4ZRIA

Crystal structure of merlin-ferm and lats2
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
293
structure length
293
Chain Sequence
KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Angiomotin binding-induced activation of Merlin/NF2 in the Hippo pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/transferase
molecule keywords Merlin
total genus 87
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4zriA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4zriA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zriA01
3DBSA 4BVUC 3PREA 2G4DB 1WXSA 2M14A 3I3TB 3QC8B 1TQZA 2KCJA 2YS5A 1WGYA 3QHTA 4FJZA 4JGHB 2N7DA 4IM2A 2KTFA 4EMOA 3OJ3A 1ZGUB 4GN1A 3NSUA 2K2JA 2KQ7A 2Y8FA 4DX90 4HK2A 2RGNB 4B6WA 3ALBA 3OAWA 4MDKE 2KHWB 4B95A 1NI2A 2P0HA 2LXCA 1OQNA 3LJ3A 2CB8A 2DLWA 5LOPB 2KVRA 2MWSB 3SO6A 3DXEA 4DXAB 2N1WA 1HB8A 2CHWA 2KNBA 4W9EA 3UINB 1E90A 1VD2A 1WE7A 2BCJA 1GNUA 4KDIC 1V49A 2DHKA 2OJRA 1B55A 2KUPA 3A1QA 3ODOA 5C16A 4GGQA 4MSQB 5AZHA 4DBGA 3L0WB 3V5WA 3PGEA 1GG3A 1WGQA 1EVHA 2WH5A 2DHIA 4K17A 1K8RB 3A9JA 1XD4A 2M8SA 4NAWA 5L83A 4MT7A 4FJYA 2FJ9A 4HVBA 3H1UA 4TQ0A 3UQBA 2RSUA 2Q13A 2DZIA 1V81A 2HD5B 3H9DA 2BWFA 5D27A 2CY5A 2MBQA 1Z5SB 3KW5B 5DCNA 1P3RA 2ELBA 4A20A 2DX5B 3HHMA 1PLSA 1DBHA 2IFSA 2KJRA 3DBLI 1X1GA 2YVCA 3ZIMA 4WJPA 4PYZA 4HJKA 2K2UA 2R09A 3HK0A 4A6KA 4DX8A 1EGXA 2GMIC 2ZPNA 4TUUA 2KANA 5D94A 1J8CA 1WRDB 1ACAA 1MK9B 2RNRB 1Q1OA 1V5MA 2VKIA 2IYBA 4CHMA 4W9HA 4F7GA 5JHBA 3ZO5B 2X18A 4E3CA 1OMWA 3R7RA 4BKSA 4HAZB 4A5KA 2LD9A 4LDTD 3ZNHB 1E8ZA 2DENB 4YL8A 3A8PA 2K6QA 1PQSA 2HTHB 2WYQA 1WGRA 3D8EA 1WJ1A 2ZEQA 1UPQA 3JSVB 3QK0A 4WWOA 5C23A 4NPNA 4FULA 2MQJA 2KK8A 4HAUB 2GJYA 2LYDA 3A8QA 2KFKA 2RQ1A 5KHOA 2BYVE 5AZFA 3DVGY 1WJNA 2LVQA 2DHZA 5DPRA 4MEMA 4PS8A 3RUIB 1MIZB 2W2XC 1TZ1A 2DKPA 3WA0A 2D9ZA 2MLBA 4JIOU 2FIDA 4ZYNA 4AP4C 3P7ZA 2IYDB 1KI1B 3KRWA 1UELA 3CF6E 3GYPA 2COFA 2J0KA 1E5WA 5KQ4A 2LRUA 1GC7A 2PJHA 2NZ8B 4F7UP 3KYCD 3DVGX 5C5BB 4AWJA 3VHTC 1GC6A 1WGUA 2RSGA 2KX3A 2REXA 1E8WA 3VIAA 2JZ3B 3A9KA 3TFMA 3PPAA 2CKHB 1T0YA 3KSYA 4W9IA 1Q5WB 2DYMA 1RRPB 3VUXA 4IWPA 4EFOA 3H6NA 2AWTA 1U27A 2EJ8A 2L0FA 4IAPA 1QZEA 3ENEA 4RM8A 1ZW7A 1M94A 3P6AA 2J7QB 4LCDE 4W9JA 5J3QA 3UGBB 5J17A 5KCVA 2R0DA 1WX9A 3SYXA 3BY4B 2KQSA 2QKLA 1MKEA 3APFA 1V88A 5JLJB 3R3MA 5CLQB 3DVNU 3ML4A 3PTFC 3PG7A 5DH9B 1GUAB 1L7YA 1LXDA 5CLLB 2K25A 4HWIB 4I6NB 3EFUA 4KSKC 4M0WB 3ZKJC 3PZDA 3X0WA 4HHVA 2LULA 4KIKB 5C1ZA 3ODWA 4GMVA 2LXAA 2XEWA 2HJ8A 3RYTA 3ZVVA 3ZVRA 1BTKA 5HE3A 2RLOA 2ROVA 2YF0A 2LGXA 2C7NB 3VTVA 2BPSA 2O2VA 3MDBC 3AU5A 3F5RA 2MBBB 4F8CB 2LBBA 3X23A 4HB2B 3PEGA 1EF5A 1WF9A 1P6SA 2KXJA 2MW5A 2G3QB 1FGZA 4KAXB 2O2VB 3QCAA 4NQLB 1K5DB 2EMSA 2DTCA 2HRJA 2N4FA 2FIFA 4KSLC 2COCA 2WX1A 1BAKA 1MG8A 3DDCB 3Q3FA 4BKSD 4ZDVA 1ZM0A 4K7UA 4P7IA 4ZRIA 2IO3B 3IHPC 4ANXA 5C5BA 3HM3A 3MPXA 1RAXA 3WAPA 3WIMA 1V2YA 4WWNA 4DHJB 4I6LB 3VFKA 2YS3A 1FXTB 1WR1A 4HAWB 5DPTA 2XK5B 4M8NA 2L3ZA 2CODA 2Z0DB 3QWMA 1IYFA 4C0AA 2M1MA 3L10B 1DDMA 2P0FA 2CHZA 2XBBC 2KJHB 3ODXA 3VH3B 2ZVOA 4MELA 4BOSC 1Q67A 1AWEA 3PS6A 4XWXA 1RFAA 1UGMA 1UNRA 2C60A 2DYBA 4IW0A 4MK0A 1NTVA 3FM8C 5GOWB 4PS3A 4LJOB 5EFXA 4EJNA 2BWES 1ST7A 4GXBA 4II3B 4HAVB 1OTRB 1U5EA 2H7DA 1P98A 4B6HA 1WMHB 1UBIA 2GBKA 2LZ6A 4KZ0A 2KFJA 5FI1A 2KO3A 5HKHA 5JH5C 3KYDD 2O6VA 3SNHA 1NDDA 2MBOA 1NTYA 3WAMA 3RCZA 4TKNA 3UIPB 4ANWA 2KN5A 4NY0A 3RT3B 1U4AA 1UZXB 2RVBB 3A9JB 1ZSQA 2RUKB 3NOBA 4GOCA 4NAWB 1U2BA 1L2NA 4DDGD 2MP2A 2QHOA 2FCQA 5LXHA 2G4SA 2NBUA 2L1CA 4NJ7A 2UYZB 5J3YA 3L17A 3FSSA 4WJQA 4A6FB 2LUEA 3AXCA 1U5FA 2GCLA 4HPLB 2C9WB 4MGZE 1WH3A 4TV3A 1WYWB 4ICVA 4MGKE 2OTXA 3F0WA 3W1YA 1MK7B 2KTRB 3QA8A 4HXDA 3PVUA 2D07B 2YS1A 4GPTB 3G9WA 3KRXA 2KWVB 3KUDB 4G3XB 2ELAA 3GYOA 3ULBA 3TO1A 2XK5A 2DN6A 2LGDA 4RM9A 3VVWB 3WANA 4WSFA 1Y8RC 2COPA 1VCBA 4KDLB 5IAAC 2D9WA 4M8MA 1WX7A 1SGHA 3DBRI 3O96A 4JLCA 5G2NA 4FLHA 2WDTB 1V86A 1WM2A 1I7AA 1U5DA 1YQBA 2AL3A 2GBJA 2YLMA 4KIKA 1GJZA 1X1FA 2M38A 3ZUNA 2RGFA 2J59M 4W9CA 4FJVB 1XODA 5DPSA 4K1RB 1WGDA 1BWNA 2DX1A 1ZC3B 1V5OA 2DAJA 3OLMD 2K00A 1WXAA 1YX5B 2CU1A 2R2QA 4RMAA 4W9FA 5D7GA 1XT9B 3RZFA 4BFRA 4MJSA 4EKUA 1NBFC 2ZNVC 4GDKA 2PPHA 4NJ6A 5DHAB 3M3JA 1W1HA 3HQCA 3IG3A 3QAQA 3PLVA 1WGHA 2PE6B 1EUVB 3HW2B 2Z0QA 3CSFA 2LRWA 4IWOA 1A5RA 1WI1A 5L81A 2FUHB 2IO1B 2ZZPB 1WG7A 3R66C 1H10A 3NZSA 2D4QA 4CHJA 3D32A 4JL9A 3SHQA 4EZLA 2UWQA 3VH4B 3A98B 4E74A 3C0RB 3R7QA 2G35A 4AJYB 1WY8A 2A4ZA 1WJ4A 2W9NA 4G50A 3UZTA 4I6PA 4CYEA 2O6VD 1FAOA 4H8SA 3OANA 3VQIA 4FADA 4DHZE 2I1KA 3TL5A 2D3GA 2VRWB 2NPTB 1WR6E 3H7PB 4A3OA 5J18A 1OEYA 5TR5A 2DFKA 4K7WA 3V6CB 2GBMA 3NS8A 2Y7BA 3M62B 5DPWA 3T06A 2ROZB 2NCNA 5G55A 2KKCA 2RR9A 5KHQA 1J19A 1RLFA 3O65B 3RZWC 5DIFB 2MSED 2DKQA 4YONA 2CY4A 3K9PB 2KWCA 3A1QB 4K81A 1DROA 2BF8B 2IBIB 1H8CA 4PQ0A 5CTRC 1X86A 3PVLA 3A4RA 1H4RA 1WFYA 2LWPA 4MY6A 2NBVB 3H7SA 2D11A 2LASA 4GZUA 4KZCA 4IFSA 3WAOA 1FGYA 2KWUB 5AZGA 2EC1A 1TTNA 3FLVA 3QBVB 2UVMA 2L00B 2J0MA 2CQUA 1V61A 3ZNZB 1FHWA 1HE8A 3FEHA 4Z2MB 3N30A 3MTNB 3CIKA 3W1SC 3EPYA 1J0WA 3K9OB 2KDFB 4W9DA 2Z0EB 2V4LA 4FHKA 4FN2A 3DBHI 1F9JA 2KMCA 2KGXB 1E8YA 1V5PA 1BTNA 3FP5A 1I2HA 2J0JA 4KHOA 1LFDA 3BJIA 3U8ZA 1LM8B 2C5LC 4BKTA 5AEKB 2XQNM 2NR2A 2H7EA 2WWZA 2KX0A 3KZ1A 2DHJA 2JF5A 2W2XD 1C3TA 4LJPB 1TXDA 2DYNA 1Q0WB 2ABDA 5D3XA 3WYFB 1UBQA 1AARA 1YJ1A 2LVPA 3JVZX 3PT2B 4MSMB 1WJMA 5D3VA 1ZC4B 2B3AA 4TQ1A 3TBLD 1P0RA 4HB4B 5LONB 2K8BA 2MX2A 2KDEB 2RD0A 4X57B 4URKA 3EC8A 1OY2A 1NU2A 3CMMB 4NQKE 3GZNI 2YRYA 2BKFA 1WZ0A 4GMXB 1S3SG 3PSCA 3P2BA 3L13A 1HBKA 2GS0A 3TVVA 4BBKA 1P9DU 3KUCB 2C7MB 3NY5A 2COAA 1UD7A 1DDWA 2LVOA 1XR0B 2K39A 2OOBB 3V61A 2JXXA 1SHCA 3LJUX 4Y94A 3M1IB 3PV1A 1IP9A 4MJSB 1E8XA 2KMAA 4HATB 3SV1A 1MAIA 1WE6A 4A6HA 1I35A 2C7HA 2GOWA 1V80A 1WGGA 1V6EA 3M95A 3ZW3A 4CHKA 4IOYX 2ZCBA 4HCPB 4DWFA 1DDVA 3UIOB 4KV2A 5C6RA 3KH0A 3VUYA 2V76A 3ZTDA 2ADZA 2PEAA 4EUTA 3D8DA 3SD5A 2FCMA 2N1VA 3HIZA 2DYQA 1EO6A 1R4MI 3VOQA 3KVFB 1WXMA 2KLGA 3ZLZA 2K8CA 2OQBA 1FHOA 5E6OA 4IC7B 1PMSA 2L2IA 1RJ2A 2K1FA 4DHZB 3HM6X 1XCGA 1I42A 4HAYB 2Z59B 2MBHA 5CX3A 4FBJB 3N32A 1R4NI 3ML9A 2W2WA 1TJ6A 2DZJA 1OQYA 1ZKHA 2K6DB 2G45B 5JZEB 1P1AA 4DHJD 2KOXA 5FR6A 3TCAA 1WXVA 2FDQA 3ZNGC 1MIXA 2DA0A 2FJLA 2N23A 3JSVA 2VRRB 5EDSA 4GDLA 3T9LA 2KD0A 2YT0A 1D3ZA 2KFKB 2R2OA 3APDA 5CHWA 3TMPB 1UNQA 2NMBA 3VAWA 1FOEA 2UZSA 3LDZE 4ANVA 2QKMA 3BINA 1WIAA 4W9KA 4EZJA 5D3WA 1WZ3A 2GBNA 2LI5A 3A9KB 2MBEA 3DVNV 3Q3JA 5D2MB 1XQQA 2HE7A 4XX5A 2DZMA 1LQBA 1XKEA 1Z87A 2D9VA 1P3QU 2JVCA 2NS5A 1K5GB 2L0TA 3TW1A 1IPGA 4HDQA 1UPRA 4A6FA 1KOTA 5HE1A 5E6NA 5L95C 5DI9B 4D0NB 4XC2A 4ANUA 3CSTA 1ISNA 1C1YB 3L16A 2KC1A 2WX0A 3V6EB 2MFQA 1IRSA 2MWNB 2Z0PA 1JRUA 3N7CA 1WX8A 2FCNA 2LOZA 1KM7A 2L8JA 3UF8A 2DAFA 1U5GA 2N9PC 3CXBB 4GB9A 4IUMB 3ZTCA 4EOYA 3UQAA 1PFJA 2M0XA 2Y8GA 2BYEA 2LGYA 4PYUA 2BKRB 2JWZA 2NVUI 2P0DA 2AYOB 4GIVA 4KHAA 3QWZB 4MGIE 2AEHA 3TIXA 2JPHA 2HTHA 1YIWA 3B08A 4A3PA 4DK5A 4HB0B 3B0AA 2E2XA 5C79A 2EMTA 3PVWA 3N3KB 4JQWC 2MKRA 4GDLB 1MPHA 2BGFA 1V5UA 2LJ5A 2RPQA 5D3YA 2JRIB 1ZVRA 3PRMB 1HB6A 2D2QA 3PSEB 2CR5A 2JT4B 2KDIA 2YSZA 3NHEB 4K7SA 2GBRA 3PHXB 3RULA 1XD3B 1KZGA 3EECA 4EEWA 4KVGB 2MDXA 5JHHA 3GOEA 4HLEA 2N7EA 3B1LX 2CRFA 1OGWA 2L76A 4HCNB 4IM0A 4J6IA 4W9LA 2N9XA 3DOWA 4MM3A 3V60A 3KY9A 4F7ZA 3S2AA 2CAYA 4E71A 2VSZA 3DQVA 3ZDMC 2JP2A 3QIJA 4B9KA 3ZDTA 4PS7A 1QC6A 5JP4A 4ICUA 1DYNA 2N9EB 2BYFA 3KUZA 4XZ4A 4HB3B 4F1SA 4L6EA 2KTRA 3M63B 1LW3A 2MA9B 2LKOA 4G11A 3NZUA 2JZZA 3ZRFA 2ZJDA 3PP2A 2I5CA 3ML8A 3W1SA 4TYZA 1WI0A 2I5FA 2FNJB 5DHFB 4EZKA 3MJWA 1TBEA 4GSWA 4ASWC 5KQ1A 2FAZA 1X11A 2NBWB 4HDOA 2V3SA 5GMVA 3VXWA 4BOZB 2IY1B 1U29A 4WAAA 4MH0E 4AJWA 2M4NA 3JYUA 4BBNF 2CS4A 4K2PA 3TJPA 2ZNVB 1CMXB 1X05A 1N3HA 3L08A 1UEFA 3A33B 1KJTA 4NNJB 1QQGA 2ZPYA 4WJOA 2A5UA 2ASQA 4FA6A 1G6JA 1SIFA 1WMHA 4WVFB 4PNKA 1Z2MA 2YT1A 1YX6B 1M7EA 3IVFA 3PLUA 3VTWA 5LXIB 1J0GA 4GDKB 2KC2A 4WJNA 2AL6A 3ECIA 4OVUA 4DBBA 1Y5OA 4BKGA 2Y5BB 4K2OA 1X1MA 2JUOA 3SDLC 2UZRA 3ULCA 3RCPA 2IY0B 3IFWB 3DXCA 3SUZA 2MP2B 5BO4B 5CHFA 2MCNB 3VTUA 5D6JB 5J2RA 1TGZB 3APCA 1NTIA 2DX5A 2LG1A 5HE2A 3AULA 1WVHA 1S1QB 4W9GA 1EAZA 1FHXA 3IBEA 1UNPA 5HE0A 2NPTA 1SE9A 3ONSA 2IO2B 4IG7B 5JHGA 4Z2NA 4LDTB 3RD2A 3JW0X 3MHSD 3QX1A 3T8MA 3U30A 4DDID 2LOXA 2MRPA 3PHWB 1WJ6A 4HPMB 3DPDA 5FI0A 3VDZA 1Y19B 4OVVA 5JHAA 2ZVNA 3H7PA 1P5TA 2IO0B 2IZVB 4FHJA 2FCSA 3L54A 2D9YA 1NVLA 4IM3A 4BBNC 1RRBA 2N0YA 1BT0A 2P8VA 2GCJA 2PZ1A 4F7HA 2DYOA 2K8HA 2JRHA 3A4SC 1OEYJ 3ZRCA 3D8FA 1YD8U 2KDBA 3OJ4B 1FB8A 1LB1A 2M17A 2EKEC 5E6PA 3QJZA 1EF1A 5IA7A 1M7RA 4ZRJA 3VUWA 2O6VB 3U7DA 2L7RA 4G0NB 1WM3A 2CHXA 1E7UA 4HAXB 4N9F4 2D10A 3DCGA 2I1JA 4AOFA 4II2B 1W1DA 1AQCA 3DXDA 2KJ6A 3AI5A 3V62A 2JY6A 3EHVA 1E7VA 4NSWA 2DZKA 3QARA 4ZRKA 5IJMA 3AU4A 1W1GA 2D9XA 1V9JA 1V5TA 2KZRA 2V1YA 2ZCCA 1XX0A 5J3TA 4MGYE 3ZNID 1KLVA 1KZ7A 2Z0OA 2KLCA 4WJ7A 2L05A 4GU2A 3AJ4A 4IWQA 4AUQC 1V89A 4WQOB 5CHVC 4WWPA 4CO7A 2PE9A 5LLIA 3WALA 3QQ8B 1UH6A 1WJUA 3PRZA 3SU8X 3PRPB 4KHBB
chains in the Genus database with same CATH superfamily
4BVUC 5G5HA 1WXSA 4KX6B 1FIQA 1WGYA 1MI1A 1MVKA 1QKZA 4GN1A 4HK2A 4QJ5B 4B95A 1NI2A 1GAQB 3Q8FA 4B0MA 2KVRA 3SO6A 2N1WA 2KNBA 4OZAA 4QXAB 1FCLA 2MEKA 1T0QC 2V4IB 1NI3A 2WH5A 4K17A 3DWGC 5L83A 2INDC 2FBWB 2WU5B 4MACA 5HG2A 3RNGC 2DZIA 2HD5B 2MBQA 3RNEC 5DCNA 2ELBA 1KF6B 3HHMA 2KJRA 3DBLI 2GRIA 1EWYC 3AE9B 1J8CA 3NVZA 5T8IA 5D94A 1ACAA 1MI0A 1MK9B 2RNRB 1Q1OA 2VKIA 4MH8A 3ZO5B 2X18A 4HAZB 3R2TA 4LDTD 2K6QA 1UPQA 4NPNA 5KHOA 3A8QA 1SF0A 5E6JA 2W2XC 1TZ1A 4JK7A 2D9ZA 2MLBA 4JIOU 2INCC 4AP4C 5DPWA 3GYPA 1KLUD 2LRUA 1GC7A 2NZ8B 3AN1A 5C5BB 2H88B 2V9HA 4ILJA 2RSGA 2KX3A 3VIAA 3TFMA 1SXTA 1JROA 1RRPB 3ENEA 4IAPA 1QZEA 3UGBB 5J2RA 5J17A 4W9JA 5KCVA 1XCQL 3BY4B 1C79A 2QKLA 1JMLA 1V88A 2QCZA 3Q69A 1PUTA 1GUAB 1L7YA 1LXDA 2WGSA 1CJEA 4KIKB 4JPSA 1BTKA 5HE3A 2UU7A 4JKGB 2DWQA 4LNIA 5M4YB 3X23A 4HB2B 1EF5A 1T77A 2G3QB 4KAXB 3O13A 1K5DB 4E3CA 3DDCB 1BAKA 1MG8A 3DCXA 3Q3FA 4K7UA 3BVGA 4ZRIA 1N62A 5D3DA 4C7YA 1QT9A 2EELA 3AE3B 5DPTA 1CK1A 4M8NA 4C0AA 1T0RC 4CQNA 1DDMA 2ZVOA 4MELA 3FKYA 1AWEA 2QEJC 1UGMA 1UNRA 2DYBA 1PYWD 4LJOB 1ST7A 4GXBA 3OG5A 1U5EA 4B6HA 5HHDG 1UBIA 2KFJA 2D3AA 2MJEA 4P6VF 1NDDA 3WAMA 3UIPB 3VR9B 4NY0A 2I38A 1ZSQA 4K3BA 4NJ7A 3L17A 5J3YA 3FSSA 1XLPA 2GCLA 4BAXA 2C9WB 4MGZE 4ZOHC 1WYWB 3W1YA 3QA8A 4HXDA 3PVUA 4OVZA 4G3XB 2ELAA 2WXJA 2LGDA 3VVWB 1Y8RC 4YTNB 1L4DB 1SGHA 3DBRI 4JLCA 3FILA 4KKJA 2YLMA 1X1FA 3ZUNA 4W9CA 4K1RB 1WGDA 1ZC3B 3I9V1 3OLMD 2R2QA 2KIEA 1XT9B 2JXTA 4EKUA 1NBFC 2IPKD 1W1HA 3QAQA 1WGHA 2BQQA 3R2IA 2Z0QA 3CSFA 1TS4A 2IO1B 2ZZPB 4JL9A 3R66C 4CHJA 2R82A 4M01A 1WY8A 2W9NA 1WJ4A 1ZE3D 3UZTA 3I57A 1YOVB 2O6VD 3VQIA 1N6ZA 2I1KA 3TL5A 5LG4B 1WR6E 4A3OA 2VH1A 4K7WA 3HSAA 3T06A 3U4EG 2NCNA 3MJ5A 2KKCA 1J19A 4A55A 2GI9A 3K9PB 4K81A 2BF8B 5CTRC 3H7SA 4IFSA 1QQRA 2V0GA 2D5GA 1V61A 3ZNZB 1FHWA 3FEHA 3N30A 3W1SC 1J0WA 2V4LA 2LGSA 3BYYB 4YTMB 3EFUA 4JKEA 2KDMA 2C5LC 2NR2A 2WWZA 2H7EA 2KX0A 1Q0WB 3N20C 5BMIA 3WYFB 2J42A 1YJ1A 3MHZA 1WJMA 2K8BA 3P4SB 4NAMA 4C4VB 3CMMB 1WRIA 3GZNI 2N7JA 3HRDD 2YRYA 4GMXB 3PSCA 3NY5A 4BBKA 4ZHOA 4URKA 1XR0B 3HIEA 2IGGA 3V61A 2PVGC 3LJUX 3M1IB 1IP9A 2KMAA 3VRAB 1MAIA 3ZXVA 4A6HA 1YMHE 3ZW3A 4DWFA 4OW0A 4JKAA 2PEAA 2PVOD 2DYQA 2KACA 3LB8C 5IP4D 2L2IA 2Z4DA 1I42A 1ET9A 1LGRA 4N58A 2DZJA 4FXCA 3OHMB 2G45B 1DOYA 1P1AA 5FR6A 1MIXA 2FJLA 3GB1A 5EDSA 2KD0A 3APDA 1UNQA 3Q3OC 1FXAA 1D5XC 1WZ3A 3DVNV 2MBEA 4WIPA 3P63A 3IXSA 1IPGA 1T0SC 4A6FA 2BW2A 5BMGA 1KOTA 5HE1A 3B9JA 5L95C 4TSSA 2K8EA 1C1YB 2K5PA 2WX0A 3V6EB 2MWNB 1WX8A 2AX5A 2LOZA 1KM7A 1U5GA 3CXBB 3ZTCA 4IUMB 3UQAA 2BYEA 1H8CA 2L83A 2GUMA 4KHAA 3BIID 2HTHA 3B08A 3B0AA 3Q6BA 2K3UA 1MPEA 2MKRA 2RPQA 1V5UA 2ZW1A 1T3QA 2D2QA 2WXMA 3IT6B 2JT4B 4K7SA 1FCCC 1R4MB 1XD3B 4KGRA 5JHHA 2MDXA 3GOEA 2WDVB 1GGOA 2CRFA 1L2NA 4HCNB 4W9LA 3V60A 3MC8A 4F7ZA 4E71A 3AE7B 1YQ3B 1UWMA 1Y56A 3QIJA 1DYQA 2M0AA 4ICUA 2BYFA 3TUOA 4L6EA 3M63B 4G11A 3ZRFA 2ZJDA 3W1SA 5DHFB 4EZKA 1TBEA 1D5MC 1AN8A 1X11A 4HDOA 5GMVA 1UNSA 5TSSA 1EU3A 4AJWA 4BBNF 3JYUA 3RFZB 3A58A 1N3HA 4MT5A 2J4XA 1UEFA 1QOFA 2A5UA 4FA6A 4JKBA 2I2YA 5LXIB 5I2MA 2KC2A 4RCOA 2DNFA 2Y5BB 3SDLC 3ZJUA 3RCPA 2IY0B 3IFWB 3SUZA 3ZNHB 1JWSD 1ZXHA 5CHFA 1ZPSA 5D6JB 1PGAA 3AE4B 1TGZB 1WVHA 2CU3A 5HE0A 4AJYB 2IO2B 4Z2NA 3JW0X 3QX1A 4DDID 2MRPA 1AW7A 4OZCA 2XNAC 4YTPB 1Y19B 4OVVA 5EE9A 3B2GA 1L0VB 2IO0B 2IZVB 2FCSA 4FHJA 4IM3A 1NVLA 4XWTA 1N5WA 2N0YA 1RRBA 4F7HA 2JRHA 4H2AA 3N1YC 2KDBA 3AEBB 1FB8A 1YN4A 3QJZA 1EF1A 5JVLA 2X0SA 1E7UA 3V62A 3DXDA 1UWXA 1W1GA 2KZRA 2D9XA 2V1YA 2ZCCA 5BYQA 4L2YA 1J7BA 4WJ7A 1WGKA 2BB5A 2PE9A 5LLIA 3WALA 1IGDA 3GE8C 3SU8X 3TEWA 3PRPB 2V3PA 3I3TB 3VAWA 4ANVA 4IM2A 3OJ3A 1ZGUB 1C4PA 5G5GA 2R61A 5IO9A 3ZXRA 2KHWB 3HUIA 4B0EA 1OQNA 2CB8A 3E66A 3W2DA 5LOPB 2CHWA 1WE7A 1GNUA 1TS5A 4KDIC 1V49A 2OJRA 1VJKA 2KUPA 3ODOA 4GGQA 1C4CA 3L0WB 3PGEA 1WGQA 1JALA 1SB3C 3N1ZC 4KGTA 3AECB 2M8SA 4P16A 4FJYA 3RNBC 4K3CA 3UQBA 2MCNB 3H9DA 2Q5WD 2CY5A 4ARCA 4KGSA 1QOGA 1QOBA 4WJPA 1HXYD 4A6KA 2KANA 5C3JB 2X38A 2RPVA 2WXQA 2Z59A 1OMWA 1YJIA 2DENB 2WYQA 1YNTE 4FULA 1V1PA 1VZ7A 2KK8A 2LYDA 3DVGY 2K49A 1WJNA 2LVQA 1DIKA 4PS8A 1NENB 4BKSA 3OWEB 2FIDA 2Y3AA 4ZYNA 3CF6E 4FJVB 5KQ4A 2PJHA 5D7GA 3KYCD 3DWMA 3VHTC 2NTSA 1QLBB 2JZ3B 2Y5CA 1T0YA 3KSYA 4EFOA 1SE4A 2DYMA 2EJ8A 4RM8A 4LCDE 3P6AA 2MH7A 3SYXA 1E9MA 1AWDA 3TEXA 2OEDA 1MG4A 3ML4A 3PTFC 1E10A 4ILHA 2QDFA 3ZKJC 4M0WB 3PZDA 4HHVA 1VR9A 3ODWA 4GMVA 2HJ8A 2LGXA 2C7NB 1TIFA 3MDBC 3AU5A 3N9YC 2MW5A 3QCAA 1FGZA 2FJUB 3W5UB 4KSLC 2WX1A 4ZDVA 4BKSD 3MC0B 4P7IA 2IO3B 3IHPC 4ANXA 4WWNA 4DHJB 3VFKA 2YS3A 1FXTB 1I4QA 3URYA 2P0FA 2CHZA 1HTOA 4BOSC 1L6UA 3PS6A 4IW0A 4MK0A 5GOWB 3RPFC 5EFXA 4HAVB 1P98A 3ZJTA 5AUIA 5JH5C 1R7SA 2O6VA 2MBOA 3H8HA 2KT7A 3NOBA 4NAWB 2RUKB 2PKOA 2MP2A 2BB6A 2WS3B 1IGCA 2UYZB 4AS1A 4WJQA 2LUEA 4LK0M 4ICVA 2BBCA 3F0WA 2KTRB 2D07B 3KWLA 4JX1C 2SEBD 3G9WA 3KRXA 3KUDB 3GYOA 3TO1A 2DN6A 4A8XC 2COPA 2RMMA 3Q8BA 3U2SC 1WX7A 2E3TA 1MJDA 3L4PA 3O96A 5G2NA 4FLHA 2WDTB 1V86A 1WM2A 1F1HA 2EKIA 2JZPA 2RGFA 1XODA 2B76B 1IBXA 3RZFA 4NJ6A 5DHAB 4RH6A 3LYYA 3PLVA 2BYTA 3HW2B 2LRWA 1A5RA 1WI1A 5L81A 2FUHB 2WLBA 1H10A 3VH4B 5FKAC 2G35A 2A4ZA 1K53A 3UI3A 3IAS1 4H8SA 1FFVA 4FADA 5J18A 5TR5A 2N9LA 4WWMA 3NS8A 3V6CB 1JQ4A 1RLFA 2ACZB 2MSED 3EA6A 3A1QB 1X86A 3PVLA 4ZRPA 1D5ZC 1WFYA 3U52E 3WCQA 2KWUB 5AZGA 2UVMA 2L00B 2J0MA 1FEHA 1PFDA 3AB5A 3CIKA 3K9OB 2J53A 4FN2A 2KMCA 1E8YA 1BTNA 3FP5A 1LFDA 1D6EC 5AEKB 2XQNM 2DHJA 4LJPB 2MJDA 1TXDA 2LVPA 5D3XA 4MSMB 3SEBA 3NVVA 3IAM1 5LONB 3NW8A 1TKGA 3AE6B 2BKFA 3DBHB 3L13A 2GS0A 3KUCB 2WHIA 2K39A 2VZKB 1VBHA 1SHCA 4Y94A 1XCTL 3NWDA 3DHHC 1E8XA 2INPE 2PLPA 4MJSB 4XDDA 3SV1A 1QOAA 2C7HA 1V80A 1WGGA 2WXPA 4CHKA 2V76A 3ZTDA 3SD5A 2N1VA 3HIZA 4XWWA 2ZKMX 1FO4A 3P4RB 2KLGA 4IC7B 3AE2B 1RJ2A 1VRAB 3TSSA 2LHDA 1R4NI 3ML9A 5GXGB 1FNUA 2BS3B 4JKCA 2PIAA 3TEYA 4L23A 3ZNGC 2DA0A 3J9CA 3JSVA 2W54A 3T9LA 1KFYB 2YT0A 1D3ZA 3RN9C 2UZSA 3LDZE 1TS2A 2QKMA 4EZJA 1WIAA 2AQ3B 3A9KB 1VLBA 1ZYIA 1XQQA 2DZMA 2L0TA 5FK9C 4HDQA 2IJ0A 2PTLA 4D0NB 2RDGA 1ISNA 2KC1A 2Z0PA 3B2FA 2MJ3A 4GB9A 2L1AA 4P1BC 1PFJA 1RM6C 2LHEA 4IDIA 4PYUA 2NVUI 1ZUD2 2JWZA 4GIVA 2AYOB 3TIXA 4MGIE 2AEHA 2KYWA 1GOZA 1YIWA 4DK5A 4D2KA 3PVWA 4CSQA 4YSZB 2BGFA 2LJ5A 1FD6A 5D3YA 2JRIB 1ZVRA 3PRMB 1HB6A 4RF1A 2CR5A 1CQVA 2YSZA 3NHEB 3LXFA 1KZGA 3EECA 2N7EA 4REZA 1T6BX 4J6IA 1F77A 1FXIA 2VSZA 3ZDMC 2JP2A 2WQYB 3ZDTA 4RGTA 5JP4A 4F1SA 2WNMA 1LW3A 2MA9B 3BVZA 1N60A 2NTTA 3PP2A 3ML8A 4TYZA 2JX5A 2LEKA 5KQ1A 2V3SA 1V1OA 2NBWB 3DBLB 4S17A 4BOZB 4WAAA 4MH0E 2M4NA 2CS4A 4WAFA 1N5XA 1RWSA 3TJPA 2ZNVB 1CMXB 2ZPYA 4WJOA 3ZYYX 1AYFA 1SIFA 1Z2MA 2K0PA 1YX6B 3PLUA 3IVFA 1J0GA 2KAJA 3GZNB 4OVUA 4DBBA 1Y5OA 2RDHA 2JUOA 1X1MA 3ULCA 5IKCM 5H92C 2MP2B 3AEGB 5IOIA 2DX5A 2LG1A 5HE2A 4W9GA 3IBEA 1UNPA 1SE9A 3E9PA 2AQ2B 3T8MA 3AE5B 2LOXA 2MHJA 3PHWB 3VDZA 2Y5PA 3IT4B 5JHAA 3L54A 4BBNC 1BT0A 3A4SC 1HZ6A 2BS4B 2YEPB 3N1XC 1LB1A 2EKEC 4HKZE 4TMAB 2Z13A 3U7DA 4G0NB 2CHXA 4N9F4 4HAXB 2D10A 2I1JA 4AOFA 4II2B 3SBGA 3AI5A 1E7VA 2DZKA 3AU4A 2CJNA 1V5TA 5J3TA 4MGYE 2WXNA 1KZ7A 2Z0OA 2KLCA 2L05A 4IWQA 4WQOB 5CHVC 3RNFC 1OFFA 4IOIE 1TZOA 1UH6A 3FC4A 1YN3A 1SBBB 3DBSA 3PREA 3QC8B 3BVMA 4FJZA 2N7DA 2IDYA 4EMOA 3NSUA 2K2JA 3CIRB 4JKHA 4B6WA 2RGNB 1MHHE 3ALBA 1EM7A 3LJ3A 4RGMA 3DXEA 4DXAB 1E90A 1VD2A 2BCJA 2NBVA 2QSDA 1B55A 3A1QA 5C16A 4MSQB 4DBGA 3V5WA 1GG3A 4ILGB 1EVHA 1K52A 2DHIA 1K8RB 3NVWA 4NAWA 1XD4A 4MT7A 2FJ9A 1L0YB 1FNWA 2RSUA 2Q13A 4MM3B 1V81A 2GB1A 4GOUA 4BZAA 2DX5B 1PLSA 1DBHA 2G1EA 2YVCA 2N9KA 2K2UA 3HK0A 1EGXA 2JSVX 1V5MA 2FE8A 2IYBA 1PGXA 3P4QB 2D3CA 4F7GA 4W9HA 3R7RA 1FRDA 3A8PA 4RGOS 1WGRA 1WJ1A 2ZEQA 3JSVB 5C23A 2K9XA 3MFGA 2BYVE 2DHZA 5DPRA 4MEMA 1MIZB 2W3RA 3WA0A 1XLOA 2IYDB 1KI1B 3KRWA 1UELA 3PO0A 2COFA 1E5WA 4F7UP 4AWJA 1GC6A 1WGUA 2REXA 1E8WA 2ICIA 3VUXA 4IWPA 3ABVB 3H6NA 1U27A 3Q2AC 1ZW7A 3VR8B 2R0DA 4ITKA 2KQSA 5CLQB 1DOIA 1NVID 4JWUC 5D3IB 4US8A 3AM9A 5FR3A 1ESFA 3PG7A 4HWIB 4I6NB 5LXHA 5CLLB 1JWBD 1E7PB 2W55A 3EFCA 5C1ZA 4ARIA 2XEWA 1HZ5A 3ZVVA 2RLOA 2YF0A 3VTVA 3F5RA 2MBBB 4F8CB 2LBBA 3PEGA 2O2VB 2KXJA 5EE1A 3CWIA 1I4GA 2DTCA 1KTKA 2HRJA 2FIFA 1C9FA 1ZM0A 5C5BA 3HM3A 4JWSC 3WIMA 1UF0A 4NZLB 4I6LB 1ACCA 2XK5B 4C56C 2L3ZA 2CODA 2Z0DB 3AH7A 3Q8AA 3QWMA 2M1MA 3Q8CA 1FM0D 1PGBA 2XBBC 2KJHB 3ODXA 4OT1A 1K51A 3BZDB 1TJEA 3VH3B 1RFAA 2C60A 1XEEA 1TT5B 1N63A 4EJNA 2BWES 2QIEB 3SR6A 4KZ0A 5HKHA 5FI1A 2KO3A 4HROA 3SNHA 1NTYA 3RCZA 4N59A 4TKNA 1XF5L 1Q10A 2X8XX 2KN5A 3RT3B 1JDEA 4GOCA 3A9JB 3W9CB 2AQ1B 1U2BA 3V3XA 2FCQA 2G4SA 4YSYB 4A6FB 4QJ3B 4TV3A 4MGKE 2YS1A 2W82A 1DGJA 2KWVB 3ULBA 2JWUA 4M8MA 2DIKA 2RDBC 1R4NB 2WP9B 2AL3A 2XN9C 1GJZA 2M38A 4WQMA 5DPSA 2DX1A 1V5OA 4AQ7A 4W9FA 2CU1A 1YX5B 4BFRA 4MJSA 4P1CC 2ZNVC 4GDKA 2PPHA 2PMVA 3M3JA 3IG3A 2V3NA 1V97A 2PE6B 5BYSA 1EUVB 1WYGA 4IWOA 1I4PA 3AV8A 2VZKD 2KUQA 3BK2A 2UWQA 3A98B 4E74A 4KHBA 3I63C 3R7QA 4JKFA 1L0XB 4I6PA 2JQRB 4G50A 4CYEA 3B77A 4DHZE 2D3BA 2D3GA 2VRWB 2NPTB 3H7PB 1OEYA 3E9SA 2DFKA 2Y7BA 2ROZB 2RR9A 5KHQA 4D6WA 3RZWC 5DIFB 4YONA 2CY4A 2DLBA 1DROA 2IBIB 1KBLA 1GB4A 1H4RA 2LWPA 4A9AA 2NBVB 2LASA 4KZCA 4GZUA 3WAOA 2KMMA 4QAYA 2EC1A 3FLVA 3QBVB 5IRSA 1TY2A 4Z2MB 3MTNB 3EPYA 2WU2B 4FHKA 3DBHI 2KGXB 2ONQA 1JWUD 2OHFA 4KHOA 3SBTA 4BKTA 2JF5A 1C3TA 2W2XD 1P7EA 2BT6A 2ABDA 3PT2B 1UBQA 1AARA 3JVZX 1YN5A 2HTME 3KQ4A 2L52A 4PT5A 1SJHD 1ZC4B 1ZP0B 2B3AA 4TQ1A 1P0RA 2MX2A 4X57B 3EC8A 4NQKE 2KR0A 3P2BA 1WZ0A 1HBKA 1JWMD 3TVVA 1P9DU 2C7MB 2COAA 1DDWA 2LVOA 3PV1A 2M19A 1HEZE 2GOWA 3U12A 1V6EA 4IOYX 2ZCBA 4HCPB 1DDVA 3UIOB 5C6RA 3D8DA 1TYGB 1WXMA 3ZLZA 2OQBA 5E6OA 3NVYA 2IGHA 4DHZB 1I4RA 4FBJB 3N32A 2W2WA 1OQYA 1ZKHA 2K6DB 3FILB 4M02A 4DXGA 2KOXA 2WXIA 1WXVA 2FDQA 2VRRB 4GDLA 3NZ3A 5CHWA 3TMPB 2NMBA 3BINA 4W9KA 5D2MB 3Q3JA 1ENFA 1JRPA 2HE7A 4XE0A 2N0SB 1PDXA 3GS2A 1LQBA 1XKEA 2D9VA 4IKGA 1SE2A 1P3QU 4R3DA 2NS5A 1K5GB 2YEPF 1NYRA 1UPRA 4JE3B 3C8YA 2L32A 5DI9B 1A70A 4XC2A 3CSTA 3DBRB 2KN4A 1IRSA 1VDVA 4HEA1 3N7CA 5AUKA 1K50A 5MPOA 2DAFA 4EOYA 1SIJA 2M0XA 2Y8GA 2LGYA 2BKRB 3QWZB 4HSIA 1ROEA 2JPHA 4HB0B 4US9A 4XDCA 5C79A 3N3KB 1I4XA 1VZ8A 2IGDA 4JQWC 4XGAB 2KWDA 4GDLB 5BMHA 3AEFB 1UUPA 3PSEB 2KDIA 3RULA 4A6QA 3E56A 4KVGB 3NG0A 3B1LX 4IM0A 1OGWA 2L76A 2N9XA 3DOWA 3BYTB 1B9RA 1L4ZB 3DQVA 4B9KA 1F2RC 4PS7A 1KRHA 1QC6A 1DYNA 1BMLC 2N9EB 4HB3B 2KTRA 2LKOA 3NZUA 2JZZA 1WI0A 4LLGM 3MJWA 1WWTA 2NMQA 2FAZA 4OHJA 3A33B 1KJTA 4NNJB 1QQGA 2ASQA 1WMHA 1FRRA 4PNKA 2WXKA 3AEDB 2QJLA 1FFUA 3VTWA 3ZJVA 5JXVA 1E0ZA 3ECIA 1L5PA 3E9OA 4BKGA 4K2OA 5I4DA 3VTUA 4OSNA 3FAHA 1WSPA 3APCA 3AULA 1S1QB 4LNKA 2NPTA 4IG7B 3MHSD 2KVZA 2WXLA 3DPDA 2ZVNA 1P5TA 2D9YA 3W5VB 1HTQA 2P8VA 2GCJA 3Q14C 2K8HA 4M0WA 1FMAD 1RYJA 1OEYJ 3D8FA 3OJ4B 5IA7A 2M17A 4KKIA 3BK1A 2WXHA 4ZRJA 3VUWA 2O6VB 2L7RA 1ZOYB 3EHVA 4NSWA 1VBGA 2W3SA 1TY0A 1T5XD 3HVZA 4GU2A 4XYCA 4KHBB 2G4DB 2M14A 4DIXA 1ZDVA 1TQZA 2KCJA 2YS5A 3QHTA 4JGHB 3ZQ4A 1STEA 2KTFA 3KLSX 2KQ7A 3NS1A 2Y8FA 4DX90 3DHIC 3OAWA 4MDKE 4HPPA 2P0HA 3MC9A 2LXCA 2M56B 2DLWA 2MWSB 1SEBD 1HB8A 4W9EA 2BTEA 3NUHB 3UINB 1OQRA 2DHKA 1C4AA 5AZHA 4YSXB 4C00A 3A9JA 3AEAB 3H1UA 4TQ0A 2BWFA 5D27A 3KW5B 1Z5SB 5HFYA 1P3RA 4A20A 1IUEA 2IFSA 1X1GA 4L1BA 3U7ZA 3ZIMA 4PYZA 4HJKA 2R09A 4DX8A 2GMIC 2ZPNA 4TUUA 4S0RA 1E6EB 1WRDB 3R8BA 1MFWA 3T3NA 3AE1B 4CHMA 2ZW0A 5JHBA 4HRSA 2LJIA 4A5KA 2LD9A 1E8ZA 4YL8A 1PQSA 2HTHB 4HVBA 3PZ8A 3D8EA 3QK0A 4WWOA 2MQJA 4NJCA 4HAUB 2GJYA 2KFKA 2RQ1A 5AZFA 4C80A 2DKPA 1SJED 3P7ZA 2J0KA 3DVGX 3A9KA 3PPAA 2CKHB 4W9IA 1Q5WB 3NJTA 3RNCC 2AWTA 2L0FA 1F0ZA 1M94A 2J7QB 5J3QA 1EU4A 3AE8B 1WX9A 1MKEA 2GLSA 3APFA 5JLJB 3R3MA 1NEKB 3DVNU 2LUMA 4USAA 3GE3C 4GLSC 5DH9B 1KH0A 2K25A 4KSKC 3EUB2 3X0WA 2LULA 2LXAA 3RYTA 3ZVRA 2ROVA 2BPSA 2O2VA 3P1MA 1C78A 1WF9A 2R2YA 1P6SA 4NQLB 4JKDA 2EMSA 2N4FA 4EE2A 1CZPA 2COCA 3RI7C 1L6VA 1KLGD 1JWAD 2BVCA 3MPXA 1RAXA 3WAPA 1V2YA 2K22A 1WR1A 4HAWB 1VZ6A 2JYTA 1IYFA 3L10B 1C76A 3DHGC 1Q67A 1XLQA 4XWXA 4PS3A 4JK8A 1WXQA 1NTVA 3FM8C 1V8CA 1QILA 4II3B 1OTRB 2VH2A 2H7DA 1WMHB 2GBKA 2LZ6A 3KYDD 5LNK1 2WXOA 3ETRA 4ANWA 1U4AA 1UZXB 2RVBB 2DBYA 1HA5A 4DDGD 2QHOA 4C7ZA 2NBUA 2L1CA 2BS2B 3AXCA 1U5FA 4HPLB 4RNAA 1WH3A 1NYQA 2OTXA 1MK7B 4WURA 1SSNA 2QMTA 4GPTB 1DOXA 2XK5A 3WANA 4RM9A 4WSFA 1VCBA 4KDLB 5IAAC 2D9WA 3RNAC 5EE0A 3TEZA 3SFEB 1YQBA 1I7AA 1U5DA 2GBJA 4KIKA 2H89B 2J59M 1J7AA 2DAJA 1BWNA 1YQ4B 3RUIB 2K00A 4JKGA 1WXAA 4RMAA 5BYRA 1F52A 4RGNA 2Z8LA 1N61A 3HQCA 2G9HD 4UDUC 1WG7A 3NZSA 4ZRQA 2D4QA 3D32A 3SHQA 4EZLA 3C0RB 3BWUD 4ZHPA 1YJJA 1FAOA 3OANA 2GBMA 3M62B 4LNOA 5G55A 3O65B 2PW9A 2DKQA 1D4BA 1HQRD 2KWCA 1LO5D 3NRZA 4PQ0A 1GPXA 3A4RA 4MY6A 2D11A 1FGYA 2OJWA 1TTNA 2JU6X 2CQUA 4RF0A 1HE8A 1I4HA 3ZGZA 1FPYA 2KDFB 2Z0EB 4YWGG 1F9JA 1V5PA 1I2HA 2J0JA 1LM8B 3BJIA 3U8ZA 2HJ1A 3KZ1A 2DYNA 4L1RA 4J3OD 5D3VA 4GNKB 3TBLD 2QILA 4HB4B 2KDEB 2RD0A 4JK9A 3MP9A 1OY2A 1NU2A 1SE3A 4C4VA 2CJOA 1S3SG 2KQ4X 4M00A 2KIGA 1UD7A 2OOBB 2JXXA 2JYEA 4HATB 1WE6A 1I35A 2INNE 3M95A 4WH4A 4KV2A 1UGJA 3KH0A 3VUYA 4EUTA 2ADZA 2LGIA 3NWFA 2FCMA 3KWVA 1MHXA 1EO6A 1R4MI 3VOQA 3HVDA 3KVFB 3NWAA 2K8CA 1FHOA 4Q2JA 1PMSA 1J7CA 2K1FA 3HM6X 1XCGA 5IN7A 4HAYB 2Z59B 2MBHA 5CX3A 4QJ4B 2E6XA 1TJ6A 1TS3A 3RMKC 4PK1A 2YT2A 1TKYA 5JZEB 4DHJD 1XXGA 3TCAA 2N23A 1C77A 2SAKA 1BUIC 2KFKB 2R2OA 1FOEA 1P7FA 5D3WA 1KC7A 2RRFA 2GBNA 2LI5A 4XX5A 1Z87A 2JVCA 3TW1A 4LTUA 4OZBA 5E6NA 1XLNA 4ANUA 2QC8A 3C19A 3L16A 3SFDB 1FNVA 2MFQA 1JRUA 4W9DA 2L8JA 2FCNA 3UF8A 2N9PC 2LFIA 4ZYSA 2HDEA 2P0DA 3P42A 4A3PA 2E2XA 1I7HA 2EMTA 1ET6A 1V1PB 1TKEA 3V05A 1MPHA 3I5JC 2J52A 2Z14A 4LNNA 1ZXIA 3FVCA 2GBRA 3PHXB 4EEWA 3E9LA 4LNFA 4RFBA 4HLEA 3VRBB 4MM3A 3KY9A 3Q3NC 3S2AA 2CAYA 4DXFA 4O1NA 2WXRA 3ENBA 1XO3A 4XZ4A 3KUZA 3Q8EA 3AEEB 1BXTA 5C2TB 1B1ZA 2I5CA 1M4VA 4HJGE 3AMZA 2FNJB 2I5FA 2WDQB 4GSWA 4ASWC 1EWCA 3GP7A 3VXWA 4ACFA 2IY1B 1U29A 4N6EB 5H8YE 4K2PA 5EE3A 2WXFA 3L08A 1X05A 5HI1A 1F2RI 1G6JA 2WDRB 4WVFB 2FUG1 2YT1A 1M7EA 1JCKB 4GDKB 4WJNA 2AL6A 4DQOC 3PZ7A 2TSSA 2UZRA 3DXCA 1ZDXA 5BO4B 1NTIA 1EAZA 1FHXA 3ONSA 4YT0B 4LDTB 5JHGA 3RD2A 3U30A 2WXGA 3P4PB 1WJ6A 4HPMB 4HKQA 5FI0A 3H7PA 1RFKA 3T3OA 2PZ1A 2DYOA 3Q3MC 2ON8A 3ZRCA 1YD8U 5E6PA 1IBXB 1M7RA 3EGRA 4YXDB 1WM3A 1QF6A 5I2SA 3DCGA 1OQQA 1W1DA 1AQCA 2KJ6A 2JY6A 1JW9D 4A90A 2LMCA 3QARA 4ZRKA 5IJMA 1V9JA 3ZNID 1XX0A 1KLVA 1GB1A 3AJ4A 4AUQC 1V89A 4WWPA 4CO7A 3QQ8B 1WJUA 3PRZA
chains in the Genus database with same CATH topology
4BVUC 1WXSA 1WGYA 4GN1A 4HK2A 4B95A 1NI2A 2KVRA 3SO6A 2N1WA 2KNBA 2WH5A 4K17A 5L83A 2DZIA 2HD5B 2MBQA 5DCNA 2ELBA 3HHMA 2KJRA 3DBLI 1J8CA 5D94A 1ACAA 1MK9B 2RNRB 1Q1OA 2VKIA 3ZO5B 2X18A 4HAZB 4LDTD 2K6QA 1UPQA 4NPNA 5KHOA 3A8QA 2W2XC 1TZ1A 4JK7A 2D9ZA 2MLBA 4JIOU 4AP4C 5DPWA 3GYPA 2LRUA 1GC7A 2NZ8B 5C5BB 4ILJA 2RSGA 2KX3A 3VIAA 3TFMA 1RRPB 3ENEA 4IAPA 1QZEA 3UGBB 5J2RA 5J17A 4W9JA 5KCVA 3BY4B 2QKLA 1V88A 1GUAB 1L7YA 1LXDA 4KIKB 1BTKA 5HE3A 4JKGB 3X23A 4HB2B 1EF5A 2G3QB 4KAXB 1K5DB 4E3CA 3DDCB 1BAKA 1MG8A 3Q3FA 4K7UA 4ZRIA 5DPTA 4M8NA 4C0AA 1DDMA 2ZVOA 4MELA 1AWEA 1UGMA 1UNRA 2DYBA 4LJOB 1ST7A 4GXBA 1U5EA 4B6HA 1UBIA 2KFJA 1NDDA 3WAMA 3UIPB 4NY0A 1ZSQA 4NJ7A 3L17A 5J3YA 3FSSA 2GCLA 2C9WB 4MGZE 1WYWB 3W1YA 3QA8A 4HXDA 3PVUA 4G3XB 2ELAA 2LGDA 3VVWB 1Y8RC 1SGHA 3DBRI 4JLCA 2YLMA 1X1FA 3ZUNA 4W9CA 4K1RB 1WGDA 1ZC3B 3OLMD 2R2QA 1XT9B 4EKUA 1NBFC 1W1HA 3QAQA 1WGHA 2Z0QA 3CSFA 2IO1B 2ZZPB 4JL9A 3R66C 4CHJA 2R82A 1WY8A 2W9NA 1WJ4A 3UZTA 2O6VD 3VQIA 2I1KA 3TL5A 1WR6E 4A3OA 4K7WA 3T06A 2NCNA 2KKCA 1J19A 3K9PB 4K81A 2BF8B 5CTRC 3H7SA 4IFSA 1V61A 3ZNZB 1FHWA 3FEHA 3N30A 3W1SC 1J0WA 2V4LA 3EFUA 4JKEA 2C5LC 2NR2A 2WWZA 2H7EA 2KX0A 1Q0WB 3WYFB 1YJ1A 1WJMA 2K8BA 3CMMB 3GZNI 2YRYA 4GMXB 3PSCA 3NY5A 4BBKA 4URKA 1XR0B 3V61A 3LJUX 3M1IB 1IP9A 2KMAA 1MAIA 4A6HA 3ZW3A 4DWFA 4JKAA 2PEAA 2DYQA 2L2IA 1I42A 2DZJA 2G45B 1P1AA 5FR6A 1MIXA 2FJLA 5EDSA 2KD0A 3APDA 1UNQA 1WZ3A 3DVNV 2MBEA 1IPGA 4A6FA 1KOTA 5HE1A 5L95C 1C1YB 2WX0A 3V6EB 2MWNB 1WX8A 2LOZA 1KM7A 1U5GA 3CXBB 3ZTCA 4IUMB 3UQAA 2BYEA 1H8CA 4KHAA 2HTHA 3B08A 3B0AA 2MKRA 2RPQA 1V5UA 2D2QA 2JT4B 4K7SA 1XD3B 5JHHA 2MDXA 3GOEA 1GGOA 2CRFA 1L2NA 4HCNB 4W9LA 3V60A 4F7ZA 4E71A 3QIJA 4ICUA 2BYFA 4L6EA 3M63B 4G11A 3ZRFA 2ZJDA 3W1SA 5DHFB 4EZKA 1TBEA 1X11A 4HDOA 5GMVA 4AJWA 4BBNF 3JYUA 1N3HA 1UEFA 2A5UA 4FA6A 4JKBA 5LXIB 2KC2A 2Y5BB 3SDLC 3ZNHB 3RCPA 2IY0B 3IFWB 3SUZA 5CHFA 5D6JB 1TGZB 1WVHA 5HE0A 4AJYB 2IO2B 4Z2NA 3JW0X 3QX1A 4DDID 2MRPA 1Y19B 4OVVA 2IO0B 2IZVB 4FHJA 2FCSA 4IM3A 1NVLA 1RRBA 2N0YA 4F7HA 2JRHA 2KDBA 1FB8A 3QJZA 1EF1A 5JVLA 2X0SA 1E7UA 3V62A 3DXDA 1W1GA 2KZRA 2D9XA 2V1YA 2ZCCA 4WJ7A 2PE9A 5LLIA 3WALA 3SU8X 3PRPB 3I3TB 3VAWA 4ANVA 4IM2A 3OJ3A 1ZGUB 2KHWB 1OQNA 2CB8A 3E66A 5LOPB 2CHWA 1WE7A 1GNUA 4KDIC 1V49A 2OJRA 2KUPA 3ODOA 4GGQA 3L0WB 3PGEA 1WGQA 2M8SA 4FJYA 3UQBA 2MCNB 3H9DA 2CY5A 4WJPA 4A6KA 2KANA 1OMWA 2DENB 2WYQA 4FULA 2KK8A 2LYDA 3DVGY 1WJNA 2LVQA 1DIKA 4PS8A 4BKSA 4ZYNA 2FIDA 3CF6E 4FJVB 5KQ4A 2PJHA 5D7GA 3KYCD 3VHTC 2JZ3B 1T0YA 3KSYA 4EFOA 2DYMA 2EJ8A 4RM8A 4LCDE 3P6AA 3SYXA 3ML4A 3PTFC 4ILHA 3ZKJC 4M0WB 3PZDA 4HHVA 3ODWA 4GMVA 2HJ8A 2LGXA 2C7NB 3MDBC 3AU5A 2MW5A 3QCAA 1FGZA 4KSLC 2WX1A 4ZDVA 4BKSD 4P7IA 2IO3B 3IHPC 4ANXA 4WWNA 4DHJB 3VFKA 2YS3A 1FXTB 2P0FA 2CHZA 4BOSC 3PS6A 4IW0A 4MK0A 5GOWB 5EFXA 4HAVB 1P98A 5JH5C 2O6VA 2MBOA 3NOBA 4NAWB 2RUKB 2MP2A 2UYZB 4WJQA 2LUEA 4ICVA 3F0WA 2KTRB 2D07B 3G9WA 3KRXA 3KUDB 3GYOA 3TO1A 2DN6A 2COPA 1WX7A 3O96A 5G2NA 4FLHA 2WDTB 1V86A 1WM2A 2RGFA 1XODA 3RZFA 4NJ6A 5DHAB 3PLVA 3HW2B 2LRWA 1A5RA 1WI1A 5L81A 2FUHB 1H10A 3VH4B 2G35A 2A4ZA 4H8SA 4FADA 5J18A 5TR5A 3V6CB 3NS8A 1RLFA 2MSED 3A1QB 1X86A 3PVLA 1WFYA 2KWUB 5AZGA 2UVMA 2L00B 2J0MA 3CIKA 3K9OB 4FN2A 2KMCA 1E8YA 1BTNA 3FP5A 1LFDA 5AEKB 2XQNM 2DHJA 4LJPB 1TXDA 2LVPA 5D3XA 4MSMB 5LONB 2BKFA 3L13A 2GS0A 3KUCB 2K39A 1VBHA 1SHCA 4Y94A 4MJSB 1E8XA 3SV1A 2C7HA 1V80A 1WGGA 4CHKA 2V76A 3ZTDA 3SD5A 2N1VA 3HIZA 2KLGA 4IC7B 1RJ2A 1R4NI 3ML9A 4JKCA 3ZNGC 2DA0A 3JSVA 3T9LA 2YT0A 1D3ZA 2UZSA 3LDZE 2QKMA 4EZJA 1WIAA 3A9KB 1XQQA 2DZMA 2L0TA 4HDQA 4D0NB 1ISNA 2KC1A 2Z0PA 4GB9A 1PFJA 4PYUA 2NVUI 2JWZA 4GIVA 2AYOB 3TIXA 4MGIE 2AEHA 1YIWA 4DK5A 3PVWA 2BGFA 2LJ5A 5D3YA 2JRIB 1ZVRA 3PRMB 1HB6A 2CR5A 2YSZA 3NHEB 1KZGA 3EECA 2N7EA 4J6IA 2VSZA 3ZDMC 2JP2A 3ZDTA 4F1SA 5JP4A 1LW3A 2MA9B 3PP2A 3ML8A 4TYZA 5KQ1A 2V3SA 2NBWB 4BOZB 4WAAA 4MH0E 2M4NA 2CS4A 3TJPA 2ZNVB 1CMXB 2ZPYA 4WJOA 1SIFA 1Z2MA 1YX6B 3PLUA 3IVFA 1J0GA 4OVUA 4DBBA 1Y5OA 2JUOA 1X1MA 3ULCA 2MP2B 2DX5A 2LG1A 5HE2A 4W9GA 3IBEA 1UNPA 1SE9A 3E9PA 3T8MA 2LOXA 3PHWB 3VDZA 5JHAA 3L54A 4BBNC 1BT0A 3A4SC 1LB1A 2EKEC 3U7DA 4G0NB 2CHXA 4N9F4 4HAXB 2D10A 2I1JA 4AOFA 4II2B 3SBGA 3AI5A 1E7VA 2DZKA 3AU4A 1V5TA 5J3TA 4MGYE 1KZ7A 2Z0OA 2KLCA 2L05A 4IWQA 4WQOB 5CHVC 1UH6A 3DBSA 3PREA 3QC8B 4FJZA 2N7DA 4EMOA 3NSUA 2K2JA 4B6WA 4JKHA 2RGNB 3ALBA 3LJ3A 3DXEA 4DXAB 1E90A 1VD2A 2BCJA 1B55A 3A1QA 5C16A 4MSQB 4DBGA 3V5WA 1GG3A 4ILGB 1EVHA 1K8RB 2DHIA 4NAWA 1XD4A 4MT7A 2FJ9A 2RSUA 2Q13A 1V81A 2DX5B 1PLSA 1DBHA 2YVCA 2K2UA 3HK0A 1EGXA 1V5MA 2IYBA 4W9HA 4F7GA 3R7RA 3A8PA 1WGRA 1WJ1A 2ZEQA 3JSVB 5C23A 2BYVE 2DHZA 5DPRA 4MEMA 1MIZB 3WA0A 2IYDB 1KI1B 3KRWA 1UELA 2COFA 1E5WA 4F7UP 4AWJA 1GC6A 1WGUA 2REXA 1E8WA 3VUXA 4IWPA 3H6NA 1U27A 1ZW7A 2R0DA 2KQSA 5CLQB 3PG7A 4HWIB 4I6NB 5LXHA 5CLLB 5C1ZA 2XEWA 3ZVVA 2RLOA 2YF0A 3VTVA 3F5RA 2MBBB 4F8CB 2LBBA 3PEGA 2O2VB 2KXJA 2DTCA 2HRJA 2FIFA 1ZM0A 5C5BA 3HM3A 3WIMA 4I6LB 2XK5B 2L3ZA 2CODA 2Z0DB 3QWMA 2M1MA 2XBBC 2KJHB 3ODXA 3VH3B 1RFAA 2C60A 4EJNA 2BWES 4KZ0A 5HKHA 5FI1A 2KO3A 3SNHA 1NTYA 3RCZA 4TKNA 2KN5A 3RT3B 1JDEA 4GOCA 3A9JB 1U2BA 2FCQA 2G4SA 4A6FB 4TV3A 4MGKE 2YS1A 2KWVB 3ULBA 4M8MA 2DIKA 2AL3A 1GJZA 2M38A 5DPSA 2DX1A 1V5OA 4W9FA 2CU1A 1YX5B 4BFRA 4MJSA 2ZNVC 4GDKA 2PPHA 3M3JA 3IG3A 2PE6B 1EUVB 4IWOA 2UWQA 3A98B 4E74A 3R7QA 4JKFA 4I6PA 4G50A 4CYEA 4DHZE 2D3GA 2VRWB 2NPTB 3H7PB 1OEYA 2DFKA 2Y7BA 2ROZB 2RR9A 5KHQA 3RZWC 5DIFB 4YONA 2CY4A 1DROA 2IBIB 1KBLA 1H4RA 2LWPA 2NBVB 2LASA 4KZCA 4GZUA 3WAOA 2EC1A 3FLVA 3QBVB 4Z2MB 3MTNB 3EPYA 4FHKA 3DBHI 2KGXB 4KHOA 3SBTA 4BKTA 2JF5A 1C3TA 2W2XD 2ABDA 3PT2B 1UBQA 1AARA 3JVZX 2B3AA 1ZC4B 4TQ1A 1P0RA 2MX2A 4X57B 3EC8A 4NQKE 3P2BA 1WZ0A 1HBKA 1P9DU 3TVVA 2C7MB 2COAA 1DDWA 2LVOA 3PV1A 2GOWA 1V6EA 4IOYX 2ZCBA 4HCPB 1DDVA 3UIOB 5C6RA 3D8DA 1WXMA 3ZLZA 2OQBA 5E6OA 4DHZB 4FBJB 3N32A 2W2WA 1OQYA 1ZKHA 2K6DB 2KOXA 1WXVA 2FDQA 2VRRB 4GDLA 5CHWA 3TMPB 2NMBA 3BINA 4W9KA 5D2MB 3Q3JA 2HE7A 1LQBA 1XKEA 2D9VA 1P3QU 2NS5A 1K5GB 1UPRA 5DI9B 4XC2A 3CSTA 1IRSA 3N7CA 2DAFA 4EOYA 2M0XA 2Y8GA 2LGYA 2BKRB 3QWZB 2JPHA 4HB0B 5C79A 3N3KB 4JQWC 4GDLB 3PSEB 2KDIA 3RULA 4KVGB 3B1LX 4IM0A 1OGWA 2L76A 2N9XA 3DOWA 3DQVA 4B9KA 4PS7A 1QC6A 1DYNA 2N9EB 4HB3B 2KTRA 2LKOA 3NZUA 2JZZA 1WI0A 3MJWA 2FAZA 3A33B 1KJTA 4NNJB 1QQGA 2ASQA 1WMHA 4PNKA 3VTWA 3ECIA 3E9OA 4BKGA 4K2OA 3VTUA 3APCA 3AULA 1S1QB 2NPTA 4IG7B 3MHSD 3DPDA 2ZVNA 1P5TA 2D9YA 2P8VA 2GCJA 2K8HA 1OEYJ 3D8FA 3OJ4B 5IA7A 2M17A 4ZRJA 3VUWA 2O6VB 2L7RA 3EHVA 4NSWA 1VBGA 4GU2A 4KHBB 2G4DB 2M14A 3QHTA 1TQZA 2KCJA 2YS5A 4JGHB 2KTFA 2KQ7A 2Y8FA 4DX90 3OAWA 4MDKE 2P0HA 2LXCA 2DLWA 2MWSB 1HB8A 4W9EA 3UINB 2DHKA 5AZHA 3A9JA 3H1UA 4TQ0A 2BWFA 5D27A 3KW5B 1Z5SB 1P3RA 4A20A 2IFSA 1X1GA 3ZIMA 4PYZA 4HJKA 2R09A 4DX8A 2GMIC 2ZPNA 4TUUA 1WRDB 4CHMA 5JHBA 4A5KA 2LD9A 1E8ZA 4YL8A 1PQSA 4HVBA 2HTHB 3D8EA 3QK0A 4WWOA 2MQJA 4HAUB 2GJYA 2KFKA 2RQ1A 5AZFA 2DKPA 3P7ZA 2J0KA 3DVGX 3A9KA 3PPAA 2CKHB 4W9IA 1Q5WB 2AWTA 2L0FA 1M94A 2J7QB 5J3QA 1WX9A 1MKEA 3APFA 5JLJB 3R3MA 3DVNU 5DH9B 2K25A 4KSKC 3X0WA 2LULA 2LXAA 3RYTA 3ZVRA 2ROVA 2BPSA 2O2VA 1WF9A 1P6SA 4NQLB 4JKDA 2EMSA 2N4FA 2COCA 3MPXA 1RAXA 3WAPA 1V2YA 1WR1A 4HAWB 1IYFA 3L10B 1Q67A 4XWXA 4PS3A 4JK8A 1NTVA 3FM8C 4II3B 1OTRB 2H7DA 1WMHB 2GBKA 2LZ6A 3KYDD 4ANWA 1U4AA 1UZXB 2RVBB 4DDGD 2QHOA 2NBUA 2L1CA 3AXCA 1U5FA 4HPLB 1WH3A 2OTXA 1MK7B 4GPTB 2XK5A 3WANA 4RM9A 4WSFA 1VCBA 4KDLB 5IAAC 2D9WA 1YQBA 1I7AA 1U5DA 2GBJA 4KIKA 2J59M 2DAJA 1BWNA 3RUIB 2K00A 4JKGA 1WXAA 4RMAA 3HQCA 1WG7A 3NZSA 2D4QA 3D32A 3SHQA 4EZLA 3C0RB 1FAOA 3OANA 2GBMA 3M62B 5G55A 3O65B 2DKQA 2KWCA 4PQ0A 3A4RA 4MY6A 2D11A 1FGYA 1TTNA 2CQUA 1HE8A 2KDFB 2Z0EB 1F9JA 1V5PA 1I2HA 2J0JA 1LM8B 3BJIA 3U8ZA 3KZ1A 2DYNA 5D3VA 3TBLD 4HB4B 2KDEB 2RD0A 4JK9A 1OY2A 1NU2A 1S3SG 1UD7A 2OOBB 2JXXA 4HATB 1WE6A 1I35A 3M95A 4KV2A 3KH0A 3VUYA 4EUTA 2ADZA 2FCMA 1EO6A 1R4MI 3VOQA 3KVFB 2K8CA 1FHOA 1PMSA 2K1FA 3HM6X 1XCGA 4HAYB 2Z59B 2MBHA 5CX3A 1TJ6A 5JZEB 4DHJD 3TCAA 2N23A 2KFKB 2R2OA 1FOEA 5D3WA 1KC7A 2GBNA 2LI5A 4XX5A 1Z87A 2JVCA 3TW1A 5E6NA 4ANUA 3L16A 2MFQA 4W9DA 1JRUA 2L8JA 2FCNA 3UF8A 2N9PC 2P0DA 4A3PA 2E2XA 2EMTA 1MPHA 2GBRA 3PHXB 4EEWA 3E9LA 4HLEA 4MM3A 3KY9A 3S2AA 2CAYA 3ENBA 4XZ4A 3KUZA 2I5CA 2FNJB 2I5FA 4GSWA 4ASWC 3VXWA 2IY1B 1U29A 4K2PA 3L08A 1X05A 1G6JA 4WVFB 2YT1A 1M7EA 4GDKB 4WJNA 2AL6A 2UZRA 3DXCA 5BO4B 1NTIA 1EAZA 1FHXA 3ONSA 3U30A 5JHGA 4LDTB 3RD2A 1WJ6A 4HPMB 5FI0A 3H7PA 2PZ1A 2DYOA 3ZRCA 1YD8U 5E6PA 1M7RA 1WM3A 3DCGA 1W1DA 1AQCA 2KJ6A 2JY6A 3QARA 4ZRKA 5IJMA 1V9JA 3ZNID 1XX0A 1KLVA 3AJ4A 4AUQC 1V89A 4WWPA 4CO7A 3QQ8B 1WJUA 3PRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBS A;  4BVU C;  3PRE A;  2G4D B;  1WXS A;  2M14 A;  3I3T B;  3QC8 B;  1TQZ A;  2KCJ A;  2YS5 A;  1WGY A;  3QHT A;  4FJZ A;  4JGH B;  2N7D A;  4IM2 A;  2KTF A;  4EMO A;  3OJ3 A;  1ZGU B;  4GN1 A;  3NSU A;  2K2J A;  2KQ7 A;  2Y8F A;  4DX9 0;  4HK2 A;  2RGN B;  4B6W A;  3ALB A;  3OAW A;  4MDK E;  2KHW B;  4B95 A;  1NI2 A;  2P0H A;  2LXC A;  1OQN A;  3LJ3 A;  2CB8 A;  2DLW A;  5LOP B;  2KVR A;  2MWS B;  3SO6 A;  3DXE A;  4DXA B;  2N1W A;  1HB8 A;  2CHW A;  2KNB A;  4W9E A;  3UIN B;  1E90 A;  1VD2 A;  1WE7 A;  2BCJ A;  1GNU A;  4KDI C;  1V49 A;  2DHK A;  2OJR A;  1B55 A;  2KUP A;  3A1Q A;  3ODO A;  5C16 A;  4GGQ A;  4MSQ B;  5AZH A;  4DBG A;  3L0W B;  3V5W A;  3PGE A;  1GG3 A;  1WGQ A;  1EVH A;  2WH5 A;  2DHI A;  4K17 A;  1K8R B;  3A9J A;  1XD4 A;  2M8S A;  4NAW A;  5L83 A;  4MT7 A;  4FJY A;  2FJ9 A;  4HVB A;  3H1U A;  4TQ0 A;  3UQB A;  2RSU A;  2Q13 A;  2DZI A;  1V81 A;  2HD5 B;  3H9D A;  2BWF A;  5D27 A;  2CY5 A;  2MBQ A;  1Z5S B;  3KW5 B;  5DCN A;  1P3R A;  2ELB A;  4A20 A;  2DX5 B;  3HHM A;  1PLS A;  1DBH A;  2IFS A;  2KJR A;  3DBL I;  1X1G A;  2YVC A;  3ZIM A;  4WJP A;  4PYZ A;  4HJK A;  2K2U A;  2R09 A;  3HK0 A;  4A6K A;  4DX8 A;  1EGX A;  2GMI C;  2ZPN A;  4TUU A;  2KAN A;  5D94 A;  1J8C A;  1WRD B;  1ACA A;  1MK9 B;  2RNR B;  1Q1O A;  1V5M A;  2VKI A;  2IYB A;  4CHM A;  4W9H A;  4F7G A;  5JHB A;  3ZO5 B;  2X18 A;  4E3C A;  1OMW A;  3R7R A;  4BKS A;  4HAZ B;  4A5K A;  2LD9 A;  4LDT D;  3ZNH B;  1E8Z A;  2DEN B;  4YL8 A;  3A8P A;  2K6Q A;  1PQS A;  2HTH B;  2WYQ A;  1WGR A;  3D8E A;  1WJ1 A;  2ZEQ A;  1UPQ A;  3JSV B;  3QK0 A;  4WWO A;  5C23 A;  4NPN A;  4FUL A;  2MQJ A;  2KK8 A;  4HAU B;  2GJY A;  2LYD A;  3A8Q A;  2KFK A;  2RQ1 A;  5KHO A;  2BYV E;  5AZF A;  3DVG Y;  1WJN A;  2LVQ A;  2DHZ A;  5DPR A;  4MEM A;  4PS8 A;  3RUI B;  1MIZ B;  2W2X C;  1TZ1 A;  2DKP A;  3WA0 A;  2D9Z A;  2MLB A;  4JIO U;  2FID A;  4ZYN A;  4AP4 C;  3P7Z A;  2IYD B;  1KI1 B;  3KRW A;  1UEL A;  3CF6 E;  3GYP A;  2COF A;  2J0K A;  1E5W A;  5KQ4 A;  2LRU A;  1GC7 A;  2PJH A;  2NZ8 B;  4F7U P;  3KYC D;  3DVG X;  5C5B B;  4AWJ A;  3VHT C;  1GC6 A;  1WGU A;  2RSG A;  2KX3 A;  2REX A;  1E8W A;  3VIA A;  2JZ3 B;  3A9K A;  3TFM A;  3PPA A;  2CKH B;  1T0Y A;  3KSY A;  4W9I A;  1Q5W B;  2DYM A;  1RRP B;  3VUX A;  4IWP A;  4EFO A;  3H6N A;  2AWT A;  1U27 A;  2EJ8 A;  2L0F A;  4IAP A;  1QZE A;  3ENE A;  4RM8 A;  1ZW7 A;  1M94 A;  3P6A A;  2J7Q B;  4LCD E;  4W9J A;  5J3Q A;  3UGB B;  5J17 A;  5KCV A;  2R0D A;  1WX9 A;  3SYX A;  3BY4 B;  2KQS A;  2QKL A;  1MKE A;  3APF A;  1V88 A;  5JLJ B;  3R3M A;  5CLQ B;  3DVN U;  3ML4 A;  3PTF C;  3PG7 A;  5DH9 B;  1GUA B;  1L7Y A;  1LXD A;  5CLL B;  2K25 A;  4HWI B;  4I6N B;  3EFU A;  4KSK C;  4M0W B;  3ZKJ C;  3PZD A;  3X0W A;  4HHV A;  2LUL A;  4KIK B;  5C1Z A;  3ODW A;  4GMV A;  2LXA A;  2XEW A;  2HJ8 A;  3RYT A;  3ZVV A;  3ZVR A;  1BTK A;  5HE3 A;  2RLO A;  2ROV A;  2YF0 A;  2LGX A;  2C7N B;  3VTV A;  2BPS A;  2O2V A;  3MDB C;  3AU5 A;  3F5R A;  2MBB B;  4F8C B;  2LBB A;  3X23 A;  4HB2 B;  3PEG A;  1EF5 A;  1WF9 A;  1P6S A;  2KXJ A;  2MW5 A;  2G3Q B;  1FGZ A;  4KAX B;  2O2V B;  3QCA A;  4NQL B;  1K5D B;  2EMS A;  2DTC A;  2HRJ A;  2N4F A;  2FIF A;  4KSL C;  2COC A;  2WX1 A;  1BAK A;  1MG8 A;  3DDC B;  3Q3F A;  4BKS D;  4ZDV A;  1ZM0 A;  4K7U A;  4P7I A;  4ZRI A;  2IO3 B;  3IHP C;  4ANX A;  5C5B A;  3HM3 A;  3MPX A;  1RAX A;  3WAP A;  3WIM A;  1V2Y A;  4WWN A;  4DHJ B;  4I6L B;  3VFK A;  2YS3 A;  1FXT B;  1WR1 A;  4HAW B;  5DPT A;  2XK5 B;  4M8N A;  2L3Z A;  2COD A;  2Z0D B;  3QWM A;  1IYF A;  4C0A A;  2M1M A;  3L10 B;  1DDM A;  2P0F A;  2CHZ A;  2XBB C;  2KJH B;  3ODX A;  3VH3 B;  2ZVO A;  4MEL A;  4BOS C;  1Q67 A;  1AWE A;  3PS6 A;  4XWX A;  1RFA A;  1UGM A;  1UNR A;  2C60 A;  2DYB A;  4IW0 A;  4MK0 A;  1NTV A;  3FM8 C;  5GOW B;  4PS3 A;  4LJO B;  5EFX A;  4EJN A;  2BWE S;  1ST7 A;  4GXB A;  4II3 B;  4HAV B;  1OTR B;  1U5E A;  2H7D A;  1P98 A;  4B6H A;  1WMH B;  1UBI A;  2GBK A;  2LZ6 A;  4KZ0 A;  2KFJ A;  5FI1 A;  2KO3 A;  5HKH A;  5JH5 C;  3KYD D;  2O6V A;  3SNH A;  1NDD A;  2MBO A;  1NTY A;  3WAM A;  3RCZ A;  4TKN A;  3UIP B;  4ANW A;  2KN5 A;  4NY0 A;  3RT3 B;  1U4A A;  1UZX B;  2RVB B;  3A9J B;  1ZSQ A;  2RUK B;  3NOB A;  4GOC A;  4NAW B;  1U2B A;  1L2N A;  4DDG D;  2MP2 A;  2QHO A;  2FCQ A;  5LXH A;  2G4S A;  2NBU A;  2L1C A;  4NJ7 A;  2UYZ B;  5J3Y A;  3L17 A;  3FSS A;  4WJQ A;  4A6F B;  2LUE A;  3AXC A;  1U5F A;  2GCL A;  4HPL B;  2C9W B;  4MGZ E;  1WH3 A;  4TV3 A;  1WYW B;  4ICV A;  4MGK E;  2OTX A;  3F0W A;  3W1Y A;  1MK7 B;  2KTR B;  3QA8 A;  4HXD A;  3PVU A;  2D07 B;  2YS1 A;  4GPT B;  3G9W A;  3KRX A;  2KWV B;  3KUD B;  4G3X B;  2ELA A;  3GYO A;  3ULB A;  3TO1 A;  2XK5 A;  2DN6 A;  2LGD A;  4RM9 A;  3VVW B;  3WAN A;  4WSF A;  1Y8R C;  2COP A;  1VCB A;  4KDL B;  5IAA C;  2D9W A;  4M8M A;  1WX7 A;  1SGH A;  3DBR I;  3O96 A;  4JLC A;  5G2N A;  4FLH A;  2WDT B;  1V86 A;  1WM2 A;  1I7A A;  1U5D A;  1YQB A;  2AL3 A;  2GBJ A;  2YLM A;  4KIK A;  1GJZ A;  1X1F A;  2M38 A;  3ZUN A;  2RGF A;  2J59 M;  4W9C A;  4FJV B;  1XOD A;  5DPS A;  4K1R B;  1WGD A;  1BWN A;  2DX1 A;  1ZC3 B;  1V5O A;  2DAJ A;  3OLM D;  2K00 A;  1WXA A;  1YX5 B;  2CU1 A;  2R2Q A;  4RMA A;  4W9F A;  5D7G A;  1XT9 B;  3RZF A;  4BFR A;  4MJS A;  4EKU A;  1NBF C;  2ZNV C;  4GDK A;  2PPH A;  4NJ6 A;  5DHA B;  3M3J A;  1W1H A;  3HQC A;  3IG3 A;  3QAQ A;  3PLV A;  1WGH A;  2PE6 B;  1EUV B;  3HW2 B;  2Z0Q A;  3CSF A;  2LRW A;  4IWO A;  1A5R A;  1WI1 A;  5L81 A;  2FUH B;  2IO1 B;  2ZZP B;  1WG7 A;  3R66 C;  1H10 A;  3NZS A;  2D4Q A;  4CHJ A;  3D32 A;  4JL9 A;  3SHQ A;  4EZL A;  2UWQ A;  3VH4 B;  3A98 B;  4E74 A;  3C0R B;  3R7Q A;  2G35 A;  4AJY B;  1WY8 A;  2A4Z A;  1WJ4 A;  2W9N A;  4G50 A;  3UZT A;  4I6P A;  4CYE A;  2O6V D;  1FAO A;  4H8S A;  3OAN A;  3VQI A;  4FAD A;  4DHZ E;  2I1K A;  3TL5 A;  2D3G A;  2VRW B;  2NPT B;  1WR6 E;  3H7P B;  4A3O A;  5J18 A;  1OEY A;  5TR5 A;  2DFK A;  4K7W A;  3V6C B;  2GBM A;  3NS8 A;  2Y7B A;  3M62 B;  5DPW A;  3T06 A;  2ROZ B;  2NCN A;  5G55 A;  2KKC A;  2RR9 A;  5KHQ A;  1J19 A;  1RLF A;  3O65 B;  3RZW C;  5DIF B;  2MSE D;  2DKQ A;  4YON A;  2CY4 A;  3K9P B;  2KWC A;  3A1Q B;  4K81 A;  1DRO A;  2BF8 B;  2IBI B;  1H8C A;  4PQ0 A;  5CTR C;  1X86 A;  3PVL A;  3A4R A;  1H4R A;  1WFY A;  2LWP A;  4MY6 A;  2NBV B;  3H7S A;  2D11 A;  2LAS A;  4GZU A;  4KZC A;  4IFS A;  3WAO A;  1FGY A;  2KWU B;  5AZG A;  2EC1 A;  1TTN A;  3FLV A;  3QBV B;  2UVM A;  2L00 B;  2J0M A;  2CQU A;  1V61 A;  3ZNZ B;  1FHW A;  1HE8 A;  3FEH A;  4Z2M B;  3N30 A;  3MTN B;  3CIK A;  3W1S C;  3EPY A;  1J0W A;  3K9O B;  2KDF B;  4W9D A;  2Z0E B;  2V4L A;  4FHK A;  4FN2 A;  3DBH I;  1F9J A;  2KMC A;  2KGX B;  1E8Y A;  1V5P A;  1BTN A;  3FP5 A;  1I2H A;  2J0J A;  4KHO A;  1LFD A;  3BJI A;  3U8Z A;  1LM8 B;  2C5L C;  4BKT A;  5AEK B;  2XQN M;  2NR2 A;  2H7E A;  2WWZ A;  2KX0 A;  3KZ1 A;  2DHJ A;  2JF5 A;  2W2X D;  1C3T A;  4LJP B;  1TXD A;  2DYN A;  1Q0W B;  2ABD A;  5D3X A;  3WYF B;  1UBQ A;  1AAR A;  1YJ1 A;  2LVP A;  3JVZ X;  3PT2 B;  4MSM B;  1WJM A;  5D3V A;  1ZC4 B;  2B3A A;  4TQ1 A;  3TBL D;  1P0R A;  4HB4 B;  5LON B;  2K8B A;  2MX2 A;  2KDE B;  2RD0 A;  4X57 B;  4URK A;  3EC8 A;  1OY2 A;  1NU2 A;  3CMM B;  4NQK E;  3GZN I;  2YRY A;  2BKF A;  1WZ0 A;  4GMX B;  1S3S G;  3PSC A;  3P2B A;  3L13 A;  1HBK A;  2GS0 A;  3TVV A;  4BBK A;  1P9D U;  3KUC B;  2C7M B;  3NY5 A;  2COA A;  1UD7 A;  1DDW A;  2LVO A;  1XR0 B;  2K39 A;  2OOB B;  3V61 A;  2JXX A;  1SHC A;  3LJU X;  4Y94 A;  3M1I B;  3PV1 A;  1IP9 A;  4MJS B;  1E8X A;  2KMA A;  4HAT B;  3SV1 A;  1MAI A;  1WE6 A;  4A6H A;  1I35 A;  2C7H A;  2GOW A;  1V80 A;  1WGG A;  1V6E A;  3M95 A;  3ZW3 A;  4CHK A;  4IOY X;  2ZCB A;  4HCP B;  4DWF A;  1DDV A;  3UIO B;  4KV2 A;  5C6R A;  3KH0 A;  3VUY A;  2V76 A;  3ZTD A;  2ADZ A;  2PEA A;  4EUT A;  3D8D A;  3SD5 A;  2FCM A;  2N1V A;  3HIZ A;  2DYQ A;  1EO6 A;  1R4M I;  3VOQ A;  3KVF B;  1WXM A;  2KLG A;  3ZLZ A;  2K8C A;  2OQB A;  1FHO A;  5E6O A;  4IC7 B;  1PMS A;  2L2I A;  1RJ2 A;  2K1F A;  4DHZ B;  3HM6 X;  1XCG A;  1I42 A;  4HAY B;  2Z59 B;  2MBH A;  5CX3 A;  4FBJ B;  3N32 A;  1R4N I;  3ML9 A;  2W2W A;  1TJ6 A;  2DZJ A;  1OQY A;  1ZKH A;  2K6D B;  2G45 B;  5JZE B;  1P1A A;  4DHJ D;  2KOX A;  5FR6 A;  3TCA A;  1WXV A;  2FDQ A;  3ZNG C;  1MIX A;  2DA0 A;  2FJL A;  2N23 A;  3JSV A;  2VRR B;  5EDS A;  4GDL A;  3T9L A;  2KD0 A;  2YT0 A;  1D3Z A;  2KFK B;  2R2O A;  3APD A;  5CHW A;  3TMP B;  1UNQ A;  2NMB A;  3VAW A;  1FOE A;  2UZS A;  3LDZ E;  4ANV A;  2QKM A;  3BIN A;  1WIA A;  4W9K A;  4EZJ A;  5D3W A;  1WZ3 A;  2GBN A;  2LI5 A;  3A9K B;  2MBE A;  3DVN V;  3Q3J A;  5D2M B;  1XQQ A;  2HE7 A;  4XX5 A;  2DZM A;  1LQB A;  1XKE A;  1Z87 A;  2D9V A;  1P3Q U;  2JVC A;  2NS5 A;  1K5G B;  2L0T A;  3TW1 A;  1IPG A;  4HDQ A;  1UPR A;  4A6F A;  1KOT A;  5HE1 A;  5E6N A;  5L95 C;  5DI9 B;  4D0N B;  4XC2 A;  4ANU A;  3CST A;  1ISN A;  1C1Y B;  3L16 A;  2KC1 A;  2WX0 A;  3V6E B;  2MFQ A;  1IRS A;  2MWN B;  2Z0P A;  1JRU A;  3N7C A;  1WX8 A;  2FCN A;  2LOZ A;  1KM7 A;  2L8J A;  3UF8 A;  2DAF A;  1U5G A;  2N9P C;  3CXB B;  4GB9 A;  4IUM B;  3ZTC A;  4EOY A;  3UQA A;  1PFJ A;  2M0X A;  2Y8G A;  2BYE A;  2LGY A;  4PYU A;  2BKR B;  2JWZ A;  2NVU I;  2P0D A;  2AYO B;  4GIV A;  4KHA A;  3QWZ B;  4MGI E;  2AEH A;  3TIX A;  2JPH A;  2HTH A;  1YIW A;  3B08 A;  4A3P A;  4DK5 A;  4HB0 B;  3B0A A;  2E2X A;  5C79 A;  2EMT A;  3PVW A;  3N3K B;  4JQW C;  2MKR A;  4GDL B;  1MPH A;  2BGF A;  1V5U A;  2LJ5 A;  2RPQ A;  5D3Y A;  2JRI B;  1ZVR A;  3PRM B;  1HB6 A;  2D2Q A;  3PSE B;  2CR5 A;  2JT4 B;  2KDI A;  2YSZ A;  3NHE B;  4K7S A;  2GBR A;  3PHX B;  3RUL A;  1XD3 B;  1KZG A;  3EEC A;  4EEW A;  4KVG B;  2MDX A;  5JHH A;  3GOE A;  4HLE A;  2N7E A;  3B1L X;  2CRF A;  1OGW A;  2L76 A;  4HCN B;  4IM0 A;  4J6I A;  4W9L A;  2N9X A;  3DOW A;  4MM3 A;  3V60 A;  3KY9 A;  4F7Z A;  3S2A A;  2CAY A;  4E71 A;  2VSZ A;  3DQV A;  3ZDM C;  2JP2 A;  3QIJ A;  4B9K A;  3ZDT A;  4PS7 A;  1QC6 A;  5JP4 A;  4ICU A;  1DYN A;  2N9E B;  2BYF A;  3KUZ A;  4XZ4 A;  4HB3 B;  4F1S A;  4L6E A;  2KTR A;  3M63 B;  1LW3 A;  2MA9 B;  2LKO A;  4G11 A;  3NZU A;  2JZZ A;  3ZRF A;  2ZJD A;  3PP2 A;  2I5C A;  3ML8 A;  3W1S A;  4TYZ A;  1WI0 A;  2I5F A;  2FNJ B;  5DHF B;  4EZK A;  3MJW A;  1TBE A;  4GSW A;  4ASW C;  5KQ1 A;  2FAZ A;  1X11 A;  2NBW B;  4HDO A;  2V3S A;  5GMV A;  3VXW A;  4BOZ B;  2IY1 B;  1U29 A;  4WAA A;  4MH0 E;  4AJW A;  2M4N A;  3JYU A;  4BBN F;  2CS4 A;  4K2P A;  3TJP A;  2ZNV B;  1CMX B;  1X05 A;  1N3H A;  3L08 A;  1UEF A;  3A33 B;  1KJT A;  4NNJ B;  1QQG A;  2ZPY A;  4WJO A;  2A5U A;  2ASQ A;  4FA6 A;  1G6J A;  1SIF A;  1WMH A;  4WVF B;  4PNK A;  1Z2M A;  2YT1 A;  1YX6 B;  1M7E A;  3IVF A;  3PLU A;  3VTW A;  5LXI B;  1J0G A;  4GDK B;  2KC2 A;  4WJN A;  2AL6 A;  3ECI A;  4OVU A;  4DBB A;  1Y5O A;  4BKG A;  2Y5B B;  4K2O A;  1X1M A;  2JUO A;  3SDL C;  2UZR A;  3ULC A;  3RCP A;  2IY0 B;  3IFW B;  3DXC A;  3SUZ A;  2MP2 B;  5BO4 B;  5CHF A;  2MCN B;  3VTU A;  5D6J B;  5J2R A;  1TGZ B;  3APC A;  1NTI A;  2DX5 A;  2LG1 A;  5HE2 A;  3AUL A;  1WVH A;  1S1Q B;  4W9G A;  1EAZ A;  1FHX A;  3IBE A;  1UNP A;  5HE0 A;  2NPT A;  1SE9 A;  3ONS A;  2IO2 B;  4IG7 B;  5JHG A;  4Z2N A;  4LDT B;  3RD2 A;  3JW0 X;  3MHS D;  3QX1 A;  3T8M A;  3U30 A;  4DDI D;  2LOX A;  2MRP A;  3PHW B;  1WJ6 A;  4HPM B;  3DPD A;  5FI0 A;  3VDZ A;  1Y19 B;  4OVV A;  5JHA A;  2ZVN A;  3H7P A;  1P5T A;  2IO0 B;  2IZV B;  4FHJ A;  2FCS A;  3L54 A;  2D9Y A;  1NVL A;  4IM3 A;  4BBN C;  1RRB A;  2N0Y A;  1BT0 A;  2P8V A;  2GCJ A;  2PZ1 A;  4F7H A;  2DYO A;  2K8H A;  2JRH A;  3A4S C;  1OEY J;  3ZRC A;  3D8F A;  1YD8 U;  2KDB A;  3OJ4 B;  1FB8 A;  1LB1 A;  2M17 A;  2EKE C;  5E6P A;  3QJZ A;  1EF1 A;  5IA7 A;  1M7R A;  4ZRJ A;  3VUW A;  2O6V B;  3U7D A;  2L7R A;  4G0N B;  1WM3 A;  2CHX A;  1E7U A;  4HAX B;  4N9F 4;  2D10 A;  3DCG A;  2I1J A;  4AOF A;  4II2 B;  1W1D A;  1AQC A;  3DXD A;  2KJ6 A;  3AI5 A;  3V62 A;  2JY6 A;  3EHV A;  1E7V A;  4NSW A;  2DZK A;  3QAR A;  4ZRK A;  5IJM A;  3AU4 A;  1W1G A;  2D9X A;  1V9J A;  1V5T A;  2KZR A;  2V1Y A;  2ZCC A;  1XX0 A;  5J3T A;  4MGY E;  3ZNI D;  1KLV A;  1KZ7 A;  2Z0O A;  2KLC A;  4WJ7 A;  2L05 A;  4GU2 A;  3AJ4 A;  4IWQ A;  4AUQ C;  1V89 A;  4WQO B;  5CHV C;  4WWP A;  4CO7 A;  2PE9 A;  5LLI A;  3WAL A;  3QQ8 B;  1UH6 A;  1WJU A;  3PRZ A;  3SU8 X;  3PRP B;  4KHB B; 
#chains in the Genus database with same CATH topology
 4BVU C;  5G5H A;  1WXS A;  4KX6 B;  1FIQ A;  1WGY A;  1MI1 A;  1MVK A;  1QKZ A;  4GN1 A;  4HK2 A;  4QJ5 B;  4B95 A;  1NI2 A;  1GAQ B;  3Q8F A;  4B0M A;  2KVR A;  3SO6 A;  2N1W A;  2KNB A;  4OZA A;  4QXA B;  1FCL A;  2MEK A;  1T0Q C;  2V4I B;  1NI3 A;  2WH5 A;  4K17 A;  3DWG C;  5L83 A;  2IND C;  2FBW B;  2WU5 B;  4MAC A;  5HG2 A;  3RNG C;  2DZI A;  2HD5 B;  2MBQ A;  3RNE C;  5DCN A;  2ELB A;  1KF6 B;  3HHM A;  2KJR A;  3DBL I;  2GRI A;  1EWY C;  3AE9 B;  1J8C A;  3NVZ A;  5T8I A;  5D94 A;  1ACA A;  1MI0 A;  1MK9 B;  2RNR B;  1Q1O A;  2VKI A;  4MH8 A;  3ZO5 B;  2X18 A;  4HAZ B;  3R2T A;  4LDT D;  2K6Q A;  1UPQ A;  4NPN A;  5KHO A;  3A8Q A;  1SF0 A;  5E6J A;  2W2X C;  1TZ1 A;  4JK7 A;  2D9Z A;  2MLB A;  4JIO U;  2INC C;  4AP4 C;  5DPW A;  3GYP A;  1KLU D;  2LRU A;  1GC7 A;  2NZ8 B;  3AN1 A;  5C5B B;  2H88 B;  2V9H A;  4ILJ A;  2RSG A;  2KX3 A;  3VIA A;  3TFM A;  1SXT A;  1JRO A;  1RRP B;  3ENE A;  4IAP A;  1QZE A;  3UGB B;  5J2R A;  5J17 A;  4W9J A;  5KCV A;  1XCQ L;  3BY4 B;  1C79 A;  2QKL A;  1JML A;  1V88 A;  2QCZ A;  3Q69 A;  1PUT A;  1GUA B;  1L7Y A;  1LXD A;  2WGS A;  1CJE A;  4KIK B;  4JPS A;  1BTK A;  5HE3 A;  2UU7 A;  4JKG B;  2DWQ A;  4LNI A;  5M4Y B;  3X23 A;  4HB2 B;  1EF5 A;  1T77 A;  2G3Q B;  4KAX B;  3O13 A;  1K5D B;  4E3C A;  3DDC B;  1BAK A;  1MG8 A;  3DCX A;  3Q3F A;  4K7U A;  3BVG A;  4ZRI A;  1N62 A;  5D3D A;  4C7Y A;  1QT9 A;  2EEL A;  3AE3 B;  5DPT A;  1CK1 A;  4M8N A;  4C0A A;  1T0R C;  4CQN A;  1DDM A;  2ZVO A;  4MEL A;  3FKY A;  1AWE A;  2QEJ C;  1UGM A;  1UNR A;  2DYB A;  1PYW D;  4LJO B;  1ST7 A;  4GXB A;  3OG5 A;  1U5E A;  4B6H A;  5HHD G;  1UBI A;  2KFJ A;  2D3A A;  2MJE A;  4P6V F;  1NDD A;  3WAM A;  3UIP B;  3VR9 B;  4NY0 A;  2I38 A;  1ZSQ A;  4K3B A;  4NJ7 A;  3L17 A;  5J3Y A;  3FSS A;  1XLP A;  2GCL A;  4BAX A;  2C9W B;  4MGZ E;  4ZOH C;  1WYW B;  3W1Y A;  3QA8 A;  4HXD A;  3PVU A;  4OVZ A;  4G3X B;  2ELA A;  2WXJ A;  2LGD A;  3VVW B;  1Y8R C;  4YTN B;  1L4D B;  1SGH A;  3DBR I;  4JLC A;  3FIL A;  4KKJ A;  2YLM A;  1X1F A;  3ZUN A;  4W9C A;  4K1R B;  1WGD A;  1ZC3 B;  3I9V 1;  3OLM D;  2R2Q A;  2KIE A;  1XT9 B;  2JXT A;  4EKU A;  1NBF C;  2IPK D;  1W1H A;  3QAQ A;  1WGH A;  2BQQ A;  3R2I A;  2Z0Q A;  3CSF A;  1TS4 A;  2IO1 B;  2ZZP B;  4JL9 A;  3R66 C;  4CHJ A;  2R82 A;  4M01 A;  1WY8 A;  2W9N A;  1WJ4 A;  1ZE3 D;  3UZT A;  3I57 A;  1YOV B;  2O6V D;  3VQI A;  1N6Z A;  2I1K A;  3TL5 A;  5LG4 B;  1WR6 E;  4A3O A;  2VH1 A;  4K7W A;  3HSA A;  3T06 A;  3U4E G;  2NCN A;  3MJ5 A;  2KKC A;  1J19 A;  4A55 A;  2GI9 A;  3K9P B;  4K81 A;  2BF8 B;  5CTR C;  3H7S A;  4IFS A;  1QQR A;  2V0G A;  2D5G A;  1V61 A;  3ZNZ B;  1FHW A;  3FEH A;  3N30 A;  3W1S C;  1J0W A;  2V4L A;  2LGS A;  3BYY B;  4YTM B;  3EFU A;  4JKE A;  2KDM A;  2C5L C;  2NR2 A;  2WWZ A;  2H7E A;  2KX0 A;  1Q0W B;  3N20 C;  5BMI A;  3WYF B;  2J42 A;  1YJ1 A;  3MHZ A;  1WJM A;  2K8B A;  3P4S B;  4NAM A;  4C4V B;  3CMM B;  1WRI A;  3GZN I;  2N7J A;  3HRD D;  2YRY A;  4GMX B;  3PSC A;  3NY5 A;  4BBK A;  4ZHO A;  4URK A;  1XR0 B;  3HIE A;  2IGG A;  3V61 A;  2PVG C;  3LJU X;  3M1I B;  1IP9 A;  2KMA A;  3VRA B;  1MAI A;  3ZXV A;  4A6H A;  1YMH E;  3ZW3 A;  4DWF A;  4OW0 A;  4JKA A;  2PEA A;  2PVO D;  2DYQ A;  2KAC A;  3LB8 C;  5IP4 D;  2L2I A;  2Z4D A;  1I42 A;  1ET9 A;  1LGR A;  4N58 A;  2DZJ A;  4FXC A;  3OHM B;  2G45 B;  1DOY A;  1P1A A;  5FR6 A;  1MIX A;  2FJL A;  3GB1 A;  5EDS A;  2KD0 A;  3APD A;  1UNQ A;  3Q3O C;  1FXA A;  1D5X C;  1WZ3 A;  3DVN V;  2MBE A;  4WIP A;  3P63 A;  3IXS A;  1IPG A;  1T0S C;  4A6F A;  2BW2 A;  5BMG A;  1KOT A;  5HE1 A;  3B9J A;  5L95 C;  4TSS A;  2K8E A;  1C1Y B;  2K5P A;  2WX0 A;  3V6E B;  2MWN B;  1WX8 A;  2AX5 A;  2LOZ A;  1KM7 A;  1U5G A;  3CXB B;  3ZTC A;  4IUM B;  3UQA A;  2BYE A;  1H8C A;  2L83 A;  2GUM A;  4KHA A;  3BII D;  2HTH A;  3B08 A;  3B0A A;  3Q6B A;  2K3U A;  1MPE A;  2MKR A;  2RPQ A;  1V5U A;  2ZW1 A;  1T3Q A;  2D2Q A;  2WXM A;  3IT6 B;  2JT4 B;  4K7S A;  1FCC C;  1R4M B;  1XD3 B;  4KGR A;  5JHH A;  2MDX A;  3GOE A;  2WDV B;  1GGO A;  2CRF A;  1L2N A;  4HCN B;  4W9L A;  3V60 A;  3MC8 A;  4F7Z A;  4E71 A;  3AE7 B;  1YQ3 B;  1UWM A;  1Y56 A;  3QIJ A;  1DYQ A;  2M0A A;  4ICU A;  2BYF A;  3TUO A;  4L6E A;  3M63 B;  4G11 A;  3ZRF A;  2ZJD A;  3W1S A;  5DHF B;  4EZK A;  1TBE A;  1D5M C;  1AN8 A;  1X11 A;  4HDO A;  5GMV A;  1UNS A;  5TSS A;  1EU3 A;  4AJW A;  4BBN F;  3JYU A;  3RFZ B;  3A58 A;  1N3H A;  4MT5 A;  2J4X A;  1UEF A;  1QOF A;  2A5U A;  4FA6 A;  4JKB A;  2I2Y A;  5LXI B;  5I2M A;  2KC2 A;  4RCO A;  2DNF A;  2Y5B B;  3SDL C;  3ZJU A;  3RCP A;  2IY0 B;  3IFW B;  3SUZ A;  3ZNH B;  1JWS D;  1ZXH A;  5CHF A;  1ZPS A;  5D6J B;  1PGA A;  3AE4 B;  1TGZ B;  1WVH A;  2CU3 A;  5HE0 A;  4AJY B;  2IO2 B;  4Z2N A;  3JW0 X;  3QX1 A;  4DDI D;  2MRP A;  1AW7 A;  4OZC A;  2XNA C;  4YTP B;  1Y19 B;  4OVV A;  5EE9 A;  3B2G A;  1L0V B;  2IO0 B;  2IZV B;  2FCS A;  4FHJ A;  4IM3 A;  1NVL A;  4XWT A;  1N5W A;  2N0Y A;  1RRB A;  4F7H A;  2JRH A;  4H2A A;  3N1Y C;  2KDB A;  3AEB B;  1FB8 A;  1YN4 A;  3QJZ A;  1EF1 A;  5JVL A;  2X0S A;  1E7U A;  3V62 A;  3DXD A;  1UWX A;  1W1G A;  2KZR A;  2D9X A;  2V1Y A;  2ZCC A;  5BYQ A;  4L2Y A;  1J7B A;  4WJ7 A;  1WGK A;  2BB5 A;  2PE9 A;  5LLI A;  3WAL A;  1IGD A;  3GE8 C;  3SU8 X;  3TEW A;  3PRP B;  2V3P A;  3I3T B;  3VAW A;  4ANV A;  4IM2 A;  3OJ3 A;  1ZGU B;  1C4P A;  5G5G A;  2R61 A;  5IO9 A;  3ZXR A;  2KHW B;  3HUI A;  4B0E A;  1OQN A;  2CB8 A;  3E66 A;  3W2D A;  5LOP B;  2CHW A;  1WE7 A;  1GNU A;  1TS5 A;  4KDI C;  1V49 A;  2OJR A;  1VJK A;  2KUP A;  3ODO A;  4GGQ A;  1C4C A;  3L0W B;  3PGE A;  1WGQ A;  1JAL A;  1SB3 C;  3N1Z C;  4KGT A;  3AEC B;  2M8S A;  4P16 A;  4FJY A;  3RNB C;  4K3C A;  3UQB A;  2MCN B;  3H9D A;  2Q5W D;  2CY5 A;  4ARC A;  4KGS A;  1QOG A;  1QOB A;  4WJP A;  1HXY D;  4A6K A;  2KAN A;  5C3J B;  2X38 A;  2RPV A;  2WXQ A;  2Z59 A;  1OMW A;  1YJI A;  2DEN B;  2WYQ A;  1YNT E;  4FUL A;  1V1P A;  1VZ7 A;  2KK8 A;  2LYD A;  3DVG Y;  2K49 A;  1WJN A;  2LVQ A;  1DIK A;  4PS8 A;  1NEN B;  4BKS A;  3OWE B;  2FID A;  2Y3A A;  4ZYN A;  3CF6 E;  4FJV B;  5KQ4 A;  2PJH A;  5D7G A;  3KYC D;  3DWM A;  3VHT C;  2NTS A;  1QLB B;  2JZ3 B;  2Y5C A;  1T0Y A;  3KSY A;  4EFO A;  1SE4 A;  2DYM A;  2EJ8 A;  4RM8 A;  4LCD E;  3P6A A;  2MH7 A;  3SYX A;  1E9M A;  1AWD A;  3TEX A;  2OED A;  1MG4 A;  3ML4 A;  3PTF C;  1E10 A;  4ILH A;  2QDF A;  3ZKJ C;  4M0W B;  3PZD A;  4HHV A;  1VR9 A;  3ODW A;  4GMV A;  2HJ8 A;  2LGX A;  2C7N B;  1TIF A;  3MDB C;  3AU5 A;  3N9Y C;  2MW5 A;  3QCA A;  1FGZ A;  2FJU B;  3W5U B;  4KSL C;  2WX1 A;  4ZDV A;  4BKS D;  3MC0 B;  4P7I A;  2IO3 B;  3IHP C;  4ANX A;  4WWN A;  4DHJ B;  3VFK A;  2YS3 A;  1FXT B;  1I4Q A;  3URY A;  2P0F A;  2CHZ A;  1HTO A;  4BOS C;  1L6U A;  3PS6 A;  4IW0 A;  4MK0 A;  5GOW B;  3RPF C;  5EFX A;  4HAV B;  1P98 A;  3ZJT A;  5AUI A;  5JH5 C;  1R7S A;  2O6V A;  2MBO A;  3H8H A;  2KT7 A;  3NOB A;  4NAW B;  2RUK B;  2PKO A;  2MP2 A;  2BB6 A;  2WS3 B;  1IGC A;  2UYZ B;  4AS1 A;  4WJQ A;  2LUE A;  4LK0 M;  4ICV A;  2BBC A;  3F0W A;  2KTR B;  2D07 B;  3KWL A;  4JX1 C;  2SEB D;  3G9W A;  3KRX A;  3KUD B;  3GYO A;  3TO1 A;  2DN6 A;  4A8X C;  2COP A;  2RMM A;  3Q8B A;  3U2S C;  1WX7 A;  2E3T A;  1MJD A;  3L4P A;  3O96 A;  5G2N A;  4FLH A;  2WDT B;  1V86 A;  1WM2 A;  1F1H A;  2EKI A;  2JZP A;  2RGF A;  1XOD A;  2B76 B;  1IBX A;  3RZF A;  4NJ6 A;  5DHA B;  4RH6 A;  3LYY A;  3PLV A;  2BYT A;  3HW2 B;  2LRW A;  1A5R A;  1WI1 A;  5L81 A;  2FUH B;  2WLB A;  1H10 A;  3VH4 B;  5FKA C;  2G35 A;  2A4Z A;  1K53 A;  3UI3 A;  3IAS 1;  4H8S A;  1FFV A;  4FAD A;  5J18 A;  5TR5 A;  2N9L A;  4WWM A;  3NS8 A;  3V6C B;  1JQ4 A;  1RLF A;  2ACZ B;  2MSE D;  3EA6 A;  3A1Q B;  1X86 A;  3PVL A;  4ZRP A;  1D5Z C;  1WFY A;  3U52 E;  3WCQ A;  2KWU B;  5AZG A;  2UVM A;  2L00 B;  2J0M A;  1FEH A;  1PFD A;  3AB5 A;  3CIK A;  3K9O B;  2J53 A;  4FN2 A;  2KMC A;  1E8Y A;  1BTN A;  3FP5 A;  1LFD A;  1D6E C;  5AEK B;  2XQN M;  2DHJ A;  4LJP B;  2MJD A;  1TXD A;  2LVP A;  5D3X A;  4MSM B;  3SEB A;  3NVV A;  3IAM 1;  5LON B;  3NW8 A;  1TKG A;  3AE6 B;  2BKF A;  3DBH B;  3L13 A;  2GS0 A;  3KUC B;  2WHI A;  2K39 A;  2VZK B;  1VBH A;  1SHC A;  4Y94 A;  1XCT L;  3NWD A;  3DHH C;  1E8X A;  2INP E;  2PLP A;  4MJS B;  4XDD A;  3SV1 A;  1QOA A;  2C7H A;  1V80 A;  1WGG A;  2WXP A;  4CHK A;  2V76 A;  3ZTD A;  3SD5 A;  2N1V A;  3HIZ A;  4XWW A;  2ZKM X;  1FO4 A;  3P4R B;  2KLG A;  4IC7 B;  3AE2 B;  1RJ2 A;  1VRA B;  3TSS A;  2LHD A;  1R4N I;  3ML9 A;  5GXG B;  1FNU A;  2BS3 B;  4JKC A;  2PIA A;  3TEY A;  4L23 A;  3ZNG C;  2DA0 A;  3J9C A;  3JSV A;  2W54 A;  3T9L A;  1KFY B;  2YT0 A;  1D3Z A;  3RN9 C;  2UZS A;  3LDZ E;  1TS2 A;  2QKM A;  4EZJ A;  1WIA A;  2AQ3 B;  3A9K B;  1VLB A;  1ZYI A;  1XQQ A;  2DZM A;  2L0T A;  5FK9 C;  4HDQ A;  2IJ0 A;  2PTL A;  4D0N B;  2RDG A;  1ISN A;  2KC1 A;  2Z0P A;  3B2F A;  2MJ3 A;  4GB9 A;  2L1A A;  4P1B C;  1PFJ A;  1RM6 C;  2LHE A;  4IDI A;  4PYU A;  2NVU I;  1ZUD 2;  2JWZ A;  4GIV A;  2AYO B;  3TIX A;  4MGI E;  2AEH A;  2KYW A;  1GOZ A;  1YIW A;  4DK5 A;  4D2K A;  3PVW A;  4CSQ A;  4YSZ B;  2BGF A;  2LJ5 A;  1FD6 A;  5D3Y A;  2JRI B;  1ZVR A;  3PRM B;  1HB6 A;  4RF1 A;  2CR5 A;  1CQV A;  2YSZ A;  3NHE B;  3LXF A;  1KZG A;  3EEC A;  2N7E A;  4REZ A;  1T6B X;  4J6I A;  1F77 A;  1FXI A;  2VSZ A;  3ZDM C;  2JP2 A;  2WQY B;  3ZDT A;  4RGT A;  5JP4 A;  4F1S A;  2WNM A;  1LW3 A;  2MA9 B;  3BVZ A;  1N60 A;  2NTT A;  3PP2 A;  3ML8 A;  4TYZ A;  2JX5 A;  2LEK A;  5KQ1 A;  2V3S A;  1V1O A;  2NBW B;  3DBL B;  4S17 A;  4BOZ B;  4WAA A;  4MH0 E;  2M4N A;  2CS4 A;  4WAF A;  1N5X A;  1RWS A;  3TJP A;  2ZNV B;  1CMX B;  2ZPY A;  4WJO A;  3ZYY X;  1AYF A;  1SIF A;  1Z2M A;  2K0P A;  1YX6 B;  3PLU A;  3IVF A;  1J0G A;  2KAJ A;  3GZN B;  4OVU A;  4DBB A;  1Y5O A;  2RDH A;  2JUO A;  1X1M A;  3ULC A;  5IKC M;  5H92 C;  2MP2 B;  3AEG B;  5IOI A;  2DX5 A;  2LG1 A;  5HE2 A;  4W9G A;  3IBE A;  1UNP A;  1SE9 A;  3E9P A;  2AQ2 B;  3T8M A;  3AE5 B;  2LOX A;  2MHJ A;  3PHW B;  3VDZ A;  2Y5P A;  3IT4 B;  5JHA A;  3L54 A;  4BBN C;  1BT0 A;  3A4S C;  1HZ6 A;  2BS4 B;  2YEP B;  3N1X C;  1LB1 A;  2EKE C;  4HKZ E;  4TMA B;  2Z13 A;  3U7D A;  4G0N B;  2CHX A;  4N9F 4;  4HAX B;  2D10 A;  2I1J A;  4AOF A;  4II2 B;  3SBG A;  3AI5 A;  1E7V A;  2DZK A;  3AU4 A;  2CJN A;  1V5T A;  5J3T A;  4MGY E;  2WXN A;  1KZ7 A;  2Z0O A;  2KLC A;  2L05 A;  4IWQ A;  4WQO B;  5CHV C;  3RNF C;  1OFF A;  4IOI E;  1TZO A;  1UH6 A;  3FC4 A;  1YN3 A;  1SBB B;  3DBS A;  3PRE A;  3QC8 B;  3BVM A;  4FJZ A;  2N7D A;  2IDY A;  4EMO A;  3NSU A;  2K2J A;  3CIR B;  4JKH A;  4B6W A;  2RGN B;  1MHH E;  3ALB A;  1EM7 A;  3LJ3 A;  4RGM A;  3DXE A;  4DXA B;  1E90 A;  1VD2 A;  2BCJ A;  2NBV A;  2QSD A;  1B55 A;  3A1Q A;  5C16 A;  4MSQ B;  4DBG A;  3V5W A;  1GG3 A;  4ILG B;  1EVH A;  1K52 A;  2DHI A;  1K8R B;  3NVW A;  4NAW A;  1XD4 A;  4MT7 A;  2FJ9 A;  1L0Y B;  1FNW A;  2RSU A;  2Q13 A;  4MM3 B;  1V81 A;  2GB1 A;  4GOU A;  4BZA A;  2DX5 B;  1PLS A;  1DBH A;  2G1E A;  2YVC A;  2N9K A;  2K2U A;  3HK0 A;  1EGX A;  2JSV X;  1V5M A;  2FE8 A;  2IYB A;  1PGX A;  3P4Q B;  2D3C A;  4F7G A;  4W9H A;  3R7R A;  1FRD A;  3A8P A;  4RGO S;  1WGR A;  1WJ1 A;  2ZEQ A;  3JSV B;  5C23 A;  2K9X A;  3MFG A;  2BYV E;  2DHZ A;  5DPR A;  4MEM A;  1MIZ B;  2W3R A;  3WA0 A;  1XLO A;  2IYD B;  1KI1 B;  3KRW A;  1UEL A;  3PO0 A;  2COF A;  1E5W A;  4F7U P;  4AWJ A;  1GC6 A;  1WGU A;  2REX A;  1E8W A;  2ICI A;  3VUX A;  4IWP A;  3ABV B;  3H6N A;  1U27 A;  3Q2A C;  1ZW7 A;  3VR8 B;  2R0D A;  4ITK A;  2KQS A;  5CLQ B;  1DOI A;  1NVI D;  4JWU C;  5D3I B;  4US8 A;  3AM9 A;  5FR3 A;  1ESF A;  3PG7 A;  4HWI B;  4I6N B;  5LXH A;  5CLL B;  1JWB D;  1E7P B;  2W55 A;  3EFC A;  5C1Z A;  4ARI A;  2XEW A;  1HZ5 A;  3ZVV A;  2RLO A;  2YF0 A;  3VTV A;  3F5R A;  2MBB B;  4F8C B;  2LBB A;  3PEG A;  2O2V B;  2KXJ A;  5EE1 A;  3CWI A;  1I4G A;  2DTC A;  1KTK A;  2HRJ A;  2FIF A;  1C9F A;  1ZM0 A;  5C5B A;  3HM3 A;  4JWS C;  3WIM A;  1UF0 A;  4NZL B;  4I6L B;  1ACC A;  2XK5 B;  4C56 C;  2L3Z A;  2COD A;  2Z0D B;  3AH7 A;  3Q8A A;  3QWM A;  2M1M A;  3Q8C A;  1FM0 D;  1PGB A;  2XBB C;  2KJH B;  3ODX A;  4OT1 A;  1K51 A;  3BZD B;  1TJE A;  3VH3 B;  1RFA A;  2C60 A;  1XEE A;  1TT5 B;  1N63 A;  4EJN A;  2BWE S;  2QIE B;  3SR6 A;  4KZ0 A;  5HKH A;  5FI1 A;  2KO3 A;  4HRO A;  3SNH A;  1NTY A;  3RCZ A;  4N59 A;  4TKN A;  1XF5 L;  1Q10 A;  2X8X X;  2KN5 A;  3RT3 B;  1JDE A;  4GOC A;  3A9J B;  3W9C B;  2AQ1 B;  1U2B A;  3V3X A;  2FCQ A;  2G4S A;  4YSY B;  4A6F B;  4QJ3 B;  4TV3 A;  4MGK E;  2YS1 A;  2W82 A;  1DGJ A;  2KWV B;  3ULB A;  2JWU A;  4M8M A;  2DIK A;  2RDB C;  1R4N B;  2WP9 B;  2AL3 A;  2XN9 C;  1GJZ A;  2M38 A;  4WQM A;  5DPS A;  2DX1 A;  1V5O A;  4AQ7 A;  4W9F A;  2CU1 A;  1YX5 B;  4BFR A;  4MJS A;  4P1C C;  2ZNV C;  4GDK A;  2PPH A;  2PMV A;  3M3J A;  3IG3 A;  2V3N A;  1V97 A;  2PE6 B;  5BYS A;  1EUV B;  1WYG A;  4IWO A;  1I4P A;  3AV8 A;  2VZK D;  2KUQ A;  3BK2 A;  2UWQ A;  3A98 B;  4E74 A;  4KHB A;  3I63 C;  3R7Q A;  4JKF A;  1L0X B;  4I6P A;  2JQR B;  4G50 A;  4CYE A;  3B77 A;  4DHZ E;  2D3B A;  2D3G A;  2VRW B;  2NPT B;  3H7P B;  1OEY A;  3E9S A;  2DFK A;  2Y7B A;  2ROZ B;  2RR9 A;  5KHQ A;  4D6W A;  3RZW C;  5DIF B;  4YON A;  2CY4 A;  2DLB A;  1DRO A;  2IBI B;  1KBL A;  1GB4 A;  1H4R A;  2LWP A;  4A9A A;  2NBV B;  2LAS A;  4KZC A;  4GZU A;  3WAO A;  2KMM A;  4QAY A;  2EC1 A;  3FLV A;  3QBV B;  5IRS A;  1TY2 A;  4Z2M B;  3MTN B;  3EPY A;  2WU2 B;  4FHK A;  3DBH I;  2KGX B;  2ONQ A;  1JWU D;  2OHF A;  4KHO A;  3SBT A;  4BKT A;  2JF5 A;  1C3T A;  2W2X D;  1P7E A;  2BT6 A;  2ABD A;  3PT2 B;  1UBQ A;  1AAR A;  3JVZ X;  1YN5 A;  2HTM E;  3KQ4 A;  2L52 A;  4PT5 A;  1SJH D;  1ZC4 B;  1ZP0 B;  2B3A A;  4TQ1 A;  1P0R A;  2MX2 A;  4X57 B;  3EC8 A;  4NQK E;  2KR0 A;  3P2B A;  1WZ0 A;  1HBK A;  1JWM D;  3TVV A;  1P9D U;  2C7M B;  2COA A;  1DDW A;  2LVO A;  3PV1 A;  2M19 A;  1HEZ E;  2GOW A;  3U12 A;  1V6E A;  4IOY X;  2ZCB A;  4HCP B;  1DDV A;  3UIO B;  5C6R A;  3D8D A;  1TYG B;  1WXM A;  3ZLZ A;  2OQB A;  5E6O A;  3NVY A;  2IGH A;  4DHZ B;  1I4R A;  4FBJ B;  3N32 A;  2W2W A;  1OQY A;  1ZKH A;  2K6D B;  3FIL B;  4M02 A;  4DXG A;  2KOX A;  2WXI A;  1WXV A;  2FDQ A;  2VRR B;  4GDL A;  3NZ3 A;  5CHW A;  3TMP B;  2NMB A;  3BIN A;  4W9K A;  5D2M B;  3Q3J A;  1ENF A;  1JRP A;  2HE7 A;  4XE0 A;  2N0S B;  1PDX A;  3GS2 A;  1LQB A;  1XKE A;  2D9V A;  4IKG A;  1SE2 A;  1P3Q U;  4R3D A;  2NS5 A;  1K5G B;  2YEP F;  1NYR A;  1UPR A;  4JE3 B;  3C8Y A;  2L32 A;  5DI9 B;  1A70 A;  4XC2 A;  3CST A;  3DBR B;  2KN4 A;  1IRS A;  1VDV A;  4HEA 1;  3N7C A;  5AUK A;  1K50 A;  5MPO A;  2DAF A;  4EOY A;  1SIJ A;  2M0X A;  2Y8G A;  2LGY A;  2BKR B;  3QWZ B;  4HSI A;  1ROE A;  2JPH A;  4HB0 B;  4US9 A;  4XDC A;  5C79 A;  3N3K B;  1I4X A;  1VZ8 A;  2IGD A;  4JQW C;  4XGA B;  2KWD A;  4GDL B;  5BMH A;  3AEF B;  1UUP A;  3PSE B;  2KDI A;  3RUL A;  4A6Q A;  3E56 A;  4KVG B;  3NG0 A;  3B1L X;  4IM0 A;  1OGW A;  2L76 A;  2N9X A;  3DOW A;  3BYT B;  1B9R A;  1L4Z B;  3DQV A;  4B9K A;  1F2R C;  4PS7 A;  1KRH A;  1QC6 A;  1DYN A;  1BML C;  2N9E B;  4HB3 B;  2KTR A;  2LKO A;  3NZU A;  2JZZ A;  1WI0 A;  4LLG M;  3MJW A;  1WWT A;  2NMQ A;  2FAZ A;  4OHJ A;  3A33 B;  1KJT A;  4NNJ B;  1QQG A;  2ASQ A;  1WMH A;  1FRR A;  4PNK A;  2WXK A;  3AED B;  2QJL A;  1FFU A;  3VTW A;  3ZJV A;  5JXV A;  1E0Z A;  3ECI A;  1L5P A;  3E9O A;  4BKG A;  4K2O A;  5I4D A;  3VTU A;  4OSN A;  3FAH A;  1WSP A;  3APC A;  3AUL A;  1S1Q B;  4LNK A;  2NPT A;  4IG7 B;  3MHS D;  2KVZ A;  2WXL A;  3DPD A;  2ZVN A;  1P5T A;  2D9Y A;  3W5V B;  1HTQ A;  2P8V A;  2GCJ A;  3Q14 C;  2K8H A;  4M0W A;  1FMA D;  1RYJ A;  1OEY J;  3D8F A;  3OJ4 B;  5IA7 A;  2M17 A;  4KKI A;  3BK1 A;  2WXH A;  4ZRJ A;  3VUW A;  2O6V B;  2L7R A;  1ZOY B;  3EHV A;  4NSW A;  1VBG A;  2W3S A;  1TY0 A;  1T5X D;  3HVZ A;  4GU2 A;  4XYC A;  4KHB B;  2G4D B;  2M14 A;  4DIX A;  1ZDV A;  1TQZ A;  2KCJ A;  2YS5 A;  3QHT A;  4JGH B;  3ZQ4 A;  1STE A;  2KTF A;  3KLS X;  2KQ7 A;  3NS1 A;  2Y8F A;  4DX9 0;  3DHI C;  3OAW A;  4MDK E;  4HPP A;  2P0H A;  3MC9 A;  2LXC A;  2M56 B;  2DLW A;  2MWS B;  1SEB D;  1HB8 A;  4W9E A;  2BTE A;  3NUH B;  3UIN B;  1OQR A;  2DHK A;  1C4A A;  5AZH A;  4YSX B;  4C00 A;  3A9J A;  3AEA B;  3H1U A;  4TQ0 A;  2BWF A;  5D27 A;  3KW5 B;  1Z5S B;  5HFY A;  1P3R A;  4A20 A;  1IUE A;  2IFS A;  1X1G A;  4L1B A;  3U7Z A;  3ZIM A;  4PYZ A;  4HJK A;  2R09 A;  4DX8 A;  2GMI C;  2ZPN A;  4TUU A;  4S0R A;  1E6E B;  1WRD B;  3R8B A;  1MFW A;  3T3N A;  3AE1 B;  4CHM A;  2ZW0 A;  5JHB A;  4HRS A;  2LJI A;  4A5K A;  2LD9 A;  1E8Z A;  4YL8 A;  1PQS A;  2HTH B;  4HVB A;  3PZ8 A;  3D8E A;  3QK0 A;  4WWO A;  2MQJ A;  4NJC A;  4HAU B;  2GJY A;  2KFK A;  2RQ1 A;  5AZF A;  4C80 A;  2DKP A;  1SJE D;  3P7Z A;  2J0K A;  3DVG X;  3A9K A;  3PPA A;  2CKH B;  4W9I A;  1Q5W B;  3NJT A;  3RNC C;  2AWT A;  2L0F A;  1F0Z A;  1M94 A;  2J7Q B;  5J3Q A;  1EU4 A;  3AE8 B;  1WX9 A;  1MKE A;  2GLS A;  3APF A;  5JLJ B;  3R3M A;  1NEK B;  3DVN U;  2LUM A;  4USA A;  3GE3 C;  4GLS C;  5DH9 B;  1KH0 A;  2K25 A;  4KSK C;  3EUB 2;  3X0W A;  2LUL A;  2LXA A;  3RYT A;  3ZVR A;  2ROV A;  2BPS A;  2O2V A;  3P1M A;  1C78 A;  1WF9 A;  2R2Y A;  1P6S A;  4NQL B;  4JKD A;  2EMS A;  2N4F A;  4EE2 A;  1CZP A;  2COC A;  3RI7 C;  1L6V A;  1KLG D;  1JWA D;  2BVC A;  3MPX A;  1RAX A;  3WAP A;  1V2Y A;  2K22 A;  1WR1 A;  4HAW B;  1VZ6 A;  2JYT A;  1IYF A;  3L10 B;  1C76 A;  3DHG C;  1Q67 A;  1XLQ A;  4XWX A;  4PS3 A;  4JK8 A;  1WXQ A;  1NTV A;  3FM8 C;  1V8C A;  1QIL A;  4II3 B;  1OTR B;  2VH2 A;  2H7D A;  1WMH B;  2GBK A;  2LZ6 A;  3KYD D;  5LNK 1;  2WXO A;  3ETR A;  4ANW A;  1U4A A;  1UZX B;  2RVB B;  2DBY A;  1HA5 A;  4DDG D;  2QHO A;  4C7Z A;  2NBU A;  2L1C A;  2BS2 B;  3AXC A;  1U5F A;  4HPL B;  4RNA A;  1WH3 A;  1NYQ A;  2OTX A;  1MK7 B;  4WUR A;  1SSN A;  2QMT A;  4GPT B;  1DOX A;  2XK5 A;  3WAN A;  4RM9 A;  4WSF A;  1VCB A;  4KDL B;  5IAA C;  2D9W A;  3RNA C;  5EE0 A;  3TEZ A;  3SFE B;  1YQB A;  1I7A A;  1U5D A;  2GBJ A;  4KIK A;  2H89 B;  2J59 M;  1J7A A;  2DAJ A;  1BWN A;  1YQ4 B;  3RUI B;  2K00 A;  4JKG A;  1WXA A;  4RMA A;  5BYR A;  1F52 A;  4RGN A;  2Z8L A;  1N61 A;  3HQC A;  2G9H D;  4UDU C;  1WG7 A;  3NZS A;  4ZRQ A;  2D4Q A;  3D32 A;  3SHQ A;  4EZL A;  3C0R B;  3BWU D;  4ZHP A;  1YJJ A;  1FAO A;  3OAN A;  2GBM A;  3M62 B;  4LNO A;  5G55 A;  3O65 B;  2PW9 A;  2DKQ A;  1D4B A;  1HQR D;  2KWC A;  1LO5 D;  3NRZ A;  4PQ0 A;  1GPX A;  3A4R A;  4MY6 A;  2D11 A;  1FGY A;  2OJW A;  1TTN A;  2JU6 X;  2CQU A;  4RF0 A;  1HE8 A;  1I4H A;  3ZGZ A;  1FPY A;  2KDF B;  2Z0E B;  4YWG G;  1F9J A;  1V5P A;  1I2H A;  2J0J A;  1LM8 B;  3BJI A;  3U8Z A;  2HJ1 A;  3KZ1 A;  2DYN A;  4L1R A;  4J3O D;  5D3V A;  4GNK B;  3TBL D;  2QIL A;  4HB4 B;  2KDE B;  2RD0 A;  4JK9 A;  3MP9 A;  1OY2 A;  1NU2 A;  1SE3 A;  4C4V A;  2CJO A;  1S3S G;  2KQ4 X;  4M00 A;  2KIG A;  1UD7 A;  2OOB B;  2JXX A;  2JYE A;  4HAT B;  1WE6 A;  1I35 A;  2INN E;  3M95 A;  4WH4 A;  4KV2 A;  1UGJ A;  3KH0 A;  3VUY A;  4EUT A;  2ADZ A;  2LGI A;  3NWF A;  2FCM A;  3KWV A;  1MHX A;  1EO6 A;  1R4M I;  3VOQ A;  3HVD A;  3KVF B;  3NWA A;  2K8C A;  1FHO A;  4Q2J A;  1PMS A;  1J7C A;  2K1F A;  3HM6 X;  1XCG A;  5IN7 A;  4HAY B;  2Z59 B;  2MBH A;  5CX3 A;  4QJ4 B;  2E6X A;  1TJ6 A;  1TS3 A;  3RMK C;  4PK1 A;  2YT2 A;  1TKY A;  5JZE B;  4DHJ D;  1XXG A;  3TCA A;  2N23 A;  1C77 A;  2SAK A;  1BUI C;  2KFK B;  2R2O A;  1FOE A;  1P7F A;  5D3W A;  1KC7 A;  2RRF A;  2GBN A;  2LI5 A;  4XX5 A;  1Z87 A;  2JVC A;  3TW1 A;  4LTU A;  4OZB A;  5E6N A;  1XLN A;  4ANU A;  2QC8 A;  3C19 A;  3L16 A;  3SFD B;  1FNV A;  2MFQ A;  1JRU A;  4W9D A;  2L8J A;  2FCN A;  3UF8 A;  2N9P C;  2LFI A;  4ZYS A;  2HDE A;  2P0D A;  3P42 A;  4A3P A;  2E2X A;  1I7H A;  2EMT A;  1ET6 A;  1V1P B;  1TKE A;  3V05 A;  1MPH A;  3I5J C;  2J52 A;  2Z14 A;  4LNN A;  1ZXI A;  3FVC A;  2GBR A;  3PHX B;  4EEW A;  3E9L A;  4LNF A;  4RFB A;  4HLE A;  3VRB B;  4MM3 A;  3KY9 A;  3Q3N C;  3S2A A;  2CAY A;  4DXF A;  4O1N A;  2WXR A;  3ENB A;  1XO3 A;  4XZ4 A;  3KUZ A;  3Q8E A;  3AEE B;  1BXT A;  5C2T B;  1B1Z A;  2I5C A;  1M4V A;  4HJG E;  3AMZ A;  2FNJ B;  2I5F A;  2WDQ B;  4GSW A;  4ASW C;  1EWC A;  3GP7 A;  3VXW A;  4ACF A;  2IY1 B;  1U29 A;  4N6E B;  5H8Y E;  4K2P A;  5EE3 A;  2WXF A;  3L08 A;  1X05 A;  5HI1 A;  1F2R I;  1G6J A;  2WDR B;  4WVF B;  2FUG 1;  2YT1 A;  1M7E A;  1JCK B;  4GDK B;  4WJN A;  2AL6 A;  4DQO C;  3PZ7 A;  2TSS A;  2UZR A;  3DXC A;  1ZDX A;  5BO4 B;  1NTI A;  1EAZ A;  1FHX A;  3ONS A;  4YT0 B;  4LDT B;  5JHG A;  3RD2 A;  3U30 A;  2WXG A;  3P4P B;  1WJ6 A;  4HPM B;  4HKQ A;  5FI0 A;  3H7P A;  1RFK A;  3T3O A;  2PZ1 A;  2DYO A;  3Q3M C;  2ON8 A;  3ZRC A;  1YD8 U;  5E6P A;  1IBX B;  1M7R A;  3EGR A;  4YXD B;  1WM3 A;  1QF6 A;  5I2S A;  3DCG A;  1OQQ A;  1W1D A;  1AQC A;  2KJ6 A;  2JY6 A;  1JW9 D;  4A90 A;  2LMC A;  3QAR A;  4ZRK A;  5IJM A;  1V9J A;  3ZNI D;  1XX0 A;  1KLV A;  1GB1 A;  3AJ4 A;  4AUQ C;  1V89 A;  4WWP A;  4CO7 A;  3QQ8 B;  1WJU A;  3PRZ A; 
#chains in the Genus database with same CATH homology
 4BVU C;  1WXS A;  1WGY A;  4GN1 A;  4HK2 A;  4B95 A;  1NI2 A;  2KVR A;  3SO6 A;  2N1W A;  2KNB A;  2WH5 A;  4K17 A;  5L83 A;  2DZI A;  2HD5 B;  2MBQ A;  5DCN A;  2ELB A;  3HHM A;  2KJR A;  3DBL I;  1J8C A;  5D94 A;  1ACA A;  1MK9 B;  2RNR B;  1Q1O A;  2VKI A;  3ZO5 B;  2X18 A;  4HAZ B;  4LDT D;  2K6Q A;  1UPQ A;  4NPN A;  5KHO A;  3A8Q A;  2W2X C;  1TZ1 A;  4JK7 A;  2D9Z A;  2MLB A;  4JIO U;  4AP4 C;  5DPW A;  3GYP A;  2LRU A;  1GC7 A;  2NZ8 B;  5C5B B;  4ILJ A;  2RSG A;  2KX3 A;  3VIA A;  3TFM A;  1RRP B;  3ENE A;  4IAP A;  1QZE A;  3UGB B;  5J2R A;  5J17 A;  4W9J A;  5KCV A;  3BY4 B;  2QKL A;  1V88 A;  1GUA B;  1L7Y A;  1LXD A;  4KIK B;  1BTK A;  5HE3 A;  4JKG B;  3X23 A;  4HB2 B;  1EF5 A;  2G3Q B;  4KAX B;  1K5D B;  4E3C A;  3DDC B;  1BAK A;  1MG8 A;  3Q3F A;  4K7U A;  4ZRI A;  5DPT A;  4M8N A;  4C0A A;  1DDM A;  2ZVO A;  4MEL A;  1AWE A;  1UGM A;  1UNR A;  2DYB A;  4LJO B;  1ST7 A;  4GXB A;  1U5E A;  4B6H A;  1UBI A;  2KFJ A;  1NDD A;  3WAM A;  3UIP B;  4NY0 A;  1ZSQ A;  4NJ7 A;  3L17 A;  5J3Y A;  3FSS A;  2GCL A;  2C9W B;  4MGZ E;  1WYW B;  3W1Y A;  3QA8 A;  4HXD A;  3PVU A;  4G3X B;  2ELA A;  2LGD A;  3VVW B;  1Y8R C;  1SGH A;  3DBR I;  4JLC A;  2YLM A;  1X1F A;  3ZUN A;  4W9C A;  4K1R B;  1WGD A;  1ZC3 B;  3OLM D;  2R2Q A;  1XT9 B;  4EKU A;  1NBF C;  1W1H A;  3QAQ A;  1WGH A;  2Z0Q A;  3CSF A;  2IO1 B;  2ZZP B;  4JL9 A;  3R66 C;  4CHJ A;  2R82 A;  1WY8 A;  2W9N A;  1WJ4 A;  3UZT A;  2O6V D;  3VQI A;  2I1K A;  3TL5 A;  1WR6 E;  4A3O A;  4K7W A;  3T06 A;  2NCN A;  2KKC A;  1J19 A;  3K9P B;  4K81 A;  2BF8 B;  5CTR C;  3H7S A;  4IFS A;  1V61 A;  3ZNZ B;  1FHW A;  3FEH A;  3N30 A;  3W1S C;  1J0W A;  2V4L A;  3EFU A;  4JKE A;  2C5L C;  2NR2 A;  2WWZ A;  2H7E A;  2KX0 A;  1Q0W B;  3WYF B;  1YJ1 A;  1WJM A;  2K8B A;  3CMM B;  3GZN I;  2YRY A;  4GMX B;  3PSC A;  3NY5 A;  4BBK A;  4URK A;  1XR0 B;  3V61 A;  3LJU X;  3M1I B;  1IP9 A;  2KMA A;  1MAI A;  4A6H A;  3ZW3 A;  4DWF A;  4JKA A;  2PEA A;  2DYQ A;  2L2I A;  1I42 A;  2DZJ A;  2G45 B;  1P1A A;  5FR6 A;  1MIX A;  2FJL A;  5EDS A;  2KD0 A;  3APD A;  1UNQ A;  1WZ3 A;  3DVN V;  2MBE A;  1IPG A;  4A6F A;  1KOT A;  5HE1 A;  5L95 C;  1C1Y B;  2WX0 A;  3V6E B;  2MWN B;  1WX8 A;  2LOZ A;  1KM7 A;  1U5G A;  3CXB B;  3ZTC A;  4IUM B;  3UQA A;  2BYE A;  1H8C A;  4KHA A;  2HTH A;  3B08 A;  3B0A A;  2MKR A;  2RPQ A;  1V5U A;  2D2Q A;  2JT4 B;  4K7S A;  1XD3 B;  5JHH A;  2MDX A;  3GOE A;  1GGO A;  2CRF A;  1L2N A;  4HCN B;  4W9L A;  3V60 A;  4F7Z A;  4E71 A;  3QIJ A;  4ICU A;  2BYF A;  4L6E A;  3M63 B;  4G11 A;  3ZRF A;  2ZJD A;  3W1S A;  5DHF B;  4EZK A;  1TBE A;  1X11 A;  4HDO A;  5GMV A;  4AJW A;  4BBN F;  3JYU A;  1N3H A;  1UEF A;  2A5U A;  4FA6 A;  4JKB A;  5LXI B;  2KC2 A;  2Y5B B;  3SDL C;  3ZNH B;  3RCP A;  2IY0 B;  3IFW B;  3SUZ A;  5CHF A;  5D6J B;  1TGZ B;  1WVH A;  5HE0 A;  4AJY B;  2IO2 B;  4Z2N A;  3JW0 X;  3QX1 A;  4DDI D;  2MRP A;  1Y19 B;  4OVV A;  2IO0 B;  2IZV B;  4FHJ A;  2FCS A;  4IM3 A;  1NVL A;  1RRB A;  2N0Y A;  4F7H A;  2JRH A;  2KDB A;  1FB8 A;  3QJZ A;  1EF1 A;  5JVL A;  2X0S A;  1E7U A;  3V62 A;  3DXD A;  1W1G A;  2KZR A;  2D9X A;  2V1Y A;  2ZCC A;  4WJ7 A;  2PE9 A;  5LLI A;  3WAL A;  3SU8 X;  3PRP B;  3I3T B;  3VAW A;  4ANV A;  4IM2 A;  3OJ3 A;  1ZGU B;  2KHW B;  1OQN A;  2CB8 A;  3E66 A;  5LOP B;  2CHW A;  1WE7 A;  1GNU A;  4KDI C;  1V49 A;  2OJR A;  2KUP A;  3ODO A;  4GGQ A;  3L0W B;  3PGE A;  1WGQ A;  2M8S A;  4FJY A;  3UQB A;  2MCN B;  3H9D A;  2CY5 A;  4WJP A;  4A6K A;  2KAN A;  1OMW A;  2DEN B;  2WYQ A;  4FUL A;  2KK8 A;  2LYD A;  3DVG Y;  1WJN A;  2LVQ A;  1DIK A;  4PS8 A;  4BKS A;  4ZYN A;  2FID A;  3CF6 E;  4FJV B;  5KQ4 A;  2PJH A;  5D7G A;  3KYC D;  3VHT C;  2JZ3 B;  1T0Y A;  3KSY A;  4EFO A;  2DYM A;  2EJ8 A;  4RM8 A;  4LCD E;  3P6A A;  3SYX A;  3ML4 A;  3PTF C;  4ILH A;  3ZKJ C;  4M0W B;  3PZD A;  4HHV A;  3ODW A;  4GMV A;  2HJ8 A;  2LGX A;  2C7N B;  3MDB C;  3AU5 A;  2MW5 A;  3QCA A;  1FGZ A;  4KSL C;  2WX1 A;  4ZDV A;  4BKS D;  4P7I A;  2IO3 B;  3IHP C;  4ANX A;  4WWN A;  4DHJ B;  3VFK A;  2YS3 A;  1FXT B;  2P0F A;  2CHZ A;  4BOS C;  3PS6 A;  4IW0 A;  4MK0 A;  5GOW B;  5EFX A;  4HAV B;  1P98 A;  5JH5 C;  2O6V A;  2MBO A;  3NOB A;  4NAW B;  2RUK B;  2MP2 A;  2UYZ B;  4WJQ A;  2LUE A;  4ICV A;  3F0W A;  2KTR B;  2D07 B;  3G9W A;  3KRX A;  3KUD B;  3GYO A;  3TO1 A;  2DN6 A;  2COP A;  1WX7 A;  3O96 A;  5G2N A;  4FLH A;  2WDT B;  1V86 A;  1WM2 A;  2RGF A;  1XOD A;  3RZF A;  4NJ6 A;  5DHA B;  3PLV A;  3HW2 B;  2LRW A;  1A5R A;  1WI1 A;  5L81 A;  2FUH B;  1H10 A;  3VH4 B;  2G35 A;  2A4Z A;  4H8S A;  4FAD A;  5J18 A;  5TR5 A;  3V6C B;  3NS8 A;  1RLF A;  2MSE D;  3A1Q B;  1X86 A;  3PVL A;  1WFY A;  2KWU B;  5AZG A;  2UVM A;  2L00 B;  2J0M A;  3CIK A;  3K9O B;  4FN2 A;  2KMC A;  1E8Y A;  1BTN A;  3FP5 A;  1LFD A;  5AEK B;  2XQN M;  2DHJ A;  4LJP B;  1TXD A;  2LVP A;  5D3X A;  4MSM B;  5LON B;  2BKF A;  3L13 A;  2GS0 A;  3KUC B;  2K39 A;  1VBH A;  1SHC A;  4Y94 A;  4MJS B;  1E8X A;  3SV1 A;  2C7H A;  1V80 A;  1WGG A;  4CHK A;  2V76 A;  3ZTD A;  3SD5 A;  2N1V A;  3HIZ A;  2KLG A;  4IC7 B;  1RJ2 A;  1R4N I;  3ML9 A;  4JKC A;  3ZNG C;  2DA0 A;  3JSV A;  3T9L A;  2YT0 A;  1D3Z A;  2UZS A;  3LDZ E;  2QKM A;  4EZJ A;  1WIA A;  3A9K B;  1XQQ A;  2DZM A;  2L0T A;  4HDQ A;  4D0N B;  1ISN A;  2KC1 A;  2Z0P A;  4GB9 A;  1PFJ A;  4PYU A;  2NVU I;  2JWZ A;  4GIV A;  2AYO B;  3TIX A;  4MGI E;  2AEH A;  1YIW A;  4DK5 A;  3PVW A;  2BGF A;  2LJ5 A;  5D3Y A;  2JRI B;  1ZVR A;  3PRM B;  1HB6 A;  2CR5 A;  2YSZ A;  3NHE B;  1KZG A;  3EEC A;  2N7E A;  4J6I A;  2VSZ A;  3ZDM C;  2JP2 A;  3ZDT A;  4F1S A;  5JP4 A;  1LW3 A;  2MA9 B;  3PP2 A;  3ML8 A;  4TYZ A;  5KQ1 A;  2V3S A;  2NBW B;  4BOZ B;  4WAA A;  4MH0 E;  2M4N A;  2CS4 A;  3TJP A;  2ZNV B;  1CMX B;  2ZPY A;  4WJO A;  1SIF A;  1Z2M A;  1YX6 B;  3PLU A;  3IVF A;  1J0G A;  4OVU A;  4DBB A;  1Y5O A;  2JUO A;  1X1M A;  3ULC A;  2MP2 B;  2DX5 A;  2LG1 A;  5HE2 A;  4W9G A;  3IBE A;  1UNP A;  1SE9 A;  3E9P A;  3T8M A;  2LOX A;  3PHW B;  3VDZ A;  5JHA A;  3L54 A;  4BBN C;  1BT0 A;  3A4S C;  1LB1 A;  2EKE C;  3U7D A;  4G0N B;  2CHX A;  4N9F 4;  4HAX B;  2D10 A;  2I1J A;  4AOF A;  4II2 B;  3SBG A;  3AI5 A;  1E7V A;  2DZK A;  3AU4 A;  1V5T A;  5J3T A;  4MGY E;  1KZ7 A;  2Z0O A;  2KLC A;  2L05 A;  4IWQ A;  4WQO B;  5CHV C;  1UH6 A;  3DBS A;  3PRE A;  3QC8 B;  4FJZ A;  2N7D A;  4EMO A;  3NSU A;  2K2J A;  4B6W A;  4JKH A;  2RGN B;  3ALB A;  3LJ3 A;  3DXE A;  4DXA B;  1E90 A;  1VD2 A;  2BCJ A;  1B55 A;  3A1Q A;  5C16 A;  4MSQ B;  4DBG A;  3V5W A;  1GG3 A;  4ILG B;  1EVH A;  1K8R B;  2DHI A;  4NAW A;  1XD4 A;  4MT7 A;  2FJ9 A;  2RSU A;  2Q13 A;  1V81 A;  2DX5 B;  1PLS A;  1DBH A;  2YVC A;  2K2U A;  3HK0 A;  1EGX A;  1V5M A;  2IYB A;  4W9H A;  4F7G A;  3R7R A;  3A8P A;  1WGR A;  1WJ1 A;  2ZEQ A;  3JSV B;  5C23 A;  2BYV E;  2DHZ A;  5DPR A;  4MEM A;  1MIZ B;  3WA0 A;  2IYD B;  1KI1 B;  3KRW A;  1UEL A;  2COF A;  1E5W A;  4F7U P;  4AWJ A;  1GC6 A;  1WGU A;  2REX A;  1E8W A;  3VUX A;  4IWP A;  3H6N A;  1U27 A;  1ZW7 A;  2R0D A;  2KQS A;  5CLQ B;  3PG7 A;  4HWI B;  4I6N B;  5LXH A;  5CLL B;  5C1Z A;  2XEW A;  3ZVV A;  2RLO A;  2YF0 A;  3VTV A;  3F5R A;  2MBB B;  4F8C B;  2LBB A;  3PEG A;  2O2V B;  2KXJ A;  2DTC A;  2HRJ A;  2FIF A;  1ZM0 A;  5C5B A;  3HM3 A;  3WIM A;  4I6L B;  2XK5 B;  2L3Z A;  2COD A;  2Z0D B;  3QWM A;  2M1M A;  2XBB C;  2KJH B;  3ODX A;  3VH3 B;  1RFA A;  2C60 A;  4EJN A;  2BWE S;  4KZ0 A;  5HKH A;  5FI1 A;  2KO3 A;  3SNH A;  1NTY A;  3RCZ A;  4TKN A;  2KN5 A;  3RT3 B;  1JDE A;  4GOC A;  3A9J B;  1U2B A;  2FCQ A;  2G4S A;  4A6F B;  4TV3 A;  4MGK E;  2YS1 A;  2KWV B;  3ULB A;  4M8M A;  2DIK A;  2AL3 A;  1GJZ A;  2M38 A;  5DPS A;  2DX1 A;  1V5O A;  4W9F A;  2CU1 A;  1YX5 B;  4BFR A;  4MJS A;  2ZNV C;  4GDK A;  2PPH A;  3M3J A;  3IG3 A;  2PE6 B;  1EUV B;  4IWO A;  2UWQ A;  3A98 B;  4E74 A;  3R7Q A;  4JKF A;  4I6P A;  4G50 A;  4CYE A;  4DHZ E;  2D3G A;  2VRW B;  2NPT B;  3H7P B;  1OEY A;  2DFK A;  2Y7B A;  2ROZ B;  2RR9 A;  5KHQ A;  3RZW C;  5DIF B;  4YON A;  2CY4 A;  1DRO A;  2IBI B;  1KBL A;  1H4R A;  2LWP A;  2NBV B;  2LAS A;  4KZC A;  4GZU A;  3WAO A;  2EC1 A;  3FLV A;  3QBV B;  4Z2M B;  3MTN B;  3EPY A;  4FHK A;  3DBH I;  2KGX B;  4KHO A;  3SBT A;  4BKT A;  2JF5 A;  1C3T A;  2W2X D;  2ABD A;  3PT2 B;  1UBQ A;  1AAR A;  3JVZ X;  2B3A A;  1ZC4 B;  4TQ1 A;  1P0R A;  2MX2 A;  4X57 B;  3EC8 A;  4NQK E;  3P2B A;  1WZ0 A;  1HBK A;  1P9D U;  3TVV A;  2C7M B;  2COA A;  1DDW A;  2LVO A;  3PV1 A;  2GOW A;  1V6E A;  4IOY X;  2ZCB A;  4HCP B;  1DDV A;  3UIO B;  5C6R A;  3D8D A;  1WXM A;  3ZLZ A;  2OQB A;  5E6O A;  4DHZ B;  4FBJ B;  3N32 A;  2W2W A;  1OQY A;  1ZKH A;  2K6D B;  2KOX A;  1WXV A;  2FDQ A;  2VRR B;  4GDL A;  5CHW A;  3TMP B;  2NMB A;  3BIN A;  4W9K A;  5D2M B;  3Q3J A;  2HE7 A;  1LQB A;  1XKE A;  2D9V A;  1P3Q U;  2NS5 A;  1K5G B;  1UPR A;  5DI9 B;  4XC2 A;  3CST A;  1IRS A;  3N7C A;  2DAF A;  4EOY A;  2M0X A;  2Y8G A;  2LGY A;  2BKR B;  3QWZ B;  2JPH A;  4HB0 B;  5C79 A;  3N3K B;  4JQW C;  4GDL B;  3PSE B;  2KDI A;  3RUL A;  4KVG B;  3B1L X;  4IM0 A;  1OGW A;  2L76 A;  2N9X A;  3DOW A;  3DQV A;  4B9K A;  4PS7 A;  1QC6 A;  1DYN A;  2N9E B;  4HB3 B;  2KTR A;  2LKO A;  3NZU A;  2JZZ A;  1WI0 A;  3MJW A;  2FAZ A;  3A33 B;  1KJT A;  4NNJ B;  1QQG A;  2ASQ A;  1WMH A;  4PNK A;  3VTW A;  3ECI A;  3E9O A;  4BKG A;  4K2O A;  3VTU A;  3APC A;  3AUL A;  1S1Q B;  2NPT A;  4IG7 B;  3MHS D;  3DPD A;  2ZVN A;  1P5T A;  2D9Y A;  2P8V A;  2GCJ A;  2K8H A;  1OEY J;  3D8F A;  3OJ4 B;  5IA7 A;  2M17 A;  4ZRJ A;  3VUW A;  2O6V B;  2L7R A;  3EHV A;  4NSW A;  1VBG A;  4GU2 A;  4KHB B;  2G4D B;  2M14 A;  3QHT A;  1TQZ A;  2KCJ A;  2YS5 A;  4JGH B;  2KTF A;  2KQ7 A;  2Y8F A;  4DX9 0;  3OAW A;  4MDK E;  2P0H A;  2LXC A;  2DLW A;  2MWS B;  1HB8 A;  4W9E A;  3UIN B;  2DHK A;  5AZH A;  3A9J A;  3H1U A;  4TQ0 A;  2BWF A;  5D27 A;  3KW5 B;  1Z5S B;  1P3R A;  4A20 A;  2IFS A;  1X1G A;  3ZIM A;  4PYZ A;  4HJK A;  2R09 A;  4DX8 A;  2GMI C;  2ZPN A;  4TUU A;  1WRD B;  4CHM A;  5JHB A;  4A5K A;  2LD9 A;  1E8Z A;  4YL8 A;  1PQS A;  4HVB A;  2HTH B;  3D8E A;  3QK0 A;  4WWO A;  2MQJ A;  4HAU B;  2GJY A;  2KFK A;  2RQ1 A;  5AZF A;  2DKP A;  3P7Z A;  2J0K A;  3DVG X;  3A9K A;  3PPA A;  2CKH B;  4W9I A;  1Q5W B;  2AWT A;  2L0F A;  1M94 A;  2J7Q B;  5J3Q A;  1WX9 A;  1MKE A;  3APF A;  5JLJ B;  3R3M A;  3DVN U;  5DH9 B;  2K25 A;  4KSK C;  3X0W A;  2LUL A;  2LXA A;  3RYT A;  3ZVR A;  2ROV A;  2BPS A;  2O2V A;  1WF9 A;  1P6S A;  4NQL B;  4JKD A;  2EMS A;  2N4F A;  2COC A;  3MPX A;  1RAX A;  3WAP A;  1V2Y A;  1WR1 A;  4HAW B;  1IYF A;  3L10 B;  1Q67 A;  4XWX A;  4PS3 A;  4JK8 A;  1NTV A;  3FM8 C;  4II3 B;  1OTR B;  2H7D A;  1WMH B;  2GBK A;  2LZ6 A;  3KYD D;  4ANW A;  1U4A A;  1UZX B;  2RVB B;  4DDG D;  2QHO A;  2NBU A;  2L1C A;  3AXC A;  1U5F A;  4HPL B;  1WH3 A;  2OTX A;  1MK7 B;  4GPT B;  2XK5 A;  3WAN A;  4RM9 A;  4WSF A;  1VCB A;  4KDL B;  5IAA C;  2D9W A;  1YQB A;  1I7A A;  1U5D A;  2GBJ A;  4KIK A;  2J59 M;  2DAJ A;  1BWN A;  3RUI B;  2K00 A;  4JKG A;  1WXA A;  4RMA A;  3HQC A;  1WG7 A;  3NZS A;  2D4Q A;  3D32 A;  3SHQ A;  4EZL A;  3C0R B;  1FAO A;  3OAN A;  2GBM A;  3M62 B;  5G55 A;  3O65 B;  2DKQ A;  2KWC A;  4PQ0 A;  3A4R A;  4MY6 A;  2D11 A;  1FGY A;  1TTN A;  2CQU A;  1HE8 A;  2KDF B;  2Z0E B;  1F9J A;  1V5P A;  1I2H A;  2J0J A;  1LM8 B;  3BJI A;  3U8Z A;  3KZ1 A;  2DYN A;  5D3V A;  3TBL D;  4HB4 B;  2KDE B;  2RD0 A;  4JK9 A;  1OY2 A;  1NU2 A;  1S3S G;  1UD7 A;  2OOB B;  2JXX A;  4HAT B;  1WE6 A;  1I35 A;  3M95 A;  4KV2 A;  3KH0 A;  3VUY A;  4EUT A;  2ADZ A;  2FCM A;  1EO6 A;  1R4M I;  3VOQ A;  3KVF B;  2K8C A;  1FHO A;  1PMS A;  2K1F A;  3HM6 X;  1XCG A;  4HAY B;  2Z59 B;  2MBH A;  5CX3 A;  1TJ6 A;  5JZE B;  4DHJ D;  3TCA A;  2N23 A;  2KFK B;  2R2O A;  1FOE A;  5D3W A;  1KC7 A;  2GBN A;  2LI5 A;  4XX5 A;  1Z87 A;  2JVC A;  3TW1 A;  5E6N A;  4ANU A;  3L16 A;  2MFQ A;  4W9D A;  1JRU A;  2L8J A;  2FCN A;  3UF8 A;  2N9P C;  2P0D A;  4A3P A;  2E2X A;  2EMT A;  1MPH A;  2GBR A;  3PHX B;  4EEW A;  3E9L A;  4HLE A;  4MM3 A;  3KY9 A;  3S2A A;  2CAY A;  3ENB A;  4XZ4 A;  3KUZ A;  2I5C A;  2FNJ B;  2I5F A;  4GSW A;  4ASW C;  3VXW A;  2IY1 B;  1U29 A;  4K2P A;  3L08 A;  1X05 A;  1G6J A;  4WVF B;  2YT1 A;  1M7E A;  4GDK B;  4WJN A;  2AL6 A;  2UZR A;  3DXC A;  5BO4 B;  1NTI A;  1EAZ A;  1FHX A;  3ONS A;  3U30 A;  5JHG A;  4LDT B;  3RD2 A;  1WJ6 A;  4HPM B;  5FI0 A;  3H7P A;  2PZ1 A;  2DYO A;  3ZRC A;  1YD8 U;  5E6P A;  1M7R A;  1WM3 A;  3DCG A;  1W1D A;  1AQC A;  2KJ6 A;  2JY6 A;  3QAR A;  4ZRK A;  5IJM A;  1V9J A;  3ZNI D;  1XX0 A;  1KLV A;  3AJ4 A;  4AUQ C;  1V89 A;  4WWP A;  4CO7 A;  3QQ8 B;  1WJU A;  3PRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...