2 A;  3HVD A;  2D10 A;  1XLP A;  4KSK C;  2MDX A;  4NQK E;  5JHB A;  3NVW A;  1X1G A;  2D9Z A;  2H88 B;  5T8I A;  3AN1 A;  3N32 A;  2D3B A;  3NWF A;  2YEP B;  5KHQ A;  1N3H A;  4WQO B;  2BW2 A;  1IGD A;  1C3T A;  1MPH A;  3VH4 B;  1EWC A;  4JKB A;  2E6X A;  3EEC A;  4DHJ B;  3TEY A;  2RRF A;  1W1D A;  1MAI A;  4WJP A;  1BML C;  4NY0 A;  3Q8A A;  1UPR A;  5CLL B;  5AZF A;  2FCS A;  4PQ0 A;  1EAZ A;  4ILH A;  4NAW B;  1E7P B;  3H7P A;  4D2K A;  4JKG A;  3WIM A;  3ZKJ C;  4DXG A;  5JLJ B;  3Q8E A;  4P16 A;  4AOF A;  4GGQ A;  2ABD A;  3RZF A;  3V61 A;  1WX8 A;  5CHW A;  3P2B A;  5JHA A;  5KCV A;  4OZB A;  3T8M A;  1KM7 A;  3DBH B;  3KH0 A;  2W2W A;  3VFK A;  2WXI A;  1I7A A;  4NPN A;  3TCA A;  4LNF A;  4ACF A;  2JZZ A;  2QCZ A;  2G4S A;  1V81 A;  3AE9 B;  2GBK A;  2Z59 B;  2DLW A;  3V6E B;  2IJ0 A;  1UEL A;  3PHX B;  1P7E A;  4XWX A;  1XD3 B;  1SE9 A;  1MVK A;  3BZD B;  2LFI A;  2ADZ A;  1V97 A;  4IWO A;  1WJ6 A;  2FIF A;  3B0A A;  4PS8 A;  2CY4 A;  3DCG A;  4ANW A;  1VZ7 A;  2UYZ B;  1FGY A;  3NWD A;  2QHO A;  3B08 A;  4YSY B;  1YJI A;  4RGO S;  2LAS A;  3I63 C;  5GXG B;  1YQ4 B;  2C60 A;  3PS6 A;  4HCN B;  5D3D A;  2XNA C;  3WYF B;  4MH0 E;  1VD2 A;  3Q3M C;  3PHW B;  4XDC A;  3ODO A;  1FFV A;  4E3C A;  2A5U A;  4IC7 B;  3Q8C A;  2KLC A;  2NS5 A;  3ZNI D;  2QDF A;  1RJ2 A;  4LTU A;  2O2V B;  4W9J A;  5E6P A;  1EO6 A;  4NJ7 A;  2WXH A;  5AUI A;  1SJH D;  5HE1 A;  2M0X A;  3P6A A;  4QJ4 B;  3KUZ A;  1V6E A;  2M56 B;  2RLO A;  2PEA A;  2UVM A;  5C5B A;  1MI1 A;  4EUT A;  4FJZ A;  4JKH A;  4RM9 A;  3TW1 A;  2D3A A;  3CF6 E;  3TEX A;  4Q2J A;  4KHA A;  1LM8 B;  1V49 A;  4HAU B;  2GBR A;  5JVL A;  1ROE A;  4Z2N A;  4EEW A;  2MJ3 A;  1TIF A;  3DHI C;  1FHW A;  4IFS A;  1IPG A;  4RF0 A;  2COA A;  4GZU A;  1KRH A;  3ABV B;  1SF0 A;  2DKQ A;  2CHX A;  1E90 A;  3SO6 A;  2L3Z A;  3E9L A;  2LUL A;  4BAX A;  1UH6 A;  1JRU A;  3U4E G;  4DWF A;  3NW8 A;  1NDD A;  2NMB A;  2N0Y A;  2DHJ A;  5IN7 A;  5H8Y E;  2WYQ A;  2KO3 A;  3L16 A;  1H8C A;  1GC7 A;  2E2X A;  4AP4 C;  1D5Z C;  2YT1 A;  2V3P A;  1ZUD 2;  3UZT A;  1TQZ A;  1VJK A;  2VH1 A;  4RFB A;  1V89 A;  2BPS A;  3QAQ A;  4KHB B;  3FAH A;  1DOX A;  2W54 A;  5LXH A;  2J53 A;  2OTX A;  1OEY J;  2Y3A A;  2YS3 A;  1E7V A;  1K8R B;  4LLG M;  1IUE A;  3PG7 A;  4A6H A;  2Q13 A;  5FR3 A;  1WGG A;  2DAJ A;  2L52 A;  1NBF C;  2IPK D;  5J3Q A;  1E8Y A;  4XC2 A;  5EDS A;  4QXA B;  4EOY A;  4EZL A;  3A8P A;  3ZJT A;  3QWZ B;  4OHJ A;  5E6N A;  5IJM A;  5D7G A;  3ODW A;  1TS2 A;  2SAK A;  4HJG E;  3ZDM C;  3F0W A;  2RSG A;  2JZ3 B;  2J4X A;  3APD A;  4TQ0 A;  3GZN I;  4GDL A;  2MCN B;  2HD5 B;  2N9E B;  3MP9 A;  3PZ8 A;  2JSV X;  2QKL A;  2KD0 A;  4OVV A;  4LK0 M;  1CJE A;  1FHX A;  2K49 A;  2VRR B;  4BBN F;  2V0G A;  2L2I A;  1WY8 A;  1T6B X;  3ZXV A;  4G3X B;  5FKA C;  3VH3 B;  2KNB A;  3C0R B;  3DXC A;  4NJC A;  2JY6 A;  4K7S A;  2PE6 B;  1P7F A;  3JVZ X;  1SB3 C;  3ULB A;  2WXO A;  1JWU D;  3A9K A;  1SHC A;  4JLC A;  2JZP A;  1C76 A;  3VAW A;  3AI5 A;  4IKG A;  1Y56 A;  1X05 A;  3NY5 A;  5MPO A;  4XGA B;  4KDL B;  1I4H A;  3AMZ A;  1FGZ A;  2BQQ A;  3E66 A;  2BBC A;  4WWN A;  4JKG B;  3ENE A;  3QWM A;  4HRS A;  1FM0 D;  4HPM B;  4K2O A;  5EE9 A;  1BTK A;  1V5O A;  4W9C A;  4DXA B;  1U27 A;  1ZXH A;  1L7Y A;  1XD4 A;  3MC8 A;  1SE4 A;  2ELA A;  1WGK A;  2K5P A;  2PVG C;  3DXE A;  4OW0 A;  2BF8 B;  1ZOY B;  2MJE A;  3CIK A;  1KI1 B;  2UU7 A;  1UGM A;  2WHI A;  3NZ3 A;  4W9I A;  4AS1 A;  3PZD A;  2DYN A;  2LGY A;  1PUT A;  1DRO A;  2M4N A;  2ZCC A;  4ZRK A;  2M19 A;  2B76 B;  4HB2 B;  5FK9 C;  3Q3O C;  4ZRP A;  1JDE A;  1KTK A;  1JWA D;  4C56 C;  4RF1 A;  2KVZ A;  4M0W A;  2FCQ A;  1FB8 A;  4GNK B;  2PZ1 A;  1R4N I;  4RGT A;  4K17 A;  1P3Q U;  2Z0D B;  3V05 A;  3SV1 A;  3MHS D;  3DOW A;  1WE7 A;  3DBH I;  4DX8 A;  3M3J A;  4LNK A;  3JSV A;  3M62 B;  1I4P A;  1CK1 A;  2KFJ A;  5GMV A;  3DBS A;  2D3C A;  1NVL A;  4MH8 A;  3AE4 B;  1ZPS A;  2WX1 A;  3GZN B;  4KKI A;  3ZGZ A;  3QCA A;  1JCK B;  1PFD A;  4JQW C;  1L2N A;  4AWJ A;  4EZJ A;  1EU3 A;  4YSZ B;  4QJ3 B;  3R3M A;  2YF0 A;  2C9W B;  1YOV B;  4HAV B;  2DTC A;  3L08 A;  2WXM A;  3BYY B;  2KUP A;  1TBE A;  1VDV A;  3NS8 A;  3BYT B;  4BKT A;  4FHK A;  2AQ2 B;  1QF6 A;  3A9J A;  2YSZ A;  3PSE B;  1YN4 A;  2RR9 A;  2IZV B;  3D8F A;  4EZK A;  2LUM A;  3BII D;  1UF0 A;  1E6E B;  4ZYS A;  2LOX A;  3BY4 B;  2JF5 A;  2JT4 B;  1B55 A;  1OMW A;  1DYQ A;  1L6U A;  3AE2 B;  3TL5 A;  3SBT A;  5LON B;  4KDI C;  4ANU A;  1N60 A;  2Z59 A;  3Q3F A;  2KDE B;  4W9G A;  1L0V B;  2L76 A;  3FM8 C;  4IM0 A;  2KIE A;  1XT9 B;  3HIZ A;  3OG5 A;  3NJT A;  5LXI B;  1Q1O A;  3U52 E;  2CB8 A;  2CAY A;  4CO7 A;  4R3D A;  2L8J A;  4BFR A;  1JW9 D;  4TQ1 A;  5C1Z A;  1F2R I;  5L81 A;  4MGK E;  1FNW A;  4FUL A;  1IBX A;  2RD0 A;  4Y94 A;  5BMH A;  1E8X A;  2BVC A;  3DXD A;  3QC8 B;  2XK5 A;  3DQV A;  3PVW A;  1MJD A;  5DPR A;  3MJW A;  1SGH A;  3BIN A;  1J8C A;  3VRB B;  3KWV A;  4KV2 A;  2N0S B;  4W9D A;  4B0E A;  2KC2 A;  2I1J A;  1IGC A;  3K9O B;  2KT7 A;  1MHH E;  1W1H A;  2KX3 A;  4WJQ A;  5GOW B;  4LNI A;  3RI7 C;  3ZNZ B;  5L95 C;  1TY0 A;  2DX5 A;  2SEB D;  4O1N A;  2RGF A;  5DHF B;  1X1F A;  1ESF A;  2MP2 B;  3VUY A;  4HAW B;  3T06 A;  1K52 A;  5HG2 A;  1S3S G;  2LGD A;  4F7U P;  4NSW A;  2KQ4 X;  4PNK A;  4L6E A;  2O6V B;  4A6F A;  4HEA 1;  4K1R B;  1AYF A;  3L4P A;  1GG3 A;  2DX1 A;  4HPL B;  3EPY A;  4FN2 A;  1Z87 A;  1BTN A;  4P1C C;  2DYQ A;  2HDE A;  3R8B A;  1UBQ A;  3RUL A;  3ZJV A;  1MFW A;  3KWL A;  2MBB B;  2YS5 A;  2MFQ A;  4E71 A;  2IGG A;  3JYU A;  5G2N A;  5KHO A;  2BYV E;  1WXA A;  2AEH A;  1WX9 A;  1X86 A;  1DDW A;  1E8Z A;  4A9A A;  2CJO A;  1ACA A;  2L0F A;  1MIZ B;  4DK5 A;  3ODX A;  3GP7 A;  3SD5 A;  2MWN B;  4WQM A;  4X57 B;  1QKZ A;  4J3O D;  2J7Q B;  4XWW A;  1WZ0 A;  1UZX B;  1U5D A;  3NRZ A;  1JRP A;  1UWM A;  2DZJ A;  4URK A;  2OQB A;  3BVG A;  2WX0 A;  1EM7 A;  3TVV A;  2MBQ A;  3DVG Y;  5HFY A;  2I38 A;  4YON A;  1CZP A;  4FJY A;  2ROV A;  2N7D A;  3PLU A;  1ET9 A;  2PVO D;  3W5V B;  1VR9 A;  2DHI A;  2D3G A;  2MLB A;  3A9J B;  1NTY A;  3C8Y A;  1HB8 A;  2NCN A;  2WS3 B;  2WXF A;  4B95 A;  1OFF A;  1C9F A;  4IW0 A;  2FJ9 A;  4KSL C;  4US9 A;  4HDO A;  3VTV A;  4ILJ A;  1C4A A;  3DBL I;  1PMS A;  2FE8 A;  5C79 A;  3Q8F A;  2FDQ A;  3ML4 A;  2LZ6 A;  4DDI D;  2BS2 B;  3L54 A;  2WP9 B;  2FCN A;  1GJZ A;  1FNV A;  1WRI A;  3VTU A;  1ZYI A;  5EFX A;  2XEW A;  2NR2 A;  1FO4 A;  4WIP A;  2K9X A;  1TYG B;  2EJ8 A;  3VR9 B;  4N58 A;  3Q3J A;  2JWU A;  4I6P A;  4DHZ B;  1GAQ B;  1PGA A;  2Z4D A;  4MGY E;  4M8N A;  4HAT B;  1STE A;  2FCM A;  2HRJ A;  1WM3 A;  3R7R A;  4KVG B;  1UUP A;  4ZRJ A;  5C2T B;  3NVV A;  5BYQ A;  1GUA B;  3BK1 A;  5D27 A;  2LUE A;  4G50 A;  3QAR A;  1K50 A;  3AEC B;  3PRM B;  2INC C;  2IY0 B;  4CHM A;  5D2M B;  1LQB A;  1WJN A;  3ZIM A;  3CSF A;  2Z0E B;  2K8E A;  2LVP A;  4BOZ B;  3C19 A;  1RM6 C;  3N3K B;  5IA7 A;  4ZRQ A;  2EKI A;  1WH3 A;  1T0S C;  3PRP B;  3DWG C;  5EE3 A;  1SXT A;  1WE6 A;  3J9C A;  1WZ3 A;  1HA5 A;  1YQ3 B;  1ZC3 B;  3AUL A;  5M4Y B;  2JXX A;  1P3R A;  1C4C A;  4OZA A;  3VOQ A;  2GUM A;  4JPS A;  3K9P B;  2B3A A;  2COD A;  1C78 A;  1E0Z A;  3KYD D;  2UWQ A;  2X8X X;  4C0A A;  4ARC A;  4ASW C;  4CYE A;  2WGS A;  2AQ1 B;  4YT0 B;  3VUW A;  4BOS C;  5JH5 C;  4K3C A;  1KZG A;  3W1S A;  3U7Z A;  1HTQ A;  3ONS A;  3NHE B;  4BBK A;  4MJS A;  2QSD A;  1V2Y A;  3R2T A;  3VRA B;  1WI1 A;  1YJJ A;  2CR5 A;  1ENF A;  2LEK A;  3M95 A;  3R7Q A;  3ZUN A;  5C5B B;  3DPD A;  2W2X D;  4IWP A;  5JZE B;  2X38 A;  3IHP C;  4EJN A;  4XE0 A;  4DHJ D;  4IM3 A;  4KKJ A;  4RNA A;  3BK2 A;  3WAN A;  2ZNV C;  4JKA A;  2XBB C;  5AZH A;  1HB6 A;  1QOA A;  1QOF A;  3BJI A;  2EC1 A;  2LJ5 A;  1I42 A;  1V86 A;  1FOE A;  4MT7 A;  1YX5 B;  4MY6 A;  1L0Y B;  1VZ8 A;  4C00 A;  2O6V A;  4XWT A;  5DHA B;  1U5E A;  3O65 B;  3RZW C;  2V76 A;  2RPV A;  1J7B A;  2N9P C;  2JRI B;  1V80 A;  1EF1 A;  2KMC A;  3WAP A;  2MH7 A;  4FLH A;  1R4N B;  2JYT A;  2NBW B;  5CLQ B;  1TT5 B;  4WSF A;  2IO1 B;  4REZ A;  3OJ3 A;  2JPH A;  1L4Z B;  4P7I A;  2DFK A;  2MBO A;  2KLG A;  3ETR A;  3AU5 A;  1I4R A;  2JVC A;  2NPT A;  2LOZ A;  4RH6 A;  2Q5W D;  1N6Z A;  2QMT A;  1QQR A;  1ZXI A;  2K2J A;  4RCO A;  1TZO A;  1XCQ L;  4MEM A;  1HBK A;  3WCQ A;  5FI0 A;  5BMI A;  4DXF A;  1OTR B;  1JWB D;  3HVZ A;  1UWX A;  1GB4 A;  3IAM 1;  2WU5 B;  2VH2 A;  3HUI A;  3NZS A;  4FA6 A;  4FXC A;  3RNG C;  2BS3 B;  5G55 A;  4C4V B;  2KZR A;  1B9R A;  4UDU C;  5JXV A;  4HAY B;  2INP E;  3VXW A;  1Y5O A;  2ZKM X;  4MDK E;  1UNQ A;  3LJ3 A;  1YMH E;  2DIK A;  3AE8 B;  1R4M I;  1QOB A;  2W3S A;  3U7D A;  4HKZ E;  1ZDX A;  2NBU A;  2RMM A;  4OSN A;  1I4X A;  5LG4 B;  1RFK A;  2G3Q B;  1FHO A;  3GOE A;  2JRH A;  3ZDT A;  5KQ4 A;  1QZE A;  2MEK A;  1WXS A;  2BGF A;  3ZJU A;  1FNU A;  3QBV B;  2R2O A;  3EUB 2;  1NYR A;  1I7H A;  3ZTC A;  3A58 A;  4WWM A;  5D94 A;  3IFW B;  1SJE D;  1OEY A;  4BKS D;  1WVH A;  3RNE C;  1DIK A;  2NMQ A;  1V5U A;  4PS3 A;  2WU2 B;  3TSS A;  3TIX A;  1AW7 A;  2KHW B;  3M1I B;  1T77 A;  2WDQ B;  3AU4 A;  2CRF A;  1WGD A;  4HWI B;  5AEK B;  2CHW A;  2REX A;  4GDK B;  4KHO A;  4F7H A;  1VBG A;  1MK9 B;  4TKN A;  1KLV A;  2RDB C;  3Q8B A;  2ROZ B;  3AE1 B;  3KW5 B;  4PT5 A;  2N9L A;  4ITK A;  3AED B;  3B2G A;  3A1Q B;  4MGZ E;  2IFS A;  1H4R A;  3BVZ A;  4USA A;  3GYP A;  3FIL B;  1K53 A;  2AL3 A;  3UF8 A;  3V3X A;  3AE7 B;  5G5G A;  2Z13 A;  2IGH A;  1N5W A;  4WJN A;  2GCL A;  1YIW A;  1MK7 B;  2K6Q A;  4YL8 A;  1MHX A;  1ISN A;  2K3U A;  3O13 A;  4WWP A;  2CU3 A;  3D8E A;  4A3O A;  1N61 A;  3GE8 C;  3DDC B;  2K8B A;  1ACC A;  2BWF A;  3HSA A;  4YTN B;  2EKE C;  2WXG A;  2FAZ A;  1VZ6 A;  1C77 A;  2N1W A;  4XX5 A;  2KWV B;  2Z8L A;  4HSI A;  1Q5W B;  3RCZ A;  3SNH A;  1PQS A;  4M02 A;  1OQR A;  2DBY A;  4LCD E;  1I4G A;  3EFU A;  4GXB A;  2L0T A;  2YVC A;  4XZ4 A;  3W5U B;  1RYJ A;  3QQ8 B;  1CQV A;  1X11 A;  1MPE A;  1K51 A;  3U30 A;  2N4F A;  4GOU A;  4I6L B;  5FR6 A;  4RGN A;  4OVU A;  4JE3 B;  2V9H A;  4HHV A;  3PVU A;  4MSM B;  1VBH A;  1M4V A;  2BYT A;  3IBE A;  1WF9 A;  3H7P B;  2N9X A;  2DHK A;  3A4S C;  3W2D A;  2ZPY A;  1SEB D;  2L83 A;  2LRW A;  4HDQ A;  1XO3 A;  3HM6 X;  5C16 A;  5E6O A;  1P98 A;  3N9Y C;  3E56 A;  1XLN A;  1UNR A;  3T3O A;  1FAO A;  2C5L C;  1AWE A;  2FUG 1;  2BYE A;  2Z14 A;  3P4P B;  4OZC A;  2KR0 A;  2MBH A;  2LGX A;  3RCP A;  1G6J A;  2P0H A;  1J0G A;  1F1H A;  2BTE A;  3ML8 A;  4PS7 A;  2OOB B;  4MK0 A;  4N59 A;  4DDG D;  2NVU I;  2ZVO A;  1DOI A;  3IXS A;  4TV3 A;  4MEL A;  1WJ1 A;  1WGH A;  2R0D A;  3VIA A;  1IRS A;  1WWT A;  2K2U A;  2K1F A;  3KQ4 A;  3Q14 C;  3TJP A;  5BO4 B;  4G0N B;  3D8D A;  4II3 B;  3MHZ A;  2ICI A;  3RT3 B;  4H8S A;  4QJ5 B;  4LNN A;  3UIN B;  3F5R A;  4D0N B;  3PSC A;  4L2Y A;  3B9J A;  1EWY C;  2KTR B;  3APC A;  2KFK B;  1VLB A;  2RUK B;  3N1X C;  3PRZ A;  4Z2M B;  2FJU B;  4F7Z A;  3V62 A;  1YN5 A;  3ZO5 B;  4GPT B;  3SUZ A;  2MWS B;  2L1A A;  4A20 A;  4HB4 B;  4A6K A;  2IO2 B;  2UZS A;  2L05 A;  2YS1 A;  1MI0 A;  1WXM A;  3ECI A;  1FXA A;  1GNU A;  5LOP B;  1WSP A;  4GDK A;  3LXF A;  1WIA A;  2MHJ A;  1OQQ A;  2KDM A;  2Y5P A;  2KWU B;  1U2B A;  1WJM A;  4XYC A;  4WAF A;  4ICV A;  4KZ0 A;  1T0Y A;  2GBN A;  3JW0 X;  2NBV B;  2CKH B;  2EMT A;  1BT0 A;  1IYF A;  5HKH A;  3P4R B;  3U8Z A;  1ZE3 D;  3AJ4 A;  4JKC A;  1HQR D;  2J42 A;  2COP A;  2QIE B;  2HTH B;  2D4Q A;  4A55 A;  4JX1 C;  2K6D B;  1NTI A;  4FAD A;  4EE2 A;  4W9E A;  3FLV A;  4BZA A;  1KF6 B;  2KIG A;  1QLB B;  2C7N B;  4LJO B;  5AUK A;  1RAX A;  3TEZ A;  2GOW A;  3CMM B;  3EHV A;  2WH5 A;  4EMO A;  1D6E C;  1WMH B;  3NOB A;  1V1P A;  1ZP0 B;  3AH7 A;  3OAW A;  2KTR A;  1QOG A;  1JAL A;  4NZL B;  1I35 A;  1PGB A;  1XQQ A;  3UQA A;  2V3N A;  3AE5 B;  5IOI A;  4K81 A;  2VRW B;  2QJL A;  1LGR A;  2KOX A;  2WDR B;  1T5X D;  4A6F B;  4KGT A;  3U12 A;  4ICU A;  1V5P A;  1Q67 A;  1L6V A;  2UZR A;  2DYO A;  2KKC A;  2PE9 A;  2C7H A;  2H7D A;  1FRR A;  1EU4 A;  1PDX A;  5LLI A;  3I3T B;  2BB5 A;  3MJ5 A;  2BYF A;  4OVZ A;  2KVR A;  5FI1 A;  2PMV A;  2J0K A;  2BKF A;  3APF A;  4RGM A;  1WMH A;  3WAM A;  3NVY A;  2MW5 A;  2R2Y A;  3IVF A;  2C7M B;  3QA8 A;  2RNR B;  4GIV A;  4W9H A;  2NTT A;  1V5M A;  4B0M A;  2ZCB A;  1VCB A;  5JHH A;  3E9P A;  3IT6 B;  3GE3 C;  4TSS A;  3PP2 A;  1ET6 A;  2DYB A;  3GS2 A;  3H8H A;  4YWG G;  3UI3 A;  4ZRI A;  2D2Q A;  4LJP B;  3BVM A;  4JWS C;  3SEB A;  3HQC A;  4GOC A;  2AL6 A;  4JIO U;  3ALB A;  2L7R A;  3UIO B;  4M8M A;  5D3V A;  3ZVV A;  2K0P A;  4DBG A;  2D9V A;  2WNM A;  4YTP B;  3MPX A;  3OAN A;  3L17 A;  2DA0 A;  2FID A;  3AEF B;  4JGH B;  3RNF C;  4A3P A;  2DHZ A;  3ZNH B;  4BVU C;  3ZXR A;  2MA9 B;  2LGI A;  5H92 C;  4XDD A;  4IG7 B;  2GS0 A;  4ZYN A;  2D11 A;  2MSE D;  3VVW B;  2ONQ A;  2NPT B;  1N62 A;  3SHQ A;  4A6Q A;  1SIJ A;  1FCL A;  2K8H A;  1QQG A;  2HJ1 A;  3RUI B;  2JU6 X;  4RM8 A;  3M63 B;  1U5F A;  2LHE A;  2RDH A;  3KUC B;  1DYN A;  2P0F A;  3HHM A;  1Y19 B;  4WJO A;  2PKO A;  2FUH B;  4C7Z A;  4WAA A;  4W9K A;  4F1S A;  2CY5 A;  1XCT L;  5DCN A;  2LBB A;  4MGI E;  1OQN A;  3T9L A;  2JXT A;  4HAZ B;  4DQO C;  2ZW1 A;  3LYY A;  4IM2 A;  3A1Q A;  3PZ7 A;  3QHT A;  4LNO A;  1FRD A;  5KQ1 A;  2LRU A;  3L0W B;  5CHV C;  5BYR A;  3X23 A;  3NWA A;  1AWD A;  2J52 A;  2NZ8 B;  2DAF A;  2RPQ A;  4YSX B;  1VRA B;  2K8C A;  5I2S A;  1K5G B;  4GMV A;  2ZEQ A;  3TBL D;  1R4M B;  2D07 B;  2ZW0 A;  5JP4 A;  3EGR A;  2N7E A;  4CHJ A;  3PRE A;  1SE3 A;  1QT9 A;  3PGE A;  4HKQ A;  3R66 C;  4HAX B;  2PTL A;  2A4Z A;  3ZW3 A;  2JUO A;  2M1M A;  3I5J C;  3N20 C;  4HVB A;  4M00 A;  3LB8 C;  4JKD A;  3KUD B;  5DH9 B;  3FIL A;  3B77 A;  2ASQ A;  2COF A;  1BUI C;  1V9J A;  2DKP A;  1UBI A;  1UEF A;  1J0W A;  4WH4 A;  4WJ7 A;  4CSQ A;  1HE8 A;  1UD7 A;  5DI9 B;  4JWU C;  4AQ7 A;  4K2P A;  2KN5 A;  3QK0 A;  5IP4 D;  4IUM B;  3B1L X;  2IO0 B;  1TKG A;  2XQN M;  3MDB C;  2GRI A;  4IOY X;  2LHD A;  2LKO A;  1ZGU B;  3OJ4 B;  1WI0 A;  1MG8 A;  3H6N A;  3L13 A;  3PO0 A;  1E5W A;  2VSZ A;  4K7W A;  1W1G A;  3ZVR A;  2IGD A;  5HHD G;  1J19 A;  1C79 A;  1TJ6 A;  1QC6 A;  2KQS A;  2M8S A;  1BXT A;  3VUX A;  1A70 A;  2NBV A;  4MSQ B;  1PFJ A;  1MIX A;  1L0X B;  2V4I B;  5EE1 A;  3W1Y A;  1D4B A;  1DDV A;  1WJU A;  2P0D A;  4GMX B;  3DBR B;  2ZVN A;  3NG0 A;  2IYB A;  4W9L A;  4NJ6 A;  4CHK A;  1WXQ A;  2DEN B;  1V61 A;  2VZK D;  2D5G A;  2HE7 A;  5DPW A;  3DCX A;  1U5G A;  4MM3 A;  5LNK 1;  1TGZ B;  1H10 A;  3CIR B;  3ENB A;  3VDZ A;  3L10 B;  2OJW A;  2KMA A;  2WXQ A;  4RMA A;  4KHB A;  1WJ4 A;  1L5P A;  3KY9 A;  2Y5B B;  5AZG A;  3HIE A;  2WXL A;  3AV8 A;  3ZLZ A;  2KN4 A;  4NQL B;  3FKY A;  3VQI A;  4ZOH C;  2Y5C A;  2FJL A;  2GB1 A;  2LG1 A;  2KJH B;  1XF5 L;  2PLP A;  2W55 A;  3P1M A;  3UGB B;  2PIA A;  4AUQ C;  5DPS A;  1DDM A;  2Y8G A;  2DN6 A;  3EA6 A;  1TKE A;  1V1O A;  2L00 B;  1ZDV A;  1FFU A;  1NI3 A;  3VTW A;  5DPT A;  3PV1 A;  3P4S B;  2ACZ B;  3QJZ A;  2K39 A;  3AE6 B;  1ZC4 B;  5D3X A;  4S0R A;  3ZNG C;  4DX9 0;  4FBJ B;  2D9Y A;  1XOD A;  2GJY A;  3BWU D;  1U4A A;  4NAW A;  3KRW A;  2KQ7 A;  2IO3 B;  3N1Y C;  1P0R A;  2P8V A;  4EFO A;  2CJN A;  4WUR A;  4MJS B;  1FPY A;  2R61 A;  2KMM A;  3S2A A;  4L23 A;  5TR5 A;  2GBJ A;  3KSY A;  4A5K A;  1KLG D;  5DIF B;  2K00 A;  1WGQ A;  2KDF B;  3RNC C;  3SFE B;  2CQU A;  1PGX A;  3P42 A;  1JML A;  3URY A;  1GOZ A;  2KJ6 A;  3LDZ E;  5EE0 A;  3FP5 A;  1HEZ E;  2AWT A;  3MTN B;  4HPP A;  2KDB A;  4KZC A;  3SFD B;  3DBR I;  2IYD B;  3U2S C;  3V60 A;  5IKC M;  5J18 A;  1NEN B;  1V8C A;  1Q0W B;  3KZ1 A;  1SIF A;  2LXA A;  3KLS X;  1R7S A;  2KFK A;  3HRD D;  1YX6 B;  4MAC A;  3SDL C;  3DHH C;  3EC8 A;  3TO1 A;  1RRP B;  4B6H A;  1PLS A;  2L32 A;  5CHF A;  2KWD A;  3SR6 A;  2BKR B;  2KJR A;  2COC A;  2MKR A;  2YRY A;  2AYO B;  3CWI A;  1WRD B;  1LB1 A;  1TKY A;  1D5X C;  3TMP B;  4JK9 A;  1NEK B;  2X18 A;  3DVN U;  1JQ4 A;  3A4R A;  2RQ1 A;  1F52 A;  4B9K A;  1RLF A;  1T0R C;  3OHM B;  1SE2 A;  2LWP A;  1LXD A;  2MX2 A;  3OWE B;  3TFM A;  2W9N A;  2G4D B;  1KH0 A;  4KX6 B;  3VHT C;  1UPQ A;  1B1Z A;  3MC9 A;  1BAK A;  1XLO A;  3IAS 1;  2DYM A;  1NTV A;  3AM9 A;  2JX5 A;  4HLE A;  2D9W A;  2Z0O A;  4TUU A;  3SU8 X;  4GN1 A;  2ZPN A;  1V5T A;  4IOI E;  2ELB A;  3TUO A;  4JKE A;  3AEB B;  3FSS A;  2KWC A;  5G5H A;  1HZ5 A;  4KGR A;  4C4V A;  4YTM B;  3PT2 B;  1KBL A;  3EFC A;  3RMK C;  1ZM0 A;  2VKI A;  3WA0 A;  1Z5S B;  2KAN A;  3AXC A;  1BWN A;  4W9F A;  3D32 A;  1UGJ A;  5C3J B;  2L1C A;  1SBB B;  4E74 A;  3AEG B;  4GLS C;  3AB5 A;  3N7C A;  2V3S A;  2N9K A;  1J7A A;  2ON8 A;  1GC6 A;  3DVN V;  2X0S A;  3Q3N C;  1J7C A;  2KDI A;  2YT0 A;  1XX0 A;  3E9S A;  2BB6 A;  4FHJ A;  1YQB A;  2WXK A;  1I4Q A;  5D3I B;  2RSU A;  2XN9 C;  5D3W A;  2I5F A;  3H7S A;  1C4P A;  4WVF B;  1S1Q B;  1TJE A;  4IWQ A;  1TS4 A;  1FXT B;  3PVL A;  1XKE A;  3W1S C;  2BS4 B;  2WQY B;  3QIJ A;  2GBM A;  1TTN A;  1HTO A;  2R2Q A;  1K5D B;  1MG4 A;  3AEE B;  2MBE A;  2ZZP B;  1M7E A;  5BMG A;  3ULC A;  1RRB A;  1I2H A;  3V5W A;  2PJH A;  1P1A A;  4CQN A;  4F8C B;  4ANV A;  2FBW B;  4M01 A;  2O2V A;  3FEH A;  2QC8 A;  5D3Y A;  2IBI B;  5TSS A;  4MM3 B;  2JWZ A;  1AN8 A;  1M94 A;  1WG7 A;  3AEA B;  2WXR A;  3CST A;  1YD8 U;  3ZRF A;  1FCC C;  1UNS A;  2G9H D;  4MT5 A;  2KUQ A;  2KCJ A;  2IND C;  2KX0 A;  2CHZ A;  3ZTD A;  2M17 A;  1EGX A;  1WGU A;  3KVF B;  2OED A;  4ANX A;  3B2F A;  3UQB A;  5HE0 A;  1KLU D;  1ZKH A;  4PYZ A;  4ZDV A;  2GCJ A;  2OJR A;  2W2X C;  3PLV A;  3HK0 A;  4JK7 A;  3RFZ B;  4TMA B;  5I4D A;  3RNB C;  4HJK A;  2J0M A;  1D3Z A;  2PW9 A;  2LVO A;  3IG3 A;  4GSW A;  1X1M A;  2KXJ A;  3A98 B;  1NU2 A;  2LVQ A;  2BT6 A;  1QIL A;  1ZSQ A;  4FJV B;  2JQR B;  4I6N B;  4B6W A;  1JRO A;  4PYU A;  4ARI A;  3AE3 B;  2KYW A;  4HK2 A;  2LD9 A;  2MRP A;  2H89 B;  4DIX A;  3ML9 A;  1KC7 A;  2LXC A;  4QAY A;  2LJI A;  2J59 M;  2OHF A;  1KJT A;  1F0Z A;  5L83 A;  3UIP B;  5HE3 A;  1NVI D;  2K25 A;  1V1P B;  2FNJ B;  5J3Y A;  1F9J A;  4A8X C;  4KAX B;  1AQC A;  1GPX A;  4HRO A;  3P7Z A;  2EEL A;  1AAR A;  4G11 A;  2NTS A;  2I1K A;  3JSV B;  4HXD A;  4KIK B;  5IRS A;  1E10 A;  1RWS A;  5E6J A;  1DGJ A;  1PYW D;  3SBG A;  2HJ8 A;  2XK5 B;  1N5X A;  2KK8 A;  1EF5 A;  4C80 A;  3NZU A;  3N30 A;  2HTH A;  5IO9 A;  2K22 A;  3TEW A;  4P1B C;  4NNJ B;  3DVG X;  2RVB B;  2QEJ C;  2YEP F;  1JWM D;  2LYD A;  4GB9 A;  2VZK B;  1YJ1 A;  1TS3 A;  2QIL A;  1A5R A;  3P4Q B;  3Q69 A;  1TS5 A;  3NS1 A;  4BKS A;  2IY1 B;  4L1B A;  3NUH B;  2WLB A;  1RFA A;  1KOT A;  3Q2A C;  2WXJ A;  3NSU A;  1TZ1 A;  4DHZ E;  1XXG A;  1D5M C;  2O6V D;  5HE2 A;  2CS4 A;  4N9F 4;  1NYQ A;  2WXP A;  4HCP B;  3VR8 B;  2RDG A;  1NI2 A;  2WXN A;  4J6I A;  1V88 A;  1U29 A;  1WR6 E;  3WAL A;  1XR0 B;  1F77 A;  1FMA D;  3ZRC A;  2BCJ A;  2Y8F A;  3PEG A;  1TY2 A;  4AJW A;  2M38 A;  3RPF C;  5C6R A;  1UNP A;  4N6E B;  1N63 A;  3FVC A;  1M7R A;  1GGO A;  1ST7 A;  4TYZ A;  3V6C B;  1P9D U;  5JHG A;  2YT2 A;  1F2R C;  2I5C A;  4ZHP A;  2DLB A;  5HI1 A;  4H2A A;  3DHG C;  3A8Q A;  4HB0 B;  1WX7 A;  2LMC A;  1P6S A;  5J3T A;  1WGR A;  3RNA C;  3R2I A;  1P5T A;  4D6W A;  1YNT E;  3GYO A;  2N7J A;  2DNF A;  3DWM A;  3QX1 A;  3RN9 C;  3E9O A;  3G9W A;  4LDT B;  2J0J A;  2M0A A;  2WDT B;  2LI5 A;  3OLM D;  2JYE A;  4GU2 A;  2Y7B A;  2BWE S;  2DZM A;  3RYT A;  2DZK A;  2QKM A;  1TXD A;  2EMS A;  4NAM A;  1LO5 D;  1JWS D;  2AQ3 B;  5I2M A;  3LJU X;  2TSS A;  2KAC A;  2W3R A;  4P6V F;  3Q6B A;  3I9V 1;  4ILG B;  1HZ6 A;  1E8W A;  3I57 A;  3PTF C;  4M0W B;  4ZHO A;  1LFD A;  5CTR C;  5C23 A;  4F7G A;  2JP2 A;  1FIQ A;  1XCG A;  2R09 A;  4WWO A;  4KIK A;  3T3N A;  1IBX B;  4HB3 B;  1WXV A;  3A33 B;  2WWZ A;  2G35 A;  4A90 A;  5BYS A;  3O96 A;  3A9K B;  2KAJ A;  1GB1 A;  2RGN B;  2R82 A;  4GDL B;  1Q10 A;  1HXY D;  2HTM E;  5J2R A;  2GI9 A;  1DOY A;  1KFY B;  2MJD A;  2GLS A;  1WM2 A;  2INN E;  3W9C B;  3H1U A;  1SSN A;  1WFY A;  1C1Y B;  2G45 B;  1WYG A;  3H9D A;  4L1R A;  2ZNV B;  5J17 A;  1WYW B;  5CX3 A;  1WR1 A;  3CXB B;  5IAA C;  1ZVR A;  4PK1 A;  2GMI C;  1MKE A;  3GB1 A;  2KTF A;  1OGW A;  3ZYY X;  3MC0 B;  2AX5 A;  1XLQ A;  1FEH A;  4KGS A;  2V4L A;  3PPA A;  4K3B A;  1L4D B;  1EVH A;  4JL9 A;  3SYX A;  3ZQ4 A;  1DBH A;  3FC4 A;  2LGS A;  2I2Y A;  1Z2M A;  2W82 A;  4AJY B;  4YXD B;  1EUV B;  2V1Y A;  4EKU A;  2Z0P A;  2ZJD A;  2M14 A;  1E9M A;  1WGY A;  5D6J B;  2CU1 A;  1KZ7 A;  1XEE A;  2G1E A;  4BBN C;  3KYC D;  1CMX B;  2KGX B;  3N1Z C;  4K7U A;  4IAP A;  2MP2 A;  3NVZ A;  4II2 B;  2N23 A;  4BKG A;  2PPH A;  1YN3 A;  3HW2 B;  4JKF A;  1OQY A;  4US8 A;  3MFG A;  1ZW7 A;  3KRX A;  2N1V A;  4S17 A;  2H7E A;  2YLM A;  2WDV B;  4JK8 A;  1LW3 A;  3X0W A;  1T0Q C;  3IT4 B;  1Y8R C;  4LDT D;  4IDI A;  2IDY A;  3RD2 A;  2Z0Q A;  1FD6 A;  4C7Y A;  1T3Q A;  2E3T A;  4DBB A;  2KC1 A;  2DX5 B;  2DWQ A;  1FXI A; 
#chains in the Genus database with same CATH homology
 1E7U A;  2DZI A;  3WAO A;  1IP9 A;  2D9X A;  3HM3 A;  2MQJ A;  1OY2 A;  2D10 A;  4KSK C;  2MDX A;  4NQK E;  5JHB A;  1X1G A;  2D9Z A;  3N32 A;  5KHQ A;  1N3H A;  4WQO B;  1C3T A;  1MPH A;  3VH4 B;  4JKB A;  3EEC A;  4DHJ B;  1W1D A;  1MAI A;  4WJP A;  4NY0 A;  1UPR A;  5CLL B;  5AZF A;  2FCS A;  4PQ0 A;  1EAZ A;  4ILH A;  4NAW B;  3H7P A;  4JKG A;  3WIM A;  3ZKJ C;  5JLJ B;  4AOF A;  4GGQ A;  2ABD A;  3RZF A;  3V61 A;  1WX8 A;  5CHW A;  3P2B A;  5JHA A;  5KCV A;  3T8M A;  1KM7 A;  3KH0 A;  2W2W A;  3VFK A;  1I7A A;  4NPN A;  3TCA A;  2JZZ A;  2G4S A;  1V81 A;  2GBK A;  2Z59 B;  2DLW A;  3V6E B;  1UEL A;  3PHX B;  4XWX A;  1XD3 B;  1SE9 A;  2ADZ A;  4IWO A;  1WJ6 A;  2FIF A;  4PS8 A;  3B0A A;  2CY4 A;  3DCG A;  4ANW A;  2UYZ B;  1FGY A;  2QHO A;  3B08 A;  2LAS A;  2C60 A;  3PS6 A;  4HCN B;  3WYF B;  4MH0 E;  1VD2 A;  3PHW B;  3ODO A;  4E3C A;  2A5U A;  4IC7 B;  2KLC A;  2NS5 A;  3ZNI D;  1RJ2 A;  2O2V B;  4W9J A;  5E6P A;  1EO6 A;  4NJ7 A;  5HE1 A;  2M0X A;  3P6A A;  3KUZ A;  1V6E A;  2RLO A;  2PEA A;  2UVM A;  5C5B A;  4EUT A;  4FJZ A;  4JKH A;  4RM9 A;  3TW1 A;  3CF6 E;  4KHA A;  1LM8 B;  1V49 A;  4HAU B;  2GBR A;  5JVL A;  4Z2N A;  4EEW A;  1FHW A;  4IFS A;  1IPG A;  2COA A;  4GZU A;  2DKQ A;  2CHX A;  1E90 A;  3SO6 A;  2L3Z A;  3E9L A;  2LUL A;  1UH6 A;  1JRU A;  4DWF A;  1NDD A;  2NMB A;  2N0Y A;  2DHJ A;  2WYQ A;  2KO3 A;  3L16 A;  1H8C A;  1GC7 A;  2E2X A;  4AP4 C;  2YT1 A;  3UZT A;  1TQZ A;  1V89 A;  2BPS A;  3QAQ A;  4KHB B;  5LXH A;  2OTX A;  1OEY J;  2YS3 A;  1E7V A;  1K8R B;  3PG7 A;  4A6H A;  2Q13 A;  1WGG A;  2DAJ A;  1NBF C;  5J3Q A;  1E8Y A;  4XC2 A;  5EDS A;  4EOY A;  4EZL A;  3A8P A;  3QWZ B;  5E6N A;  5IJM A;  5D7G A;  3ODW A;  3ZDM C;  3F0W A;  2RSG A;  2JZ3 B;  3APD A;  4TQ0 A;  3GZN I;  4GDL A;  2MCN B;  2HD5 B;  2N9E B;  2QKL A;  2KD0 A;  4OVV A;  1FHX A;  2VRR B;  4BBN F;  2L2I A;  1WY8 A;  4G3X B;  3VH3 B;  2KNB A;  3C0R B;  3DXC A;  2JY6 A;  4K7S A;  2PE6 B;  3JVZ X;  3ULB A;  3A9K A;  1SHC A;  4JLC A;  3VAW A;  3AI5 A;  1X05 A;  3NY5 A;  4KDL B;  1FGZ A;  3E66 A;  4WWN A;  4JKG B;  3ENE A;  3QWM A;  4HPM B;  4K2O A;  1BTK A;  1V5O A;  4W9C A;  4DXA B;  1U27 A;  1L7Y A;  1XD4 A;  2ELA A;  3DXE A;  2BF8 B;  3CIK A;  1KI1 B;  1UGM A;  4W9I A;  3PZD A;  2DYN A;  2LGY A;  2ZCC A;  1DRO A;  2M4N A;  4ZRK A;  4HB2 B;  1JDE A;  2FCQ A;  1FB8 A;  2PZ1 A;  1R4N I;  4K17 A;  1P3Q U;  2Z0D B;  3SV1 A;  3MHS D;  3DOW A;  1WE7 A;  3DBH I;  4DX8 A;  3M3J A;  3JSV A;  3M62 B;  2KFJ A;  5GMV A;  3DBS A;  1NVL A;  2WX1 A;  3QCA A;  4JQW C;  1L2N A;  4AWJ A;  4EZJ A;  3R3M A;  2YF0 A;  2C9W B;  4HAV B;  2DTC A;  3L08 A;  2KUP A;  1TBE A;  3NS8 A;  4BKT A;  4FHK A;  3A9J A;  2YSZ A;  3PSE B;  2RR9 A;  2IZV B;  3D8F A;  4EZK A;  2LOX A;  3BY4 B;  2JF5 A;  2JT4 B;  1B55 A;  1OMW A;  3TL5 A;  3SBT A;  5LON B;  4KDI C;  4ANU A;  3Q3F A;  2KDE B;  4W9G A;  2L76 A;  3FM8 C;  4IM0 A;  1XT9 B;  3HIZ A;  5LXI B;  1Q1O A;  2CB8 A;  2CAY A;  4CO7 A;  2L8J A;  4BFR A;  4TQ1 A;  5C1Z A;  4MGK E;  5L81 A;  4FUL A;  2RD0 A;  4Y94 A;  1E8X A;  3DXD A;  3QC8 B;  2XK5 A;  3DQV A;  3PVW A;  5DPR A;  3MJW A;  1SGH A;  3BIN A;  1J8C A;  4KV2 A;  4W9D A;  2KC2 A;  2I1J A;  3K9O B;  1W1H A;  2KX3 A;  4WJQ A;  5GOW B;  3ZNZ B;  5L95 C;  2DX5 A;  2RGF A;  5DHF B;  1X1F A;  2MP2 B;  3VUY A;  4HAW B;  3T06 A;  1S3S G;  2LGD A;  4F7U P;  4NSW A;  4PNK A;  4L6E A;  2O6V B;  4A6F A;  4K1R B;  1GG3 A;  2DX1 A;  4HPL B;  3EPY A;  4FN2 A;  1Z87 A;  1BTN A;  2DYQ A;  1UBQ A;  3RUL A;  2MBB B;  2YS5 A;  2MFQ A;  4E71 A;  3JYU A;  5G2N A;  5KHO A;  2BYV E;  1WXA A;  2AEH A;  1WX9 A;  1X86 A;  1DDW A;  1E8Z A;  1ACA A;  2L0F A;  1MIZ B;  4DK5 A;  3ODX A;  3SD5 A;  2MWN B;  4X57 B;  2J7Q B;  1WZ0 A;  1UZX B;  1U5D A;  2DZJ A;  4URK A;  2OQB A;  2WX0 A;  3TVV A;  2MBQ A;  3DVG Y;  4YON A;  4FJY A;  2ROV A;  2N7D A;  3PLU A;  2DHI A;  2D3G A;  2MLB A;  3A9J B;  1NTY A;  1HB8 A;  2NCN A;  4B95 A;  4IW0 A;  2FJ9 A;  4KSL C;  4HDO A;  3VTV A;  4ILJ A;  3DBL I;  1PMS A;  5C79 A;  2FDQ A;  3ML4 A;  2LZ6 A;  4DDI D;  3L54 A;  2FCN A;  1GJZ A;  3VTU A;  5EFX A;  2XEW A;  2NR2 A;  2EJ8 A;  3Q3J A;  4I6P A;  4DHZ B;  4MGY E;  4M8N A;  4HAT B;  2FCM A;  2HRJ A;  1WM3 A;  3R7R A;  4KVG B;  4ZRJ A;  1GUA B;  5D27 A;  2LUE A;  4G50 A;  3QAR A;  3PRM B;  2IY0 B;  4CHM A;  5D2M B;  1LQB A;  1WJN A;  3ZIM A;  3CSF A;  2Z0E B;  2LVP A;  4BOZ B;  3N3K B;  5IA7 A;  1WH3 A;  3PRP B;  1WE6 A;  1WZ3 A;  1ZC3 B;  3AUL A;  2JXX A;  1P3R A;  3VOQ A;  3K9P B;  2B3A A;  2COD A;  3KYD D;  2UWQ A;  4C0A A;  4ASW C;  4CYE A;  3VUW A;  4BOS C;  5JH5 C;  3W1S A;  1KZG A;  3ONS A;  3NHE B;  4BBK A;  4MJS A;  1V2Y A;  1WI1 A;  2CR5 A;  3M95 A;  3R7Q A;  3ZUN A;  5C5B B;  3DPD A;  2W2X D;  4IWP A;  5JZE B;  3IHP C;  4EJN A;  4DHJ D;  4IM3 A;  3WAN A;  2ZNV C;  4JKA A;  2XBB C;  5AZH A;  1HB6 A;  3BJI A;  2EC1 A;  2LJ5 A;  1I42 A;  1V86 A;  1FOE A;  4MT7 A;  1YX5 B;  4MY6 A;  2O6V A;  5DHA B;  1U5E A;  3O65 B;  3RZW C;  2V76 A;  2N9P C;  2JRI B;  1V80 A;  1EF1 A;  2KMC A;  3WAP A;  4FLH A;  2NBW B;  5CLQ B;  4WSF A;  2IO1 B;  3OJ3 A;  2JPH A;  4P7I A;  2DFK A;  2MBO A;  2KLG A;  3AU5 A;  2JVC A;  2NPT A;  2LOZ A;  2K2J A;  4MEM A;  1HBK A;  5FI0 A;  1OTR B;  3NZS A;  4FA6 A;  5G55 A;  2KZR A;  4HAY B;  3VXW A;  1Y5O A;  4MDK E;  1UNQ A;  3LJ3 A;  2DIK A;  1R4M I;  3U7D A;  2NBU A;  2G3Q B;  1FHO A;  3GOE A;  2JRH A;  3ZDT A;  5KQ4 A;  1QZE A;  1WXS A;  2BGF A;  3QBV B;  2R2O A;  3ZTC A;  5D94 A;  3IFW B;  4BKS D;  1OEY A;  1WVH A;  1DIK A;  1V5U A;  4PS3 A;  3TIX A;  2KHW B;  3M1I B;  4HWI B;  3AU4 A;  2CRF A;  1WGD A;  5AEK B;  2CHW A;  2REX A;  4GDK B;  4KHO A;  4F7H A;  1VBG A;  1MK9 B;  4TKN A;  1KLV A;  2ROZ B;  3KW5 B;  3A1Q B;  4MGZ E;  2IFS A;  1H4R A;  3GYP A;  2AL3 A;  3UF8 A;  4WJN A;  2GCL A;  1YIW A;  1MK7 B;  2K6Q A;  4YL8 A;  1ISN A;  4WWP A;  3D8E A;  4A3O A;  3DDC B;  2K8B A;  2BWF A;  2EKE C;  2FAZ A;  2N1W A;  4XX5 A;  2KWV B;  1Q5W B;  3RCZ A;  3SNH A;  1PQS A;  4LCD E;  3EFU A;  4GXB A;  2L0T A;  2YVC A;  4XZ4 A;  3QQ8 B;  1X11 A;  3U30 A;  2N4F A;  4I6L B;  5FR6 A;  4OVU A;  4HHV A;  3PVU A;  4MSM B;  1VBH A;  3IBE A;  1WF9 A;  3H7P B;  2N9X A;  2DHK A;  3A4S C;  2ZPY A;  2LRW A;  4HDQ A;  3HM6 X;  5C16 A;  5E6O A;  1P98 A;  1UNR A;  1FAO A;  2C5L C;  1AWE A;  2BYE A;  2MBH A;  2LGX A;  3RCP A;  1G6J A;  2P0H A;  1J0G A;  3ML8 A;  4PS7 A;  2OOB B;  4MK0 A;  4DDG D;  2NVU I;  2ZVO A;  4TV3 A;  4MEL A;  1WJ1 A;  1WGH A;  2R0D A;  3VIA A;  1IRS A;  2K2U A;  2K1F A;  3TJP A;  5BO4 B;  4G0N B;  3D8D A;  4II3 B;  3RT3 B;  4H8S A;  3UIN B;  3F5R A;  4D0N B;  3PSC A;  2KTR B;  3APC A;  2KFK B;  2RUK B;  3PRZ A;  4Z2M B;  4F7Z A;  3V62 A;  3ZO5 B;  4GPT B;  3SUZ A;  2MWS B;  4A20 A;  4HB4 B;  4A6K A;  2IO2 B;  2UZS A;  2L05 A;  2YS1 A;  1WXM A;  3ECI A;  1GNU A;  5LOP B;  4GDK A;  1WIA A;  2KWU B;  1U2B A;  1WJM A;  4ICV A;  4KZ0 A;  1T0Y A;  2GBN A;  3JW0 X;  2NBV B;  2CKH B;  2EMT A;  1BT0 A;  1IYF A;  5HKH A;  3U8Z A;  3AJ4 A;  4JKC A;  2COP A;  2HTH B;  2D4Q A;  2K6D B;  1NTI A;  4FAD A;  4W9E A;  3FLV A;  2C7N B;  4LJO B;  1RAX A;  2GOW A;  3CMM B;  3EHV A;  2WH5 A;  4EMO A;  1WMH B;  3NOB A;  3OAW A;  2KTR A;  1I35 A;  1XQQ A;  3UQA A;  4K81 A;  2VRW B;  2KOX A;  4A6F B;  4ICU A;  1V5P A;  1Q67 A;  2UZR A;  2DYO A;  2KKC A;  2PE9 A;  2C7H A;  2H7D A;  5LLI A;  3I3T B;  2BYF A;  2KVR A;  5FI1 A;  2J0K A;  2BKF A;  3APF A;  1WMH A;  3WAM A;  2MW5 A;  3IVF A;  2C7M B;  3QA8 A;  2RNR B;  4GIV A;  4W9H A;  1V5M A;  2ZCB A;  1VCB A;  5JHH A;  3E9P A;  3PP2 A;  2DYB A;  4ZRI A;  2D2Q A;  4LJP B;  3HQC A;  4GOC A;  2AL6 A;  4JIO U;  3ALB A;  2L7R A;  3UIO B;  4M8M A;  5D3V A;  3ZVV A;  4DBG A;  2D9V A;  3MPX A;  3OAN A;  3L17 A;  2DA0 A;  2FID A;  4JGH B;  4A3P A;  2DHZ A;  3ZNH B;  4BVU C;  2MA9 B;  4IG7 B;  2GS0 A;  4ZYN A;  2D11 A;  2MSE D;  3VVW B;  2NPT B;  3SHQ A;  2K8H A;  1QQG A;  3RUI B;  4RM8 A;  3M63 B;  1U5F A;  3KUC B;  1DYN A;  2P0F A;  3HHM A;  1Y19 B;  4WJO A;  2FUH B;  4WAA A;  4W9K A;  4F1S A;  2CY5 A;  5DCN A;  2LBB A;  4MGI E;  1OQN A;  3T9L A;  4HAZ B;  4IM2 A;  3A1Q A;  3QHT A;  5KQ1 A;  2LRU A;  3L0W B;  5CHV C;  3X23 A;  2NZ8 B;  2DAF A;  2RPQ A;  2K8C A;  1K5G B;  4GMV A;  2ZEQ A;  3TBL D;  2D07 B;  5JP4 A;  2N7E A;  4CHJ A;  3PRE A;  3PGE A;  3R66 C;  4HAX B;  2A4Z A;  3ZW3 A;  2JUO A;  2M1M A;  4HVB A;  4JKD A;  3KUD B;  5DH9 B;  2ASQ A;  2COF A;  1V9J A;  2DKP A;  1UBI A;  1UEF A;  1J0W A;  4WJ7 A;  1HE8 A;  1UD7 A;  5DI9 B;  4K2P A;  2KN5 A;  3QK0 A;  4IUM B;  3B1L X;  2IO0 B;  2XQN M;  3MDB C;  4IOY X;  2LKO A;  1ZGU B;  3OJ4 B;  1WI0 A;  1MG8 A;  3H6N A;  3L13 A;  1E5W A;  2VSZ A;  4K7W A;  1W1G A;  3ZVR A;  1J19 A;  1TJ6 A;  1QC6 A;  2KQS A;  2M8S A;  3VUX A;  4MSQ B;  1PFJ A;  1MIX A;  3W1Y A;  1DDV A;  1WJU A;  2P0D A;  4GMX B;  2ZVN A;  2IYB A;  4W9L A;  4NJ6 A;  4CHK A;  2DEN B;  1V61 A;  5DPW A;  2HE7 A;  1U5G A;  4MM3 A;  1TGZ B;  1H10 A;  3ENB A;  3VDZ A;  3L10 B;  2KMA A;  4RMA A;  1WJ4 A;  3KY9 A;  2Y5B B;  5AZG A;  3ZLZ A;  4NQL B;  3VQI A;  2FJL A;  2LG1 A;  2KJH B;  3UGB B;  4AUQ C;  5DPS A;  1DDM A;  2Y8G A;  2DN6 A;  2L00 B;  3VTW A;  5DPT A;  3PV1 A;  3QJZ A;  2K39 A;  1ZC4 B;  5D3X A;  3ZNG C;  4DX9 0;  4FBJ B;  2D9Y A;  1XOD A;  2GJY A;  1U4A A;  4NAW A;  3KRW A;  2KQ7 A;  2IO3 B;  1P0R A;  2P8V A;  4EFO A;  4MJS B;  3S2A A;  5TR5 A;  2GBJ A;  3KSY A;  4A5K A;  5DIF B;  2K00 A;  1WGQ A;  2KDF B;  2CQU A;  2KJ6 A;  3LDZ E;  3FP5 A;  2AWT A;  3MTN B;  2KDB A;  4KZC A;  3DBR I;  2IYD B;  3V60 A;  5J18 A;  1Q0W B;  3KZ1 A;  1SIF A;  2LXA A;  2KFK A;  1YX6 B;  3SDL C;  3EC8 A;  3TO1 A;  1RRP B;  4B6H A;  1PLS A;  5CHF A;  2BKR B;  2KJR A;  2COC A;  2MKR A;  2YRY A;  2AYO B;  1WRD B;  1LB1 A;  3TMP B;  4JK9 A;  2X18 A;  3DVN U;  3A4R A;  2RQ1 A;  4B9K A;  1RLF A;  2LWP A;  1LXD A;  2MX2 A;  3TFM A;  2W9N A;  2G4D B;  3VHT C;  1UPQ A;  1BAK A;  2DYM A;  1NTV A;  4HLE A;  2D9W A;  2Z0O A;  4TUU A;  3SU8 X;  4GN1 A;  2ZPN A;  1V5T A;  2ELB A;  4JKE A;  3FSS A;  2KWC A;  3PT2 B;  1KBL A;  1ZM0 A;  2VKI A;  3WA0 A;  1Z5S B;  2KAN A;  3AXC A;  1BWN A;  4W9F A;  3D32 A;  2L1C A;  4E74 A;  3N7C A;  2V3S A;  1GC6 A;  3DVN V;  2X0S A;  2KDI A;  2YT0 A;  1XX0 A;  4FHJ A;  1YQB A;  2RSU A;  5D3W A;  2I5F A;  3H7S A;  4WVF B;  1S1Q B;  4IWQ A;  1FXT B;  3PVL A;  1XKE A;  3W1S C;  3QIJ A;  2GBM A;  1TTN A;  2R2Q A;  1K5D B;  2MBE A;  2ZZP B;  1M7E A;  3ULC A;  1RRB A;  1I2H A;  3V5W A;  2PJH A;  1P1A A;  4F8C B;  4ANV A;  2O2V A;  3FEH A;  5D3Y A;  2IBI B;  2JWZ A;  1M94 A;  1WG7 A;  3CST A;  1YD8 U;  3ZRF A;  2KCJ A;  2CHZ A;  2KX0 A;  3ZTD A;  2M17 A;  1EGX A;  1WGU A;  3KVF B;  4ANX A;  3UQB A;  5HE0 A;  1ZKH A;  4PYZ A;  4ZDV A;  2GCJ A;  2OJR A;  2W2X C;  3PLV A;  3HK0 A;  4JK7 A;  1D3Z A;  4HJK A;  2J0M A;  2LVO A;  3IG3 A;  4GSW A;  1X1M A;  2KXJ A;  3A98 B;  1NU2 A;  2LVQ A;  1ZSQ A;  4FJV B;  4I6N B;  4B6W A;  4PYU A;  4HK2 A;  2LD9 A;  2MRP A;  3ML9 A;  1KC7 A;  2LXC A;  2J59 M;  1KJT A;  5L83 A;  3UIP B;  5HE3 A;  2K25 A;  2FNJ B;  5J3Y A;  1F9J A;  4KAX B;  1AQC A;  3P7Z A;  1AAR A;  4G11 A;  2I1K A;  3JSV B;  4HXD A;  4KIK B;  3SBG A;  2HJ8 A;  2XK5 B;  2KK8 A;  1EF5 A;  3NZU A;  3N30 A;  2HTH A;  4NNJ B;  3DVG X;  2RVB B;  2LYD A;  4GB9 A;  1YJ1 A;  1A5R A;  4BKS A;  2IY1 B;  1RFA A;  1KOT A;  3NSU A;  1TZ1 A;  4DHZ E;  2O6V D;  5HE2 A;  2CS4 A;  4N9F 4;  4HCP B;  1NI2 A;  4J6I A;  1V88 A;  1U29 A;  1WR6 E;  3WAL A;  1XR0 B;  3ZRC A;  2BCJ A;  2Y8F A;  3PEG A;  4AJW A;  2M38 A;  5C6R A;  1UNP A;  1M7R A;  1GGO A;  1ST7 A;  4TYZ A;  3V6C B;  1P9D U;  5JHG A;  2I5C A;  3A8Q A;  4HB0 B;  1WX7 A;  1P6S A;  5J3T A;  1WGR A;  1P5T A;  3QX1 A;  3GYO A;  3E9O A;  3G9W A;  4LDT B;  2J0J A;  2WDT B;  2LI5 A;  3OLM D;  4GU2 A;  2Y7B A;  2BWE S;  2DZM A;  3RYT A;  2DZK A;  2QKM A;  1TXD A;  2EMS A;  3LJU X;  4ILG B;  1E8W A;  3PTF C;  4M0W B;  1LFD A;  5CTR C;  5C23 A;  4F7G A;  2JP2 A;  1XCG A;  2R09 A;  4WWO A;  4KIK A;  4HB3 B;  1WXV A;  3A33 B;  2WWZ A;  2G35 A;  3O96 A;  3A9K B;  2RGN B;  2R82 A;  4GDL B;  5J2R A;  1WM2 A;  3H1U A;  1WFY A;  1C1Y B;  2G45 B;  3H9D A;  2ZNV B;  5J17 A;  1WYW B;  5CX3 A;  1WR1 A;  3CXB B;  5IAA C;  1ZVR A;  2GMI C;  1MKE A;  2KTF A;  1OGW A;  2V4L A;  3PPA A;  1EVH A;  4JL9 A;  3SYX A;  1DBH A;  1Z2M A;  4AJY B;  1EUV B;  2V1Y A;  4EKU A;  2Z0P A;  2ZJD A;  2M14 A;  1WGY A;  5D6J B;  2CU1 A;  1KZ7 A;  4BBN C;  3KYC D;  1CMX B;  2KGX B;  4K7U A;  4IAP A;  2MP2 A;  4II2 B;  2N23 A;  4BKG A;  2PPH A;  3HW2 B;  4JKF A;  1OQY A;  1ZW7 A;  3KRX A;  2N1V A;  2H7E A;  2YLM A;  4JK8 A;  1LW3 A;  3X0W A;  1Y8R C;  4LDT D;  3RD2 A;  2Z0Q A;  4DBB A;  2KC1 A;  2DX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...