4ZS6C

Receptor binding domain and fab complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
221
structure length
221
Chain Sequence
VQLLETGGGLVKPGGSLRLSCAASGFSLSDYYMNWIRQAPGKGLEWVAYISSSSGYTNYGDSVKGRFTISRDHAKNSLYLQMNSLRVEDTAVYYCVRDRDDFWSGYYKHWGLGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fab Light Chain
publication title Structural basis for the neutralization of MERS-CoV by a human monoclonal antibody MERS-27
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 221
sequence length 221
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zs6C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zs6C01
5C07A 2VKWA 3B6SA 5CJOH 4P2RA 5B8CB 5E8EA 3HNSH 4PJHA 4X6DF 5DQ9A 3SJVE 1HINL 2OTWB 4WY7H 3I75A 2DQFB 1S9YB 2IMNA 2XN9E 2E7MA 2YHGA 3AM8C 4KK9D 3PQYB 4MA1B 3RVVC 5DHYB 1OQXA 3RUGB 5KSBE 3NCBB 2C3WA 4O5LL 1QR4A 4HWBL 3OJMB 5GIRB 5BZWB 4U7KA 2ADGA 5EBGA 4XI5D 3GHEL 1CD1A 4HDIA 4J4PC 5BS0D 3ZYOA 4QRUA 1HOCB 3X12B 3QUKA 3TO4D 2OL3B 2CK0L 2A9NL 3WXWL 4ORGB 4P9HC 4YH6A 3S7GA 5C86A 2B1HL 2AEPH 4ZDHB 4Q2ZB 1R3LB 3ISWA 2EKSA 1I7RA 3H3KA 4XVSL 1VFUA 3JWOC 2AEQH 4G3YL 4WGWB 3S36L 3V6FA 4U1SB 3ELAT 5E8OA 3CFCH 5EU3A 2CK0H 4EUPA 3ZDXE 5HDQH 1BEYL 4HCRA 4G8GD 4JGMA 2FH8A 1Z9LA 5T3XD 2HRPH 2BSRB 4NNYB 1JPSH 4N0UE 1MHHB 1RY7B 2CDGB 5D7IB 3GMLB 2O26U 1S7RA 5DR5H 1BD2D 5D7JA 3O4LD 4XBPA 1S5HB 5TF1H 4Y1AE 4TUOB 3FN0L 25C8L 3VFSB 3C6LB 3FOLB 4JFEA 4K3DL 4QCIA 4EN3B 4JRYB 5DEFB 3T3ME 1SJXA 1WZKA 4S2SB 1K8IA 2E6JA 3OGCB 1NC4B 2XKSA 5MEOB 3AROA 3RIFF 4UDTA 4QRRE 4LHQB 3PWNA 3OX8A 5ISZB 4ZOCA 2FIKA 4XRCB 4WFEE 3ZT7A 5KW9L 5IVXE 2W59A 1T3FB 1T5WB 1V5JA 1FZOA 2X1QA 4LCYA 2A6DB 5JW3L 3FN0H 3FZUD 1X7QA 3SE8L 4D0CB 5I1EL 5F7DB 4S1DD 1A5FL 4J3WA 3SBWC 4K2UL 5EA0L 4X5WA 1KB5H 2XG4A 1NCWL 1BQHA 4IRJC 1EGJH 5CKGA 4JFFA 2NX5D 3PP3H 4V1DB 1FAIL 1FVCA 2XNAB 5DRWA 4OFVA 1P6FA 2HVJB 1D5BA 3ARBA 3LH2H 3DUSB 1QA9B 4G6ML 5GGRB 3V5DA 3WFBH 2W0KA 3QFJD 3KNBA 4K9EH 1R5WA 2DQIH 4K2UH 4DW2L 1JGDA 1IGYB 1CN4A 3BZFA 3VFOB 4PJBB 3HE7A 4S1QL 4OZFH 2JJVA 4LLDA 4FQ2L 5F96L 5IVZB 3GJEA 1XF3B 5DRXB 1NGZA 4CVZA 5IVOA 4MA3B 3QDME 4O2CA 1B6DA 1YMHB 3WUWG 2OXGA 3T09A 4NUJB 2V5SA 3NA9L 1IBGL 4YEEA 3IAQA 3FQTB 4XWOC 3MRMA 5HYJB 1A2YA 3QZWA 3BGMA 3QUXD 4XTRD 4JFDA 4P59L 3SPVA 1PBYA 4N90E 2VQTA 2YPLD 3MRPA 5F1SA 5KS9A 4BZ2L 5C0RH 4OZIA 2FHFA 4N8VB 5ERWA 1JFQL 1G7QA 4B7IA 4XNXL 2VE6B 1W0VA 1MFBL 1RIVH 1ZT7B 5E7FA 3U7YL 1FZKA 2B5IC 4YDVA 1N8ZA 3UTSA 1CDBA 1B88A 3C5SA 1MAML 3QUZC 4LQFH 4JLRB 3VFMA 2CDEB 4Z7UE 3O6LL 3S3JA 1REIA 2W9EH 3QUYC 2E7HA 3GIVA 1WV7T 5C0AB 3CXHJ 3U2SB 2AJXL 5I66A 1T20B 1IRAY 3U7YH 5IJVB 1W72A 2XTJD 3TCLB 1NLBH 4YBQD 5EBWB 4NQTA 4M8QB 1J8KA 4P5KA 2OX5A 1J11A 5C3TA 2KL6A 5GS1A 4NOFA 1XZ0A 4TQEL 3ULUL 1MAMH 3RY6C 4F33A 5DF0A 4GXUM 1GGYA 5AG9A 4JM2C 3KVQA 1F4AA 4UQ2A 3BMVA 1RMFH 3P9MA 4XHJD 5SX4I 1CL7L 1RVFH 4U0RC 1CFVH 2YC1B 5D9SB 5IWLA 5DUBA 5C0IA 2CUMA 4XCFL 1QLEL 2DQGL 2BP3A 3ARGC 2BVYA 3GK8L 3IFLL 3P11H 2OJEB 4NN5C 1YA5A 2VDQL 4NN5B 1IQDA 5F9DC 4P2YA 4ODTL 4YDKL 4PLJC 4KKCD 3VFRB 1WCBB 2KPNA 4GUPA 4ZSOE 4PJIE 3NPZB 3QUMB 5ILTH 1KEMH 1DFBH 5M7QA 5DFVD 3QEUA 3QO0B 1CL7H 2EDQA 3P0VL 5DJ8A 1MJ7L 4XCFH 4D8PA 1NJ9B 3MRIB 5EIIA 3GK8H 4KHXL 4OZHB 3KPNB 3KPSB 4MJ4A 3ESUF 3G5ZB 2B4CC 1ED3A 2NY0D 3HAEA 3VGHA 4YDKH 4P2OD 4L5FL 5FYLL 3IXTB 2FJHA 4CRPA 1CLCA 2DWEA 3ZTNH 7CGTA 2VLKA 1LO3L 3P0VH 3NBNA 2BZDA 4IJ3B 4NC1E 4X6DE 3L6FB 3KPMB 5K9KA 1DQTA 4WUUD 3QQNA 1KIQB 4KKLC 1F4WL 4ZUSA 4RWHA 5JHDE 4WFHD 4AJ0A 2YD4A 5BS0B 5C0CE 1MCLA 3WSQH 1AQKH 1FAKT 3RPIB 3TO4B 1NAMB 5KVEL 3FQXA 3HZVA 5HHPA 1FFOB 4FXGB 4U1NB 2NW2A 4XPAL 3SDXA 3EOAB 1TCRB 1LO3H 4N9GB 4G80A 2CLVA 4GT7A 5I2IA 4L4VA 3CX5J 3D0VB 3FMGH 2HTKC 4MJ2A 1JZ8A 1NFDF 2G2RB 3B9DA 3KR3L 4TVPL 3REWA 1OP5H 1MRDL 3SGEI 1WFOA 2FEEL 1CDJA 3IDUA 1I8KB 3FHQA 5KVEH 4J1UB 3JSSA 4TVSa 5J9PA 3FQNA 1F58L 3D2UA 4DKEH 1A02N 5I71C 1SY6A 2KZ1B 4YGAB 1GGIH 2IEPA 2WUBL 3O6MH 4G8GB 4LOUD 1DP0A 4OLYH 1T7YA 1C5DA 1ZWIB 3T1FB 4FZ8H 3ARED 5C0FA 2IGFH 5CSZA 3OQ3B 2YRLA 1U8HA 5ETUA 4OB5L 4EQ2A 1HIML 3STZA 3NZ8B 3QHFL 3SJVD 4OF5A 1Q94A 1UB6B 3G6JF 3KPTA 2DRUA 3WS3A 1BD2B 2Q86A 3CMGA 3O4LB 4CL7A 4KQ4H 4A2LA 4Y4FD 4LHUD 4UQ3B 5FKPA 2R4SH 3RZWA 1AGBA 4JN2B 5JORA 3VCLB 3OWEA 3MLVL 4NKOA 2WUBH 2HFEB 4LMQE 3HC0A 1FGVL 4G42B 5C2BH 3RWFA 1MI5B 1U8OA 1HIMH 4NZRL 3QHFH 1H3PL 3SKOA 4JM2F 3GJFB 3UAJD 4KQ3H 4P4KD 1LEKB 1A1OA 1NBQA 2PYEA 3VFNB 4JG1H 1GZPB 1ZV5A 1NUFA 1P2CB 4M3KB 3T08A 3HCVB 2VJXA 3LIZL 1DUYA 4GAFB 1DCLA 4L4TA 3TBSB 2X70A 1C5CL 5H37G 2OK0L 3BKYL 3DNKA 2NX5B 4PJCB 2VZVA 4Z0BH 1NCCL 5E6ID 2I27N 1WAAA 1FV1A 3BDYH 1R3JA 1ORQB 2D0HA 2VDNH 3IDIA 1MCRA 4LGPB 5L2KA 4G9DB 2BJMH 3F7VA 5F6HJ 4HS6B 1OQOA 2Q7YB 4ONOA 4KWUA 1EHXA 4ORZC 5T1KA 1T66C 1DQLH 4JFZL 4TULL 4RX4D 1UJTA 3HNVL 5E8NA 3X3GL 4NN6C 4R0LC 4U3CA 3BZEB 1AQDA 1S9VA 2K7PA 5FO7A 3G08A 4NN6B 1N0XL 3ULSB 2NPLX 2V7NB 1AR1C 2DM4A 4WW1A 5IJKA 4JRXE 3PJSA 4M7KL 3LKOB 2DS4A 1FFPA 2FX7H 1EFXA 4Y2DC 1NFIB 4U3XA 1R6VA 4Y2DB 1R0AH 4QRRD 3DX7A 3VFWA 4JFZH 3QUXB 1U3HC 4RMTA 5F1NA 1MCBA 2XY2A 3GHBL 2BOBB 4R4BB 3W5NA 3U82B 1I4FB 4PJ9D 2YPLB 1KELH 4FS0A 3RZCD 4NRXA 3FFDB 3HPLA 2VSDA 4FQPA 3O8XC 4YLQT 3VFTB 4M7KH 2A6JA 2EICA 1YEFH 3O8XB 5HYQA 4YC2C 2YA2A 5I1CH 1EBPA 1TZIB 3WIHH 1M71A 1G7HB 3BP7B 4YX2H 2DQTH 3GHBH 4MCYA 5E2TL 5DO2D 3VH8B 2KKQA 4L3EE 1UYWH 4ZPVB 3EDJA 4KK8D 2X40A 1FIGL 2MHAA 4XGZA 1BGXH 1BX2A 3TT1L 3TH4T 4AMKH 1DBBH 5CJQH 1LD9B 3RGVA 3DO7A 4LF3A 2PXYD 1JRHI 3I6LE 5EUOB 3SDDA 4AQOA 3LS5L 4WI6A 3GNML 5E2TH 1AIFB 1CLOL 1I9IL 2NTFA 3CC5A 4AYFA 4WNQB 2B0SH 2DICA 3GBML 4NSKB 5IB3A 4Y5XC 3MA7A 3WD5L 3KLDA 4W4OC 4U1HA 5DI8A 3RAJH 4N8PA 3MLYL 3VMNA 2AJZA 3QQ9D 1ZLWK 4AEIH 1GH7A 2QSTA 4JFYB 3VDBA 3P73A 1JNHA 1QLRB 3VXTB 1R5IB 3R0NA 5BVJA 1DVFA 3LS5H 3BP6B 4NO0D 3KDMA 3SGJC 1ND0B 5B38B 1E0OB 1H8NA 1LO5B 1L0XA 3V5KA 3H3BC 5BMFH 3SDCD 2IQAA 4FQCL 1RAMA 4HIEA 1Q9WB 4F8TA 4WWID 4KI5F 1KCVH 2G75A 4M1DH 5IF0A 4JKWA 1JYWA 1OAYL 1S9KC 1H5BB 1OGTA 2BK8A 3GBNL 2I9TA 1UWGH 4OGZA 3V0VA 3MBED 2V5RA 5IHZB 2MQCA 3MOAL 1E4WH 3QAZB 9CGTA 4Y19A 2QHLA 4RRPG 1WFUA 2SEBB 2J4WL 4WV1B 4LLVA 4NRZA 4HUVA 2PTTA 1WWCA 1U92B 2NXYC 2C26A 3UBXB 4Z76B 2NY0B 2EYRA 3TBYB 3QCVH 4AENA 4P2OB 5T1DL 2V2XA 3TYFA 2D7QA 3AXLA 3ARFC 3VRJA 4WO4D 1MY7A 3DSFH 2GI7A 4J7RA 4OD1L 3BPNC 3SE4C 3GMPA 1RZKL 4OLEA 4D2NA 3KG5A 3GSNH 3H9HB 2H6PB 4M00A 3ZHDA 4RGOL 1J10A 4LVEA 4WUUB 3SKUD 5LKNA 4X6BB 1AR2A 5DMYA 1FNFA 4JQVC 2QKIB 1PG7W 4I0PC 1ZHLA 3U6RA 2OQJA 1X3DA 4CJ0A 1ZTXH 2BHYA 4M61B 4QHMA 4R2GC 2UUDH 4ELMF 4E5XB 1RZKH 3MRQA 4LASL 4XNYL 1F3DJ 4Y4KC 3OKEB 1TJGH 5D1QA 2ICWI 1IARB 1MAJA 3I6KA 4MX7A 5ACZB 4I2XB 4ONHA 5BV7B 1EEYA 5DJCA 4O00A 5J89A 1LE5B 4X9GA 3NTCL 2Z8VC 3T0ED 1QBML 3CFIC 2F74A 4PJXB 1OOAA 4PRNB 5DD1L 4XNYH 1ADQL 4NT6A 5HDBF 2OM5A 1S3KH 3EIFA 3AREB 3IDJB 5AWNL 5SWZA 1EEQA 4Y2OA 3TVMC 3PWJB 4JREC 3W0WA 3TVMB 1S7QB 2ZP0T 1WK0A 3IKCB 4MA7H 3GB7A 4Y4FB 4LHUB 3ARDD 4RGNC 4Q9BA 3IETA 3G6JE 3I3DA 3R06B 1ADQH 2AS5M 3DXAE 1W8OA 1A64A 3CXDL 1E27A 5CEZL 1T6WA 1XCQB 2DQHH 1CICC 4WWKA 4JM4L 2HT4C 1T04B 1CICB 5C0CD 5IV2A 2A6KA 1YN6A 4OTXL 3AB0C 5IUSA 3WE6B 3AB0B 2GKIA 2GTZA 3FO9B 4FQHA 4GRLA 2OJZH 4P4KB 1KJ2B 4PBWD 3LKQA 1PEWA 1NGQL 5DJ2A 1B4RA 4WHTA 4G9FE 4DN4H 3JTSB 3WO4B 5I1JL 4IHOA 4X7DC 5CEZH 1M7IB 4XXCC 4XNMA 1PSKL 2ZOKB 3FQRB 5BOZG 1JZ3A 2W0FA 1I7UB 4PJ7F 2R2BB 1CXHA 3QIWA 4XT1C 2MKWA 4GH7B 1AY1L 4X0KB 3VXRE 2EEBA 3WN5A 5GGSB 3NN8B 2UZXB 1CGTA 3DARA 5TQ2L 4IDLA 4YEFA 1IAOA 1BWWA 1KB5B 3PGDB 4YZFF 4I48A 3U36A 3RWIA 2IQ9L 3I6GB 3LEYH 4GXVL 4F7MB 1QFUH 1TDQA 1FZMB 1DQQA 4RZCB 2CDFA 1A7QL 1BF2A 4K71C 4AT6A 4HQQH 1BIIB 4GRMB 3SGEH 4OGYL 1ETZA 2JELL 1TVHB 3H6JA 4K9EC 4MQ7A 4DWHA 2CRMA 1SMAA 1TJIL 1AI1L 3SCMD 4L8CA 4QXWA 5TQ2H 3K2MC 4M48H 2Z0BA 3RWDB 5F21B 1BFVL 1J05B 4Y4HC 1CZ8L 3WNOA 4JJ5A 2HA1A 2D7TL 3BEWB 4GXVH 4Z77B 1PKQA 4OZFB 3VGFA 1CFNB 4UT6H 4PRAA 2DBJA 1DEEB 5B39B 3RP1A 3VW3H 4N1CA 1C5BL 4H1LB 5JW4Q 4LARH 4PJ9B 1EDQA 1OT1A 2JELH 3RDTD 1TJIH 5D5MA 3RZCB 1JZ7A 1AI1H 2AXFA 3DVNA 1UFUA 4E42A 4GAGL 3L3GB 4Z7OF 3X11A 5TE4H 2HFTA 2PW2A 1DBKH 3BIAX 1AD0A 3MMEB 4IDJH 3DX6B 3MPCA 4KMTH 3QPQC 4PRPE 1C5BH 1F4YL 4NFBA 2OS7A 4NJAH 4IMLB 5F8RC 5INCA 2VZ3A 2FDBP 3TNNB 2OSLB 1IGIH 2MFNA 5FYKE 4GW5B 4GAGH 3CFKB 1AHWC 2VXTL 3CVHB 3FRPA 3MROB 4KPHL 2BNQA 3QA3B 5F72S 4X98A 1XIWA 4AZ8A 1BZ9B 2EH7L 3JTTA 5DYOA 3RKDC 4XHQA 5EC1B 2PXYB 1SJEB 2OI9C 3R1GL 5H37H 2IBZY 4LCCC 2OI9B 4EI5C 3PV6A 1S7WB 4EI5B 4BH8B 1FL3A 2EE9A 3C2SA 3GRWA 3QPXL 1V3LA 3BZ4B 2HH0H 3RL2B 2XG5A 3LAFA 3UX9B 3OKKA 5DC0A 5EU4B 4BFEA 2VXTH 3CCHA 1XF5A 3QQ9C 4OI7A 1D5ZB 5C0BA 4F9LC 2Y36H 3AMKA 2EH7H 1N7MH 4MJ6B 3D3VA 4L4JA 3R1GH 4Z7WF 5EU7C 4NO0B 3W11D 4MWFA 5DVMA 2R29L 2JB6B 3QPXH 3DHJA 3SDCB 3ZHKA 1WT5A 4YHYB 5JW4N 3WBDA 4A6YL 1NGWA 1RK1A 5EBLB 2ZCLL 1YMMB 4HLJA 4W81A 3LV3A 4KI5E 4MHHI 3JV4A 1M05A 4GW4B 3MBEB 2WBKA 3BH9A 4HUXA 1NCTA 4NKDB 3EGSA 1PYWB 4JPWL 4QF1B 1KCSH 2BY3A 3HZMA 1KFAL 1T7WA 4WU5B 4IOFD 3MRLA 4HJ0D 1QFHA 4A6YH 5K93A 1QACA 3I6LD 3JBG7 3SE3A 5K9JL 1BVLA 4MVBC 4OZ4B 2PO6D 3DTXA 1RZJL 1AKJA 2AK1L 2Q76B 4ISVB 5E08L 1Z0MA 4QOKB 3HA0A 1UM6L 2IG2H 5T3ZE 1ZS8B 1QQDB 5IMKB 3MLUL 1X5GA 1KFAH 3N06B 3OKMA 1KLUB 1OSPH 1YEDB 3K4AA 4PREA 2EDJA 5GGTA 5ALBL 4RFOL 2CGRL 2FHCA 3EJYC 1S78D 3GMMB 5D2LB 5HVHC 4IMKC 4OCRH 4HV8B 5D8JL 3AGVA 4BKLA 2CJUH 3ROOA 4E41B 3UJTL 5IP4A 4P2QE 3T2QA 3PF2A 1KT2B 1RFDH 1NQBA 4WW2C 3T0EC 4WW2B 3T0EB 4LLUA 4H8WH 3LN5A 2L4OA 2CGRH 1D6EA 3T77A 4OLXH 3WDJA 1XH3B 3P0YL 2DYPA 4OLWL 1P4LA 1WIUA 1IGCL 1OCWL 4Q0XL 4QHNA 4XCYA 4YAQA 1UJ3A 4BFIA 4WJ5B 3QZWG 5HDBE 5HY9A 2FLBT 2ARJB 5BRZE 3MJ9H 4KJPD 4MB3A 3LKRA 3WHE0 5KSAA 5CIPH 1BFSA 2R8SL 4NQEA 3N85L 1EO8L 4G8FB 5IESL 5IB5B 3HNTL 1D7FA 5E1AB 1T2QL 4WDIA 5EZOH 1NPUA 3ARDB 3MREB 1PFCA 3P0YH 4S1SH 3LMJL 3KPRE 1NSNL 4OLWH 4XZUA 1UKQA 3FB6A 4X4MA 1IGCH 4K8RD 4AH2B 1KXVC 4JE4B 5GSRB 2VO5A 4AM0B 3ZL4L 4UNUA 2BHZA 3K2UH 3N85H 1LP9F 1A6WL 2C3HA 1HSBB 2EYTB 4R4NC 4ZXBA 4LSTH 1R3HA 1DQJB 5E4IA 3VXUA 2CO7B 4FFWD 3MRHA 5BW7C 1TQCC 2XOTA 1IFHH 2X4PA 4JFQB 4NP4H 3WNPA 4XPFL 5IEKB 1K4DA 4OD2B 2DQEL 3TIDA 1RUKL 1B0RA 5TGBA 4U0QB 5C6TH 4TSAL 3IFOB 2MJWA 3HFML 4M7LL 2QSVA 3OAYK 5I15H 3OKNA 3STLA 4DZ8B 1I1RA 4PJ7E 4PGDA 1AXTL 3QIBC 4BUGA 3QIBB 1OSZA 4XPHL 1FJ1B 1YEGL 4PV9B 2DQEH 3BHBA 4C57C 5C09E 3D18B 3CFEA 4YZFE 3TV3L 4TOYH 4LQ1A 4N5ED 4W6YB 3IDXH 4R9HA 1OM3H 2ATPA 5J1AA 4LVOB 3SCMB 4P4RA 4FQXC 1J1XH 2CH8A 4MNGB 4FQXB 5K33A 1NGXA 5JPMA 5D70L 2Q8AL 4GG6F 1Q9KB 1CGWA 3MRBB 4UIMA 2AXGA 5KTEL 2EDRA 4QRPE 2ITCB 3WFEL 4BH7A 4ZUUB 2YEZA 5D7KE 4FXLA 5GGUB 2RFXB 4WI7A 4ZFFA 4ZO7A 3S5LG 3GMOA 4NYLB 5DRNA 3RDTB 4PJGB 1A7OL 1MNUH 5SWQB 5F3BB 5F7UA 3CPLA 4XP4H 5B8CA 4MAYA 1L6ZA 2QHRL 1HZHL 3PV7A 2OTWA 5I75C 1MEXL 2P4AB 2X44D 5I75B 1XEDA 3PQYA 4Z7OE 5DHYA 3UP1A 5KTEH 1F4XL 1QPPA 1G6RA 3RUGA 3WFEH 4HUUA 5GRVL 5GIRA 4F57L 5BZWA 2H26B 3OTTA 1A3RH 2V2TB 3OKYA 1Z0NA 1INEH 4NQXB 1NCDL 4HGKC 1HOCA 1AJ7L 3X12A 1IT9L 3WFZA 4F58L 5JLZB 3FT2B 2H32H 1AGEB 5CGYD 1HZHH 4RAVB 4AY0A 1T21A 4BFGA 3S98A 3SO3C 2DLFH 1NLDL 3V4PH 3SO3B 3U1SL 4Z7NF 2HWZL 4GMTH 2NR6C 2ZSWB 2A0LC 2YPKB 3WJJC 5DJ6B 6FABL 4AK1A 5CD3B 4NQDE 1Z5LB 1AJ7H 4LLWB 1IT9H 3CSGA 3KLSA 3G6DH 2R1XA 3L5HA 5MEND 5F7EH 2H2SD 1FBIL 4NCDA 5IR1B 2GSIB 3HS0A 5H94B 1CDHA 1XGTB 4OV6F 4I5BA 2HWZH 4BJLA 2P44B 2BSRA 5EO0B 3MODH 4NNYA 4P23D 4RGNE 1T1WA 3RX8A 3RVWC 1F11A 1MHHA 5T1LD 2CDGA 4Z7WE 6FABH 3GMLA 4KI1A 4UV7L 4HPYL 1MPAL 4TPRH 1YC8A 1MREL 3FRUB 4JAMA 4HEME 1S5HA 4PGBB 2F54E 1TJHL 1FBIH 4HIIA 1KYOJ 1TNNA 3VFSA 3C6LA 3FOLA 4M5YH 4EN3A 4JRYA 1ZGLB 1AO7A 1JNLL 2DKSA 2P5EE 4S2SA 4K7PY 3VFPB 4N0YL 4XC1H 5MEOA 4TRPL 4XVTH 3V6BR 1BPVA 2VLJA 2YD7A 4TUJA 1XCTA 5ISZA 4UV7H 4F7EB 3B9KC 2R1YB 4XRCA 2ITDB 3MLRH 3RY5A 4M5ZL 3B9KB 1T5WA 3RQ3A 2VKXA 1TJHH 2A6DA 2J1KA 3DMMC 1H8SA 2VERN 4D0CA 2O5XH 1A1NB 2PO6B 5F7DA 1ORSA 1T89A 1I85C 1JNLH 3MZTA 4AG4H 4ZO6A 4I3SL 3ZTJG 5I19H 4YR6B 5GRVK 4Q7DA 1PZ5B 4YHML 3ULVL 5F7HA 2DJUA 4V1DA 1VGKA 2XNAA 2WBWB 2FJFB 4HXAL 3C60C 4A2MA 1Y6KR 3GSNB 3VXPB 3C60B 1T83A 2E3VA 1LWRA 3DUSA 4J23A 1QA9A 1SYSB 3SDAC 5GGRA 1G9EA 4GXUN 4O58H 2UWEB 4I3SH 4MD5B 3VWJA 1J0ZA 1IGYA 4ZO9A 2G5BB 3VFOA 4PJBA 2YBRB 3O0RH 1QFWH 1M6OA 4JFHD 1UC6A 4X9FA 4JQIL 1WLHA 4QTHB 2C3GA 3UEZA 5CD5D 5DRXA 4KI5D 1H3XA 4MA3A 3QBTB 4EUPH 2W65A 2DLIA 4NUJA 4LLYB 4ZPTA 2XFXB 1ZANL 4HCRH 1VPOL 5EZJB 5KN5A 4XWGL 5TFSH 5HDLA 3WLWC 4FFYH 2GAZB 5DTFB 4H20H 4XP1L 2JCCF 5DD5H 5IGXL 2JIXD 1NFKA 1ZMYA 4OGAC 4XX1E 1BWMA 2VE6A 4YDIH 1MJJA 5HHQA 3DIFA 2Y5EA 1SVZA 1EAPB 4JFOB 5FDWB 1YEIH 4KVCH 5CWSA 3O45B 4BYHA 5JMRA 4HD9A 3D1MC 1JF5A 4XP1H 5DJZA 2R15A 5C08E 4JLRA 4HMDA 1SJHA 3TJEH 5C0AA 1VA9A 3S35L 1N6QL 3U2SA 1T20A 4O2EB 1RZ8B 1LP9E 4O02H 3HN3A 5H35B 5F7MC 4NKQB 3TCLA 4XPTH 5EBWA 3TN0C 2VXQL 4M8QA 1T0PB 5LQBL 1T1YB 4P2QD 3TN0B 4OQ1A 4HUNB 1IKFL 1GOFA 2C7UA 5DUML 2L7UA 2BERA 1NFDB 3DRTB 1RULL 5DC9B 4EXKA 4ESKA 3SN6N 1X5KA 4PRDB 4JY5H 3U9PH 3ILPA 2VXQH 2YC1A 4XMPH 5D9SA 4EIZC 2F19L 3JV6B 1U91B 4KKNA 2OXHA 4G6KL 4NO5B 1D9KA 2ZNWA 4LRNH 3IDYC 4M6AA 1UCBL 2OJEA 4LCWD 3O4OB 4ACPA 1DLHB 4PJFA 2HT2D 3M45A 3MUGA 4Q9QL 5IBUB 4UTAH 1WCBA 4U2YA 3RVTD 5F1IA 1GGCL 4X7SL 1WWWX 3E6FA 3QO0A 1U3ZA 4NM4L 2Q1EA 4POUB 1NJ9A 3MRIA 4GG6E 3LQAH 3O9WC 5IFAL 4PD4J 2VL4A 3O9WB 2X41A 4OZHA 3KPNA 3ALXA 5FUOH 3G5ZA 1MF2L 4U1LB 4Q9QH 1KIPB 2M1KA 2QLVB 2DBLL 3PHQB 1I8MB 3IXTA 1GGCH 3CLFL 3QNYB 4B7LA 4PR5B 1HYSD 5CFHA 3P9LA 2GJ6D 3L6FA 3KPMA 1GOGA 5D2LE 5JQ6H 2WP3O 1CGSL 2F5BH 1VERA 3MACL 5BS0A 4O9HL 1KGCD 3EFDH 4Q6IA 4ETYA 1ZVSB 5LG1A 5BCAA 4M43L 4CMHB 3PHOA 3RPIA 3TO4A 1NAMA 1HHIB 4P9MH 1FFOA 3A0OA 4X80H 3O2VH 4N9GA 1YEHH 5EB9A 3TESA 1I3GL 4JKPL 5DHVB 4BQ9A 3K3QA 2R1WB 4NBXB 1ZHKB 4Y0GA 3H9ZA 1MCDA 2GCYA 3TPKA 3D0VA 2OCFD 3V8CA 1CGSH 4V2CB 3V79C 4QY8A 2G2RA 3B8SA 5D7SL 1S7TA 4Z7NE 4O9HH 4HK0A 2P8LA 3IFNH 4KXZI 4M43H 4UMGA 2HTLD 1I1FB 4J1UA 5MENB 3MJ7A 1U6AL 2M26A 5M95B 3BSZH 4PJDB 2WZPD 5A3IC 3PWPE 1I3GH 3MLZH 4JKPH 3HB3C 4G8GA 2HRLA 3O2WL 4G5ZL 1ZWIA 3T1FA 4P23B 1JK8A 2ZZUT 1RZGB 1MJUL 1S7VB 5D7SH 1QSED 5T1LB 5ID1B 1X4YA 2NY4D 3NZ8A 1UB6A 4Z78B 1BD2A 1NMAL 3O4LA 2BSSA 4X9IA 1U6AH 1FL5B 5BO1L 3D48R 4DVRL 4BELD 3IF1A 3W5MA 4OM1H 3WDIA 4JN2A 4U7SA 2J8UB 2PETA 4ZNEE 5D2NC 2E9WA 4G5ZH 4HBCL 4YQXL 3HUJB 5D2NB 4G42A 5IBTL 5FO8B 2CRYA 3QXUA 3QG6B 1BOGB 3AVEA 1EJ6A 3IU4H 2VR9A 2EO1A 4KROD 3UTPE 3GJFA 3ALPA 1O7VA 3HAEH 2EC8A 4YHZH 1NMAH 3QXDB 5FGCB 4FABL 4XNZC 1P2CA 1LO4L 3RVUC 5HVWA 3DOSA 4R97C 1GHFL 4YHNA 1KN2L 3TBSA 1UVQB 5D6DC 1U8NB 3HZYB 2Z35B 2NX5A 3QEHB 1RUPL 2EC9U 2NY7H 4KY1L 4FABH 1P9MC 3BX7C 4G9DA 1Z3GL 3EJZD 1EJOH 1FG9C 3QFJA 4HS6A 3PL6D 3UXFA 1GHFH 2Q7YA 2O93L 2N1KA 5I8CB 2IJ0C 4PY7A 5GISH 3GSRB 3BZEA 1RUPH 3KXFE 4C56E 1MY5A 3ULSA 3FFCE 4YXHH 3MCLH 2V7NA 5EO9A 4B50A 4CJ1A 3IDMB 5I1HL 3G5XA 1Z3GH 1WUNT 4Z0XB 3FONA 3QFDB 4OZGF 1T4KB 1SY6H 4LSVL 2UZIL 3P4MA 4Y8DC 1T0MB 2CXGA 1QFPA 2WQ8A 3QUXA 4H8WC 2BOBA 3MNVB 1I4FA 4RSVA 1UXSB 2YPLA 3QISA 1JCKA 4OLZL 3U46B 3NOIA 3FO1A 4L9LB 2JCCE 1FYTD 3UPAA 5J1TC 1EHNA 4LLAA 4P5MB 4WEMB 1TZIA 2P46B 2UZIH 4U33A 1CG9B 2N7AA 3PWLB 1G7HA 3BP7A 3VFGL 2PYFA 3BQUD 3THML 1N6VA 2QSCL 1T7VA 5AZEL 3RWHA 3VH8A 3MLXH 3EO9L 4XPGH 1QSZA 1WZ1L 4ZPVA 3PUCA 4PS4L 4JHAH 2JF1A 4YDLB 2EO9A 4NIKB 4QYOB 2HN7B 5EC2A 3TC9A 4EOWL 4F7TB 2DLEA 1UENA 4ZUTB 3FO0H 2J8OA 1LD9A 5TQ0H 2VC2L 4ELMB 3S4SB 3ZTJH 5IBLC 3FRPG 4MMZC 4DK6A 3RWCA 3QXWA 4LIQL 2XV6B 5FFLA 3OPZH 5C0GA 4X4YA 5AZEH 2FYYB 3EO9H 2ZUYA 1WZ1H 5ICYB 4R7NB 2AK4D 3GJFK 5IMLB 4TSCL 2EYSB 3VGBA 1CXIA 4DOHB 2X7LA 3WS6A 5JXEC 5EPMB 5IKCA 1ZHNB 4JFYA 4P5TD 1QPXA 3VXTA 3WFCH 1R5IA 1BVZA 2JTDA 3BP6A 4OLUH 4H88H 5F89A 4M7ZC 1ND0A 2DDQH 1LO5A 4QRSA 2EDOA 4XP9L 2ZCKL 4HT1L 4LCWB 1U8IA 3QT2A 4XVUD 3S3PA 4EJ1C 5EOQH 5GS3A 1Q9WA 1OTUC 2GK2A 5DWUH 1H5BA 2YMXL 5ALCL 2X9XA 1KG0A 3C5ZD 2VABB 2I5YH 4C4KO 1MFAL 2NY1D 2VDRL 2YUVA 3BKML 2AABL 3JXAA 5KVGL 4QTIH 1LK2B 1UA6L 1V7NH 3LEXA 3HC4H 3ROLB 2SEBA 5I6XC 5LGJB 4WV1A 1FFNB 1NCBH 3QHZL 1QO3B 4OCWL 1U92A 1YEJH 3UBXA 2KH2B 4Z76A 3H7BB 2Z4QB 3INUL 4M93C 4P2OA 4KTDH 4LDEB 1YEKH 2YMXH 1X5LA 1AE6L 4YHOL 1HSAA 1A7PH 3BYYA 5FM4A 1QHPA 5GJTL 1G9ML 2GJ6B 3H9HA 5KVGH 4OV5A 5C0JA 3Q6GH 2X4NA 4WUUA 1CS6A 4XCNA 3QHZH 4ENEC 3P30H 2BNRE 1MHCB 3C5JB 4YUEH 1ZSDB 1BZ7B 3ULUD 3BGFC 3FN3A 4FTVE 1J1PH 4JRWA 3BGFB 4E5XA 4XXDA 1J8HE 3MGTB 1QHOA 4D9QD 3MRNB 2AJ3B 3GSUB 3U4BL 2H8PB 3L95B 5GHWL 3OKEA 4Y5YB 4KKBD 4FFZL 2ZKHL 4OFPA 2O5ZL 2H32B 1TQBC 5ITBH 5ACZA 1EO7A 4I2XA 3EOTL 5AG8A 2XWBA 2HTLC 1J18A 1LE5A 2OYPA 5AAWA 3CX2A 2OP4L 4PJXA 4LSPH 2JJTC 5F88B 2AERT 4ODVL 3BWAA 1EPFA 5I1LB 3D9AL 5J8OA 1JPGB 1I7ZB 3AREA 5KG9B 2P43B 3OAUL 1GCFA 5I1IH 1QSEB 1NEZB 2NY4B 5IB2B 2OZ4A 1I8LC 3SJVA 3V5HB 1YJDC 4OKVB 2HLFD 4EXPX 3IKCA 1NCAL 3VG9C 4Y4FA 4LHUA 1VKXB 4XMLH 2DWDA 3LHPL 3SOBH 1R24B 4U6TA 3RVXC 1PX3A 4X83A 1KC5L 3D9AH 3HG1D 1XCQA 5GRUL 5FYLD 2IPUK 4ZODA 4I77L 1T04A 1GXEA 3RWGB 4NKIH 5FGSA 4HIXH 5TDPB 1PJ9A 3BAEL 3F58L 1MIEH 4NGHL 4QT5A 3WE6A 5CSBA 1CCZA 5T1MB 2A9ML 4WI8A 4UU9B 5FK9B 2IANE 4P4KA 1KJ2A 3MV7E 5EOCL 1NCAH 3W39B 4MJIE 2AJSL 5CEZE 3JTSA 2D7OA 2GYSA 4NHCH 4KUCD 3TA3C 5FEBA 4WTXA 4RDQG 3TA3B 3ZLQC 1KC5H 4OF6A 4PP2B 5D6CA 2R2BA 3B6SB 3QWOA 5E8EB 4PJ5D 1ITCA 4PJHB 3DHMA 3IVKB 5E6IA 2A9MH 4X0KA 3TBVB 3DLQR 5GGSA 4DJMA 1E6JH 4XP6L 3PGDA 3MRDA 4J12A 1J87A 4TVPD 2VXUL 1RPQA 3I6GA 4NQCD 2ADIA 1OVZA 1OWRM 1YNKL 4TUKL 2EDHA 5AD0B 4RZCA 3W9DA 4RX4A 3WHXB 4MA8H 2IPTH 4YO0B 1BIIA 4GRMA 4MNQE 1S7XB 2X6MA 4PLKD 2AEWA 1BZQK 4JZJB 2N7BA 4MZ2A 4ZS7H 1QOKA 4GW1B 1J05A 4X6CF 1K6QH 2EKSB 1I7RB 2VXUH 3BEWA 4Z77A 4KV5F 4LCIL 1DBAL 3NABH 4TUKH 4Q9RL 4QRRA 1DEEA 4HWUA 5B39A 5E99L 1AXSA 4OZGE 3UTPD 5I30H 4PJ9A 4EUPB 4YHPA 2IF7A 4JGJA 4B5EA 4LSRH 1HWHB 4H26B 3RZCA 4RFNC 2YWYA 5DMKB 3L3GA 2D3VA 1GC1L 5L7XL 1FYTB 1RZFL 4K94H 1ZA6B 4X7EC 12E8H 4LCIH 3MMEA 2FECI 4UIKL 5FV1L 3DX6A 1OAXL 4U4BA 5D7JC 3F12A 3VXSE 4XBPB 2HG5A 5MERB 5LCVH 2FJGA 4XAWH 2W07A 2YKLH 2X1WL 3ES6B 4KK5D 2OSLA 1F3RB 2IADA 3GSQB 4GW5A 3CFKA 2BVEA 3CVHA 1RZFH 4ONGL 1IAKB 3MGAA 3QA3A 1J0YA 5KSVB 1BZ9A 3CD4A 3D85D 4S0TD 4F7PA 1E4KA 2H9GB 2PXYA 1OAXH 1R5VB 1FE8L 4HIHB 5EU6E 2FIKB 4QGYA 3QEGH 4JVWA 4C56D 4GRWB 3EYQD 4YNYB 1G7MB 1OGAE 1S7WA 5B22A 2JK5A 2R0KH 4LCYB 4BH8A 3RIAK 4J3SA 4ZNCD 2FB4H 4PPTA 5DQDL 3U0WL 5I0DA 2EDDA 3EDDA 3RL2A 4E9LA 2AK4B 4NNXB 5EU4A 4KHTL 3ORJA 5I76B 4TNWF 2VDPL 4ONGH 5SV4A 3MV11 3ZKQD 1FNHA 1BQHB 1D5ZA 3L5JA 4JFFB 5EZLB 3OXSB 4JR9L 4F9LA 3LPWA 4MJ6A 2P7TB 1FE8H 5HD8D 4NO0A 1BFOA 5DRWB 3V6ZB 1C16B 1T22B 2WUCH 3DRQB 4XNUL 3TZVD 1JNNH 3QRGH 4I13B 5HHOD 3ARBC 5JQHC 3VDAA 4HJJL 1D5BB 3ARBB 3GBLA 2JB6A 3E3QC 3BPLC 4ZAKD 4YXKH 3SDCA 3BPLB 4KHTH 4HC1L 4U1GC 1P1ZB 1JGDB 2MMXA 5EBLA 3HE7C 3BZFB 4JR9H 4OIIH 5IHLB 3HE7B 1IEBA 1CXKA 2NY1B 3MBEA 2HKFL 4LLDB 4MLIA 4Z7UA 3GJEB 4NKDA 1I1YB 4QF1A 4AEHH 4HJJH 1FO0A 1JTPA 4O2CB 4AL8L 5GZOD 5CZKA 4HC1H 1PG7X 5JDSB 3U0PB 3LQAC 1KJVA 1F97A 4OZ4A 4WO4A 3SPVB 4IBLT 3TO2A 3K8MA 4KRNA 3G5VB 2IPKB 1BMGA 3O41A 4LPUA 4WI9A 5INDB 4U1IB 2AJVH 1ZS8A 1QQDA 2FO1A 5IMKA 4KK6C 4G6JH 1U93B 2UZYB 4YDVB 1KLUA 1N8ZB 3JWNC 1EX0A 1MCPL 3RJDA 4I8DA 3UTQB 3BKJH 1QD0A 1FLRL 3LPGA 2XPGB 3GMMA 2PF6A 4HKXA 5J06A 5JIHA 1JPTL 2EZ0D 4R96B 4KJWC 4WEBH 4JY4A 1P4BL 4MXWH 4ZFGH 1J12A 3GKZA 4ZSOA 3GRWH 5JA8B 1W72B 1A6AA 1ZGLM 3VRIA 1MCPH 3HRPA 5GS1C 5B21A 3T0EA 4P5KB 5GS1B 2P47B 1DN0A 3FOMB 4L8SB 1XH3A 3S8WA 2H45A 4QXTB 1DBJL 1VADA 5HHVL 1JPTH 1YY8B 5HI4C 5IQ7L 5FUZH 4ZFOB 5DMGD 1LDPH 3N1FC 3L1OL 2ARJA 3LCYA 2P5WD 1NC2D 5IWLC 1KJMA 3QEQE 5E1AA 3KYAA 1Q8MA 5C0IB 3HMXL 3ARDA 4N8VG 2E9IA 3MREA 4HBQA 1DBJH 5HI3C 3HG1B 2BNRD 5IQ7H 1L9NA 4YE4H 3UTOA 4AH2A 2ZSVB 4GUPB 5DZLA 4WIQA 3L1OH 5GSRA 4AM0A 3LZFL 1JI1A 4FTVD 2R9HC 3N0PB 5F6HI 1G7PB 2XZQL 3LRSA 4PJAB 1J8HD 1HSBA 2EYTA 3REVB 3SGDH 3VGAC 2ESVD 4UBDD 1MSPA 2GT9A 3MBXH 4HUKB 4R6UA 3VMOA 4X8JA 1QR1B 5CINH 4LPVA 1C08A 1DQDL 5IEKA 4OD2A 1TETL 4FRWA 3OJDA 2B39A 3HAEB 2F53E 3Q5OA 5JUEH 1EBAA 3IFOA 4DAGL 5A2IH 3LB6D 4HUMB 1EAJA 2FJHB 3MUZ1 3OKDB 2ICEB 4PJ5B 1YECL 2VLKB 4ZUWB 4GKNB 3JWDL 4YXLH 3IDGB 1LO2L 4GFTB 2VAAB 4ODBD 3QIBA 4M1GH 1DQDH 4NQCB 1FJ1A 3CIQA 4PV9A 1TETH 4YHKL 2VISB 4I18C 2RB8A 3D18A 3IXAA 4WU7B 4I18B 3M17A 3ZO0A 4H25A 4DUXA 4OAWB 5HHPB 1YECH 4HAFA 3VXNB 2VLRE 3S96B 3TYGH 2FGWH 3SCMA 3T0WA 32C2A 4P46D 1CFSA 3KPQB 4MNGA 1CWVA 2D7NA 5KS9F 4OCXH 4OZIF 4HF5H 1CF8H 1VFBA 4MYWB 2H2PC 4QWWD 3MRBA 1IM9D 4X6CE 5EZIH 1OAUL 3BI9X 4HAGA 4ZUUA 3D39E 5J9PB 3OMZA 5GS0H 2RFXA 4GOSA 4GSDL 3D2UB 4OCNC 3P4OB 3RDTA 5CEZD 4M6MH 4PJGA 3QI9D 5F3BA 4W6WB 1ZGLP 5E6YA 4YDJB 2Y72A 3ZSSA 5CSZB 1U8HB 1QSFD 2EIDA 2XXMB 5ETUB 3KYNB 3STZB 1C8PA 3MA9L 2H26A 3U4EB 1U0QA 2V2TA 4GSDH 3MCG1 3M8OL 2R0WL 4NQXA 5JORB 5JLZA 3FT2A 3OJVC 3ARYA 4G6AC 4MXQD 1AGEA 4ZYKA 4RAVA 1BVKA 3D85B 3KPOB 4FMKA 4MNQD 3MA9H 4ZTPL 2YPKA 2I60L 1YPZF 3MLPA 2X10A 5ANMB 4KZEH 3M8OH 2R0WH 4WHYH 5SX5K 2J88H 4G6FB 1Z5LA 4LLWA 2E7BA 1Q9LA 1NL0H 4OKDA 5IMMA 2X70B 5IR1A 2CMRH 2C4FT 2GSIA 1BM3L 4OBSA 1IVLA 3PP4H 1R3IL 3EHBC 3R0MA 3NCFB 1FV1B 5CUSH 5IHUH 5EO0A 1R3JB 5HHOB 3IDIB 3T4YB 3GIZH 5L2KB 1WBYB 3OF6D 3DVFA 5DJ0B 3F7VB 1ZEAH 3FRUA 1MCWM 1XFPA 4PGBA 3GZKA 3JV5A 5T1KB 3O2DL 1E6OH 1JGUL 1OTSC 4R8WL 1JZ4A 2FECL 1R3IH 5CJXA 4UV4L 4M6OL 1S9VB 3IAGC 5E2VL 3ARVA 3VXMD 5M94B 1ZGLA 3KGRA 5FB8A 4OLVH 4OQTA 3VFPA 5IJKC 5FYJH 1TPXB 4WW1B 4WCYL 3CZJA 2M2DA 3PJSB 5J1SC 2LU4A 1U58B 3IYLW 3HI6L 5C07E 3TT3L 2CKBB 4BM7A 3TEUA 2R1YA 4P2RE 1LHZA 3DX7B 2OL3L 3O2DH 1JGUH 1A1NA 2PO6A 7FABH 4UV4H 4M6OH 1OGAD 5DA0B 4P9HL 1YY9C 2X5PA 4FG6D 2XQYK 4NRXB 1G6RH 3S37X 2VWEC 2GSGB 1YQVL 3SDXF 5AYUH 2WM0A 3HI6H 3RIFK 3NCYP 4X7TB 3JWOL 1HKLH 2WBJC 2FJFA 4PGZA 5IW6A 2WBJB 1M71B 5HI5D 3RY4A 2Y6SC 5EFIA 4P9HH 1MJ8L 2BVUA 5JW5A 2J12B 4FZEH 4MD5A 3CJJA 2WWKO 4NFCA 2V5MA 4XGZB 4NO3A 4POZD 3EYUL 3QNZA 3RGVC 3GSVA 3JWOH 3UZVB 5D1ZD 3SDDC 4LVNC 1QRNE 3DV6B 4TYUA 3SDDB 1VEMA 4GAJL 5GJSL 1RIUH 2NTFB 3MOBL 4LLYA 5HGGS 1KPRB 2R4RH 5J13C 3HLAB 4N0FB 5EZJA 4JZNA 1FVEB 1KV3A 1QEWB 4JDTL 2CO6B 2GAZA 3QH3B 2E8YA 5DI8B 5E9DD 5DTFA 4PGEB 3O3AB 4FNLH 4JCLA 2P5WB 1Y0LA 1DVFC 5I9QC 1DVFB 3KDMB 4JFEE 5GJSH 1WBXB 3IS0X 1C12B 3FQUB 3V5KB 1EAPA 1UQSB 3BKCL 5FDWA 1IC5L 2IQAB 3B4NA 1TXKA 1D5XA 5ID0A 4HIEB 4JDTH 2WIMA 5IF0B 4C4KT 4M3JA 1DL7L 5F9JB 1OGTB 1A7RH 1OP3H 3VH8G 2ESVB 1AD9B 1EEZA 2QBWA 3TP4A 1U8QB 4O2EA 3SEPA 5SWSD 5H35A 1UACH 3SGKA 4RFEA 4JFFE 3V6OA 2EYRB 4TN9A 3DI2B 1DL7H 3AS2A 3TYFB 5I16B 3BP4B 2DM7A 3AXLB 3ZYZA 1G9NC 1NFDA 3NFSL 1OAKH 4M4RA 1MWAA 4XC3L 4C54A 4TTDD 5B4MD 2IAMD 5CGMA 3E3QE 1D5MB 2NYYD 1NANH 3NVQA 5IK3B 4PRDA 2J2ZA 4LNRB 2DQJH 3SKMA 3U6RB 1U91A 4FFVD 4NO5A 5DHXB 1YEEH 4QHMB 2YK1L 4Q58C 5B38G 3NFSH 3IJSB 1DLHA 1WIPA 2HAZA 4XC3H 3AC0A 4QHUB 5D1QC 1CFBA 4P46B 5D1QB 2AQ2A 4AQ1B 3I6KB 4MX7B 2MCPL 4JFDE 5DGRA 3KYKH 5J0BA 2XACC 5MP6H 1Q38A 5KS9E 2XQBL 4OZIE 1U8JA 2F74B 4GS7C 4U6HB 2YK1H 4LSUH 5I1AB 4RAUB 1N2RB 5ENWB 3CX5K 4U1LA 1KIPA 2EE6A 1I8MA 3QWRD 3LS4H 5LWYH 5IOPB 2X09A 3UTSE 3QNYA 5C6PB 4PR5A 2MCPH 5SWZB 1QSFB 43CAB 2BCKB 2HJKB 1GIGH 3U4AA 3W0WB 2A77H 4LSSL 3QIUD 2APXA 5BZDB 4K94C 4MS8D 3FTGA 2YA0A 4F2MB 3Q3GA 4BA8A 3IETB 3K0WA 4FQLH 4JKLA 3QB7C 2OR9H 1ZVSA 4WWKC 2EIBA 5D72L 4NJ9L 5IV2B 1YN6B 5L0QB 5DHVA 2R1WA 4GRLC 2B2XL 4LSSH 2G5RA 2Z31D 4JFPA 5DJ2B 5FF6B 1HK6A 5GGQL 1E28A 1N59B 2DQCL 3S97C 1F8TL 3MR9B 3I85A 1NMBL 1YPZE 3G9VA 2DMCA 1I1FA 4XNMB 5MENA 4NJ9H 2I07A 2W0FB 4OF0A 3QIWC 3QUML 3QIWB 1T7XA 4P3CH 4Z7VB 3PGFL 3CFBB 3EFFB 4YIQA 1AP2B 3LN4A 3WN5C 3MV9D 1ROWA 2ILLA 4P23A 3IDNB 1X6NA 4TTGA 2C1PA 4DKDC 1KEGL 2NMSA 5T1LA 3RWIB 2DQCH 4KVNL 1F8TH 4Z95L 1PX4A 2R2CA 4Z78A 1Z2KA 1NMBH 2BXZA 2NY2D 2B4CL 3MXWH 3O6KL 1DQQB 1FL5A 2CDFB 3QUMH 4RGMB 3B3IA 2LQRA 2QQKL 4AT6B 2YOCA 1GPOL 5GRJL 3VXMB 1ETZB 4MQ7B 1JTOA 5DD3H 1RSFA 4Z8FH 3I02A 5BVPH 1KNOB 3QWQB 4L9DA 3QYCA 3NPSB 5HJ3B 1NAML 3QXDA 2VXVL 5CP3A 3CSPA 2V6HA 1A3LL 2NY5C 2MPAL 2DQUH 4HS8L 2VDLH 2D2OA 4HWEH 1UVQA 3TBWB 3K81A 5C1MB 3HZYA 4U1KA 4NQUA 4CGTA 3X11B 5FYKL 1GVIA 1ES0B 1AD0B 5DD0L 3SDXE 2LE9A 1NAMH 2VYRE 2W91A 3CU7A 3OB8A 2W0PA 4EDWL 1JWMA 4L4VE 3F6IA 1WTGT 4Z5RB 3B2VL 3E2HB 5T3XL 1MCCA 2VAJA 5I8CA 2CK2A 5JMOC 3HMWL 1XIWC 2ZUWA 3ARTA 1XIWB 4XVJL 1L6XA 3UYRL 1J0IA 1S5IL 5C7XH 5D1ZB 4OCSH 3IDMA 1TVBB 3PV6B 4ZTOL 3QFDA 3RX7A 4OCYH 1FL3B 1U9KA 4OFIA 1H9VA 1T4KA 2GJZB 1EHLL 3VI3F 2RGSA 1I8IA 4RMRA 2P42B 5DDHB 5C07D 5T3XH 5E8DL 5L6YL 3T0AA 5HPOA 1CBVH 3MNVA 2BVPB 4OZFG 5E9DB 2DTML 1EZVY 2YD3A 1P84K 3UYRH 1Z6JT 2JIXA 5B39G 3ZKND 3DETD 5HPMB 4H1LG 5EBMB 3U46A 4N0CC 2X1OA 4L9LA 3ARPA 4NZUL 2EDFA 2PTUA 3I84A 2A1WL 1FH5L 2VH5L 1CG9A 4LDOB 1WT5C 3OKLB 2ZCHL 3EUUA 4N9OB 2DQDH 1RK1B 5F71A 1N5YL 4XP5L 3EW3B 2PYEE 3GJFH 2X4QA 3JV4B 5J12C 4QYOA 1A0QL 4F7TA 5J12B 4NZUH 4ZUTA 3MO1B 1KLFA 3W9EB 1AC6A 5DUPH 3ULVD 4UINH 4ELMA 5SWSB 4L4TE 4LPXA 2IH3B 3HZMB 1JYXA 3U30C 5T3ZL 3MRLB 4NN7C 5I8KH 3U30B 4P2QA 1TZGL 4NN7B 3UPRB 1I3VA 2ZCHH 2FYYA 4LDLB 1WAAE 1QRND 1BVLB 5E2UL 5ICYA 4R7NA 2Q6WA 1QFWM 1OT2A 1AKJB 5TPWL 2EYSA 3PHSA 3BOVA 2A74A 4LIQE 1NGYA 2ARJQ 4HFUL 3OGOE 1P4IH 1YUHB 1UM5L 2IBBA 1IILE 4PREB 1CR9L 2YD8A 5E2UH 4LPTA 4LCWA 5I74B 2I9LA 1F13A 3WUZA 2HMIC 4U1MB 1CU4L 2FATL 3FAWA 3PNWB 4HX1B 2DOCA 2JJWA 5ADPL 1MQKL 3ROOB 4HFUH 2VABA 5FO9A 4OCLC 5D5MF 2LAGB 3B5HA 4DFHA 3A6BH 3OB0K 1LK2A 3T2NH 4I9WD 3ROLA 4G7YL 3A6CL 4LLUB 1FFNA 1QO3A 2VDML 1G6VK 2APFA 3HKFA 3BE1H 5BJTA 2VWEE 2V9TA 3H7BA 2Z4QA 4PYGA 2R56H 2FATH 3BYTA 1P4LB 1CL7I 1UJ3C 4QHNB 3I9GH 1UJ3B 4TSBL 5GS0C 5DT1L 4KU1A 5KSAC 3BRDA 3LKRB 4NZTH 5KSAB 2GJ6A 3QIUC 3MYJA 1G7IA 3QIUB 1ZKAA 3RA7L 3QCUH 4PJ7A 2WW8A 2WINA 2R2HB 2YXFA 4ZOEA 35C8H 3C5JA 3ETBF 2R0LL 4XZUB 4MQXD 1UKTA 4UTBL 1MHPL 4GMSH 4AIXA 1XGQB 3AY4A 3MGTA 5DT1H 3MRNA 2AJ3A 4ZUVA 2HFGL 3GSUA 2FWOA 3O11B 3QHTC 2H8PA 3L95A 2BFVL 4PJEB 4Y5YA 4ZXBC 1K8DB 4XB8A 4ZXBB 3QNXB 3RA7H 1A7BA 3MRHB 3BUTA 2D7PA 4HH8A 5EDXA 1K4DB 3TIDB 5DQJB 5TGBB 1B0RB 1MCIA 4UTBH 1MHPH 4K23L 1K4CA 5F88A 3ZE1F 1RUAH 2UVFA 5T33L 5I1LA 1RIHL 3Q5YA 3MV9B 5DFWH 5IT2H 4KFZC 5K9OB 1I7ZA 4KGLA 4LCUA 5DZOA 5C9JB 5KG9A 1UH3A 1PG7L 3GFUA 3P4NB 1QSEA 1E4JA 1OSZB 2OR8A 1NEZA 2XZCH 5JA9A 1HH6B 5IB2A 5JW4R 1FNLA 4KKAD 1CGUA 4W6XB 4K23H 1CDYA 5F6IC 3SQOH 1L7TL 4I1NB 5F6IB 1X5YA 1R24A 2DM3A 4S1RH 1MFCL 2ATPB 4Y19E 1PKOA 4PP1C 1NMCC 5T33H 2ID5A 3ZZ1A 3AS1A 2Y7QB 1NMCB 2VDKH 1PLGH 3QSKB 3JUYA 2Q3ZA 5CJOL 2CSPA 4HGWA 5TDPA 1UXWB 1WWBX 3HNSL 5LXGH 2VXSL 2NY6C 5T1MA 3L3HA 2VZTA 5TE7H 4UU9A 5FK9A 1K3ZA 3C09B 4UIMB 8FABB 1QTYT 2AXGB 5FA3B 5KVFH 4MQTB 4HWBA 1XGRB 1F4HA 1A6TA 3IJYB 3TA3A 4CU7A 4YHLH 1UG9A 2KDGA 5DRNB 2YS4A 3DUHA 5B8CC 4MAYC 2NNAB 3CPLB 1X6LA 4MAYB 5FCUH 4XCCH 2VXSH 3IVKA 5C8JB 4MA1C 3TBVA 5BV7L 1UWEH 3Q6FB 1I3UA 3J7HA 2AEPL 4HPOH 4KRPD 3QDHA 1G6RB 1DLFL 4HUUB 2FZ3B 3X3FH 4LHJB 4ETQA 2AEQL 4LAQL 4YGVB 3UTTE 1JGLL 5AD0A 4JPIB 5C0JB 5HYFA 3O3DB 3WHXA 3TCXA 5JXAH 3CFCL 2YN3A 5DLMH 5E2JA 4YO0A 2P24B 3NGBB 1S7XA 1T21B 1JPFA 5BV7H 5HDQL 3DVIA 4JZJA 4LAJH 1Y6NR 1DLFH 2HRPL 4GW1A 1ZVHA 1BIHA 1JPSL 5E00B 4BQCA 5L8LB 3ARRA 3NCYS 5K59F 3MV8E 1JYVA 4LAQH 1FPTH 4CW1B 1A6UH 5JO5A 1JGLH 5DR5L 2BY0A 1HH9B 2R1XB 1V05A 3LD8C 4XMKH 4RAHA 5TF1L 1IEAA 3LD8B 1MH5A 3VI3E 4UT9H 3HS0B 3ILQD 4PFEA 2OZ4H 4H26A 3KLHD 4I5BB 5DMKA 3WFHA 3X17A 1FYTA 4K7PH 1ZA6A 1T1WB 1IGMH 4XH2B 1F11B 5MEQB 1IGJB 1BF8A 4JAMB 1MELA 3BQUA 5HVGB 5FGRA 4RDQF 3QG7H 5MERA 1VFAA 1EO5A 1H15B 4HIIB 3TJHD 3C6LC 2Q8BH 3ES6A 4EN3C 5IMOA 3GSQA 1KJ2H 1AO7B 2R69L 3G04A 1ZLVK 1IAKA 1KB5L 1HXMB 2X4OB 1IAIM 5KSVA 1EGJL 2VLJB 4TUJB 1XCTB 2H9GA 3ZKMD 4IOIB 1F6AB 1R5VA 3MUY1 4HIHA 3H42H 1Z9OA 4YNYA 1G7MA 5BOPA 1ULVA 2J6EL 3LH2L 4WI4A 1T89C 4RQQB 1JYNA 3WNKA 2AK4A 4NNXA 3WFBL 1ORSB 1CE6B 4K9EL 2R69H 5I76A 2DQIL 2XRAH 1IZKA 1KCKA 3VD4A 1IM3A 5EZLA 4PUBL 2FX9L 3OXSA 4P5TA 2WWMC 4RMSA 2P7TA 2D0GA 4OI9A 1VGKB 1L0YA 3V6ZA 1C16A 1T22A 3DRQA 1T83C 4LPWA 2X1XR 2J6EH 4MQSB 2XA8H 3DGGA 4K3EH 2WWKT 2FEDD 4X9BA 3VWJC 3DUUA 3GM8A 4EVNB 4HZLA 3VWJB 1P1ZA 5DVLA 3ZE0F 1J88A 2VL5B 1PKQE 2X42A 1W0WA 2FX9H 3F65A 4PUBH 5F7LB 1QZ1A 4WFGE 3C5ZA 4HKZA 3PDGA 1M6OB 4P3WA 1DTUA 2VN7A 5HGAB 4EI6B 5C0RL 3M07A 1OF2A 3O81A 1I1YA 4H1LH 3PGCA 5D5ME 1RIVL 5GRXG 4KUZH 2W65B 3DJ9A 4APQC 4ZPTB 4APQB 5JDSA 3V4VH 3U0PA 1OLZA 4CBPA 3RUGF 5KN5B 4R26H 3CVHL 3DI3B 4I3GA 4Z6AT 2DI9A 3G5VA 2WAHA 3QJHA 4LQFL 5HYIA 5TDOA 3BIKB 1YNLH 2IPKA 2XY1A 2E8ZA 5INDA 1CIUA 4POYA 2W9EL 3EYFB 4U1IA 4W70A 4PRHD 1JZ2A 3R4DA 1CDIA 1ONQB 1MCQA 1MJJB 5HHQB 3CH1A 3CFJB 3DIFB 3H9SE 1U93A 3IKKA 4PRID 3WFDL 5MHSE 1WZMA 2BNQE 1NLBL 2P8PB 4XPBH 4ZOBA 4GBXD 4R3SB 2AV1B 3CVHH 5CWSB 3UTQA 2E6QA 1HHHB 2HJFB 3R8BB 5DJZB 5C0NC 2XPGA 3PP3K 3QDGD 1J1OH 2GEEA 3S34H 1SJHB 4R96A 1CXFA 2C5DC 2BSTB 3NCMA 5JIPA 1WICA 4NRYB 3WL9B 1GZQA 1RMFL 3I2CL 4IM8A 3WFDH 5C0BE 1RVFL 1CFVL 4PJ8D 2LU7A 1RK0A 3D3VE 2C7UB 2XWTA 3FOMA 3L7EB 1JUFB 5D7IF 5F3HB 1CFTA 4L8SA 4JEGB 4GG6A 3P11L 5D7LE 4QXTA 2DMBA 3QDJD 1YY8A 4W68A 3ZE1E 5IFJB 4O51A 3WIFB 4F37F 4ZFOA 1RUQH 3BRGC 1R3KA 3OG4B 1FSKC 5ILTL 1KEML 5F9WB 1DFBL 3I2CH 1FSKB 1J5OL 3ILPB 4ZS6D 3C9NB 1D9KC 4GKSA 4CDHA 5C0EB 1D9KB 5GGVH 4LEOB 5CCKH 4LU5H 3HG1A 3L3IA 4PJFB 5EO1B 3MUGB 4EIGB 3BIBX 4MJ5B 4UDUB 3L3DB 2ZSVA 3K1KC 3T0DA 5F1IB 5C3LD 4XBEH 4AEEA 3E6FB 1J5OH 3ZTNL 1G7PA 2Z92A 4PJAA 3REVA 4JO2H 4MAUH 1AH1A 3WKMH 4FMFA 5LBSH 4U6VH 1QR1A 1N4XL 2Y07H 4JANA 5TF0A 1OD7A 3MJ6A 4V2BA 3S37H 1UT9A 4NWTH 3ZDZF 5CKAA 1MCJA 1T0NA 2EXYD 1AQKL 2WV3A 3WSQL 2Z8SA 4X5XB 3S6CA 4GAYA 3OKDA 2ICEA 3MNWB 4PJ5A 1DE4A 5D4QA 3GO1L 4KK9C 2OLDA 4ZUWA 4GKNA 4IJ3C 3PDOA 3ARZA 3P9LB 1RHHA 4KRPB 3IDGA 2VAAA 1N4XH 3FMGL 4PJBF 4XI5C 3ET9F 4NQCA 4D9LH 2VISA 2BVTA 4Q6IC 4K7FB 1ACYH 4NQVA 4Q6IB 4I18A 4WU7A 3TO4C 1DQMH 3F8UB 5CZVH 3S36X 3PHOB 4OAWA 2NCMA 4U49A 4H5SA 5CZXD 3ZMRA 3VXNA 2AEIT 3GO1H 3S96A 4PB9H 3EOYG 4DKEL 5KVDH 3CNKA 1GGIL 3B2UD 3KPQA 3O6ML 4OLYL 5A2KH 2GCYB 4ZNEA 1BHGA 4FZ8L 2Y25A 5IBUG 4LKCB 2IGFL 4QY8B 4DCQA 5IEHA 1S7TB 5FYJU 1BFTA 4HK0B 3V2AR 2P8LB 1PQZA 5K59E 3MJ7B 4NQEE 4KQ4L 3EOBA 2X4UB 2R4SL 3P4OA 4F9PA 5E7BA 3UYOD 3OR6B 4YDJA 5DFTA 1JK8B 5C2BL 3MRRB 4X4ME 3KYNA 5SV3A 4KQ3L 2BSSB 2XN9D 3U4EA 4FXKB 4KRMB 3IF1B 4JG1L 5KZCD 1EERB 3FB8A 4KC3B 1WVZA 3VXUE 1FG2B 4B41A 4HK3J 1A6VL 3VWKD 3UTTD 2AVGA 3LPFA 1V7MH 3D85A 3KPOA 4J3UA 4Z0BL 4C56A 2ADFL 3BDYL 2VDNL 4WFFE 3FZUC 5ANMA 1EV2E 2BJML 4S1DC 4U05A 4S10A 4LGSB 3V0AC 2YUZA 1JWUB 4MXVF 1A6VH 3IFPB 1QNZH 3MV8D 1V3KA 4YHNB 5CBEB 4ODWA 4YBHA 1DQLL 1FNSH 2ZJSH 2A38A 5J7CC 2ADFH 3TZVA 5HHME 5HHOA 1KTLB 5FA4B 3T4YA 3VD5A 1WBYA 2DI7A 1A3QA 5DJ0A 2JCCA 4M1CD 4ZAKA 5JZ7D 3CMOH 4JB9L 3QRFM 2FX7L 4ELKB 3QFJB 2NXZD 1R0AL 4MDIA 1G0XA 3UJJH 3MRGA 4KJQD 4PY7B 2FRGP 1OTTD 1J0KA 4OF7A 4Y1AD 1KELL 3B43A 3ZE0E 3ARQA 5E0QA 2Y9RT 5EO9B 2XXCB 1YEFL 2QQNH 3BD4A 1U58A 3G5XB 3FONB 2CKBA 2XZZA 4JB9H 5DK2A 5I1CL 1U8KB 2WIIA 3RX5A 3WIHL 1HHKB 1W8NA 1T1XB 3P4MB 3QUXC 4XTRC 4YX2L 1T1ZA 2DQTL 3OL2A 3PQYE 4WFED 3I3BA 3RUGE 1ZVYA 1UYWL 2NY3D 3W2DH 2GSGA 2VDOH 3FO1B 1BGXL 4KAQH 4PRHB 4AMKL 3O6FD 1DBBL 5CJQL 4PRIB 4X7TA 1JWSB 2OMNA 1OWWA 2WBJA 3CUPB 4GBXB 2YA1A 2PYFB 2VQUA 5EORL 1C7SA 4L3AA 3RWHB 2B0SL 4GKOA 5FHAL 2IFFH 1KJ3L 3QDGB 4R4FH 1P6AB 5EC2B 5FECA 4XCEA 3RAJL 5F7YC 3S88H 4AEIL 4HUWB 2XTJC 4YBQC 4Y7MA 1YDPA 2XTJB 3RHWF 4HW6A 3RWCB 2DAVA 3DV6A 1ZLUH 1ZLSH 4PJ8B 4BSWB 4L3CB 5EORH 1WC7B 4X4YB 4DZBB 5C0GB 5FHAH 1KPRA 5E4EB 3TM6A 2I24N 1KJ3H 5BMFL 1MCHA 3HLAA 5J3HD 4N0FA 5IW1B 3QDMD 3QDJB 3V7MA 1FVEA 1QEWA 4D94A 5D7IE 3QH3A 3WS6C 1KCVL 4M1DL 2X4TB 2X7LB 4PGEA 1TLKA 3O3AA 4EBQH 4XHJC 2P5WA 5IKCB 3L5WB 1UWGL 1NC2A 1IGFH 5I18L 4N90D 1E4WL 5F89B 2R2EA 3KPPB 1WBXA 1C12A 3A67H 4YPJA 4JRYE 4QRSB 4EQ3A 3FQUA 5EN2A 1UQSA 1U8IB 5IQ9B 3NIGF 4U6XB 5DMIH 3H9SD 4KKCC 4OQTH 2ZUSA 3QCVL 5ISZE 1H5BC 5F9JA 3UTZB 5GRWA 5DFVC 3PXJA 2C1OA 3DSFL 4OFDA 5L2JB 4FTVA 1KG0B 5IFHL 2F58H 4F3FB 1J8HA 5I18H 3QAZC 2ESVA 1AD9A 3GSNL 3KWWB 1U8QA 1BJMA 3LEXB 2AXHA 4I3RL 4WV1C 2F5AH 4ODHL 4PJCF 3RTQD 3PE9A 3TBTA 2NY0C 5KJRL 3S4SG 4P2OC 1YNTB 4PG2C 4KDTA 2AJYH 5I16A 4V1DE 1LO0H 2K9UA 2YD2A 1KTRL 3BP4A 1ZTXL 2CRIA 4ODXB 1HSAB 3ZDZE 5IFHH 5H2BA 3UC0H 1W0YT 2AJUL 1A4KB 4PD4K 4OV5B 2V9QA 3T2OA 2V9RA 3MJ8A 2HLAB 5D7LD 5F7NC 1F6LL 1D5MA 1TJGL 1U42A 2X4NB 4I3RH 4ODHH 3P4LA 1EUUA 1P7QD 4XCNB 5IK3A 1XAUA 4LNRA 5KJRH 2Q3AA 1INDL 4PJBE 4RBPK 1OHQA 1EIBA 5JR1H 4M03A 3QP3A 1P7HL 4XXDB 3IJSA 1SM3L 4JVUA 1IGTB 4HJGA 3WNNA 2P45B 2AJUH 3MX0A 4QHUA 4XAKE 4P46A 4HMEA 1BBJB 1S3KL 2OR7A 5HYJE 3LQMA 5IHBA 5BV7C 1CGXA 2XWBB 1INDH 2NLJB 1IM9A 4JFXB 4CNIB 1T03L 2FNBA 4L8BB 3GI9H 1ZT4B 4U6HA 3SDYH 4MA7L 4GLRH 5I1AA 4RAUA 1INQB 1N2RA 4ZO8A 5ENWA 1SM3H 3BWAB 5A16B 4LOUC 2NZ9D 3WLBB 3AREC 2DQHL 5IOPA 4OGXH 3VFVA 2CKNA 1G7LA 1QYGH 1QSFA 4LLQA 43CAA 2BCKA 2EDTA 2HJKA 3Q5TA 4UOW1 1T03H 3SJVB 1JJUA 2OJZL 4K8RH 3VD9A 4Y4FC 2XN9B 1W2KT 5E2WL 5A1AA 5BZDA 2PCPB 1U8LA 2YR3A 4F2MA 1AGCB 5D1XD 5KZCB 2DWDB 2ERJC 4DN4L 5C0AE 5KSBB 4ZG1A 2ERJB 5EUOF 1A14H 2RBLA 1GGUA 5JHDD 2B1AH 1NCNA 1SMOA 3KPLB 2E9JA 2NW3B 4QT5B 4OSUH 3UAJC 4P4KC 4LFHD 1XR8B 4MNQA 3CVIH 1FP5A 5FV2A 5E2WH 5FF6A 2UUDK 4LSQH 1AC0A 3WO4C 2QJDA 1N59A 1B4JH 2FL5B 1LE9A 1RURH 3LEYL 3MR9A 3EAKA 3RU8L 3MNZA 5HGBB 1QFUL 5EWIH 3K46A 5E8PB 3OHXB 1KB9J 1LQSR 5D6CB 1J7VR 3QWOB 4MXVE 1RZ7H 1H0DB 4OZGA 5E6IC 4Z7VA 4HQQL 3CFBA 3EFFA 3VXOB 1AP2A 5E6IB 1BBDH 1A9EA 2E9BA 3IDNA 3LOWA 4M48L 3MRDB 1MIMH 1GRWA 3OF6A 3U7WH 4JO1L 3RU8H 2ADIB 3FO2A 2HKHL 4N0UB 2NXZB 2FBOJ 1NEZG 4MSWB 4UT6L 5IM7A 2XWJB 3W9DB 3TFKD 3VW3L 4LARL 4Y1AB 3VXMA 1I1CA 1Q1JL 4OZHE 3KPSE 4ZQKA 3EDKA 1KNOA 4RIRB 4CU8A 5CEXB 4JO1H 5TE4L 2HKHH 1DBKL 4IDJL 1O5DT 3UMTA 4QRRB 3TLRA 4KMTL 5HJ3A 3EZJB 1F90L 1AXSB 4PJ9C 1JMZA 4NJAL 5IVXB 1AFVH 1OGAA 4YHPB 4WFFD 3RZCC 2NY3B 1ITBB 2EDKA 3HI5H 1Q1JH 3H8NA 3V52H 1IGIL 3TBWA 1DBMH 4DKAA 4QRQA 5BS0E 4JVPA 4NPYB 1ES0A 3UPCA 1N6UA 2P8MA 2QR0B 1X5IA 1F90H 3F12B 1E4XH 2HG5B 5DO2C 4K55A 1U2HA 4M62L 4WUKH 2FJGB 4Z5RA 3LQZA 2HJLA 1QKZH 3FCTB 4KK8C 5DHVH 5HHNB 3NACH 2HH0L 2IADB 5CP7A 2XTLA 4PJXF 5J57B 1B2WL 4IRSD 5KSUB 4NQSB 1E4KC 2Y36L 1N7ML 4F7PB 2PXYC 5D1ZA 1G0YR 4DKFH 2APBA 5DVKA 1BJ1H 1TVBA 1X5ZA 4Y16D 3H0TA 2JK5B 4M62H 4G8GE 4M4PA 5T3XE 4JRXD 2GJZA 3SHSA 3QDMB 2EXWD 1QFWI 3H3PH 5DDHA 4Q9CA 5K9QI 2BVOA 1B2WH 5K9QG 5E9DA 2BVPA 4PGCA 3BT2L 2H3NA 5A2FA 1F3JA 4NHUB 4OT1H 2ICES 2UYLB 4RWYL 1BD2E 5HPMA 3O4LE 1MCEA 5A43C 5EBMA 2MCG1 4EUPG 3RVVD 1JHKH 1BFOB 2Z91A 4FQQB 2DB8A 4OI8A 4K07A 1KCSL 3SDCC 3OAZH 1OD9A 4J4PD 3BPOB 4O2FB 1CTOA 1MI5E 4YHYC 1CXLA 3OKLA 3BT2H 5F44A 1CIDA 3NIGE 2X4RB 4RWYH 4BUHA 3PWUB 3MBEC 1IEBB 1G84A 3BO8A 1B3JA 4L3ED 3MO1A 1HKFA 4KRLB 3W9EA 4Z7UB 5CP3H 2IG2L 1SYVA 1FO0B 5SWSA 1DUZB 2IH3A 3RTQB 1HHGB 1XGYL 4UT7H 4GKZA 2NX5E 3UPRA 1DDHA 1HNFA 4PJCE 1OSPL 1XF2B 4WO4C 1KJVB 5I8OL 4WO4B 1KTKE 3G5YB 3CAFA 3WNMA 2AI0L 3TO2B 1G1YA 4OCRL 3OBAA 2IAMA 4DUVA 3O41B 3VD7A 4Y5VA 3QFJE 2Y5TA 2CJUL 3B5GA 3VG0H 1BQHG 3ESVF 1YUHA 1XGYH 1G7JB 2APTA 1RFDL 4LL9A 2K1MA 5I8OH 2B20A 3FT3B 4H8WL 1QBLH 2AI0H 4OLXL 4JRYD 4HKXB 4U1MA 2W9DH 1PZUB 1LGVA 3PNWA 4HX1A 1NC4D 3KJ6L 2NZIA 4JY4B 4JPKH 5ISZD 4ZSOB 3MJ9L 1XF1A 4PJIB 3L5XH 1L9MA 1A6AB 2YPLE 3VRIB 2ED8A 5EZOL 1DN0B 3T4AB 2DLHA 1J0JA 2L0DA 4S1SL 4FQJL 1VADB 2BOCA 3QWRA 4KZDH 5ABDE 3KJ6H 4NCC2 4IRJD 1N5AB 5I17B 1KCUH 2BNUB 3K2UL 4OUUA 5LVEA 2Q20A 1CGVA 1KJMB 1N0LA 3QIUA 4LSTL 3ARDC 4NC1C 2R2HA 4X6DB 1IFHL 4NP4L 4FQJH 2ICWA 4OF3A 1CK0H 1JF6A 5C6TL 3LEVH 5JHDB 1XGQA 5C0CB 3LKPB 3LY6A 5EUOE 3MRCB 4DN3H 3O11A 3N9GH 4EEEA 5I15L 4PJEA 3LRSB 3LDBC 1K8DA 2VIRB 3LDBB 4IRZH 3QNXA 2GT9B 2Z31A 4X8JB 4XAKD 1FVDA 1NGPH 4RMVA 5DS8B 1C08B 3L7FB 1WF5A 5HYJD 3OJDB 3SKJH 4XWOD 5DQJA 2C4FU 4TOYL 2GUOB 3IDXL 5JIKA 2EEDA 1OM3L 2IH1B 3MV9A 5C9KA 1CI5A 5K9OA 5C9JA 1BQLH 1J1XL 1JE6A 2DIBA 5E5MA 3NMEA 1BP3B 3P4NA 5DK0B 1HH6A 1VFOA 5FOBA 5FHBH 3UO1H 2YWZA 3IXAB 3IJHA 3M17B 3MLTB 3GMRB 1KIRB 2X89D 4H25B 4JZOA 3QUZD 2Y7QA 4LVOC 3SCMC 3ZKXB 5C0AD 32C2B 1MNUL 1CFSB 3DXAD 3QUYD 4XP4L 4U1JA 1B90A 1UXWA 5JOFB 4FQ1H 1I7TB 5CMAB 1VFBB 4R90H 1LEIA 2WK2A 1KENH 8FABA 5FA3A 3ZE2F 1M7XA 1XGRA 2FIRT 1A3RL 3IJYA 4J6RH 1JHLL 3D0LB 2B8OT 3RDTC 4WUUE 1INEL 5E56A 4G9FD 2IMMA 4JM2D 1IKNA 4M7JL 2NNAA 5IROA 4WFHE 2DKMA 3HAEG 4OFYD 3KAAA 5GS2D 3BW9B 4OJFH 2RHEA 5C8JA 3MQIA 5D2LF 2DLFL 3Q6FA 1OPGH 5MEPB 3V4PL 2KZWA 5FCSH 4PLNC 1XF4B 1VHPA 4GMTL 1LK3H 2FZ3A 3ARGD 3VXRD 1JHLH 4JDZA 4JN1L 5L88H 4YGVA 3P77A 4I2XE 4JG0H 4JPIA 4CAGA 4WW2F 3O3DA 4M7JH 3GKWH 5D93C 3G6DL 4PLJD 2W1NA 5D93B 3ZSTA 4ZYKB 5DJDB 5F7EL 1JIBA 2P24A 1BQSA 4DTGH 1BVKB 1YYML 4PJXE 1U95B 3R8QA 5CBAB 5TE6H 1YJDL 2PW1B 3MODL 5E00A 3FB5B 4JN1H 3KPSD 2BXYA 4JRXB 4NC0B 2AGJH 2W0LA 4CW1A 5F9AC 3CZFB 2ZNXA 3FT4A 4TPRL 4BZ1H 1I3RB 4X7CC 1HH9A 1Q9LB 5IMMB 1I1AD 1FLTX 3VFUB 4EKXA 3JVGA 1S9WB 2AAVA 1YYMH 3OZ9H 3HI1B 4M5YL 1A7NH 4HGMA 3W11C 1ZLVH 1YJDH 4YWGH 1OLLA 1EFQA 4H0HB 4NNPH 4FA8A 4LEXL 4XC1L 1RUMH 4XH2A 5MEQA 3SY0B 4XVTL 1IGJA 4KKLD 3E0GA 3GDBA 5EUKB 3BUYB 3MLRL 2BVQB 1H15A 1HINH 1A4JA 5CJXC 2O5XL 2DLGA 2L7JA 4PRPD 1L4IA 5FB8B 4YK4C 4AG4L 4L3EB 3GUTA 4YK4B 4O5LH 5I19L 4HWBH 1HXMA 2X4OA 1PEZA 2D4FA 2CLZB 2HTKD 4LEXH 3GHEH 5FYKD 1HEZB 4IOFC 1I9EA 2V17L 3F6LA 1QBBA 4IOIA 1F6AA 1HI6A 4HJ0C 1UGNA 2CIIB 2A9NH 3WXWH 1P7KB 2PO6C 1QRNA 3BP5B 4QHLB 3MRFA 4RQQA 3FB7B 2B1HH 2X1PA 4OUOA 4O58L 1CE6A 3K8KA 3ME0A 4XVSH 1IMHC 1DR9A 4U7MA 2V17H 4G3YH 1MCSA 3S36H 1UZ6F 3UJIL 3O0RL 1QFWL 5IW6B 3RI5F 4MCZB 3ECBB 5EFIB 5J56B 1S78C 1BEYH 1LMKA 3PDDA 3TGXA 1IC1A 5JW5B 4EVNA 4HCRL 3K4DA 5TFSL 5CJBA 2Z9TA 4TNWK 4FFYL 3VU2A 2VL5A 4NO3B 5FKAA 3S3SA 1MI5D 3BH8A 2HVKB 3B5TA 3QNZB 4H20L 3UJIH 2F15A 5DD5L 3GSVB 4PJGF 5HGAA 4EI6A 4YDIL 1VCAA 25C8H 4NDMA 3GSWB 3EZ8A 3QULB 4K3DH 4APQA 4BQ8A 4JZNB 5JPNA 1YEIL 4KVCL 1A21A 2XZAL 4IRJB 4KJPC 1F00I 3BIKA 2QQQA 4I4WB 3UCRA 1Y0LB 5KW9H 2V5YA 3EYFA 4K3HA 3TJEL 2MOVA 5JW3H 1ONQA 3DPBA 3SE8H 5TH2B 5I1EH 3CFJA 3P40A 2BC4B 1GGBL 4O02L 5T3ZD 4JY6A 1A5FH 4GG8B 2Z8WC 2P8PA 2WQRA 4XPTL 5EA0H 1MUJB 3PG2A 4R3SA 4C59B 2AV1A 4K8RC 3V8OA 1D5XB 1NCWH 5CEYA 2XZAH 5ID0B 1T66D 3GMNA 3VRLF 1HHHA 2HJFA 2ZUXA 1KN4L 1FAIH 2VLLB 4JO4L 4M8VA 1TZHB 4GRWH 3AU1B 3C87A 1AR1D 4FFWC 4MLSA 1EEZB 2BSTA 2FLRT 4NRYA 1MFEL 3WL9A 4G6MH 1XR9B 1D6VL 1FFRA 1GGBH 1QLFB 3QXAB 3SGKC 3NAAL 4QEGA 1O7SA 3V6OC 4ODUB 4HIJA 3PIQB 4JY5L 4RFEB 4Y2DD 3RWJB 3U9PL 4XMPL 4DW2H 5IB4B 1U3HD 3L7EA 1JUFA 4S1QH 5F3HA 1KN4H 3MC0A 4JO4H 4LRNL 5EU7E 4FQ2H 5F96H 5EG6C 5IFJA 1MWAB 3WIFA 4UTAL 3O8XD 1Q72L 1MFEH 3JZ7A 1D6VH 3NA9H 1IBGH 3NAAH 1WFTA 1ZHBB 2B5IB 1LILA 5DURD 2FHBA 5BRZD 1YMME 3C9NA 3QQ4A 3SKMB 4BQ6A 4L29B 4P59H 4N5EC 5C0EA 3LQAL 3O4OC 4BZ2H 4LEOA 3QUZB 2IC2A 5FUOL 5EO1A 1A47A 1JFQH 4XBGB 4PIRF 4XNXH 3G6JB 4MJ5A 2V5TA 4UDUA 3L3DA 1Q72H 3DXAB 1MFBH 3KPRD 3QUYB 2F9BT 2P48B 5ACMA 5I1DA 1TTGA 3NFPB 1VDGA 2XA3A 4N0RA 1MOEA 3GGWA 3O3UN 2GHWB 4QOKE 5HHXL 5JQ6L 1U8JB 2F5BL 3O6LH 3ZE2E 3F7QA 3EYSL 3EFDL 4G9FB 4JM2B 5I73C 4X5XA 5EULV 2AJXH 5I73B 2LABA 3MNWA 4P9ML 1YPZA 5ICZB 1A6ZB 5GRYA 4X80L 3O2VL 3BXNB 1YEHL 2UWEF 3OXRB 1IL1B 1W72L 4U0RB 1LNUB 3VXQB 4TQEH 1B6UA 3ULUH 3U0TB 5HHXH 3ARGB 3FTGB 3VXRB 3Q3GB 4K7FA 3WO3B 3EYSH 3KYMA 4CMHC 4E41E 3GMQA 3IFNL 5TDNB 5CGYC 1OW0C 1Z9MA 2XIDA 4ZFOL 5C09D 1ZAGA 1M7DB 3BSZL 3T0EE 4L1DA 1W72H 3MLZL 2ORBL 3LKSB 3X14A 5JNYB 5T5FL 1QLEH 2DQGH 3S5LA 3IFLH 1KPVB 4JFPB 4LKCA 1MCWW 3C08L 2VDQH 1E28B 3DROA 2VRAA 2NXYD 4ODTH 2QQLL 3H7LA 3WJLA 1I1AC 4Z18A 4H0IA 2H2SC 2ZUUA 4YFLI 1I1AB 1EMTL 4WTWA 2I07B 3ARFD 2X4UA 4OM1L 2ZG2A 4OIAA 3T65B 4QRPD 2ORBH 1MJ7H 4YIQB 1DZBA 3LN4B 3OR6A 5D7KD 4P23C 5T5FH 1FGNL 5CHNA 3C08H 4KHXH 3MRRA 4P57B 2C1PB 2J7LA 2E5EA 3IU4L 4CADA 2QQLH 4I0PD 5DJYA 4L5FH 5IG7B 5FYLH 4YHZL 1EMTH 4UUJA 4FXKA 3FL7A 4R2GD 3B3IB 3V0WL 4PY8J 4PRPB 1FG2A 4CUCA 4Y4KD 1FGNH 3DYPA 3UZEA 2A73A 4JHWL 3FHAA 3I02B 1C1EL 4M7LT 1QG3A 1F4WH 3QR2A 5HSFA 2E7LA 3KLAA 2ATKB 5JIIA 5DD6B 3ABZA 2GFBB 3BWUC 5DRZB 2NY7L 4XPAH 4FHBD 1IAIL 2VITB 3V0WH 3HRZA 1EJOL 2VZ1A 3ARWA 1JWUA 2BRQA 5I71B 1KTDA 5JTWA 3IFPA 1A1MA 4JHWH 4UB0L 5KBNC 5CBEA 1XMWA 4NQDD 4M02A 1C1EH 4K3JL 4TVPH 3KR3H 4KMQA 4HKJB 5ELIA 4U1KB 5GISL 2MSPA 1L0QA 1MRDH 4U3HA 4YXHL 3TVMD 3MCLL 4HWZB 1GJIA 1KTLA 4PTTB 5FA4A 2GITB 3TF7C 1UZ6E 1IAIH 1F58H 5AEAA 1KBGL 3F7PC 4WHCA 1JWMB 1CVRA 3HR5A 4RGND 4MNGE 1MFNA 4P3DA 4ELKA 4NKMB 1FC2D 1SY6L 3LRHA 4UB0H 1RV6X 2ENYA 1CICD 1XGPB 3A6OA 4JO3L 2HT4D 4K3JH 3OV6A 4OB5H 4IEFB 4G8IB 4QXUL 2F54D 5C2UB 2OTUB 1IAMA 2C9AA 3TPUB 4PRBA 5CD5C 4KI5C 1KBGH 5ESVA 4PJGE 2P5ED 2JJSA 1S9XB 4LP4A 1A9BB 1RQ5A 3WDHA 3VGDA 5FIEA 2KQMA 3MLVH 2P1YA 1U8KA 4JQXA 4CVXA 1HHKA 2UV3A 3P9WB 1T1XA 1I8IB 1FGVH 4HLZG 4JO3H 4QXUH 4NZRH 3MLXL 1H3PH 4XPGL 2JIXB 3TNMB 1MHEB 5DC4B 4GJTB 4L9LC 4JHAL 1ZE3C 5T5NG 5ACLA 3DURA 4PRHA 1PW3A 3FO0L 5TQ0L 4PRIA 3S35X 3LIZH 1JWSA 2A83B 5E6ZA 4NCC1 4L8DA 4C55A 3CUPA 4GBXA 1C5CH 2OK0H 3BKYH 5ECJE 3RJQB 3OPZL 1NCCH 4R0LB 3QDGA 4YDLC 4HG4K 3VRLE 2X4QB 2D7MA 1EK3A 5HGHA 4PJDF