4ZSOE

Crystal structure of a complex between b7-h6, a tumor cell ligand for natural cytotoxicity receptor nkp30, and an inhibitory antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
217
Chain Sequence
b'SMDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Light Chain
publication title Crystal structure of a complex between B7-H6, a tumor cell ligand for natural cytotoxicity receptor NKp30, and an inhibitory antibody
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 217
sequence length 224
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoE01
2IADB 4P2OA 4JDVA 2FHFA 2N1KA 5ACMA 4JQXC 2HT4C 3G5YB 1KJMB 2ZOLA 3CFCL 3OB8A 3S5LA 1MH5B 1X5YA 3B9VA 3VXMD 3JVGA 1A5FH 4K71C 4ZODA 1J9CT 2OJEB 4FQXA 2A6DB 2I9LB 3EJZD 4Z0XB 1KCKA 4DOHE 2BY3A 4N90D 5EC2A 5I6XB 1U3YA 4XP6L 4XWGH 1R3JA 4JY6B 5TF0A 3NH7L 3FMGL 3F7VB 2A73A 2JELL 2FSEB 4HCRA 1G7QB 1RUMH 3NTCH 3JUZA 5D8JH 4LK4A 1I7ZB 4UOJA 5C0IB 2VQ1A 1F4YH 2H26B 5GIRB 3VWJC 1YJDC 1SYVB 1G7JB 1IARB 1C12B 3V4PL 1G6VK 3FB5A 1NSNH 1RUPH 3GI9H 1G7PB 4QNPF 2QBWA 4ORGA 1IZKA 4QO1A 4I4WB 2VH5H 4QHMB 3GSWB 4GMSH 1CFQB 3GK8H 4YIQB 4JPKL 5DRZA 3MTRA 1VA9A 1K8IA 4E5XA 1F11B 4X7FC 3SKNA 5I76B 1IRAY 3MLWL 4BYHA 3MRGB 3RWCB 1SJXA 5J4MA 1H9VA 5AAWA 5D7JB 5GS0H 4MD4A 2FBJL 1NC4B 4UT9H 1CL7L 1TZGL 3VRIB 1I1FA 1IM9D 2JIXD 4WHCA 2GITB 3LKQA 2YD5A 3ARSA 3O11B 5A2LH 1NGXB 3TH2T 2G2RA 3NA9H 4HIIB 2QEJA 1A6ZB 1BZQK 3O6FD 4MDJA 5DF0A 1WCBA 3OMZA 4HJ0D 1DEEA 3NOIA 1WFNA 5KVGH 1SQ2N 4PREB 2VKWA 2R0ZH 4ONFH 2ILLA 4KUCD 1FORL 4PJXE 3ILQC 3U83A 2V2WB 1WWWX 4NQXB 1ONQA 4LLWB 1EBPA 5A2FA 3MJGX 2R0KL 4LLQA 3UJIH 3L7EB 2EC8A 3GSXA 2X4TA 4F33B 1UZ8B 3TESA 4HGMA 1HH6A 2AXJA 3GJEA 3ULVF 4H1LG 4R97C 5CJXA 5JZ7D 4PJHB 4MXQD 3DETD 5C6TH 3UYRH 1QR1A 4M3JA 4XVSL 1T20B 5JHDD 5GZNC 4NUJA 2DD8L 1UM5L 3HZKB 5DUPL 1UB6B 1QRNB 1JJUA 1U8MB 2NZ9D 3NN8A 3T0VA 3Q3GA 5ADOL 3BKCL 5KSVA 2Y06L 3QIUA 3MJ7A 4UV4L 3O4OC 1KIQA 1ZSDA 3ZYIA 3GMPB 2WM0A 3I6LD 3MV7E 4QHNA 5J1AB 3P9LA 4YHML 4M7ZC 4G6JH 1HQ4B 4Y0GA 5A2KH 2DYPB 4GW1B 5KVDH 3QUML 1MNUL 4HKXB 4PPTA 2ENYA 1FZMA 5K9KA 1S7TB 1IC5H 3B9KC 4MCZB 3SE8L 4F7TB 8FABA 4EN3D 3KPSD 2OR9H 5IEHA 5JW4M 3V6ZB 3BZFA 1NLBL 4JEGB 1QSEB 4EQ2A 5C0BE 5DD3L 1EJOH 1KXTB 1H5BC 3C5ZD 1B4JL 3E0GA 5ACZB 5JIPA 2XKUA 4L8BB 4QNPE 5JA8B 4YBLC 3O8XD 4DUVA 1XCTB 2NX5A 4X9HA 4Y4KD 5D1QA 3L3DA 2RBLA 1FG2A 1NPUA 1EEQA 3QAZB 4OJFL 1LO2H 3QUYC 4POZD 1FO0A 5EO1A 2HVJB 1K2DB 4KKAC 2IPKA 3U0PB 3UTPE 5DC9B 3WEXA 3EIFA 1KT2B 4MA1B 3T09A 2H1PL 3OL2A 3THML 1PG7L 2UZYB 3FT4B 5ISZA 3KYKH 1AHWB 3MLTB 1F5WA 1I7RB 4OD3H 3IAPA 3VXNA 3NCJL 1GHFL 3OGCA 4K55A 2XY1A 3VGAC 5SWZB 5TDOB 4W70A 4KROC 3MZGB 3DV6A 5JPNA 2YKLH 3ETBF 1FVCA 1A6UL 5EOQH 1RURH 3ZKSD 1DR9A 1BD2E 4I2XA 3QUMB 5E6ID 5EO9B 3QDAA 4WI4A 3FQWA 1OTUD 5GJTH 4ZO6A 3SJVD 4OCXL 5DZLA 3S9DB 3DJ9A 1KIUA 2BNUA 5GGUB 3O6ML 1F2QA 1FL5B 4G8EB 3EYFA 3TVMC 5DRWB 3RVVD 3MXVH 3CPLB 3SQBA 5C09A 4AIXA 4P4KC 3JV4A 4R0LB 3DRTA 3GM8A 3LKSA 5JXAH 1N6VA 4UT7H 4AL8H 4DN3H 4P2QD 1Y6MR 1UG9A 3DUHA 2IQAA 4NDMA 5KOVC 3Q5TA 1ZGLA 3AROA 3ULVE 4HULB 2YPKA 5HYJD 2V2XB 1GPOH 2Q8AH 5KSAD 3MBXH 3PWLB 3NGBB 1IKFL 1JYXA 2VN4A 1YEFH 5CHNB 3QFDA 2CMRH 3CFIC 1T03L 2V7HA 4ZQKA 2NY3C 5F7FA 1I8MB 5CD5D 1KELL 4APQB 4F7CB 2CLVB 1A3LL 1R3IL 4L8SA 5F8RC 5SWSE 5BMFH 4EEEA 3ZL4L 1MLBB 1N8ZB 4HGWA 1FFOB 3EFDL 4DQOH 4WIQA 1A6WL 3C60B 5DHXB 3AS0A 4KJQD 1YEEH 4IRZL 4WFED 1YNLL 5HHVH 3JV6A 3O6LL 1CL7I 3IDGB 1BVKA 3BO8B 5ICYB 2DWEB 3IGAB 2JJUA 1ZWIB 5EBLB 4PG2C 4FQCH 1UKTA 1JHTA 3HAEB 4WW2B 3VXRE 4DZBB 2R1WA 1QSZA 1RMFH 2VLLB 4K94L 4Q9RL 3E3QC 4JY5L 3DBXA 4YE4L 3LS5L 1M7IB 4AH2B 5FAAA 4U0QB 3WNOA 1TTGA 1QACA 4L1DA 3RZCC 5CBAB 5IKCB 3L3OA 4XMLH 5CZXC 4NN5C 2K3TA 4H88L 3V5HB 4NQVA 4OCMC 3T0EB 2ID5A 1QPPA 1TVBA 1WQVT 3W9DA 1JGUH 5AG9A 1OQXA 2GSIA 3K8MA 2DQGH 5JDSA 1Z5LA 1U42A 4QRRE 2EDQA 2V6HA 1CXKA 2EO1A 4MNHA 4FQ2H 3BJ91 3PV6B 4ZS7L 4PRIB 1FNLA 2BSSA 3ARDA 1VGEH 4PRHE 2NZIA 4EDWH 3IFPA 4Q0XH 2FJFA 3ZDZF 1MFEL 3O3DB 1SM3H 1NCAH 1T2XA 4K8RL 4NSKB 3HZYB 4AEIL 4BSWB 4LLMA 3T4AA 5E00A 2FJHA 3PGFH 3AY4A 2Y07L 3MCKA 4ETQB 1WSST 2OK0L 1J8HB 1RZKH 1YY9D 5A43C 3QQ3B 1QUNA 5LGHL 2R29L 3T0WA 4JANB 5T1LA 2M2DA 2YD7A 4U1NA 5E9DB 3V0WH 2HKHL 2XZQL 3MRIB 1SJVA 3T8XA 5F7WC 3KPOB 3Q6FA 5GS0D 4OLVH 2HFGL 3STBA 1JHLH 4L4TD 1U58A 4X7SH 2AV1B 4N0FB 4A6YA 4NFCA 1FNEB 5HI4D 1TLKA 2ITCA 3BD5A 5C2BH 1HHGA 4MCYB 1YJDL 1XGRA 3ULUF 1TETH 5HY9A 1BVLA 1Z9OA 3LPGA 1FZKB 4Z9KB 3BN3B 1IM9B 2IBZX 3D69A 3RVUD 1J87A 1GOGA 5T3XD 1INQB 3GSQB 5DRNA 5K9OA 2CKBH 2R69L 1TQBB 1F2XK 1E4WH 1OF2A 5GS1C 5I1HL 2VDLH 1F4WH 4OI9A 1IEBA 5FK9A 5I8CB 3V0VB 1IQWL 4LDLB 5DWUH 4HXAH 5HPMB 4B7LA 5KZCD 1ZS8B 2JJSC 3CDFA 1LE9B 2X4PA 3VH8B 3RWHA 5IGXH 4XPHH 4MNGA 2DJUA 4N5ED 4AZ8A 4LCYB 3FRPA 5C08E 5EU4B 4XMKH 4BQCA 3VXSD 2OS7A 1NL0L 4LLYA 3SDDA 5MERA 1IGJB 1YN7A 3B5GA 5L6YH 2O93L 4KKCD 2R0LL 1HOCB 3G6AB 2ADFL 2ZNWA 1OAUL 5CUSL 3GIZH 4ZO8A 1JGEA 1XT5A 3VXOA 3GSNH 1QTYT 2BSTB 1JPST 4WWKD 4M1CD 5EWIL 3SCMC 4KK5D 2EDYA 5KS9A 2GJ6E 2OXHA 1P7QD 3DXAE 5E1AA 4IM8A 3SY0A 3UBXB 4AT6B 2XTJC 1DN0B 4PUBH 3NPSB 2X4RB 4G8IA 1KCSH 4AENA 5B39B 5I1DA 1CXHA 1H8NA 35C8H 1HK6A 5IMOA 5EIQA 2OJZH 4FFVD 4RZCA 2IH3A 3ZDZE 4EN3B 1KPRB 3M1BA 4I0PC 3PWPB 3RDTD 3V6BR 3BEVA 3KXFD 4ODWA 4ZFZA 1MAKA 3C5ZB 3GMMA 4M4RA 1BP3B 1DBKL 2KBGA 3TBYA 1AQKL 5L7XL 1DQJB 5BZWB 1NMCC 5HYQA 1XF4B 3LPWA 3LQZA 1YEDB 3MLXL 3MRMA 3RVTD 5CSGA 3O8XB 4Y5YB 1T1YB 5ICXA 4KRNA 5JORA 3BKML 4Y4KB 5CZKA 3IT8D 4F8TA 5F9DC 5BXFB 4KKBC 3TP4A 2HVKA 4X4ZA 2R2EB 4YJZL 4EJ1C 1SVZA 3NACL 2E27H 5ITBL 3L5WB 1P7HL 4R4ND 3RGVD 3PHOA 5FYJE 3ULUE 5JQ6L 5ITFA 4IRJA 3P4OA 4JRWA 3B43A 4OV5A 3BKYL 3TA3C 4PJ9A 4JFQB 3FO0H 1ADQH 3VD3A 4DTGH 5I1JL 4L29A 4XHJC 5IIEA 1N0XL 4PJEF 3KVQA 1NC2D 1QLRA 1CVRA 4MJIA 4HAFA 4PJCA 5DVLA 5TFSL 3SPVB 5JW3H 3GO1L 5HGAA 3RU8H 4PGJA 3X12A 2I5YL 5IFJA 3FQTA 1QZ1A 4KVNH 3OB0H 1OAQL 1IQDA 3IU3B 4M7LL 5I8EA 5T3ZE 4XMPL 5CAYB 5E6IB 2I60H 3VW3L 4K7PX 1S9XA 1RJZB 3CCHB 3QUZD 3WKNA 3IXAB 4JFFA 3L5IA 3MRNB 4P2RE 4PY8I 5IQ9B 4CU6A 1HIML 4WTZG 1UVQA 2DTML 4N0CC 3KWWA 1G84A 3MRQA 2Q86B 2JCCF 1K3IA 1L7TH 5EUOB 5DS8A 4K9EC 4P2QB 3KYNB 3MGOB 5DHYB 1A0QL 1AE6H 4MJ6A 3CU1A 1RUML 3VFWA 1XF3B 1ORSB 2MPAH 4WW1A 5KSAB 4NPYB 5BVJA 1NANI 3E3QE 1YEHH 5F89B 3QHZL 1N3NB 1B2WH 1NSNL 3BD3A 3LEYH 2NLJB 5E5MA 1QO3A 3BGFC 5IW1A 4L4VB 5TF1H 3QQ4A 1MAJA 3TCLA 5F21B 5ESAA 4G7VH 4Z5RA 3UBXI 3ULSB 2APXA 3D9AL 4C58B 4HIJA 4TTDC 4FHBD 5EBMB 1U8PB 1EFXD 1KLFA 2A83A 3DI3B 3QNYB 1XGTB 5D7LE 2RCSH 4AM0B 5I16A 1QBAA 1XIWC 4HH9A 2IAMA 1T1WA 4M61B 4DGYH 3BH9B 5B8CC 3VFGL 4HKBA 1S7UA 4PGDA 4U1IB 3ARVA 4GAYA 2VDQH 5E08H 4L3AA 1E6OH 4J3TA 3HKFA 4JDTL 3MMEA 1H8SA 2BNRD 3R1GH 5I8KL 1CGVA 4P5MB 5FO8A 2E7MA 5F1KC 1DE4B 5T3XL 1LEIA 1CE6B 4ONHB 1WF5A 4K7PH 1K8DA 5KVGL 3R0NA 4GSDL 3MRPB 2PR4H 2X9WA 4RWYL 4XXCC 5C0GB 5H2BB 1SBSH 1CTNA 2VE6B 1ZHKA 3TT3H 4GS7B 3MFGB 4PJEE 3JVGC 1GIGL 4DGIL 3CDGB 2UVEA 3U1SL 2R1YA 1UM6H 4H8WL 1NGPL 2FZ3B 4FQXC 5TH2A 4MA8H 5DI8A 1A1MA 3O4LE 2NY2D 3GUTA 4TUOB 3O2DL 3NMEA 4EUPG 3G6DL 5ECJE 5GGTH 5DEGA 4HLZG 4LVOC 1AY1H 1WISA 1VFOA 1YYML 1G9MH 2EIZB 4WJ5B 5BS0E 4O4YH 1QSFE 1T21B 5DMIH 2A74B 4I3SL 2JCCE 1QYGH 3WS6A 4GXVH 2Z31D 5DJ0B 4L4TB 4JCMA 1B6UA 2NY3B 4I18C 4K2UH 4UINH 5DSCA 4KKLD 3RX7A 5BV7C 15C8H 3N85L 1T1XB 3QG6A 1NH6A 1EJOL 4KZDL 3F12B 4RAVB 3C5SA 4YBHA 1OGAD 2P45B 4JKKA 2EYSA 5IR1B 5JUEH 3F8UB 1PSKH 1A7BA 5C0CA 1IGIH 3BEWB 4CUCA 1S9KC 1BWWA 1HHJA 3L1OL 1NKOA 3PL6C 5CIPH 5D93C 4XWOD 5KZCB 5HGGS 1NGZA 4LOUC 1KJ2H 1KXVC 4KVCL 1F8TL 4PJ7F 3T77B 4MGXA 2VLRD 4NYLB 3OKEB 4NO2B 4R7NA 4XCCH 3CVIL 3UC0L 1NBVH 2XTJE 5D96C 1HQRB 3TGXA 3QG7H 4YDKH 4OD3L 3VXSB 2YZ8A 3T1WA 1Q9OA 2VAAA 4F15B 2BHYA 3BDYL 5ANME 2D7NA 3NIFF 4J8RB 5CP3A 4P4RB 2QQKL 1LWRA 3V79C 3IDNB 3KHQA 4XP1H 1Z9MA 3VE0B 5CJXC 3CD4A 5LXGL 4WWKB 1XH3B 2P5WB 1P1ZB 3K2MC 2BOCA 1MLCA 3O6KL 3W2DH 1P7QB 1X6NA 4V1DD 1G7MA 4JM2B 3SE4A 3NCMA 5AYUL 1JPSH 2CK0H 4HIXL 3U4EA 1BZ7A 3ZSSA 4YQXH 2BNQB 4PRAA 5IB5A 3CMOL 4NP4H 3VWKA 3GBLA 3P0VH 4IJ3B 2XI9A 4ZUSB 1SMOA 4I1NB 4Y1AD 4JRYE 1A4JA 3RDTB 1ZV5A 4M43H 3KXFB 5KG9A 2A77L 1BQUA 1BQHB 3WDJA 5BQ7A 2VC2L 3S36X 3GBMH 5CS7A 5I1KH 5DDHB 4E0RA 3JWOL 2CMRL 1P4BH 2WBJA 2RIKA 4KI5C 5I2IA 3U0TB 2NTSP 2EXYC 2GJJA 2J8UB 1FH5H 5MP6H 2H2PC 5FOJA 3FZUC 3VFSB 1LEGA 4YK4C 5KSUB 5GGSY 1BPVA 5EFIA 5JXEA 5CEZH 4U6YA 1JHKH 1BAFL 2HN7A 5FGCE 1JPTL 2HFFB 5D1QC 4MAUH 2X4SB 2Z92B 1XGQB 4UIKH 2CLZA 4G9FA 4C56E 1IKNC 2AK4A 3MLSL 4LLUB 4Q6YA 4YHIB 3PUCA 2VIRB 2LTQC 1BEYL 1WICA 1NC2B 1MFCH 2PW1A 5MENE 1Z2KA 4WHYG 1FBIH 3ARGD 1XFPA 4G6AC 2UWEA 2A1WH 3QEHB 4S1DC 4N9GB 2O61B 12E8L 5B4MD 2MHAA 4OAWB 3MV9D 4PJ7E 4U3HA 3H9SA 2ADGA 4M6OH 4E42B 5C92A 2YPLE 3MLUL 4TNWK 2P1YA 3QI9A 1A6AB 5L2KE 1W72H 4L8CB 2DLEA 1CD8A 4JFPB 5CJQH 1S78C 1ZHLA 3NABL 3UTZB 3C8DA 4L9LA 2LU7A 3OHXA 3SCMB 3TZVA 4NHCL 3O3BA 5ELIA 5FO7A 2DQIL 2ZG3A 3NIFE 2C3HA 2W9EH 4KK8C 4G8FB 3RWDA 1LO3H 4M7JL 3MA7A 4Q0XL 1D5ZB 5M94B 5L8LB 2NYYC 4OUUB 3W11D 5DVNA 3HA0A 5JNYA 1C5DA 4P23C 3A0OA 4ZXBA 2NY4D 3FFDB 5E95B 1RZKL 4G9DB 1DUZB 1EO7A 4RSVA 2J6EH 5CMAA 2NR6D 4ZNEE 4WHDA 5GGSA 2UV3A 4XVJL 4K9EL 1EAJA 3BUYA 1K4CB 4I77H 1P5VA 2EDKA 2X4OA 2GSGB 3B3IA 1JZ3A 4WFFE 4C4KO 4L8SC 5IK3B 4Z95L 2ED9A 1PKQE 3T1FA 4U1SB 3R06A 1CIDA 1D7FA 3VFUB 2JK5B 4P9HC 3WNMA 1DQDL 4LVNB 1OPGL 3QDMD 1N4XL 1S7VA 3KDMB 1WJ3A 4ZUUB 4NN6B 3DURA 2H45A 3BWAA 5ESQA 4KQ3H 4ZTPH 5AD0B 5EBWA 1BQLH 3QNZB 2VQTA 4O2EA 4H25A 4ZUVA 2PTTA 4HEME 4WCYH 5IB3B 4FTVE 1LO0H 3OAUL 3BD4A 4UT6H 1S7RA 3SKMB 3V95A 2N56A 4WU7B 2IAND 3EYVB 5C86A 1P2CA 3L3JB 2HTLC 5IESL 3P2TA 2PCPB 4S2SA 2YEZA 3SO5A 3HRZA 4KI5F 2PF6A 2XG5A 1UA6L 3HI5L 1I3GH 1JGLH 3VFOB 1A1OA 3IXTB 2ZCHH 3T2QA 2Z35B 2ICCA 3MR9B 1NGWA 1HWGB 1DVFD 3OR7B 4AK1A 1IEAA 3UTSB 4XH2B 1Q72H 5GGRY 1GAFL 5C0FA 1NFIA 1X5FA 2C3VA 32C2A 4JB9L 3KPRD 2EEDA 4NCC2 3IDIB 1P9MA 4GAGH 1ND0B 4LARL 4HS8H 1QNZL 3QEUA 4OGYL 2Z8RA 2W59A 5T33L 2UYLB 3GHBL 3SBWA 1NBZA 3QULB 3FFCE 4RAUA 5MEOA 1FL3A 5E8EA 2Y6SD 4HKZA 3EJZC 2JJWA 4RDQF 1F58H 4DVRH 1FVDA 3HI6H 4S1QH 5LG1A 3AY4C 1YECL 2VKXA 4X6CF 2H3NA 3KG5A 4EDXB 1MY5A 4LKCA 3OKLA 1OB1B 1QD0A 4WHTB 3NFPA 1MCDA 4FABL 1EAPA 3VXPB 1AGFA 2YMXL 2CGRH 3TBWA 2APVA 5CEYA 2BVOB 3DVFA 4UDTA 2O5XL 3VXUD 2XFXA 3AAZB 4BFBD 3HN3A 2X10A 4Q9QL 1T0NB 3RQ3A 2X1QA 2FX7H 4WV1B 4OLEA 5BZDA 1HYRC 3IB4A 4PGEA 2YUWA 1GC1L 1RU9L 4M6NL 2HG5B 3FB8B 4ZS6D 4L5FH 1XIWB 2Q8BL 3P3YA 5EU5B 4HGKC 3QJHA 4YAQA 5BV7L 2WK2A 5DJ8B 3TT1L 4D9QD 5B8CB 4JN2B 3ZT7A 5DZOA 3T3PF 2OI9B 2CJUH 1EHLL 5FCUL 2ZPKL 4IEFB 1P7KB 5FUCC 5EZIH 5JOPD 4E41A 3QEQA 1UJ3A 5GGRA 1JCKA 3D5OF 1RUQL 4HMCA 1NMAL 5IUSA 1V3JA 1VEPA 1CD9B 1KJ3L 4PLKD 1U3ZA 1KN2H 5D4QA 5EULV 1EGJA 4P2OB 3W0WD 4JDVB 4X6FA 3H0TB 4HJ0C 3TBSA 2IFGA 2ZOLB 3CSGA 3S5LB 3SDDC 3SDXF 2FX8L 5JPMA 4DFIA 3P0GB 2DQHH 2W0LA 4KI5E 1EFQA 3EHBC 5I1AA 2QHRH 3BH8A 3M07A 4ODHL 4ELKA 1R3JB 5BRZD 3U36A 3C8KA 4V1DB 2A73B 4YDLB 4XRCA 4PJAF 1X5LA 1NDGA 3L3HA 5CJBA 4XPTL 3U9PH 5I1IH 3STLA 4QHKI 2VQ1B 4K3HA 2L7UA 4LDEB 3HC4L 4WW2F 2NZ9C 3IFNL 1PY9A 4Y1AB 2B20A 4H26A 1OAZL 4KRPD 2DQCH 1WC7A 1CIUA 4NM8L 4ORGB 1CLCA 4JKWA 4L9DA 1RPQA 5BV7B 5CEZD 2ZUSA 3LEYL 3MACH 1ZK9A 2I24N 4X6CE 1BFSA 4HWBA 3SKNB 4TVPE 4NC1E 4M5YH 4UBDD 4HPYL 4G7VL 1QQDB 1FPTH 1YNKL 2F8VA 1RZIA 2AABL 3U46A 3LKOA 2GI7A 4BZ1H 1I1FB 1KJVA 1A9BB 4KK6D 2K7PA 4LSPL 1G6RH 1XF2A 5SX4H 4P46A 2KZWA 1JWUA 1OY3B 2FHCA 4PTTA 3MCLL 2GUOA 4FFZL 4MDJB 4POZC 5TE6H 1YA5A 4JE4B 2FATL 1VSCA 4LSDA 4PJ9C 2BVQA 5CBEB 4R3SA 1L0XA 5FYLL 1EZVY 2YUZA 1E6OL 3W5MA 1CGWA 3UO1L 2FNBA 4XVTH 1MIEH 4UUJA 3GSRA 4J1UB 5IEKB 2YD1A 2XICA 1U8OA 3T3PE 1FO0L 3H3BC 1B4RA 5E6YA 1ONQB 2YD6A 3BZEA 1SEQH 1MRFL 3LZFH 3HUJF 4WI8A 1LDSA 1XR8B 4LLQB 3O41A 3GSXB 5HYEA 1HILA 1H3TA 4UNVA 4WUUA 4PRPE 4YUEH 1HH6B 3GJEB 1G9NC 3QCTL 4HUWB 5KAQF 1LMKA 3JWDL 3I2CH 1I1RA 2D03L 1QR1B 1UWXH 2B39A 1MIMH 4NUJB 4LPXA 1OTUC 3ARUA 4TVSa 1WLHA 1JK8B 5C0AD 2W65A 3Q3GB 1NLDL 3GSOA 1UM4H 3I50L 2EDFA 3SDXE 1X4ZA 3QIUB 5IOPA 1EEZB 2AJ3B 5E8OA 1KIQB 1ZSDB 4PJ5A 3TYFA 3N9GL 4OFDA 4MB3A 4AEHL 3LD8B 1FZMB 2MCPH 4Y89A 2Z0BA 2C3WA 4ORZC 4GLRI 3X3FL 1DBBH 1C8PA 4R2GD 1I9IH 5IEHB 4PJAE 5DEFA 5CSBA 3SEPA 2IG2H 2XQBH 4IRSA 2JF1A 5DMYA 4KUCF 3H7BB 3HC3L 3MNVA 5CSZA 2DBJA 4KY1H 2D4FA 2CRIA 4BZ2H 1D5IL 2GHWB 2F54E 1P4IH 4QRSB 2NX5B 3ARRA 5JW4Q 5D1QB 3CSBA 3L3DB 3G5VB 3SOBH 4TNWF 1FO0B 5EO1B 2ADJB 5DK3A 3SDCA 4JQIH 1SYSA 1WAAA 2PYFA 3T0AA 1Y18B 2N7BA 3VXME 2DLIA 1A7PL 2E9BA 2FD6L 3LHPL 4J6RL 2IBBA 5ISZB 3MRFA 2BSRA 3W82A 4QXWA 4JAMB 4P9HL 1EEYA 3VXNB 4GMTL 5HGHB 4N90E 3OGCB 4D8PA 4MA3A 2VYRE 5L2JA 4JFYA 5GRJL 1DVFB 3BPCA 5JPNB 3QG7L 3AS3A 3L95A 5IBLC 1S3KH 2VXSH 3AU1B 2MFNA 2ZJSH 4I2XB 3KPRB 4ODSL 3FQWB 1BFOB 1CLOH 5C9JA 2WIIA 3BQUA 4ZYKB 1SJEB 3ARTA 1KB5H 1DLHA 3RI5K 3PV7A 4Z7VB 1MRCH 4LCCA 2FGWH 4GRLA 1NEZA 2QKIA 4GUPA 4NO3A 5C09B 4FA8A 5E5RB 3JV4B 2VDOL 3DRTB 3HUJE 4TUJA 3AS2A 4NQCA 2IQAB 4NDMB 2FL5A 1FE8L 4RDQG 4RMRA 1T66D 1CBVH 3WUWA 3OAZH 2DQFA 4X6DB 3DI2B 4UTAH 4O00A 5EU6D 5IBTL 1NBYA 2M8XA 3NCCB 2F53D 3VXUB 2V7HB 2AXGA 9CGTA 2Y7QA 3KYMA 1URLA 4G5ZL 5T1KD 3NA4A 4K23H 4PJGF 4PJBA 5HHOD 1N2RA 1Q38A 2X1XR 4DGVL 5GS0C 2W0FA 1CD1A 3VU2A 3NVQA 3K1KC 4HWUA 1H3GA 5CIPA 3IDXL 3IETA 5HI4C 1KYOJ 5I75B 1BVKB 4Z76A 1X9QA 1KJ2A 3HE6A 1KC5L 3EJYD 4WDIA 5DO2D 3RIFK 4GFTB 4A6YL 3DBXB 3RVUC 5E8PB 1AD0A 5EU7E 2EYRB 1IC1A 1G7HA 3L3OB 1KTLA 4M93C 4H0GA 5KS9E 3VFNB 4NQVB 1OAKH 3SE3C 4Z7WA 5JHDE 2VDRL 3D18A 5IHBA 1TVBB 3FQRA 3TJHD 3W0WB 2GSIB 1ZA3B 1HYSD 3WLBB 1BOYA 2ESVA 4IBLT 4UMGA 2O5YL 2VXQL 4ZO7A 3LQMA 1U6AH 2A6KA 3CFJB 4N5EC 1OTSD 3I6LE 2Z9TA 4Z0BL 4CMMA 4M6OL 2L7JA 1CGSH 2XY2A 5SV4A 2BSSB 3ARDB 3KPSE 1FIGH 1VB9A 2FJFB 3U2SB 2YN5A 3QSKB 2YRLA 2BXZA 4JZJC 1FG9C 5KJRL 3BVNA 4LLMB 4TQEH 2VDKH 4WO4A 4RQQB 4K3DH 3PWNB 2GJZA 5DVMA 3MX0A 3ALXA 3MCKB 2XZCH 5C0DA 3SE4C 5C07A 4UB0H 5IWLA 3Q1SL 1EK3A 2X4UB 3JTSA 3HAEG 5T1LB 3VWKC 3DO7A 4XBPA 4Y5VA 1A1NA 4M1GL 4U1NB 4XPBH 2D2OA 3HHRB 1GZPA 3S36L 1CE1H 3K8KA 3T8XB 1V8HA 3B8SA 5DJ2A 3FT3A 5FKAA 2UVFA 2EYTA 4RFOH 3S88H 4A6YB 3RGHA 2WBJC 1DFBH 4JZOA 2ZCLH 5FYJU 4KAQH 1T7WA 2ITCB 1NFDA 1HHGB 1V7NL 1XGRB 3DWTA 4OSUH 5HY9B 4OZIB 2BY2A 4X9IA 1BVLB 5FM5O 3TC9A 3TBTA 2H41A 2R56L 4O9HH 4Y8AA 4U1LA 3D87B 4CBPA 1DDHB 4UI2A 3DO3A 1JGVL 3RVTC 4FZ8L 5K9OB 4PJGE 1MCWM 1CZ8H 3QDHA 2E7CA 4FXLA 5KW9L 3GSUA 1IEBB 1EMTL 3NFNA 4EOWL 1WCQA 3TNNA 4U6XA 1BQLL 4GRWB 3SJVE 4M8QA 3E6HB 3CFBA 2X4PB 1T7XA 3RWHB 1H3WM 4JDZB 4MNGB 4Y19D 1H15A 4FQHA 2E7BA 4MD5A 1LK2A 3HNVL 1QSVA 4NUGL 4GKZA 2IH1A 4Q2ZA 5K59F 4XI5C 3OKKB 2GIYA 4LLYB 3TJEL 2HT2C 1I3GL 4XNMA 1I7UB 5MERB 1TJIH 1YN7B 5F1IA 2ZCHL 2V5YA 3WIFB 3PGDB 1J11A 3QI9C 5HYJE 5IHLB 2WWKT 2Y1VA 4OCSL 1QFHA 3S37X 1TVDA 1RUAH 1JGEB 4KWUA 5D6CB 4RISH 3V4UL 4NO0D 5CLTA 5KAQG 3DX9A 4JGJA 4L9LC 5C0AB 1DQLL 4ODXA 3GIVB 3ARFA 4UOW1 5E1AB 1XZ0A 4R26H 3QDGD 5F7LB 3I6KA 1RJLB 4MD0B 4AENB 1CFVH 3WJLA 3HI6L 4WFEE 4NJAL 2ADIA 4ZXBC 4P3CL 3TPKA 2IH3B 4R2GB 1S7WB 2WBWB 2QL1A 5D7SL 2AJXL 4PJIB 2QTEA 3BEVB 1F3RB 4ODWB 4ZFZB 4Y2OA 4WGWB 3V52L 3VH8G 2VDNH 3V6OA 3FB7A 1Q9KA 5D70H 5I9QC 2PTVA 2W9DH 2Q7YB 5JOEA 1FGNL 5IQ7H 4WI7A 4JRXD 2I25N 4C83A 1INDH 1EHXA 5HYQB 3MRMB 5JORB 4C59B 2ZWLT 4J3XA 2W60A 1CD0A 4QOKA 1FZOB 4LDOB 1TMCB 2H8PA 2VITA 5FA4A 4W6XB 3U7YL 3OB0K 2ED7A 3MRKA 1UH3A 4GQ9H 4LLVA 5F7EH 3PHOB 2HJLA 3DGGA 5HI3D 4Y5XA 4DN4L 5C8JA 2P5EA 4LAQL 4IRJB 3ZKQD 3KLSA 4CVXA 5HHQA 3DSFH 3BZ4B 4IIQC 2V2TA 5HDQH 3RWGA 4PY7A 1QLRB 2BXYA 1HNFA 2PYED 4X80H 5LCVH 5B39G 5TQ0H 4LGRB 4N8VA 4EBQH 5IJKA 1G1CA 2AS5M 5HGAB 1NAKH 2BDNH 5D5MA 5GISH 1YEKH 1HZHH 5ADPL 3S37H 4HBCL 2MKWA 1XMWA 1S9XB 1IBGL 3F7PC 4MVBD 4PYGA 1BBDH 4O2FA 2DQTL 4JFFB 2E7LC 3TIEA 5EIVA 3WKML 4ZTOL 1UVQB 3FQNB 5K59E 2GK0A 3KWWB 3H3KA 3MRQB 2BP3A 5GZOC 4NBYB 5HHPA 3BJLA 4PIRF 3SBWC 3QCVL 4R96B 1A14H 3MBED 5FUOL 2DM4A 2B1AH 2IFFH 3QWQB 3N1PC 1N64H 5C0CE 2NY2C 5BOPA 3VFPB 2HP4A 5FHBH 1BX2A 1VHPA 4ZG1A 1A64A 3MRRA 5A3ID 2VSDA 3U7WH 5KVEL 5DD6B 5BVJB 3ROLA 2UWEF 1MHEB 2XIDA 1TCRB 1FYTA 2AAVA 2F53B 2HWZL 5E2VL 3EGSA 1QFPA 4M03A 1QO3B 4QGYA 3WHXA 2EE2A 4MAYA 3G08A 1ZMYA 3L3IA 1MREH 5AZ2H 43CAA 1A7RH 1GGYA 2B1HL 5ESAB 4FMKA 2P7TB 3QRGH 1KCVL 4V2BA 3BDXA 3SGEI 4HIJB 4MJ5B 4NKMA 3SGKA 4DEPB 4BELD 4HLZH 2HRPL 4Y4FD 1VADA 3D2UA 4QWWC 1FFNA 5ESVA 1GCFA 4OCNC 1BGXL 4Z8FL 2VSCA 1E27B 1MJ8H 1SY6A 4K7FA 2A83B 2LE9A 5DMGC 4HF5H 5F70A 4NRYB 3FONA 5IF0A 3S34L 4HH9B 2IAMB 1MCEA 1VPOL 3FO1A 3EOTH 1YZZA 4OFVA 3RI5F 3DGCR 5F7DA 1S7UB 3DX8A 2DI7A 3HCVA 3PJSA 1OOAA 2G75A 2AEWA 2J2ZA 2NY6D 4LKXA 2APFA 2H6PA 4PBVC 3BT2H 4XTRC 4LSSL 2XYCA 4OF3A 2NY1D 1UJ3C 3FTGB 1MRDL 3LSOA 2WP3O 3MREA 4XP5H 1K8DB 5TDPB 2B0SH 3HFMH 1MIEL 3E1F1 5AYQA 1WZ1L 3BP7B 7FABL 1RZJH 1FJ1A 4YZFF 1X4XA 2D9QB 1S5IL 3RAJL 3FQXA 2D3VA 2R1YB 3CZFA 4OGXL 2J3SA 3TYGL 5DI8B 3GUTB 2AQ2A 3RY4A 1RULH 4DWHA 4TSBH 5DEGB 1VFMA 5DFWH 3P4MA 5EN2B 5HGDB 3QWOB 4XC1L 5F8QC 1IGMH 1KB9J 1RJCA 3G5XA 1YMMA 5DJZA 4H1LA 4HPOL 1WWCA 3RIFF 1HI6A 1EHAA 1IM3A 3ESVF 4M62H 2D7MA 5F3BA 4RIRB 2MNUA 1UEMA 2BMKA 2MCPL 5DSCB 1QLEL 5BCAA 3STZA 1I9IL 1R3HB 1N59A 2NY0D 5J6GA 5IFAH 1G9EA 2VXTL 4TOYH 1JZ4A 4YO0B 2H32A 4DAGH 5D1ZD 2UWEE 1UXSB 2DLFH 5D2NB 1C5CL 1FAIH 3MRHA 1D5BA 3BISA 3H9SE 5JLZA 1CWVA 2YBRB 1HHJB 4N0UA 2J8HA 5SV3A 3WFEH 1ZT1A 4UU9B 2MQ0A 1JRHH 4ZD3L 2VAJA 5JW4R 2EXWD 3MGAA 2HAZA 4PB9L 4X98B 3O0RH 4WY7H 1EXUB 3QWRD 4LF3A 1HXMB 2VLME 2P24B 2VISA 1RZFL 4OZ4A 2CDEB 2FWOB 4QLRA 1D9KA 1JUFA 1JZ8A 2FR4A 4PR5B 1IGFH 3V7AE 2PO6D 3NCFB 5F3HA 3CK0L 1A6PA 1INEH 1H3PH 4HUUA 1PYWA 1U8JA 3I02A 3QDJD 3HG1D 1BHGA 3ARGC 3MRJA 2E7HA 4EI5D 5HHXH 1MQ8A 4Q6IA 2VXSL 4PFEA 4NGHL 3GNML 1DN2A 5FHAH 1I8IA 1ZTXL 2X4QA 1CLOL 2QADD 3TN0A 4JO3H 4G3YH 2L0DA 3P9MA 5CILH 4NOBA 1YPZB 4X7DC 5JR1L 1BECA 4YZFE 1G7MB 1YDPB 1IFHL 3QO0A 4FNLL 1FSKC 3BE1H 4PRAB 5DJDA 4XHQA 1P5UA 1S9VA 1CDCA 1HE7A 4Y2DD 2BY1A 1U8QB 3PQYD 1OP9A 3LN4A 4JHBA 1A4JB 2NW3A 4F37K 1LHZA 3LRGA 2HTKC 3GJFA 1MFAH 4M48H 3RPKA 2NY4C 4QKXB 3UAJD 5I1GH 4JRXB 1T5WA 4IRSC 4GO6B 5EORL 3QHFH 2PTUA 3F58H 4Y88A 4ZFGL 2IPUK 5EG6C 3VXQA 1AO7D 2OL3L 4K23L 4PGBB 4EVNA 4I48A 3SO3B 2R0WH 1A7QH 3TFKD 1WTLA 2BNRE 3QUKB 4RRPG 1A6TA 4U6YB 3GSVA 2HN7B 2X89A 3OPZL 4QXUH 5KANI 2P48B 3RNKA 1OTTD 4ZAKD 3SDCC 2ZCKH 2XN9D 4G9FB 3LVEA 2J12B 2AK4B 4U1HA 3FOMA 2DQJL 2AK1L 2Y36H 4Y16A 4WI5A 1YYLL 3IDYB 5HVFB 4MQTB 2K1MA 2PW1B 1AH1A 5I74B 2ED8A 1KB5B 4ISVB 5J9PA 2DQUH 3IU4H 2EH8L 5E4EC 3LEVH 4HUVA 1KCUL 4HQQL 1M4KA 5I19L 5FA3A 1BQHG 4PJXA 4XCEA 4WUKL 4LSTL 2YHGA 1JN6A 1E6JH 2Z91B 1A22B 4LSQL 4ZO9A 1MY7A 3BQUC 2XRAL 5FGRA 4AQ1B 3SKUD 4NZUH 4O02H 3OHXB 1GYAA 1UCBH 3NAAL 3TZVB 5KN5A 3O3BB 5HJ3A 4LCCC 3RWDB 4GRLC 3D85A 1FIGL 1NAMA 1PZUB 3BHBA 3MA7B 4RMVA 1Q94A 3O2WL 4OQTH 5TE4H 2OL3B 1MCPH 3BP4A 3CX5J 4OZGF 1QKZH 3GRWA 5DLML 1OGAE 1R0AH 4X9BA 1C5DB 4ZXBB 4I9WD 1HHKB 2OBGA 3ILPA 2Y6SC 3IRZA 4ODVL 1FN4B 3ZHLA 3MV7A 4Z77A 3SDAA 1XF1A 2Y9RT 4W4OA 1A2YA 3BGMB 2A9NH 3MV8D 5CMAB 4D0DB 1ERNA 4JN1H 4CMHB 1A7NH 3G6JB 3BUYB 1PVHA 3QEQE 4M5ZL 4S1SH 2HT3C 2NW2B 2X4OB 3B3IB 4CADA 3S88L 2VLRE 3MCG1 2ZCLL 3T1FB 5H37H 4X4YA 5FECA 1JWMA 1GL4B 5IBUG 1ZHNA 1EX0A 5IB4B 3HZVB 2X40A 1J0HA 3UX9B 3AGVA 2AVGA 5J57B 2HRLA 3HE6C 4U1GB 5ESQB 4HV8A 3UMTA 2YUVA 5EBWB 4PBWD 3REWA 2QV2A 4H25B 1BMGA 4ZUVB 2PTTB 3V7AG 4YXHH 4YHYC 2VABA 3KPNA 4LIQE 2F15A 4Z7UB 1XCQA 2NXZD 2NY1B 1P2CB 2BERA 4RFNC 1MJ7H 5LQBH 1F42A 1GGBH 4S2SB 2YEZB 2X70B 4NZRH 4KPHL 4LCWD 5B22A 3D39D 5GGVY 3ZDYF 3I9GH 5F44A 1F4XH 3T3MF 4V1DE 5HI5D 4JM4H 4WI3A 1U8HA 1KG0B 1ITBB 4LPYA 1ZEAH 3S35L 3BUTA 1NFIB 5MEPA 4GG6B 1U3HA 5DFTA 3MOAL 3FN0L 4Y1AE 3U4AA 3FAXA 5F1OB 4ZDHA 1BD2A 3VG9B 5DD0L 1S9WA 4YDJA 3RJQB 3K7UA 2FEDD 4XNYL 4IOSD 5KSBF 1CR9H 1DBAH 2BVPA 4XNUH 5E8EB 4HKZB 4JFZL 4EKXA 3BPLC 5L8JB 1FVDB 1EGJL 2MOVA 1DANT 4HAGA 3HI1B 4R6UA 1YEJH 3WN5A 2H3NB 2IPTH 4R26L 5IWLC 3OSKA 4GBXA 1UB5B 4ZPVA 2Q20A 3QUXD 3V5DA 3NFPB 4PS4L 1LE5A 4Y5VC 4X5WA 1EAPB 1AGFB 4U49A 1DSFH 5CEYB 4JFDD 4UDTB 3TIDA 3S96A 4DZ8A 4HUKB 1DL7L 4OZGE 4LIQL 4IOIB 2OTUA 5IFHL 3OZ9H 4XBEH 5TDNB 4XPAH 5FF6B 4TRPH 4JO2L 5BZDB 1Z6JT 5SWSA 3H42H 4PGEB 5TE7H 1Z3GL 3PWVA 2H2SD 4J4PD 5LBSH 3WXVH 4GG8A 1RVFH 4UBDC 3QJHB 3OKMA 4HHAB 4YAQB 4HDIA 3Q5YA 4NQDD 4Z7VF 3R8BB 2F74A 3MV9E 3U0WH 2W1NA 3MLRH 2HH0L 1NGQL 1OM3L 4KK6C 3SKOA 1EA9C 3BP5B 3A6BL 3VXRA 1RHHB 1G7LA 2VLJA 4HWBL 4TUKL 4PJ8D 4BJLA 3QIWD 4LU5H 4KK9D 2GTZB 1AXTH 1I7TA 1CXEA 2P44B 5FO9A 3L5XH 3WHE1 1JBJA 4U3CA 2NXYC 1JFQH 3VWJA 3QDJB 3MYJA 3OF6D 5HHME 1XGUB 4CN4A 3CSYB 4EI5B 5D1XD 3VCLB 1X44A 1PEWA 1TJHL 3KNBA 4XNXL 3S37L 4MXWL 5JPMB 1R3KA 1S7XB 5JIHA 4QRRA 1KBGH 4LHUD 2QADB 1VESA 2JB6A 4AIZB 4FQJH 4OCWH 4RMQA 3ZDYE 5J8OA 4BSJA 3T3ME 4ONGH 3BH8B 2BJMH 2ZKHH 4ELKB 2NY7H 2OP4H 3U36B 2X1WL 1L0YA 1E0OB 1OCWH 1WEJL 4PRHA 1U91A 3O9WA 4DFHA 1U8IA 3HB3C 4G6KL 1NDGB 3L3HB 1HINH 4GW5B 4OD1L 3PQYB 5F96H 1C16A 3QXAA 4H26B 3WJLC 4R8WH 4WTZA 5KSBE 3QDME 1A7OH 1F02I 1C08B 2HFTA 5EOTA 4U6VL 3HPLA 5ALCH 1PLGH 1I4FA 4G6FD 3V6OC 5I73B 1GSMA 3C6LD 1KPUB 2RR3A 3KPMB 3RTQD 4HS3B 2SEBB 1CFSA 4LSUH 1MCWW 3HE7D 4HX1A 4RX4D 2R4SL 1RIHH 1SBBA 4HC1H 5AZEH 1OW0A 2IANE 2MQ3A 5IHUL 1CF8L 5LWYL 3JBG7 3U46B 3S5LG 3LKOB 4IS6A 1P69B 1OWWA 3KPPA 4XAWL 1WIPA 4OTXL 3U6RA 4ZAKB 1KJVB 2I07B 3CFCH 1UWEL 1AQDB 2Q6WB 1XF2B 4D9LL 5F88A 3MRBA 4P46B 1ZGLP 2EKJA 2B4CH 4XCYB 2Y23A 4PTTB 2GUOB 3QXDA 1K85A 4Y5XC 1AKJA 2FLRT 4XP6H 2X41A 3NH7H 2BVQB 3FMGH 3RPIA 2JELH 1KEML 1E4XL 3AVEA 5ETUA 1UWXK 3Q48A 4XX1E 1Q0XL 2BVYA 3H3PL 2HMID 5D7IF 2BX5A 2AQ3A 1HXYA 2X09A 1YUHA 2RFXA 4UQ2B 4HZLA 3V4PH 3TO4A 3OR6A 5C08A 1MCLA 3PP4L 5HVHB 4F37F 5EU3B 5ALBL 3BZEB 1LP9F 4P57A 3CUPA 4KJPC 3O41B 1HILB 4KHXL 2QSQA 2FJGA 4L3ED 4WUUB 5F93C 4Y4HA 3ZTNL 5LGKA 4XZUB 4P48A 4OZIF 4LVHC 4LRNL 1H5BA 2W65B 3GSOB 3MLWH 5IOPB 2WINA 4P5TD 5E8OB 4PJ5B 3TYFB 1CICD 5DJXA 4N1EA 2VLKD 1F6FB 3D3VD 1U2CA 1CL7H 4K07A 1TZGH 3HMWL 3DXAA 4FFWD 4CW1A 4CU7A 2BZDA 1H0DB 3F5WA 1ODAA 2V5TA 3OKOB 3KHOA 3QUYA 3MV8B 4KFZC 3U9UA 5A2JH 4WI2A 3EYQC 4DKEL 5AWNL 5HD8D 4EUPA 5DEFB 1ZT4A 2HLAA 5F1SA 1R5IA 4MAYC 3KLDA 1W0YT 3MNVB 3MLPA 1DCLA 1KENL 1QLFA 3S3JA 4KUZL 4GRMB 2UY7A 1BFTA 2OMBA 5DK2A 5T5NG 5JOPE 1IAIM 3SGKC 1PG7X 4LEOB 1FORH 4LASL 1FAIL 3UPRA 4JG0L 4I5BA 1RIVH 3SDCB 2R0KH 1WBYB 5IVXB 3DMMA 2HJKA 3CGTA 4KJWD 4G6ML 4NRXA 4QRTA 5GSRA 1MI5D 2A6IA 3QIBD 2VTFA 4OUOA 4XVSH 2DS4A 2EE9A 2DD8H 3EJYC 2BSRB 1UM5H 5DUPH 1GVIA 3L3GB 1EEYB 5ADOH 3BKCH 4Z78B 2Y06H 4LCWB 4P4KA 5C0JB 3KPLB 5BRZE 5E2WL 4D8PB 1F90L 3I85A 5C07E 1AP2A 4YHMH 5DTFB 3L95B 3QUMH 1MNUH 2OQJB 4X4XA 3E2HC 3OAZK 3C09B 3SE8H 3NFSL 4K3EL 4U05A 4U7KA 4R4FL 4F7PB 4QRPD 1NLBH 5C9JB 5D7IE 2IEPA 5DD3H 3LMJL 1J1XL 3DVGB 4XC3L 4QRUB 5CEZE 1B4JH 3QT2A 4P2RA 5FHAL 2QKIB 1NFDE 4GUPB 3RX8A 2WAHA 4M3KB 1J12A 1LP9E 1BBJA 4WTXA 2OZ4L 2FDBP 4TUJB 1HEZA 4ELMB 1H8OA 4NQCB 1F3JB 4NQED 2FL5B 4LQFL 4TSAL 3PABA 3U48A 4HH8A 1I1AA 2DQFB 5C7XL 3QUXB 4OJFH 2AV7A 1JNJA 2Z8SA 1KPVA 2PXYD 3VD4A 1OAXL 4GKSA 3MRCA 3L7FA 3KYMB 4OB5L 3F65A 3THMH 1PG7H 3FN9A 4PJBB 3GMNB 5F9WB 3RZCA 3DNKA 4MLSA 5EZOL 3MLZL 1GHFH 4M7LT 3QHFL 2D7TL 3PHSA 4X0KB 5FKPA 1JVKA 4MNQA 4KHTL 3IETB 2N4IA 5E2UL 5J1SC 5F97E 4JO1H 2B2XL 4NQDB 1AR1D 1T0MA 1Z0NA 2F9BT 4WDIB 5D7LA 1GZQA 3O6MH 1AD0B 2C9AA 3GHEL 2HYMA 4YHYB 1WIOA 5GRUL 4PJ8B 1G7HB 2F5AL 3QIWB 4AYFA 4BH7A 1E4XI 5FYKE 1PEZA 2NY5L 1EUUA 4Z7WB 3WFCL 3FQRB 1N5YL 1T6WA 1D9KC 2ESVB 4NWUL 3DROB 5ID0A 5D1XB 2AJZA 3UDWA 7CGTA 1IKFH 5H94B 5KTEL 4LHJB 3V6OE 4LHUB 1TITA 1FL6B 4Q6IC 3KS0J 1T03H 3U79A 3GBNH 2W07A 3KR3L 3MFFB 3PP3H 4HG4J 3I75A 3BX7C 1KELH 3PNWA 3LDBC 5KOMC 3VFVB 1A3LH 1R3IH 3TV3L 3TN0C 1FRGL 1QPXA 2K9UA 3ZL4H 1BWMA 4WO4B 4BQ9A 3EFDH 4QOKE 4IRZH 2WIMA 1S9YA 1YNLH 1BM3L 3O6LH 2VR5A 1IC4L 1KCRL 3JTSB 3DO7B 4XBPB 3RNQA 3LKRB 4LEXL 1I85A 1RJYB 5BS0A 4PJFF 4K94H 4ZOCA 3QNXB 4Q9RH 1QSFA 4BSVA 1QBML 4JY5H 5LAXB 5GS1A 5DJ2B 1G7IA 1DQTA 3FT3B 4YE4H 1AFVL 5FKAB 3C6LB 3T65A 3LS5H 3RTQB 4YXKL 1IAKA 5J3HC 2JJSA 1SMAA 1TZIA 5FYKL 4LPWA 4H88H 3RY5A 3IFOA 4IOFC 2EC9T 4FQ1L 4S1SL 1HSAA 3L9RB 3PGCB 5B21A 1A9EA 3TBTB 2AXHA 3MOBL 1HH9B 4S0TD 4KJYB 3OJVC 2V9QA 3H2WA 1CN4A 4PG9B 4ZS7H 3KJ6L 3GZKA 3GSUB 4G7YL 3NFNB 1P4LA 4U6XB 5I71C 1U8NB 5FFLA 4M8QB 3BPNB 4YPGA 4Y16C 1MFEH 3WFBL 4QHUA 4AEIH 4K8RH 4GW4B 3ARED 5HI3C 3PDGA 1FFPB 1UXWB 3BMWA 4GKZB 2Y07H 1DQQA 2OK0H 2IH1B 2CK2A 5LGHH 2R29H 1QEWA 3MUY1 1I1YA 3EUUA 4JREC 3RL2B 4ZSOB 4TN9A 3FT2B 3GFUA 5ID1A 5F1IB 1NANH 4L3EB 4RGND 2HKHH 2XZQH 4X99A 3SGDI 2EEAA 5ANMA 1ZVSB 4I0PA 2HFGH 4CVWA 3WL9B 5EU6E 1ED3B 4YNYA 5L0QC 1DUYB 1NCBL 3DX9B 4QTHA 2F53E 4NHUB 4XNQA 4R9HA 3ARFB 2IPUG 1QSED 4OLXL 1YJDH 2F19L 2FH6A 5HHOE 2VLKB 1S5HA 3D3VB 3I6KB 4OF0A 3FRUA 5CD3A 4OLUL 1MOEA 3F7RA 4U1JA 3MBEC 2WW8A 2R69H 4PP2A 5I1HH 3SDAC 4W4OC 1IQWH 4LNRA 3F7YB 4ZFFA 5IMMB 1D3CA 3RWIA 3LKPA 1U93A 2YK1L 5DD5L 5F71A 4DUWA 1JNHB 4HMDA 3VFTA 1JNLL 4PJFE 3BSZL 3WFDL 3QXTA 2W60B 4YHOL 1NL0H 3HLAB 1TVHA 4X7TB 3FOLA 5C9KA 2H8PB 4MHHG 5E99L 3KLHD 5FA4B 3JUYA 4QY8B 3MRKB 2R0LH 4LLVB 4P2YA 3DGGB 2ADFH 2VZOA 4Y5XB 5CUSH 1YPZF 2AGJL 3JTTA 3RHWK 3U0WL 4CVXB 3N0PB 4N9OB 5HHQB 3BI9X 5I1EL 4MB5A 5EWIH 2V2TB 5B38B 3PDDA 1HDMA 5CFHA 1DBJL 1T3FB 3RKDD 2Q76A 5IV2A 1SY6L 4IDJL 4OFYA 3MJ9A 4N8VB 2NY6C 3C5JB 3MXWL 3F62A 1MCIA 1VEOA 5MENA 1YN6A 3D0LA 1YMME 5C6PB 3S3SA 4YR6A 4I13B 4YGVA 2X1OA 1C7SA 2FLBT 4P9ML 3EZ8A 5J11C 1BF8A 4KTDL 4EIZC 1AXSB 3RZWA 1CFNB 4PJ7A 5C1MB 4UAOB 3TIEB 2ZUUA 1U3HC 4GXUN 2YPLA 5L2KA 4GAJL 1DBKH 2GK0B 4LVHB 1AQKH 3EOBA 5L7XH 1RK0A 3D0VA 1IL1A 2X7LB 1F97A 1PW3A 1X5IA 4F2MA 4MQXD 4MSWA 4GKNA 4NQEB 3QZWA 4APQD 4OIBA 1IC7L 1BX2B 3M17B 4OZHF 3MRRB 3WN5C 4LCUA 1EO8H 2CIIB 1T89A 3C60D 3NACH 4GBXC 5ITBH 4N0UE 1FYTB 3TNMA 3RL1B 4BQ8A 4DK3A 5JQ6H 3EGSB 3T0DA 1JGDA 1A7OL 3OX8B 3G08B 3QISA 5L9DL 1MCOL 3ARBD 3Q5OA 3BKYH 4BH8A 3N1GC 3DYMA 5D6DC 43CAB 3B2VL 4FZEL 5I1JH 1JI2A 4ZUTB 4ZNEA 2C7UB 4FXGA 1MCFA 1N0XH 2DL9A 4NZTL 4NKMB 3CLFL 5C0BD 1VADB 1MAML 3D2UB 1UYWL 4Y19E 5ESVB 5TFSH 3GO1H 5IVZA 3UPCA 2NY0C 2I5YH 1P53A 4JGMA 3MRDA 4K7FB 4NNPL 1OAQH 4OCRH 4M7LH 2BC4B 4XMPH 5D1ZC 3S98A 3FONB 5ICZA 3MJ6A 5IF0B 2Q87A 4KTEL 1JZ5A 2P8LA 1FNGA 3VW3H 4XXCA 1R24B 2Q3AA 4LLAA 5J13B 4EXPX 5DFVD 2XA8H 2GAZA 2XG4A 1HIMH 1PGRB 2EE6A 3DX8B 3PJSB 3HCVB 3LCYA 2DTMH 3WLWC 2B4CL 2G75B 3HZMA 1LK3L 2IADA 3IJHB 3O2VL 4OZFH 2V7NA 1IT9L 4PRID 1UWGL 4U1MB 8CGTA 1N6UA 2H6PB 1K9TA 4FTVA 3DRQB 5ACLA 2F8XC 3HPJA 3RKPA 2EXWC 3MREB 1A0QH 4M6ML 1WV7T 3LY6A 4OIIL 2OJEA 2I9LA 5JIIA 1DZBA 1T83A 4N5UA 5GSVA 1TPXC 3QDGE 3NIGF 3REVB 3WE6A 4XGZA 1IAIH 4JY6A 2XTLA 3F7VA 1J8HD 3G6JF 5FM5M 3QHZH 1MPAL 1D5MB 2YRZA 2PO6C 4JZNA 5GS3A 3FQXB 5EZLB 5DT1L 1QRKA 2G5RA 5GRVK 5C0IA 3AMLA 2H26A 5E9DD 3H7LA 4I18A 1F6AB 1SYVA 4J3UA 1G7JA 5F6IB 1OP5H 1LGVA 4NFBA 5F1NA 3K74B 3D9AH 3DHJA 1WZKA 5DZNA 2GKIA 3RVXD 2HJFB 4WFGD 3LKNA 3O9WC 1RUKH 3P4MB 2OXGA 1NCDL 4QHMA 2NPLX 3GSWA 4FP8L 3FFCA 3RUGF 43C9A 1CGTA 3G5XB 5DJZB 4H1LB 4X6EB 1F11A 1KN4L 4HFWA 1IM3B 4LL9A 4OGAD 4Z7UF 3PL6A 3VFGH 2CSPA 3MRGA 4CVZA 3P11L 5D7JA 4Y2DC 2ENSA 1NC4A 1N59B 4HC1A 5J6GB 3I3BA 4OZHE 4JDTH 3VRIA 2ERJC 5I8KH 2J5LB 2FYYA 1IILE 3KYOA 3MPCA 5T3XH 4XPFL 2VUOA 3Q0HA 1OW0C 4HIIA 1A6ZA 1D5BB 4GSDH 3H9YA 4GG6F 2PYEE 3DYOA 4RWYH 1C1EL 4K8RD 4QF1A 3RA7L 3TFKC 2LAAA 3BESR 1GIGH 1ZT1B 1RIVL 3RVWD 4DGIH 1EVTC 3U1SH 5J12C 1UT9A 3WYRA 4H8WH 1NGPH 1NCUA 3HR5B 5IJVB 1PZ5B 4RCAA 1EVUA 1OTTC 3AREB 3O2DH 4NQXA 3UXFA 3G6DH 5C3TA 4OZ4B 1MJUH 5DHVA 2P46B 3PWJB 1D9KB 1YYMH 3L7EA 1X3DA 1UZ8A 2FR4B 4M02A 1M7DA 2COQA 5F3HB 1KLGB 3TO4C 4HUUB 4I3SH 1PYWB 5KANG 3I02B 1OD9A 4NNYB 3JSSA 4RGNB 2A38A 4NT6A 4YC2B 1UB6A 1QRNA 1V3MA 1HWHB 1FZJA 1FC1A 4X4ME 1JI1A 3GMPA 3BAEL 1I8IB 4G42B 2X4QB 3PWPD 1ETZA 1HQ4A 3N85H 4Y4HC 2DYPA 4GW1A 3NIGE 4KZDH 3IKKA 4HKXA 1LQSR 4NJ9L 3R8QA 3P9MB 4B0MM 1EO5A 3CJJA 4N1CA 5HYFA 4RMUA 3UCRA 3V6ZA 1OL0A 2ZUVA 4IDLA 2VQUA 5DJDB 3U30C 5CEXA 2ICEB 5FOBB 2R4RL 1S9VB 2M26A 3ZHDA 4NKIL 5HHNB 3AFLA 2NW3B 3L1OH 4XP4L 2A9ML 2DDQL 3GJFB 2KZ1B 4LRIA 2FO1A 4KVCH 1F8TH 2IMNA 1IKNA 1XCTA 5GXBB 3RUGE 4W6YB 5AUMA 5GJSL 1J1PL 4NKOA 4NKDB 4RA0C 3HMXA 3VXQB 3CVIH 3UC0H 2HVJA 5GRZA 4EVNB 1K2DA 4I48B 5IP4A 1M05A 3WIIL 3GRWL 4X6CA 4Z7UE 4HJGB 1A6TB 4RGMC 4OF7A 3LIZL 1PAMA 3BDYH 1DQML 4B5EA 3ILQD 3RNKB 5JTWA 3FT4A 1CGXA 2QQKH 1AHWA 1ROWA 2R9HC 1I7RA 4JO1L 4ONOA 5BJTA 2YD4A 3DMMC 4YPJA 5SWZA 5TDOA 5HBBA 4U1HB 3FOMB 4OLZL 1ZGLM 5LXGH 3LQAC 3BIKB 4K3JL 2WUBH 4GG6E 3O6KH 1UADC 3ULUC 2X42A 5J9PB 4XVUC 5EO9A 2DIJA 5F9JA 4HG4K 5AYUH 4HIXH 4Z6AT 1AI1L 3BFOA 4ODUB 5E8DL 3CMOH 3VG0H 2ORBH 3HTLX 4G8EA 5E94B 4DW2L 3KLAA 4J3OC 2X9YA 4P23A 5DRWA 4PJXB 3CPLA 2XA3A 1JN6B 5K9JL 2A77H 4R0LA 5FV1L 2EDTA 1IGTA 5HI5C 2QSTA 4NO5A 3ZKMC 2VC2H 4J2XA 3B9KD 3JWOH 1YC7A 4N0YL 5E1HB 1MF2L 1EBAA 3GBNL 4PRPA 5AAMA 5KN5B 2A0LC 2V2XA 3D85B 1ZXQA 5GHWL 4L4VD 1Q94B 5CP7B 4LMQI 2VXVL 2NCMA 3BP4B 4XBGB 2ZUQB 4WWID 2FEDC 1BAFH 1ZANL 3BPOB 4QEGA 1JPTH 3SDXA 4XNZC 5E7FA 4HEPG 2GJ6D 3PHQB 1I1AC 4MX7A 5I30L 4F7CA 4Z77B 1MCKA 4ALAH 3MV7B 1HHHB 5FGBC 2BOBA 1A2YB 3MLSH 4O2CB 3ARBB 3RHWF 4XP9L 2VLJE 4ERSH 2FIRT 2JB5L 3CSPA 3P40A 1MHCB 1BEYH 2K7QA 4PJAA 1EH9A 2DWEA 4CADB 1ZWIA 5EBLA 3S6CA 5C0BB 1BZ9A 1BJ1J 1QA9B 4JJ5B 2P49B 3HAEA 4WW2A 4DZBA 4FG6C 2VLLA 1MCBA 2G9HB 12E8H 1ZHNB 3P77B 4TSCL 2B5IB 2F54A 3C6SA 1M7IA 2OTWA 4AH2A 3ULVL 4PY8J 5CBAA 3MLUH 5E03A 4U0RB 3V5HA 3T0EA 3HG1E 2H2SC 4OQ1A 3NABH 5FEBA 5C0ND 3T08A 1HSBA 2VABB 3KPNB 3CU7A 3B9DA 4NHCH 5DRXA 2DQIH 3AB0B 3VXMA 4M7JH 1CLYL 4M7KL 4OLYL 1J0YA 2DN7A 1OP3H 1MCSA 4LNVA 3AC0A 3A6CL 3P30L 1U8HB 5KVMC 1JYVA 3NCBB 2R8SL 4KK9C 1TQCC 1WFOA 4Z7NF 3S4SA 4OM0L 1F3DH 3O3DA 3UDWC 2IALA 4JO4L 4OM1L 1J1OL 3WO4B 3MZTA 5GGVL 2D0HA 1VFAA 3GMQB 3B9EA 3CC5A 4K9EH 4XVJH 4ZDHB 2CRYA 3UTTD 1BD2B 4ETQA 3UEZA 4ZOEA 4HD9A 1MHHB 3QQ3A 1S9WB 4BUGA 4YDJB 4YHNA 3P73B 2NY3D 4OBSA 1S8DB 4Z95H 3L3KA 1T0PB 5GQBA 1ES0B 3OKNA 3U4BL 2X1PA 1AO7E 1DQDH 1OPGH 1IVLA 4J3VA 1N4XH 3WN5B 3AS1A 5C2UB 4N0FA 3HUJA 1AIFB 1RQ5A 3DPBA 5FDWA 4JFOA 4OF8A 3V5DB 4X5WB 1I85C 2ZSWA 1YY8A 4JLRA 3OAUH 3TIDB 3S96B 4DZ8B 2OTUB 2XN9E 1IM9A 2JIXA 2EDXA 5HVGB 1INQA 5IESH 3OAYH 4JFHD 3EW3B 1AGBA 5CZXD 1UA6H 3HI5H 3V5KB 3RFZC 3O6FA 1WIUA 5I8CA 1ZLVH 3PWVB 3PIQB 3HE7C 4MDIB 4GG8B 4WTWA 3OKMB 1GAFH 2BHZA 4HDIB 4JJHA 2F74B 1GGIL 4LCYA 4JB9H 3VD7A 4K71B 1MWAH 5EZJA 3SKOB 2V5RA 5T5FH 4LARH 3VXRB 1RZ8B 1QNZH 1YMHA 4OGYH 2C4FT 5T33H 3GHBH 5DQDL 5ABDE 3JZ7A 1CGUA 3BIAX 3ARPA 2P5WD 5JOFB 4MLIA 5J1TC 1YECH 1FVEA 3IVKB 5JHDA 3VWJB 3MYJB 2AXFB 2EE3A 2W91A 2BSTA 4JM2D 2GQHA 4GLRH 4FABH 2BNQD 2YMXH 3H9HA 1R3KB 4I9WE 4RA3A 5D2LF 4PJDF 2O5XH 2JB6B 1DN0A 1M6OA 1VGKB 2AJUL 1ZT7B 4R90L 5B39A 5I15L 4Q9QH 4JFED 1RI8A 4PRHB 4EN3A 3KPSA 1U91B 1KTRL 3WO3B 1I8KB 4X8JA 3ZLQC 1B0RA 3O4LD 2YC1B 2E5EA 1GC1H 1RU9H 4M6NH 3C5ZA 4OKVA 2Q8BH 3VI3E 1AJ7H 1DQJA 1AGCB 4P5TC 5DQ9B 5BZWA 5BV7H 2KH2B 2EH7L 1CICC 3TT1H 5EOTB 1EO8L 1XF4A 1OQOA 4F7MB 3HPLB 3O8XA 4M9OA 1T1YA 4Y5YA 1I4FB 5D72L 1EHLH 1KFAH 1RHFA 3OJ2C 4Y4KA 2XWTA 5EC1B 3KGRA 5FCUH 2ZPKH 5BXFA 1KSRA 2YA0A 1MQKH 5KVFL 3T2NL 4L3CA 2LVEA 5HD8C 3TBVB 3WIHA 1RUQH 1NMAH 4MQSB 1T22B 3DLQR 4N8PA 1UGNA 4OV6F 1KJ3H 4IS6B 1GJIA 3D48R 2VDML 3KPPB 4LCWE 3D39E 1FAKT 1M1SA 2GY5A 1VACB 2IBGA 3VFRA 3U6RB 4OCRL 2AEQL 4QRQA 2FX8H 3MRBB 5LGJA 2ZUWA 1GXEA 4PJGA 3DV4B 1AKJB 4ODHH 2XA8L 4R97B 4MMZC 4P59L 4HUNB 3IU3A 2BFVL 3RPIB 1BLNA 5ETUB 4KJWC 4UQ3A 1ZVYA 5E6IA 3SJVA 3CXHK 3CCHA 1XF5B 4XPTH 3QIBC 3SCMD 5DYOA 5JIKA 1HXYB 3O4OB 3HC4H 2E6PA 3NZHL 5IQ9A 2RFXB 2GEEA 3IFNH 3OR6B 5C08B 2XTJD 4M7ZB 3W5NA 2Q86A 1OAZH 2WNGA 3CVHL 2QQNL 1FDLL 1JPGB 4P57B 4NM8H 3CUPB 3LQAL 4OKDA 4P2QA 4NQSB 1IAIL 3B9KB 2EDJA 1TXKA 4F58L 5DHYA 1FP5A 5FYJL 3ULUL 4KH2A 4OD2B 2ZP0T 3V8CA 5L88L 1YEGH 2P43B 3O3EA 1XF3A 4JFDE 4EI6A 5HYJA 3DX7A 5KSAA 1H5BB 3L5HA 4NPYA 3Q2CA 5H8DA 1FLRL 5F89A 2MJWA 2WINB 4HPYH 1N3NA 2AQ1A 1YNKH 2NLJA 4MNQE 3QEGL 5D2LE 4YBLB 2VZUA 2AABH 1NMBL 4PJDE 2GJ6B 1RUKL 2X05A 3DXAB 4QHLA 4CW1B 4LSPH 2MCG1 3F5WB 1T89C 4KKBD 5T3ZL 3QUYB 3U9UB 1OSPL 2CDGA 1JMXA 5E7BA 2VZSA 3MCLH 2EDOA 3QXWA 4FFZH 2E8YA 4HIHB 1KIRA 1ZT4B 3ZKXC 2HLAB 5EBMA 2FATH 2V17L 4JRYD 2PXYC 3QNYA 1XGTA 4AM0A 5FYLH 3TA3D 5DK2B 4MA7L 4G8GD 4GKOA 3UO1H 1F00I 3BOVA 3BH9A 4XHJD 4EZMA 4OZFB 3VGAB 1ZKAA 1IGCH 1FO0H 3EFFA 1PQZB 3F6LA 3G9VA 4HK0A 4U1IA 5FYKU 4KROB 1NCCL 3UPRB 4KU1A 4I5BB 1MRFH 1NGYA 3MNWB 3ME0A 3RRQA 2X6MA 3CVHB 1JTTA 4NRXB 3UTSD 3BP6A 5GSRB 1CE6A 3QCTH 4ONHA 4S1RL 3JWDH 3WSQL 1BOGA 4HIEA 1K5NA 1PFCA 4RMSA 3MLVL 2D03H 3DTXA 3HS0B 1R5WA 4G80A 2J4WH 3G5ZA 4HSQA 3KAAA 1ACYL 3TVMB 5H2BA 1NLDH 4N0CD 3I50H 3MA9L 2VE6A 2OYPA 4P4KB 4CL7A 4ENEC 1KCLA 3N9GH 1MJUL 5A2IH 5DEZA 3EO0B 2C4XA 2FZ3A 2E9WA 4HS6A 4HUXA 5B3NA 4U1KA 1T83C 4AEHH 3IYLW 1D5XA 4JPWL 4TUOA 4D3CL 3X3FH 4JKPL 4P3DA 2ARWA 4KDVA 3CDCA 3UTTB 1XR9A 1CU4L 3GMRA 5FB8B 1MEXL 3QQNA 3HC3H 2EIZA 3UJJL 2ITDA 4P2RB 3ZDXF 4WEBL 2A74A 4UTBL 1D5IH 4FQIH 1A8JH 1BBJB 4LLDA 4BUHA 1HEZB 5IVNA 2AEPL 1W0VA 4L4TA 1RZGA 2EDWA 3QFJD 1CQKA 2LAGB 4FFYL 3W9EB 4AIOA 2A6JB 1I1AB 4TTDD 3FCTA 3VJ6A 4DVBB 1NUDA 2AV7B 3LRSB 5DUML 2R2HB 1T1XA 3AM8A 1KPVB 4WU5A 1K4DA 5F6HJ 1XIWD 3W39A 1J18A 3MRCB 1A7PH 2FD6H 3LHPH 4J6RH 5D7JC 1U3JA 3TPUA 3BEWA 1WWAX 3RZCB 4P9HH 4UV7L 3SE9L 1AGDA 4GMTH 1SJHB 3ZYZA 1GRWA 4NN5B 3LAFA 1V3LA 3SE3A 5EOCL 5GRJH 1N7ML 2VJXA 5FCSH 1IGYB 4H0IA 4RFEB 1FYHB 2QQLL 1T0MB 3OKEA 5F7UA 5DURB 4ODSH 4P2OD 1D6EA 2GCYA 3LB6C 4KXZI 5D7LB 3VXSA 2FEEL 2HFEA 4L3EE 3PP3K 1NUGA 4U2ZA 4J8RA 4FQXD 2E6QA 5ERWA 2VDOH 2WUBL 3IRPX 1Q9WB 4JZJA 4K3GA 1Z0MA 4RMTA 3BRDA 1KTKE 2E3VA 2MQCA 1UACL 2C5DC 1FE8H 3VE0A 4V2CB 4D9RD 4WWKA 1ZE3C 1UKSA 2VLKE 1Q9LA 1KUMA 3D3VE 3VG0L 2ORBL 5IBTH 1EEUA 1P7QA 1IAII 3WNNA 5CINL 3I75B 4G5ZH 2VRAA 3PNWB 4IMLB 2DMCA 4JFEB 4PJEB 1SVCP 1R6VA 3MRLA 2EEBA 4DGVH 4ZUSA 2OTPA 2LV4A 5CWSB 3RDTA 5JHLL 2QSCL 1BFVL 3KXFA 3O4LB 4ZPTA 1BQHA 2LFGA 2YR3A 3IDXH 5DDHA 5FXCH 3RNQB 3ARYA 5I8OL 4PYHA 3ZDXE 1TZHB 1KC5H 3FQUB 5BS0B 1QSFB 5FV2A 4A6YH 4ALAL 5GS1B 3CFDB 2VL4A 5KSUA 2JCCB 2W38A 4LRIC 4JG1L 4R7DB 1L7IL 1TZIB 1MI5E 4WEMB 4PBXA 1OARL 4ERSL 3IFOB 3QAZC 2Z92A 3RGVA 2VDRH 4NC0B 1HSAB 2HA1A 4XCFH 1A9EB 3UPAA 2O5YH 2VXQH 3IJSA 4B50A 4YHIA 4MA1C 4NC1C 4CRPA 4LHUG 1U2HA 4WFHD 4Z0BH 4E9LA 1NC2A 1CT8A 1AHWC 5EO0B 3CFKB 4XPGL 4GRWH 1U8KA 3QEHA 3RWEA 1P4LB 1XGPB 5T1DL 3KLHC 2FO4A 4QRPE 1RFDL 4OAWA 4YPGB 1VFUA 5CKAA 1FNSL 4QHUB 2GY7B 4QHKJ 5HDOA 1FV1B 2VXUL 5KJRH 3QUZA 3UTQA 4YHKL 4HFUL 5DK0A 2JJTC 3QQ9C 2DBLL 4YBQC 4L8CA 1DQQB 3QCUL 2OCFD 1UQSB 3Q1SH 2XTJB 1QEWB 3E6FB 4X6BB 2O5ZL 3QIUD 3UTZA 1NEUA 1CFTB 3RBGA 3RKDC 1Q1JL 3K4DA 4M1GH 2FH8A 3SDYH 4G8FA 4X99B 3S36H 3FKUS 5ANMB 4I0PB 4R0LC 2Y25A 4YNYB 2KPNA 1OGTA 4NWTL 4UZGA 4JR9L 3VXTA 3MJ9L 1V7NH 5HTSA 3SGEH 1NMCB 2VMFA 5MEQB 1JF5A 4G9DA 1OSZA 3GKWL 2EXYD 5H35A 3NGBC 1O0VA 2VL5A 2R56H 4HWEL 3FRUB 3I6GA 2CUMA 1K4CA 4YEFA 4U1JB 1KTDB 1JGVH 3DUSA 4RAHA 4FZ8H 5FYLD 4H20L 4APQC 4AY0A 2NX5D 5EPMA 4PP2B 1GGCL 5KW9H 3GMLB 5D1QD 3K2UL 3M8OL 2Z93A 1EMTH 3LEXB 3BXNA 4PJHF 4LNRB 1JNNL 4U1SA 1EFXA 4EOWH 4JRYB 2FX9L 4ZFFB 3RWIB 2WMPA 3C60C 4NFDA 1KIPA 2XKNB 1OAYL 3V4VL 3MUGB 3TA3B 4ZUUA 5TGBB 4G8GB 4CKVX 1OLLA 4IIQA 3VFTB 3HNVH 3D6GA 4YHLL 4NUGH 5AD0A 3QNZA 4WW2C 4UOW0 5ISZD 1F4AA 1Y6KR 5I17B 1R3LA 5IB3A 4G6AD 4TULL 3K46A 2WWMC 3TJEH 4S1DD 4MS8D 3SQOL 2BNRA 5E4IA 4WU7A 2CO7B 3L3JA 3EYOA 1GOFA 5FGCB 4B7IA 1PY4A 25C8L 2PCPA 4PRNB 3CH8A 3T0EC 4OCSH 3BYTA 3BGAA 2E7LA 2EIDA 2FEEI 1CDHA 4YHPB 3VFOA 3JTTB 3V4UH 1U0QA 2FGZA 1MWAL 4LGSB 3TO2B 3MR9A 5DJCB 1DQLH 4C56B 3CH1A 1A47A 4Y8DC 1S78D 5T5FL 4F3FA 4PGCA 4M00A 2YD8A 2Q76B 4NZJA 4CU8A 5IV2B 4KK8D 4LGPB 5C09D 3VA6A 5HYSB 5MENB 3D0LB 4YXLL 5H37G 4LSRL 3IDIA 2ZG1A 4YR6B 2NYYD 4YGVB 4NJAH 4P3CH 3BIBX 3V8OA 5D7SH 4D0BB 2VR9A 2AJXH 4PRDA 4PJ7B 3V52H 2X2YA 2YPLB 3UJTL 5TQ2L 5L2KB 1MUJA 3BGFB 3QBTB 5J6HA 1TJGL 4BFIA 1FGNH 1A3RL 4EDXA 1IL1B 1MVFA 1T4KA 2AJSL 2WUCL 2Z31A 4WHTA 4HCRL 4MSWB 3QZWB 3QFJB 5SX5K 2BVOA 4W68A 4CDGC 4GXUM 2IBZY 2CKBA 3AAZA 4K94C 4FXKA 4JFXB 4LCUB 3U7YH 1MFDL 2BSED 1OGAA 4QYOA 2YPVL 1MJJA 1AJ7L 4IHOA 5I1LB 4P5KA 4WV1A 4DN4H 4LAQH 5J56B 3OKDA 5B38G 2MSPA 4BH8B 3FB8A 2CKNA 1KFAL 1U9KA 4HWZA 1MWAB 4FXGB 4OGAC 1NUNB 4FQQA 4CN6A 3H8NA 3B6SA 1UH4A 1TQBC 1MQKL 4NNXB 4JN2A 5DJ6B 2HTLD 5IVZB 2CUIA 2XZAL 1JF1A 4PJHE 3O6FC 3MRDB 2VLRA 4MYWB 4TYUA 5ADPH 1J10A 1PKQB 3CFEA 5ICZB 1QRNE 4HBCH 4X5XA 2P8LB 1FNFA 1IBGH 2DQTH 1J0ZA 2GAZB 3GSNA 1AC0A 3MYZA 3QJFA 4YWGL 3RX5A 4UNTA 4RGNE 4ZTOH 3WKMH 2EKSA 2X4NA 4FQXB 5HDBF 2V7NB 3H0TA 3RVWC 2DM2A 1VDGA 3ARDD 4FTVB 2X9XA 3QCVH 5EC2B 1OP5K 5EU7C 5FUOH 3HPJB 4LSVH 1MCNA 1QSEE 4LVOB 1V3KA 5JZ7C 4MXQC 5GSVB 3DETC 3UZVB 3WE6B 5KVEH 4HBQA 1I3UA 4XGZB 4ESKA 4KRLB 4V1DA 5IM7A 1EDQA 2I9TA 2HWZH 3FB5B 4BA8A 1IEHA 4JZNB 4KQ4L 5E2VH 2APBA 5T1LD 3QO1A 5EH1A 3ROOA 3X14A 1DLFL 1I9EA 4I18B 4YX2L 1KLUA 2B1HH 3NPSC 5DRZB 4Y1AA 1CQYA 2WWKO 5F1NB 1KCVH 1K8IB 1YEGL 4E5XB 3VRLF 1LD9A 4YGAB 2HRPH 1DEDA 4EN3C 3LKNB 1BGXH 4Z8FH 3FFCB 43C9B 2QR0A 2DRUA 3MLYL 4F57L 3LH2L 3C5ZC 4MD4B 1L6ZA 3S34H 1MHPL 3MQIA 3SKJL 2Y5TA 4HFWB 2VR4A 1VPOH 5BW7A 5SWZE 3LKQB 3PL6B 1QQDA 2B8OT 3MNZA 4PV8A 4CVZB 3T0XA 3O8XC 4Y5YC 5D93B 1ADQA 4Y4KC 2G2RB 4KMTL 4OF5A 4PD4J 4U3XA 1MFBL 1Y6NR 3GI8L 1HCVA 1KOAA 1WCBB 1A9BA 2FYYB 3KYOB 4LSSH 1VKXA 1MRDH 4OZGA 4JPVL 5DUBA 5F9OL 5D96B 1DEEB 3INUL 2G60L 4WI9A 4Q9BA 1WZ1H 4F9LA 4XAKD 7FABH 4QF1B 1IGCL 3OV6A 4FQLL 5CBEA 4K7PY 2W0KA 3ARGA 1S5IH 4TPRL 3RAJH 2ICWJ 3SDDD 4NCDA 3MODL 2AI0L 4OGXH 1J5OL 4J1UA 5E2JA 5IEKA 3TYGH 2X4TB 2V9RA 3MV9A 2DLGA 3HMXL 1UCTA 4DKFL 3EHBD 4MQ7A 2RAMA 5DHVB 1RIUL 5E6IC 1XR8A 2J4WL 4TVPL 4B53A 3VRJA 3HNSL 3NN8B 1M7DB 5KSVB 4XC1H 1ZHBA 3MJ7B 3LN5A 4HUWA 5CP3H 3T04D 3W81A 3ARQA 4CDHA 4QHNB 3P9LB 4HPOH 5HDBE 3RVVC 4NT6B 3J7HA 1JTOA 1JK8A 1GH7A 1CLZL 3PE9A 1FZJB 1EEZA 2AJ3A 5K9KB 1QLEH 8FABB 1ETZB 4JHWH 2IWGA 3BZFB 1C5BL 2F58H 3I3DA 2VXTH 1V7ML 5KSAC 4YHZL 1VEMA 1C5CH 1D6VL 3LOWA 4YH6A 4PTUA 1BJ8A 4FQIL 4YK4B 4GT7A 3PG2A 5CEXB 1X5XA 5CD5C 3BDBA 3H7BA 3ZYOA 1REIA 2KQNA 3CXDL 2BRRL 3DSNA 3T0EE 1FG2B 1WBXA 3VRLE 4ZD3H 2IPKB 3X11A 4KJQC 3X3GL 1P84K 5KSBA 3QDMA 4PB9H 5FUZL 4QRSA 3WEXB 3WS3A 2EDHA 5AUMB 2APWA 3G5VA 1RZFH 4NKOB 2LTQB 4CNIA 1LNUA 4IRJD 2ADJA 5CJ5A 1KEGL 1M05B 4PJ9D 4PRIE 4W4NA 4X6CB 3BN9D 3ARWA 1Y18A 2KL6A 1HKLL 1LDPL 2OR7A 3CK0H 5EUKA 1LO4L 3B9AA 1CK0L 4MJID 2IANA 1H3UA 3DV6B 1BIHA 2C26A 1FVCB 4JAMA 3OG4B 5HGHA 2UUDH 4PB0L 5BJTB 2ICWA 2E9IA 4NGHH 3GNMH 1J8HE 4O58H 1UEYA 1ZTXH 2QSVA 5DC0A 1DVFA 2BNUB 3P4NA 1X5ZA 3NPZB 4JFFD 3ZHKA 2HKFL 5GGTA 3AU1A 5E9DE 3EYFB 5JR1H 1EJ6A 3KPRA 1IFHH 2KQMA 5C0NC 5F9JB 1BFOA 4GS7C 1JL8A 4FNLH 1AGEA 3LKSB 4ZYKA 1SJEA 4NN7C 4WFGE 1XGYL 4Z7VA 3KLAB 1ZGLB 3OJDA 4P23B 3GGWA 2GT9A 2YPKB 1IGTB 4NO5B 3QPXL 2QJDA 5ILTL 2BRQA 3QFDB 1YY9C 5IW3A 5EORH 1T7YA 5INCA 1X5KA 4ZFGH 4PRPB 4ZQKB 4RBPH 4X6DA 2YD9A 2OL3H 2YSSA 1P6AB 4ZNCD 4L8SB 5GGQL 1YQVL 2XPGA 3VXUA 4HGWB 4NBXB 1EERB 5HGBA 3SDXB 2V5MA 5FGSA 3RY6C 3OPZH 4AG4L 4MX7B 4IMKA 3JV6B 1SEBA 2AJVL 3EBAA 4MMXC 2BOBB 1ORQA 4GQPH 2DQDL 3AM8C 4YDVA 5JQHC 2YWYA 1JHTB 2DQJH 1FLTX 2R1WB 5JMOC 2AK1H 2IAMD 5EUOF 4NRZA 5TPWL 1YYLH 1B0GA 2Y4SA 4PJAB 5IROA 3ORJA 5IW6A 5J0BA 4LCIH 5GRXG 1BZ9B 3HR6A 2EH8H 1KCUH 4TNVK 4HQQH 1A6VL 1NCWL 5E8PA 2EYRA 4XCFL 5DA0B 2YD3A 1FQ9C 2F54B 4O5LH 3C6SB 1OP3K 1ZLSH 2OTWB 3W9DB 5I19H 3QH3A 1ZLWH 2R23A 4WUKH 4F9PA 5JDSB 4LSTH 4H8WC 3VFNA 1Z5LB 1EPFA 5IBLD 5BO1L 2CIKA 2PNDA 4I0KA 4MNHB 4LSQH 3QHTC 2XRAH 3W0WA 1ZA3A 3S35X 3WLBA 1HSBB 4U2YA 4LFHD 3NAAH 3CFJA 3NCYS 5DRXB 3N1FC 4PRBA 4F15C 3VXMB 1L0QA 2C3XA 3A67L 3PWPE 3O2WH 3IFPB 5CJ8A 1ZOXA 4KKCC 4JKLA 1HKFA 5DLMH 1CS6A 4ODTL 3T4AB 5B3JF 5E00B 2FJHB 2IGFL 5BRZA 4ODVH 3LS4L 3S4SB 4WWKC 3U2SA 4M1CC 4PLNC 2IALB 4HLJA 3OWEA 4FMFA 4KK5C 4KGJA 5CCKL 4M9PA 4RQQA 1VFAB 1VFBA 3PWNA 3SDYL 3CC5B 3Q6FB 4JM2C 4OI7A 2LU4A 4OLWL 4M5ZH 1U58B 2X4UA 4YHNB 4KZEL 5D7IA 1WUNT 2DJSA 4FFVC 4IJ3C 2EIBA 4NM4L 3WV0A 3L3KB 2KKQA 3OKNB 3RDTC 3ZKND 3OAYK 4DKDC 4YFEA 3ECBA 5C0RL 3GKZA 1LP9A 5DQJA 5F7YC 3HUJB 1XAUA 5FDWB 4JFOB 5IB1A 3VFMA 1ZLVK 5BVPL 5CZVL 4J23A 3EDEA 2CRMA 3D69B 2ZSWB 5DRNB 5C0CD 1YY8B 5I1CH 2NMSA 4JLRB 4QTIL 4OZIA 4I3RL 1OF2B 4H5SA 5FK9B 4NCC1 5C70A 2JIXB 1I9RL 3ALPA 5ENWA 4F7EA 1DDHA 4L8DA 5HVWA 5CJOH 3C08L 1WZLA 4KPHH 4R4NC 3RGVC 1AGBB 2AJYL 2ZSVA 3O6FB 2XWJA 3EYSL 3BKJL 3E6HA 5EUOE 4JDZA 4AMKL 4UILL 1W72A 3S35H 4P2QE 3SDDB 1QFWL 3MOAH 3FN0H 3CLEL 1A4KA 5EZJB 1WITA 5DD0H 3OKKA 2DQEL 1YMHB 4QCIA 3T4YA 4XNYH 3V6FA 5E8NA 3WIHL 4PV9A 1I7UA 3VXOB 4AEFA 3QUZC 4JFZH 3WIFA 3PGDA 2VZVA 3RBSA 1EGJH 5KS9B 2JTDA 2AERT 4HJJL 2EDNA 4L4VE 1FVEB 1HN1A 5D6CA 3SY0B 5JHDB 4HT1L 4G8IB 5C0AA 3GIVA 5I1DB 4PS4H 2J6EA 3JWOC 4YDIH 3H9HB 3VWKD 3P0YL 3VGEA 5IMOB 4RZCB 1G9NL 3M1BB 3AMKA 1DL7H 1M6OB 4LIQH 4OFIA 1PBYA 5IFHH 1RJLA 4MD0A 5B3JE 3IDMA 5DA4A