4ZSOE

Crystal structure of a complex between b7-h6, a tumor cell ligand for natural cytotoxicity receptor nkp30, and an inhibitory antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
217
Chain Sequence
SMDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a complex between B7-H6, a tumor cell ligand for natural cytotoxicity receptor NKp30, and an inhibitory antibody
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Antibody Light Chain
total genus 39
structure length 217
sequence length 224
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zsoE01
5C3TA 3ABZA 4MVBC 2B39A 1KTRL 1DBJH 1NDMA 2GSIA 4FQHA 5I2IB 1E4XI 4DGVL 3E8UL 1CFTA 4NRXB 3EO1B 2P49B 3IDIA 4ODXB 2HKFL 3QEQA 4NP4L 5ILTH 3B2UC 1VFMA 3GMNA 4M62H 1EHAA 3HZVA 5BV7L 3UBXG 3BEVA 4PRNB 5HVHC 4GG8A 3AREB 1FL6A 5KSBE 1CFSA 1TNNA 3GGWA 1AO7A 1X5GA 5IVOA 4WY7L 1WIPA 2HKFH 1N6UA 1KPUA 2OR8A 5DFWH 1ADQH 1KFAL 1KN4H 2FX7H 5EG6C 3DO3A 5E4EC 1RD6A 1T1XA 1OP5K 4YK4B 1RJCA 2BVOA 5F88A 3GSVA 3MTRA 4R2GC 3P0GB 3QDMB 5BS0B 2WWKT 5DK3A 3RFZC 5LCVL 3D39D 3REVB 4PJGB 3SE9H 3EFFB 3BP7B 3BKYL 5GIRB 5E94B 5GIRA 5ALCH 5F8RC 2E9JA 4PRIA 2FIKB 5EH1A 3FQUB 1FC2D 2QSTA 4RISL 1WWBX 2XKSA 1W0VA 2EYRB 3LAFA 3SDDB 4ELMF 4YXHH 5DJ8B 4JFEB 2CKBH 1ZGLP 4OT1H 3MLVL 5K9JH 3GIZL 2FBOJ 4LCCC 1N8ZA 4M5YL 1A9BA 4X6EB 1CD1A 1NC2B 4JHWL 3E6HA 3W9EB 4L8SB 3MV9E 4X5LA 5CLWA 5E03A 2XWBA 5TF1H 4CVZB 1RI8A 2AABH 3EOYG 3RUGB 5JW3H 3IS1X 3UPRB 3VFUB 1OARH 4LCCA 4ORGB 3P40A 4GQPH 5D7JB 4APQA 3VJ6A 3LV3A 2MKLC 4JFQA 4YDKH 2EDOA 3MLRH 4U6VL 1NCBL 4JRXB 1ZANL 1XGUA 1G7HB 4XBEL 2XY1A 2NY5C 1N8ZB 4CMMB 4RGMB 4HEPG 1GGBH 3DMMB 4XI5D 1IGJB 5IB4A 1VENA 2E7MA 3FO2A 2CKBB 4PJ9C 3TV3L 4LHJB 1CFNA 1DSFH 1QA9A 4BZ2H 3EYOA 5GS1B 4KKBD 4QRPD 2COQA 1HYSC 1EGJA 3BPLC 1MFNA 2VITB 43C9B 3QPQC 1TJHL 1FVEA 2AJYH 5IB2A 5K9KB 4PJ9A 1YEFL 4J8RB 3DUUA 3BHBB 4RX4D 4DOHB 1S7QB 1GRWA 1XGUB 1OSPH 3O6FA 2DS4A 4OI9A 1NLDH 1JGDA 3H3PH 4UIKL 5IK3B 2DYPA 2VDKH 3WKML 2NY6C 4GG6B 3BD4A 1RJZA 1YA5A 4S11A 1DTUA 2F54E 2XZCH 5FIEA 4ELME 4NZUH 5J06A 4Y4HA 1OAYH 1F4XH 2UVEA 1R3KB 2YUXA 1JMXA 1WZMA 1FVEB 2OX5A 1E27B 1ZLWH 1TTFA 3PQYD 5C9JA 4KKBC 2OBGA 3OAUL 5T1LB 3N50A 1G9MC 5I1AA 3D85D 5FO9B 3QIWB 1A7NH 3LQMA 5DK2B 4HEME 1XGQA 3QHFH 2R23B 3SDAB 4KTYA 1B2WL 3GMMA 4KRLB 5I0ZA 1MY7A 4XTRD 1ORQB 1HSAB 5LG1A 5D5MF 5ID0B 3VD5A 3BISA 1JF1B 5ICZA 4MJIB 3QHFL 1F3DH 5EC1B 3UTTA 4LIQE 5DJAA 1KACB 1A7PH 3PXHA 4G8EA 1DQLH 5FGSA 1JWUA 4UV4H 4ZTOL 1CLCA 4ODTH 4QO1A 3TBWB 3WHE0 4UIMA 2I9LA 4ZDHB 3FB6A 1HHHB 2DMKA 5EZLB 4OGXH 3HMWH 3MOBL 2PTUA 1GGIL 3PWPB 4PRNA 5F1IB 1QFWH 2IH3A 2ZG1A 1BOGA 1OTSC 1X5FA 2RAMA 4HFWA 2GY5A 1C08A 4L4VD 1AI1H 2NX5D 4HFUH 1QLRB 3PDOA 1KG0A 4JFHD 5DWUH 1NLBH 5EPMA 1KJVA 1YPZA 2GK0A 1VKXB 4OD1H 2IH1A 4N68A 4QWWD 2HP4A 1LGVA 1J0ZA 2AJVL 5C2BH 2ATPA 2EEAA 1VGKB 1YDPB 3EAKA 4OAWA 4TUOA 4KVCH 2FYYA 3TP4A 1NCAL 2R4SL 3V0WL 1W0VB 3H2WA 3IF1B 8FABA 4PP2A 4LCWE 1XEDA 1XR9B 5DJ2B 1E6JL 2XZAH 1IAOA 3BZ4A 1TJIH 4QYOA 1FZOB 4R97C 3EO1A 1DBBH 2NY4B 2E8ZA 2R39A 2IAND 4LK4A 3AM8A 2LAGB 3G9AB 5E8NB 3VG9C 2HN7B 2Y5TA 5C0JA 1LD9B 1KCSH 1FDLL 1KT2A 1JK8A 3HI1B 2OK0H 1ED3B 4JY4B 3BP5B 2GKIA 4JZJA 1XGYH 4MMZC 5EN2B 1A7QH 2LU3A 4UDUB 5C09D 5KANG 3SCMA 4YHNA 5GS0C 3NPSC 5JTWA 3DX6B 3T3PF 2NXZC 3FT2A 4P46D 4HWBL 4R3SB 4K3JL 1CGYA 2V2XA 5GQBA 4XPFH 4MCYA 2BVEA 3I84A 4MCZA 1U3YA 1FAIL 1IM3A 1R3LB 3AC0A 1IAMA 5IV2B 2HJFA 4QLRA 5T33L 1Z0NA 2W92A 2CO7B 3KPPB 4LSRH 4XCCH 2FDBP 2YD1A 5SWSE 3QZWB 2E6QA 2YD6A 3WKNA 4GKNB 4GRWF 4UT7L 4YX2H 3DX6A 2NTSP 2VDQL 3QRGH 3SKJH 5SX5H 5KAQF 5A2IH 3TBTB 3BVNB 3QDME 2VERN 4Z7WA 4K9EH 4HJ0C 4X8XA 1NFDE 5AG8A 2DLFL 2VLJE 3GHBL 4MA7L 3HE7D 4DJMA 4ODWA 4NFCA 1R3LA 5J12B 5JR1L 3NPZB 5C70A 4PG9A 5F1SA 1I7TB 1MCJA 3NACL 1SJVA 5D7IB 4X4XB 3CGTA 1HXYA 1I1FB 3MV9D 2F8VA 1WITA 1S7VB 3U4AA 3RZCD 2EDQA 1I1AD 4PPTA 2FJHA 5TDNB 3CFJB 2V2XB 4JG0H 1BP3B 3ZDYF 4QTIL 4HV8A 1MFCH 3GJEB 2W9DL 1N64H 3VDBA 3HB3C 1FO0B 3HC0A 1B0RA 1EFXD 3IETB 5MEOA 1CLZL 4YBLC 5DQ9B 2BP3A 2QHLA 4M61A 3LS4H 5FKAA 4OIIH 1J8HD 5H37G 4NO3B 2VQTA 1L0XA 4XCNB 3FFCA 3O3BA 5CWSB 3OJVC 3V5HB 5D7JC 5BRZE 5D1XA 4GOSA 3K2MC 4GKSA 3CFEB 3IXTA 4O2CB 5TDNA 3MRNA 3FRPG 3PABA 1N5YL 4X6DB 2BRQA 5IFHH 4JZOB 3P3YA 3LKRA 3L9RB 3PQYB 4P5TD 1EO8L 1KLUA 3UP1A 2EEBA 3G5XB 3LS5L 4UU9B 3INUL 3H9HB 4RAUA 1RIHH 1FE8H 2Y36L 3PGDA 3WFEL 3JV4A 3RVUD 3BZFA 3DV4B 4F33B 3RP1A 1V7MH 1I7RA 2J3SA 4YDJA 3B43A 3NFSL 1WFNA 4AEIH 5I1KH 3KNBB 3W5MA 4NN7B 3WNKA 5I1HL 4W4OA 2AP2A 2Y9RT 2APTA 3DRTB 1LHZA 4PRAA 4WDIB 4XMKH 4XP1H 3HPLB 4NM4H 2A6IB 3H9SB 2PW1B 2ADIB 4EI6A 3C60D 1FNAA 5FXCH 1FYTE 4ZD3L 3M17B 4KJQC 2BNRA 2YD5A 4X6DF 2YK1H 2I26N 3UPAA 5EPMB 1MHCB 3V7MA 1F90H 1LEIA 3FT4B 3FFCB 3V5DA 3CXHJ 1SJHA 4Q6IC 1I7UB 5H37H 1MFBH 3U4BL 5KJRH 2MPAH 1G6RB 1UENA 5IEHA 1A2YA 5L8LB 1ZLSH 4XPAH 4WHTA 1U95B 32C2A 4M5ZL 1HN1A 1QR1B 4PRPD 4R9HA 4NUGL 5CHNB 4D0BB 3KPSA 3O45A 2P8MB 5HJ3B 4WU5B 5CCKH 3RNQA 4NKMA 1EAPA 4EN3B 2GYSA 5T3XD 1P9MA 3ULSA 1Y6NR 3F58H 3HI1A 4X6CB 5SWZD 5KS9B 2FATL 5I8EB 5T5FH 1JWUB 4ZG1A 3ARBB 1QKZH 1KG0B 4FZ8H 4KGLA 1G9EA 3QNZA 4L4VA 5T5NF 5I1GH 3O2DH 5FB8A 1XIWA 3IFPB 1NSNH 4R4FH 2P5WD 5C0RL 5MENE 5CBAA 1EMTH 2EECA 1QSFA 3IT8D 1AHWA 2GCYA 2XY2A 5EZJB 2BVUA 3S37X 5EBLB 1MSPA 1K9TA 3QUXC 2NW2B 1JNHA 4O2FA 4XNMA 2DTSA 2A2QT 4NQDE 2XKNA 4MA3B 2G5RA 1GL4B 2B1HL 4WGWB 5IVXF 2L0DA 4LSQL 4LLMB 4HHAA 3BP5A 1HWHB 1ZS8B 2WLZA 1U92B 3V8OA 1IGCL 3TFKD 3HHRB 3SDCA 3O4OB 5I73B 4PP1D 4WNQB 3OAYK 2AEWA 2X9WA 1JMZA 1JFQL 2WANA 3WFBH 1C5DA 4XC1L 1QBMH 3LSOB 4NQSA 5LXGL 4U31A 3UYRH 3GM0A 5C0IB 1RJLB 4F7EA 3D9AH 5DHYA 4ZUUA 1TVHB 2DTMH 1OWWA 3O2WL 4JO1H 1AQKH 3MZGB 5F9DC 1NMAH 1S7RB 2YN3A 5FYJL 3G5ZB 3GMOB 4DKFL 1MCBA 4OZGA 1CZ8H 4GW1A 4KVCL 1J11A 1B0GA 4LVHC 2C3GA 1EHXA 1EBPA 3BE1L 1T03H 3RRQA 3E6HB 3D18A 3HFML 3T1WA 4PJCF 1TETL 4ODVH 1ZT7A 4S1SL 4X5WA 5FM4A 1RHFA 4QF1B 5L0QB 3CDGB 1J1OL 1DCLA 5F96L 1I7ZB 5L6YH 3WS3B 3ET9F 1T03L 3MRDB 4WO4D 2Q8BH 4APQB 3PG2A 4RGOH 1KOAA 1DQDH 4EOWH 4IOSD 2AI0H 2JCCA 5IBLC 4OM0L 4N0UE 1ZA3B 4G9FD 2ZOKB 1DQQA 2YXFA 3B9KB 2DYPB 4QY8A 3HRPA 1ZT4A 3QFDA 3BIAX 5DK2A 1T66D 2A1WH 4RA3A 1MCNA 1HHJB 2W60A 1N26A 5H94B 4JG1L 3THMH 4HF5H 4YXLH 4EQ3A 4FTVA 5ICYB 5JQHC 4X4YB 4DZBA 2BSED 1HQRA 4RFEB 4HKXB 4XHJC 4HKXA 3RWGA 5E2WH 2GHWB 3QFJB 4LASH 3MYJA 5I75B 1D5MA 4N5UA 1JRHH 1NEZG 3C6LC 5F6IB 2B2XL 3OKEA 3SOBL 4MXVE 3FHAA 2PYEB 4P48A 5I74B 4FQ2H 1DQQB 1IAII 4NOFA 3BXNB 4QRUB 2W0KA 2MTPA 5IK3A 4X7TA 4HUUB 1IL1A 3P4NA 1FIEA 5E2TL 3UX9B 1D6VL 5D6CA 3TIEB 2VL4A 3QDGB 2OTPA 1TXKA 1RJZB 4FRWA 4EI5A 3NOIA 1ROWA 4LSUL 1EFXB 1DDHA 4KUCD 4UINH 3U0WH 3D3VD 4F37K 4F9PC 3ME0A 1CL7L 1JPFA 5INCB 5C0RH 5ECJE 4ZUTA 1CDUA 1T1YA 2DQJH 5IMOA 4RAVA 2L7UA 4L4TE 1S9VB 3L5XL 1VEMA 2FBJL 4XNQB 3QNYB 2DLTA 1J0IA 1GPOL 2VTFA 3H42L 3W39B 1J8HA 1XR8A 4BSJA 1H3WM 3MXVL 4ETQB 3OGCA 1UXSB 2VC2H 4EXPX 1H3XA 4DGIL 4WW2C 2Y7QB 3TA3C 1T80A 3EBAA 5DR5L 1NFDB 4NKIH 4QHMB 3FZUC 5ICZB 2P5EB 4XMPH 2FL5B 3QI9D 5JIKA 3T77B 1JPFB 3U79A 3LN5A 1IGIL 3NCFB 2R29H 5FDWB 3R8QA 4YDVA 3VDAA 3KPRB 3DSFL 1DR9A 1PKQA 3LB6D 1U42A 2A74B 1OLZA 2E3VA 4TSAL 3E2HC 3MREB 5HI5C 1FVCA 4JGUA 2Y72A 1MF2L 2DM3A 4D3CH 2E9IA 2XXCB 3LKPA 2FECL 1P7HL 3NH7L 4ZOEA 2NTFA 3SJVB 1X4YA 3N06B 4LPYA 4WUKL 5INCA 1UKTA 4F58H 3MLPA 3W2DH 3QB7C 4TSBL 4GMTH 4UQ2A 3D69B 2CLZB 2FWOB 2P5WA 4HC1L 3D1MC 1WBYB 1JF6A 4ZAKD 4BKLB 4XAKE 2OL3H 1H0DB 3DLQR 4J3TA 4IRJA 1J7VR 1OY3B 1WWCA 4TSBH 3JZ7A 1YNKL 3BRFA 3OG4B 2CUHA 2ICWI 3KXFB 3H9SA 2JE8A 3GMLB 1NBQA 5C0EB 2VLMD 3H9YA 3T1FB 4GFTB 4ZPTB 1MI5E 4ODSL 4UNTA 1G6RH 5GJTH 3L6FA 1I85C 1J18A 1N6QL 1JZ6A 4X9IA 5KTEL 3T3PE 1LO4L 1CXIA 4H1LG 4LCWB 4LCYB 4GMSL 2R69L 1LEKA 2DKUA 1KTLA 3CSYB 4NWUL 4M4PA 4QHUB 3TBSB 3WIFA 5E94A 4C56B 4RWYL 2JCCF 2R1XA 3T65A 1MHPL 4KKCD 4K94H 4DZ8A 4LHUB 2AJXH 4NZDA 3KDMA 1HE7A 3HE6A 1KPVA 3O4LD 3CK0H 4ZTPL 1NGZB 5I1JH 4R6UA 2WUCL 1S5IH 4O51A 3RUGE 4L8DA 5D7IF 3NFNB 1A6WL 4WI9A 4OZHB 4PJCA 5IIEA 3CSPA 1KEGL 3JWOL 2BVQA 3WE6A 3DURA 4Z18A 3T0WA 3VWJA 4PJ5A 3O6KH 5T5NG 3V4VL 3ZKXB 1CG9B 2OI9C 3SJVE 1NUNB 5F7HA 3U7AA 3GKZA 1T66C 4WUUD 3ZYOA 4KZDH 4URTB 4OGAC 1KEGH 5H35B 3UJJH 4OCWL 3LKOB 3OAZK 2X5PA 3HUJF 4EXKA 5BCAA 5L2KD 4Q2ZA 3ZTNL 5LAXA 3U0PA 4X4XA 5E6ID 2J8OA 4MD4B 4NDMB 3MBED 1TNMA 1P7QD 2EO1A 3ARXA 4LL9A 5TQ2L 3GJFH 2HFGH 5D1XB 3LHPL 1A7QL 3FB7A 5DEFB 5EOQL 2BOBB 1R5IA 4QTHA 5D7SH 3B3IB 4DVBA 1OGAA 1S7UB 5IVXA 4PJFA 5KOVC 4K8RD 3SGEI 2H2SC 4AM0B 4OGYL 3P4MA 1FFOB 2HT2C 4LSVL 5ADPH 1G0XA 2E7LA 5EC2B 1HSBB 3QZWG 2HH0L 3MCLH 3QPQD 3B9KD 2YKLH 4M7LH 3CFDA 3GSOB 2Q6WB 1AD9B 2CRYA 5D1QD 3BGMA 3QQ9D 4RFOL 5C9KA 2KQNA 1N3NA 3ARFD 1MOEA 4J12A 1G7LB 1ACYL 4Z5RA 3SKMA 1MFDH 4OQTL 1PG7H 2F54B 3GIVA 1MRDL 4Y0GA 5CZXD 1HKFA 1CDYA 5ALBH 4LLYB 1Q94B 3GK8L 1ZLUH 1EJ6A 1IC5L 2F19H 1R24B 1H3GA 4BFBD 4DOHE 1WBZB 4OD2A 3NH7H 3TJHC 4EKXA 1NCCL 2D7MA 1QACA 2YPVH 1NBYB 1NMAL 5DZOA 4X6BB 3SKOB 5B39B 5EBMA 1EERB 4PTUB 3QEQE 1A6ZB 4HFUL 5HI5D 3DBXA 4X6DA 2DLGA 1UWXK 3HUJE 2OMNA 4PJXB 4JR9L 4HW6A 5D2LF 1MUJB 4ZXBC 4WW1B 4O2EB 4X4MA 5KVFH 3IDMB 3HAEA 5HYSB 1UVQA 3WFBL 1JYVA 3GBMH 3QJHA 2ESVE 1WWAX 3T08A 3HE7C 4NO3A 3OSKA 1IAIL 5ADOH 2NX5E 1VFBA 3MCKB 5TF0A 2H9GB 1OSZA 2ICCA 4BUHA 3FN3A 4KQ4H 3KNBA 1OF2A 3UYOD 3QG6A 3LMJL 3CDFA 5L9DH 5KANI 5I75C 4MD0B 2EKJA 1RUPH 3OF6A 1B6DA 3C6LB 3MJ7A 1LP9E 3MLUH 4M6AA 1EJOL 4HIHA 4NO0A 4PGDA 5DS8A 5AYUL 5HY9A 4XH2A 4GAFB 5D2NB 2GJZB 1CL7I 5DD6A 1NDGB 3HC3H 3D6GA 5ETUA 4N1EA 1IEAA 3A6CH 3BRGC 4N0YL 5CEXA 4L5FL 3RVXD 3HI6H 3MRJA 1AQDB 3CMGA 4DN4L 4LF3A 3SE3C 5TDOA 1ZTXH 5AWNH 3K1DA 5FHAL 4P59H 1H3PL 2C9AA 3MJ9H 4U1HB 4ISVB 1BVKA 4AL8H 3FCTA 5I1GL 1EH9A 1XF3B 3EYUL 4H8WH 4X8JA 1H9VA 5AZEL 1PKQE 5DJXB 2ICEB 1LD9A 5A3IC 5KW9L 4Q0XH 3V6OC 5DQDH 4DKAA 4M03A 3PWUA 5J9PA 1GGUA 4KUZH 2B1AH 4K3DL 5IHUL 5GISL 3VXUD 4MNHB 2BVQB 3MREA 3H9ZA 1U8QB 3MPCA 3BH9B 1U8LA 2DBLL 3EYQC 4FA8A 3LRHA 5KSUA 4ZFOL 4PJAF 3G5VB 6FABH 4PJBA 1MCLA 1A4JB 1MHHB 3LQAH 2FCBA 1M6OB 4EN3D 3JTTA 1A5FL 2VB5A 3KDMB 2VQ1A 4M6ML 4G8GA 4KRPD 4OZ4A 4RQQA 3QH3B 1M7IB 2P5WB 3VXMD 3VXUA 2V17L 1JGEA 5I1IH 4V1DA 3VGDA 4PJ5D 4M93B 4UAOC 2XN9D 3ARRA 5EU5B 5FEBA 1G0DA 4TNWK 4YHIB 4GKNA 1NGPH 3DTXB 5I1DB 1S5IL 3C5SB 4LEXH 4XCEB 2P8PB 3P0VH 3CK0L 4ZTPH 4Z7VB 1LE5B 4U6VH 5IJKA 3GB7B 1HIML 1LO0H 2NXZD 2WINA 1ZA6A 4A2LA 2W65B 2ZG2A 3JTSB 2JIXA 1IM3B 1OHQA 3GSWA 4EVNA 5L2KA 1DUYB 4C4KO 3WL9A 5IB1B 3PF2A 2BNQE 1P7QA 1IC4H 4DW2H 3HLAA 5CP3H 1BAFH 3U0PB 3IDGA 3O6FB 5F7FA 4NHUA 1LDSA 2X4OB 3KPOB 2LTQB 2Z0BA 5HHVH 1D5ZA 3WS6A 5I17A 1WAAA 2CIKB 4WUUB 1YEEH 4NZRH 5D1QC 2IAMB 4PREA 4OZHF 4G6MH 4G6FB 3FO1B 4S2SA 5F1OB 4YFEA 4X4ZA 1XMWA 1KCRL 1E4KC 3HPJB 2J12B 1KEMH 2EKSB 2JJWA 2Z35A 2VXQL 3QO0B 3P4OB 3QUZD 3O3AA 1AGDA 5C0BD 4BQ6A 2OQJA 4YC2B 5D7SL 3CVIH 2EDRA 5IW6A 1U6AL 5LAXB 1QFUH 5E8DL 1G7HA 3WCYA 5D1ZD 5T3ZH 4O4YH 5AD0B 1MCDA 4X7TB 1AP2A 1DBAL 4Q58C 1OQOA 4YWGH 1RSFA 3HI5L 3RZCC 2YUWA 3GSRB 1EMTL 1I1AC 4WO4A 1PG7X 4PIRF 3W0WE 3RUGA 3O2DL 2P5EA 4PJHF 3VXOA 1SBSL 4JFFE 3S88H 1G84A 4ZODA 4XXCA 3ZKNC 3I50L 4DKDC 1PLGH 4P9HC 1RZIB 1WUNT 4M6MH 3WO3B 1ZT4B 3QFDB 1T4KA 1DN2A 2O5ZL 4ZDHA 3V7AE 3L5WB 5DTFB 1T21B 1FZMB 1YPZF 4XB8A 1ORQA 3KS0H 4NM8L 4Y4HB 1TVDA 5DQJB 3PWVB 1RUQH 3ZKQD 2FL5A 5GGUA 4E5XB 1F90L 5C07E 4B7LA 4B7IA 4P3CH 3IJSB 4OJFH 4CKVX 5D1XC 3O41B 1LNUA 4Z7UF 5D2NE 1U2CA 3KYKL 5FECA 1S9WA 4EIZC 5IW6B 1W72L 4L8CA 4HWUA 4XNZC 3WUWB 2YD2A 3QUYA 3VFOA 2BHUA 4KGJA 5E95B 3L95B 3QEHB 4U0RB 5ESVA 1QBBA 5IKCA 5KZCB 4M6NH 3TT3L 1KIQA 5ESAA 3D3VB 4NJAH 1ZHLB 5D72H 1TMCB 1Y18B 3DRQA 5CEZE 1R3JB 4DVRL 5CJ5A 5DMKB 1QFWM 3ARQA 4HPOH 2VDLH 3B9AA 4KKLC 1QLEH 1OB1B 2SEBB 4PB0H 1SY6L 3KR3L 2JB5L 2D7PA 3S5LB 3OKOA 5KVDL 2OTWB 3CCHB 5CZKA 1RZ7H 1X4ZA 3V5KB 8CGTA 4NWTH 3PWNB 5CBEA 2R23A 4YGVA 1NGQL 4GQ9H 1CFQA 1B6UA 3HI6L 2IADA 2P24B 5I6XB 2AI0L 4DUVA 3LKPB 3LPGA 4YFLF 1Y0LA 3C5JA 3JV5A 4GG8B 2P8MA 3BIKA 1NC4D 4UTBL 2VXUL 4HBQA 1IQWL 1FZJB 1F6FB 4Z77A 1NUDA 1QO3A 3VRLE 2VUOA 3MGAA 3NABL 1I9IL 1RZJH 2BDNL 4H0IA 4LSSL 1MRFH 1E28B 3BZDA 5C7XH 1DQTA 2IJ0C 3HZMB 3C9NA 4M8QB 3HZMA 5D6DC 3CU7A 5FYJH 4N1HB 5CJXC 3IDNA 1RZJL 1SEBA 5DHVA 4LAJH 1GZQA 2DL9A 2CPCA 5HHOD 1ZS8A 4X6CA 1FO0L 1VFAA 5C0CD 4IRJD 4UQ3B 1IRAY 4YIQB 4J3UA 4TUJA 1B0GB 1FFPA 3DTXA 1A6UL 1ERNA 3IDIB 4MQXC 4ODXA 4JQVC 3VFPB 2NW2A 3K3QA 4RMSA 4Y5VB 2DQEL 1Q72L 5IQ9A 3ROLA 3PIQA 2FIKA 2GEEA 3TVMC 1PBYA 1SQ2N 3DSNA 2IEPA 5E4EB 5JLZB 1IEHA 1JYWA 1M4KA 2VDOL 3ARDC 5JO5A 3G6AA 3LVEA 2CR6A 4I3RH 1M7DB 3MLYH 4PJAB 15C8H 4P59L 2IGFH 1OAXH 4IOIB 3EJZD 2IPKA 4P0DA 1T1XB 1BFSA 3CVHH 4DVRH 4JFOB 1EEZB 5JXED 2AGJL 5FO7B 3QUZC 4WVRA 4C56D 5FYLH 5D7LD 5E2JA 4XNXH 2YKLL 3M45A 3ECBA 2UY7A 3HE6D 4HSQA 1MQ8A 3BEVB 4QHLA 1NFDF 1OAQH 3IAGC 1RULH 3SGKA 5GSRB 2EIDA 3O9WD 2L7JA 3ISWA 4GRWE 5DJZB 1U8IA 5E8EA 4HHAB 2CJUH 1JGEB 5EOQH 3RI5K 4Q9QL 2DLIA 2HFFA 4YHKL 3ARDD 5IMKA 2CH8A 3QSKB 3LDBB 1WCBB 4O02H 3UJJL 4QRSA 4G6FD 1C5DB 5EORL 1UQSA 2M8XA 1A1OA 3E1F1 2QADB 3BKCH 2WIIB 3ZLQC 5C07A 1WLHA 2FD6L 2X4UA 4NHCH 1MRFL 1MFBL 4Y19A 1IT9H 4R0LA 4JDVA 5DGRA 2FSEA 3G6JE 3H9HA 4RAUB 3LN9A 3FB5A 2E7CA 1ZHKB 2Z92A 1I1FA 3W9DA 3CXDL 3BO8B 4P4KC 4JRWA 1T1ZB 1IM9D 4W4NA 1PYWA 3KS0J 3MRMB 3RKDD 4DKFH 1FE8L 4GAJL 4FFWD 2AJ3A 2V5TA 1G7PB 1P4IH 3L9RA 2PW1A 1KBGH 1JI1A 3OBAA 3DXAE 5BVJA 1OQXA 3IDMA 1YQVL 2DD8H 2C26A 3DGGA 5B22A 2BNRB 3P4OA 4JRYB 5D1QA 1EEYA 4JREC 1QPXA 1QRKA 1FYTD 1T0NA 4P2RE 2A6KA 5GGQL 2H32A 3ARFB 3OKLA 5I18H 2Z92B 4OLYL 1FRGH 1G1CA 1OF2B 1P9MC 1LK3H 5KVMC 2P47B 3B6SB 1U8HB 5ESQA 3Q6FA 4Y4KA 5J6HB 5HHXL 4ISVA 4P5TC 3ARGA 2YEZB 3GDBA 4F7MB 3NGBC 2HYMA 4OCYL 3LKRB 4X8JB 4OLYH 4WIQA 3BKYH 1XFPA 1JPSH 3BPOB 1A3LL 1DVFD 5F6HI 4X5XA 2C4XA 5F7MC 4EJ1C 2ZSVA 4L4VB 4NJ9H 3FAXA 5E99H 3EO0B 1GCFA 1S7WB 3C5ZD 4CAGA 3DVGA 4D9LL 4I3GA 1LVEA 3MJ7B 4PGDB 1R5VB 2VNCA 2ZUYA 3G04B 5IESL 4H25A 4BA8A 4PJIF 2GAZA 2GAZB 1A9EB 2J8UB 1IVLA 2NY7H 4IJ3C 5ETUB 4WTZA 1F2XK 2O5ZH 1OAKL 4MD5A 5GHWL 4DQOL 3UXFA 1P69B 5FF6B 2VLRA 2BSSA 2NR6C 1NL0L 1YUHB 3Q3GB 4YR6B 5FO8B 2OLDA 4YDJB 4Y4HC 5DF0A 1RUQL 2EIZB 1OSZB 2FD6H 3A6BH 1D6EB 2VXVH 4YHPB 5CEZH 3MROB 4Q97A 2P5WE 5HTSA 2UUDK 1AFVL 4I18A 3HPLA 1IAKA 4KUZL 1FPTH 3ILQD 5KSBF 4BH7A 2BK8A 3A6BL 1IC7L 3CPLB 4OF3A 3ARED 4P2OC 3KWWA 4PJ7F 1CIUA 4Y2OA 5BZDB 4EUPA 4HWBH 1Y6KR 3W5NA 4NPYA 4NSKB 2BX5A 3QIBC 4HJ0D 5FO7A 5EZLA 3BQUC 4YZFF 5C09B 3W11D 4PRPA 2AS5M 2H26A 4ODSH 1BQLL 4PGCA 4DN4H 3BKJL 3GI8L 3LZFL 4UILH 5SX5K 1QFUL 1DZBA 5E8DH 1RFDL 1JZ5A 5J89A 3B8SA 3L3IB 2I9TA 2X05A 2VR5A 2CDEB 5F7DB 3FJTA 2EDLA 4G7VH 4JQVA 4GBXB 2YWYA 3LPFA 5I6XC 4BKLA 5D7LA 3OKDB 2EYTB 5EZOL 1I4FA 2CK0H 3FQRB 2H1PL 3EDEA 4NKOA 4H1LB 4XCYA 3DO7A 4GMTL 1PX3A 1UH3A 4ZOAA 2L4OA 1HZHH 3O8XB 2ZUQB 4MJ2A 4KRPB 3BDYH 2Y25A 5AYQA 2WIIA 1KCKA 1U8OA 2A1WL 4Q74A 1YEHL 5HHNB 4KMLB 3PHOB 1NKOA 3MXWH 2HJFB 1KJ3H 5JW5A 3MODL 5D7JD 4YHYB 4GAJH 4HF5L 4YXLL 5ITFA 3KAAA 3OKKA 1BGXH 4D9RE 1I1YB 4WV1A 4Z7VE 4HX1A 1MCQA 2YWZA 1YQVH 4E9LA 3MRCA 5CP3A 2R0LH 3MLXH 3FT2B 1P6FA 5AUMA 3R4DA 5DT1H 5TE7L 3FO0L 3R1GH 3ULUC 2F5AH 5JLZA 3EYQD 1NCNA 2BY0A 2BXYA 4K7PH 4OF8A 4W68A 2HLFC 1QLFB 1UWEL 4ONHB 4OZHA 4Y5VC 2XIDA 3RTQB 1ZHNA 3MV8A 4PLKC 1H3TA 2HA1A 1DBKL 4M9OA 4TSCH 3I3EA 4U1IA 2ICWB 3QUYB 4Z76B 3OXSA 4LGRB 3WN5B 2JKXA 1FIGH 4HDIB 2QADD 4JE4B 4MHHG 2XWJB 4BELD 1F4YH 2DQJL 2P7TA 3QNXA 4PB0L 4GKOA 4MJ5B 4MCYB 7FABL 3ZHLA 1OOAA 2B1AL 2W38A 4KJYA 3WFHB 1FYTA 1KYOJ 4F3FB 4G9FA 4HWZA 2X4PA 4PRHE 3P9WB 1TENA 2Y4SA 3VFGL 4P57B 3FB8B 1MNUL 5T1LD 3U6RA 4HPOL 3GSXA 1A3RH 3P11H 3FQWB 1ITCA 2Z4QA 4HBCL 5DEFA 4YH6A 1GZPB 2YN5A 2XXMB 3P9MB 1HQRB 3CJJA 5I8CA 3GI9H 4WHYH 5TGBB 4MJIA 5GGUB 4MB5A 5IG7A 4I4WB 1FYTB 3OG6B 1GSMA 1OB1A 3BHBA 4OD3H 2D4FA 4H26A 2XG5A 1LP9B 3GKWH 2OTWA 3TO4D 2Q7YB 1F58H 3CH1A 1A6TB 1RK0A 4HZLA 4Y4HD 1K85A 1NJ9B 4ONOA 1CDBA 4QXWA 4WEBL 1BJ8A 2QSCL 4YGAB 2JB6A 2FATH 5D1ZC 1E4XH 4LRNL 4TUOB 3IFLL 5DEZA 5DJ6A 1GHFH 2DIBA 3SO3C 4Y4FB 3GGWB 2H6PA 1T7ZA 4S1DD 2HWZH 1LNUB 4XNYH 1AXSB 2HVJA 3CFCL 1OT2A 3AMKA 3CCHA 4L8CB 4MDJA 4D8PA 4TPRL 2F5BL 2A74A 2H2PC 3B4NA 1K5NA 1NAMB 3Q6GL 2QHRL 1A6VH 4OZIF 3QEGH 4LKCA 1NL0H 5F9WB 5C92A 2AEPH 3GSUA 5JOPD 1BM3L 3U4EB 5IR1B 3ARYA 1I3VA 3QWQB 4HC1A 5BJTB 1SMAA 1UJTA 3ULSB 2Y23A 4KFZC 3K8KA 2Q76B 3HS0A 4WGVB 4ZPVA 5DVOA 3I75B 1NGWB 1VFAB 2BY1A 3RY4A 4ZUSB 5GGTH 3OR6B 2YRLA 3BDBA 5FGBC 1DLHA 5EIIA 3ZYJA 1I7UA 3SPVB 1G7IA 1JWMA 3TCXA 1VPOL 1UC6A 1DQMH 3IDNB 5I18L 4JFYA 1A7PL 1G9MH 3V4PL 2OR9L 3MA9L 5GJSL 5HYJE 5FUZH 5TPWH 1R3IH 3HRZA 5DD1H 2B5IC 3KXFE 4ZAKA 5DO2D 3VJ6B 3I9GL 2CLZA 1KCVL 3VFTA 1MLCB 5DRXB 3QNZB 4IJ3B 3WNLA 1T0MB 4OZFB 2W9DH 3A67L 4F58L 2X4RA 4JAMB 1W72H 4FTVE 3U46B 1KB5A 3GMNB 3HNTH 3LS4L 5F7EL 3RDTD 2F53D 2EDBA 1KC5L 3RAJL 2HVKA 1XH3B 1Z5LB 3GSQB 1TVHA 1SVZA 5I73C 3QXDB 3VI4F 3LV3B 5DD3H 2HLFD 5HDBF 4K3GA 1FPTL 2APWA 3MLSH 3MRCB 1T5XB 3GHBH 5EWIH 2OXHA 1JWMB 3WJJA 3EFFA 1IGIH 3MZTA 5DLMH 4P2OB 4AQ1B 3TPUA 4Z7VA 3I50H 1F4AA 3ZE2F 5JR1H 3VRLF 4PV9B 2W65A 3L3JA 4BFIB 3TH4T 2RBLA 1JHTB 3ZTJG 3JUYA 1C1EL 2X6MA 1ULVA 5EU6B 4DGIH 4C83A 1L7TL 3BQUB 3QDJD 3OB0H 4BH8A 3QFJD 4LVOB 4PJDF 3BT2L 3G5ZA 4U1GC 3SCMD 1U3JA 2VOTA 5EU6E 3LKNB 4C56E 3FB8A 3IFNH 4XMLH 2R1WA 1I9EA 4ZFOB 3VWKD 3QIUA 3BP7A 4PJBE 1JIBA 4P23D 3QDGA 3QNXB 4PGEA 4YDKL 2Q3AA 1RUAH 2VSDA 4LHQB 1X44A 4I0PB 3VD9A 5HHNA 5CINH 4MQSB 1MI5B 4X7EC 3B9KC 3QO0A 5DMIH 1LK3L 5JW5B 1RUPL 1DQML 3SN6N 4PJ8D 1Q0YL 2ZUQC 4OCYH 4R7NB 3VE0B 3BPNB 2IQAB 2KPNA 3KLAA 4XBGA 1HDMA 4LLDA 3MCKA 5KG9B 1KEML 5I16B 5JMOC 3OKMA 4YE4L 4LDEB 3NIDE 2W07A 1F3DJ 4FTVB 3FKUS 5DEGA 3RWJA 5CZXC 4DUXA 4JJHA 1L9NA 1MCCA 3NN8A 4KQ4L 4WW1A 1FNLA 3X13A 4Z78B 2FHBA 1M71A 2H3NB 2YUZA 3K8MA 3QI9B 4IMKA 4RDQF 5F71A 2Q87A 4XP6H 2OJZH 1YUHA 3Q3GA 4DWHA 5FO8A 1QFWI 4E41A 2BSRB 1J1OH 2GJJA 1INQA 4NT6A 4Y2DA 4JM2D 3L7EB 3QCVH 3ZYIA 1BLNA 4PRBB 3ZKMC 4MD0A 4M1GL 5HHPA 3QUMH 5DJDB 3RX8A 5J6HA 1M05A 4P9MH 4XH2B 1R3HA 3FCTB 1Q9LB 5CAYB 4NN6B 5CHNA 3QUYC 3V0AC 4X9BA 1B0RB 4UDTA 5TH2B 4ZO7A 5DJXA 3CFKA 5C0GA 1ACYH 5GGSA 3M8OH 3QEUA 5BV7H 3UTZA 4X6FB 2HT4D 5IVZB 4TOYH 1RZFH 1S7WA 4CMHB 1AXTH 3EO0A 1PX4A 4HKBB 3VFMA 2CJUL 3MXWL 3O2WH 2BNQB 1QTYT 4I48B 4ZS7L 2UVFA 3S34L 2H8PA 2YR3A 3WEXB 2JB5H 4NUJB 1EXUB 3E2HB 1JFQH 1M7XA 1FJ1A 5FF6A 3SDXA 3DV4A 4LBEB 4OZHE 2ZG3A 4UINL 1LO2L 4HPYH 2VN7A 5EA0H 2ZNWA 4S1RL 5I1CH 1OTTD 4K71C 3DI3B 1WWWX 4LQFL 3VDCA 2W0FA 4JY6B 1YEKH 1BFOA 3QG6B 4PJHA 3KJ4C 3S37H 2BNQA 1W2KT 3NFPB 2QEJA 3D3VE 4GW5A 4NFBA 3KR3H 3ZE1F 1N5AA 2FGWL 2PXYD 3QR2A 3SY0B 4HGMA 5JZ7C 4NN5C 5BV7C 3UJIH 1YQ2A 4LQFH 1LK2B 4KROC 5JW4R 1UM5L 4HCRL 4KRMB 3QUXA 4NBYB 1FNHA 3I6LD 1IGML 4NJAL 5D72L 4UOW0 4HUWB 4P46C 3ULUE 5C0ND 3EJYD 5MEND 5T1MA 2MNUA 1JV5B 2X9YA 3I3DA 5T1DH 3SO3B 2FEEI 3HC3L 4AEFA 2IBGA 3BD5A 2ITDB 1CG9A 4JCMA 5F97E 3L3KB 5FHBH 3L3KA 1UGNA 1FCGA 2J6EA 1JZ8A 3L3JB 5DC0A 1WEJL 2NY2C 3MLXL 1EXUA 2VO5A 1NKRA 3MJGX 1GZQB 5KJRL 4HIXL 2ADFH 3L1OL 1OTUD 4YPGB 1WV7T 3MA7B 5F9WC 4MQ7B 2APFA 2IPKB 1EHLH 2NYYC 4NCC1 4QGYA 4H20L 2VYRE 3EJZC 3WFDH 5HPOA 1WCBA 5DI8B 4QYOB 5J12C 1UB5B 1SVCP 3FONB 4Q7DA 3BPCA 1DQJA 5J6GA 2BERA 4EBQH 4OSUH 4TQEL 4U6YB 3CVIL 1KUMA 4NWUH 2IWGA 3CIQA 4HS3A 2CK0L 1BFVL 1T7VA 4NO5A 5TFSH 4YDLB 4ONGL 1F6AB 4QRRD 5F1KC 3O11A 2FSEB 1VERA 3L3GA 3ZKXC 2NLJA 4WWKA 1NC2D 1YC8A 2NY2D 3NCMA 5IBUG 1E4KA 3KPNB 5E8PA 5BZWB 4P2OD 2G5BA 5DFVD 1VGEL 2EC8A 1CE6A 5JW3L 4YBLB 3HB3D 1XCQA 3DARA 4OM1L 4C56A 3Q5YA 3MLRL 25C8L 5GRWA 4RMUA 4J6RL 1XCTA 3OB0K 1CQKA 3FOLB 2C5DC 4MCZB 5JO5B 4TTDD 4WI7A 2VL5A 1FFOA 1NGXA 1B2WH 3LKSA 4JZNA 4JKKA 1MWAH 5HBBA 3CFDB 4NQDB 2F8XC 5BRZB 3QDJA 2WWMD 2P45B 3VXME 3OKLB 4LGSB 3I6KA 1HWGB 4LARH 4WUKH 1T1WA 5I76B 1QNZL 3L95A 4OCMC 4WEUD 4F7PA 3S9DB 4DW2L 3CFJA 5DJDA 5IUSA 3CD4A 3SKMB 3L5JA 5LGJA 3VFNB 4MMXC 2V2TA 2EH8H 2E9BA 5J13C 4MDIA 3QUZA 3X13B 5EC1A 4PJ8B 4FXLA 5JA9A 3EOAB 3BN3B 3KYAA 3QXAB 1XGPA 3WSQH 4HG4K 5GGSB 1HNGA 1PY9A 3N9GH 5IMLB 3L7FA 4M5ZH 3EJJX 4FTVD 2AW2A 1I1RA 3SDAA 3V6ZB 1AC0A 4JFFB 3C60C 3L5WA 4TNVF 5JIIA 1YEDB 1GGCL 1OAUH 2BNUB 5FGRA 1JUFB 2WBJC 2APVA 5ENWA 1Y18A 3HKFA 1J1XH 2LAAA 2V7NB 3LOWA 4AMKH 1BWWA 3C6LD 2G9HA 5ID1A 3ZO0A 2FZ3A 3CX2A 1FG2A 3H9SE 4K94L 1QLRA 5ILTL 5FECB 3IDXH 3SDAD 1PKQB 5L88L 2DWEB 4S0SD 4I0PC 4QRUA 3LS5H 3PWNA 3MRKB 2V5RA 3S5LG 3MRKA 4NQVB 1PYWB 3VXRA 3SOBH 2F74B 3ARBC 4MJID 1WIUA 1I3UA 4U1SA 4QHMA 2YBRA 3P11L 3HNVH 3QHZH 1ZHBA 5K59E 1C16A 1VADB 3MYZA 1CGTA 4WUUE 4Y19E 4XNXL 5BO1L 1JCKA 3IXAA 1YEIL 1YEEL 1MCFA 3T0ED 1QEWA 2FH8A 1S9WB 5B38A 2DJSA 1B4JH 3BH8B 2BNQD 5CJBA 4QRTA 4Z7WE 3LEVH 3MV7D 4POZD 3V6ZA 2GIYA 1R3IL 4R26L 5D2NC 4OZFA 3U48A 1Z9MA 1NJ9A 4FQJH 5F7KC 5KVGL 3ZE2E 2HT3C 2J7LA 5F3HA 4IMKC 1U3ZA 4Y4FD 2OJEB 3CFIC 3MMEB 1DBMH 5FUCE 5C0IA 2BSTB 3ZE0F 3IAPA 2NX5B 1LE9B 5CFHA 3BN9D 3V6BR 5HYFA 2GJ6E 3P0VL 2NMSA 8FABB 1FVDB 2SEBA 2DM7A 4O9HH 4S1SH 4P3WA 2I9LB 1WGOA 4NN6C 5L6YL 3QP3A 1FL5A 1HNFA 4PJFF 1FL5B 5B4MC 5D7IE 2XT1B 2I07B 3QUKB 3Q6GH 1Q0XH 5T1KD 4WCYL 4CMHC 4DTGL 4UT7H 4O02L 1YEJH 3X14A 2QSCH 3FQTA 3T4YA 5MENB 4JRYE 3CSGA 3O4LB 2DOCA 4JFQB 1WBYA 4NZTH 1PG7L 3W82A 2IFFL 2LVEA 4PD4J 4Z6AT 2DMCA 4QRTB 4S1DC 4XPGL 9CGTA 1YEHH 2DKMA 1SYSA 3L3HB 4OD3L 2DL2A 4AIZB 5M95B 2ICWJ 4Q0XL 5FYKU 4HIXH 2DKSA 4YHKH 5DFVC 2VLJD 3VU2A 4AT6A 3GHEL 4X4ME 5DVNA 4G6AC 1ZEAH 4HS3B 4NYLB 3PWPE 1L7IH 3DVIA 4WWKD 4BSWA 4ZO8A 4L3EE 3S36H 4E0RA 4GW1B 2EYTA 5C0AA 3P4LA 3NZ8A 4CMMA 2X4OA 1BF2A 2F53B 1HHJA 2F53A 1IL1B 3OXSB 3P4NB 4NO2B 1KNOB 3WN5A 5F6IC 5DC4B 5T5FL 1A4JA 4F57H 5EA0L 2F58L 3ZDXF 2QQLL 3QO1B 1A6UH 1A3RL 2WWKO 4NQCE 3PV6B 1S78C 3IJHB 1LEGA 1OGTB 2GQHA 1OAYL 4ZSOA 4OFKA 5E0QA 2VKWA 1P7KB 4WFFD 4GAYA 2W60B 1U3HB 3D18B 3RWCA 4OJFL 2M26A 4G8IB 5DFTA 3C09B 1U8KA 4L4TB 4X6DE 4PJXE 2FEDC 3UEZA 2YK1L 3NA9L 2XZAL 2UYLB 2BOCA 4G42A 3RVVC 2RR3A 2AJVH 2R2HA 1FG2B 3QAZC 5IB2B 5CEYB 3EO9L 2DI8A 3MV8B 3RZCB 5JHDB 4P4KD 1I1AB 3N85L 3O3BB 2KKQA 2VXUH 1S5HA 5DVMA 4QEGA 1IEBA 1ZSDB 1J05B 4OF6A 4WCYH 4U6HA 5C3LD 3VD4A 3UPCA 5E08L 4ZUWA 2IALB 3C6LA 4DZBB 1MI5D 4JPKL 1NCCH 4G43B 2XWTB 1KJ2L 2QQKL 1R0AH 3VRJB 4OGXL 2R0LL 4CW1B 4DFHA 5FOBB 1D9KA 4K7PX 1KB9J 1HQ4A 1RZ7L 3RA7L 3O41A 4G6JH 3UYRL 1E4WH 4H26B 2VXTL 1T83C 3QJFB 5C86A 2H41A 3QXTA 2DTML 1I9RH 4CDGC 5B21A 4Z76A 2YS4A 4N0FB 4G7VL 3MRHA 4PLJD 4B5EA 3DYOA 3TBYA 1T21A 4Z95L 3CFEA 3IXTB 2LFGA 3HG1B 5DS8B 5GZOC 2FX9L 2ZUWA 2EXWC 1A9EA 2J8UA 2E7HA 1MRCL 5DUBA 2H1PH 3QUMA 2NNAB 3IXAB 1T2XA 2DIAA 3MRGB 1UB6B 5JXAH 4WU7A 1A7OL 3SDXF 2C3VB 1CS6A 4K55A 4EUPB 4JM2A 2OL3A 1EVUA 2UZIH 3SKUD 1JV5A 3QA3A 2EDKA 2FO4A 2JK5B 2X7LA 1UKQA 3QHZL 4PJ8C 4O2CA 3DROB 3QWRA 2E7BA 1AGFA 2HKHH 1QSED 3MLTB 4NRYB 4JZOA 4N0CC 5KSVB 1DVFA 1JHLH 3T0EB 5LGKA 4YPGA 4JQIH 4Y16A 4PJGE 4JFDD 3BEWB 4LRNH 1CDIA 5C0FB 3HMXA 5CCKL 1OP3H 1ORSA 3OF6D 5C0CB 3FQRA 4M43H 4NUGH 2FGZA 4TUKL 5F7NC 4W81A 1JHKL 4QNPE 4I18B 2A73A 2EC9U 4X98A 4TYUA 4EUPG 4OFYA 2X40A 5SWZB 5EFIA 3EYFB 5L2KE 5IP4A 4JFDA 2OI9B 3OX8B 4K3JH 4GBXA 4XGZB 5HDLA 4XGZA 1AE6H 4LRIC 1O7VA 3Q1SH 2PO6D 4GW4B 5FM5M 2AJXL 4G80A 5EBWA 5EUKB 3WIHL 4XRCA 4LFHD 1RULL 4RMVA 2X09A 2X44D 4P3DB 2XN9B 3T0DA 4JZJC 1UCBH 2DICA 1V7ML 2H26B 3PWLA 4WHTB 3PWLB 5FV1L 3B3IA 4FQ2L 4YZFE 1Z9OA 5T3XL 4ZMAT 1LO4H 2E27H 1JNLH 5JNYA 4LARL 4AM0A 1RVFL 1LO3H 5E00A 3I2CH 4AEHH 4QRPA 5FM5O 2XA8L 5E2VH 5E4IA 4XVUC 3STLB 4KTDH 5FFLA 4G9FE 5CKAA 3F7VA 4PY7A 4AIOA 1MRCH 2QQNL 3NFNA 4XAKD 1DUZB 3U83A 4J3OC 3WDJA 2NY4D 4BSVA 4JFOA 1HHKB 3A0OA 4JM4H 5IQ7L 2IANB 5IBLD 1HH9B 2MOVA 2UWEB 1I9JL 3ARDB 3O6FD 1OP9A 4Z9KB 1JRHL 1IC4L 3CLEH 1L6ZA 1U58B 4QWWC 5GSRA 5M7QA 1ZOXA 5JNYB 1VGEH 1Z5LA 1UZ8A 2GUOA 3BOVA 4JPIB 5CIPB 5I0DA 1JK8B 2DRUA 5GGVH 4NNXA 4FXGA 1HSBA 1IE5A 3T2NL 2YPKB 4PJCB 4PJDA 1MIMH 1KJ2H 4UDUA 4TUJB 1N0XL 4XBGB 5LGHH 1ZGLM 5FK9A 3AROA 4N90D 4JY5L 2BFVL 3OHXB 4FQPA 2BOBA 4QTHB 5J1AB 2R29L 5I1IL 2KH2B 2AXHA 1RQ5A 4TPRH 1KJMA 1CZ8L 4RRPG 2F54A 2AV7A 1MUJA 1JNNL 3DSFH 5GRVK 5EO9B 5BVJB 1MVUB 2AXFA 5K93A 5FOBA 3RVTD 5I8OH 1HOCA 2EDEA 3R06B 4QXGH 3MRLB 2DLFH 5IHZB 4JPWL 2WAHA 3TZVA 4K9EL 5F7UA 35C8L 2GITA 1MJJB 1PQZA 1AD9A 3UJTH 2QADC 3EUUA 3OKNA 2XPGB 1MWAA 4XXDB 1I8LA 3REWB 5DURB 1T0PB 4PRHB 3S97C 1CGSH 3DIFB 2IALA 3HE7B 4HV8B 5GXBB 4CBPA 1AQKL 1YY8A 4PLJC 3C6SB 3U9PL 3HA0A 1DBJL 3GIVB 4YEEA 5DUBB 4GG6E 4N0UA 2ERJB 4ZUTB 5IMOB 2M1KA 3ARWA 4I13B 1CI5A 2P42B 1UT9A 4OLZH 4AL8L 5LXGH 4P4KB 3N1PC 3FL7A 2BJMH 5BXFA 4POUB 3IDJB 3T09A 3MJ9L 1TFHA 2D7QA 3GI8H 4IMLB 4M6OH 1HKLH 2BRRL 1WC7B 4I1NB 3DUHA 5GRZA 2RQ8A 3W9DB 1PJ9A 1U3HA 4HUUA 3MRBA 1CIDA 2DBJA 5HVGB 3QG7L 1XGYL 1NCUA 4JREB 5AEAA 3NAAL 3VRIA 5DXWA 3VRJA 2YMXL 1A21A 4LEOA 4JHBA 4WTXA 1U3HC 2GFBB 1FZJA 3Q5TA 3MRPA 3OXRB 2CRMA 5I15H 1T7XA 1YN7A 3TO4C 5E1AA 2DQUL 4M7ZC 3GHEH 5HHOA 4PGBB 3NGBB 1ZSDA 3JXAA 2FX9H 1QSZA 2BY3A 4OI8A 4EOWL 1YEJL 2VAAA 3SE8L 3GMMB 2WWMC 4FZ8L 2R4RL 4F37F 1MELA 2DM4A 4PUBL 1NANH 3T77A 2R8SL 4H5SB 5J3HC 4G9DA 4UDTB 4LOUC 2WLYA 3PP4L 3ZSSA 5C9JB 5HYQB 2FWOA 1C7TA 4ZPVB 3BH8A 1HI6A 2O5YH 4HH9B 1ZVHA 3OR6A 4WFEE 5JDJA 2IPUG 4MS8C 3V0WH 1AGCA 5ALBL 1JNJA 1FFPB 2VDRH 5I8KH 3L3HA 5F93C 1CD8A 1K6QL 2G60L 4ZNEA 1IGYA 4HXBL 5GGVL 1XIWC 3UZEA 1JE6A 2VH5H 5C0EA 4P9HH 4GO6B 4NNPL 1GGBL 5E6YA 5T3ZL 2AK4B 1RZKL 4N9OB 3SE3A 5DJAB 3TT1H 1LE9A 2B20A 3UMTA 1X5ZA 2ESVB 4ZAKB 2D7OA 5HYJD 4WW2A 2MQCA 3VW3L 3OKOB 2UV3A 3PGCA 1LEKB 5HGGS 3QDMA 1QFWL 4LLWA 4XVJH 4AENB 1G6RL 1Y6MR 4PBXA 3AS0A 4HLJA 4L8SA 1Q0YH 3V6OA 2HH0H 1PEWA 4PV9A 2NTFB 3SJVA 1CF8L 4IRSC 3QIBB 3ARBD 2IQ9H 2IAMC 4MX7A 4MA1B 2Q76A 5C6TH 1UM4L 3SGJC 3JVGA 5DMGC 3QG7H 2PF6A 4MXVF 3ZT7A 3CAFA 3WFCL 2D0HA 3QHTC 1BVZA 5I2IA 3DX7B 3MC0A 3B9KA 2C1PB 2ZKHL 1QP1A 1B4RA 5E2VL 4G6KH 2AQ2A 1OP5H 3I2CL 2HFTA 5CKGA 5JORB 1RVFH 5JPMB 3LY6A 3OAUH 3ROLB 4QF1A 2ZJSL 2LVCA 3VG0H 2J8UE 3KYNB 4XNUH 1CBVL 3GSNA 5ACMA 3IFNL 1OAZL 2WUBH 1OGTA 3FFCE 1F3JB 3CLFH 1UA6L 4LPVA 3GMOA 2LV4A 2OSLA 4LLUB 2HT2D 5BRZA 4I18C 5E24E 1REIA 3GBLA 4NHUB 1G7QA 3O8XC 4P5KB 2ZUSA 4KRPC 4R8WH 1NCWL 3U1SL 4QY8B 1C5CH 2VLJB 4M1DH 2CKBA 3ARTA 3NACH 1FBIH 2P7TB 3ROOB 4LU5H 2HTLD 3VA6A 1AY1L 2VDKL 4F7EB 3FO9A 1UZ6F 4DAGL 3QXDA 2CO6B 3H3PL 4YWGL 4DCQA 5MEQA 3IVKB 4ALAL 3MBEB 4GXVH 4UBDC 2A83A 5F7EH 4XI5C 4W6XB 1C12A 5MI0B 2IF7A 3VWKC 1MFEL 1HINH 1UM6H 5I19H 1QHPA 1BQHB 3TO2B 1UG9A 4M7LT 4FMKA 4DQOH 4L9LB 4CADA 3F7PC 5JXAL 4WO4B 4U6YA 3ES6A 4PJ7E 4NJ9L 3NFSH 3AU1A 3LRGA 1DBAH 4KU1A 4UNUA 1OD9A 1IAIM 5CJOH 2R1YB 2FECI 3DYPA 1CD9B 1YYMH 2YC1A 4ZYKA 4D0DB 4G9FB 2R0ZL 5FDWA 4NC1C 5J11C 2DYPD 4G6AD 5SX4I 3CX5K 2EE3A 1U3HD 2BNRD 4PB9H 5IFHL 1DFBH 4HX1B 4XPTL 2ICWA 5TQ0H 4MB4A 5CD5D 2DAVA 1AP2B 3UROR 2D31A 4LVEA 5DA0B 4PRHA 1FNGB 4KKLD 1ZHLA 1E4WL 4DK6A 2Z9TA 4FQXA 4HKJA 5I8CB 3RWGB 4TULL 1YJDC 4MXWH 2GFBA 5CSGA 1OW0A 4HUVA 1E6OH 3BWAB 3FMGH 3BWUC 3K4DA 1MHCA 5FA4A 4JO3H 1MJJA 1PQZB 3G6JF 1EO5A 1P84J 5KVFL 3FTGB 1RZKH 4I9WE 4JFXB 3MRBB 3O3DB 3DETD 4UT9L 4MAYB 3MLWL 4WDIA 1BMGA 1FNSH 1IGYB 2PR4H 1NLBL 1JYNA 3IU4H 1Q9KA 2ICEA 1S8DB 1UH2A 1KIPA 4D2NA 3QDJE 1YYLH 3RL1A 3RHWK 5DRNA 3T0EE 1VFBB 1RAMA 5B8CA 3TN0D 4PUBH 2ERJC 4KI5F 3BKMH 2VZOA 4TVPE 3NCYP 4KK8D 5IEHB 2XN9A 2FB4H 4LSDA 3V7AG 4IHOA 2EDFA 4KK5D 5DHVH 3SEPA 1BJ1J 3FFDB 3U7YL 3KPLB 4Y1AD 2VE6A 4IRJC 2EE9A 4DGVH 3KPRE 3ZDZE 1MJ8L 3DX8A 4U1LB 5KS9A 3MRIB 1E4JA 4BFGA 1OTTC 3WUWG 4Y5YA 4X6FA 4KMTL 1BBDL 2PCPB 3QA3B 1AGCB 4YHIA 3UZVB 3GMQA 4LSQH 4OLVH 2KBGA 3SJVD 5BS0D 1MJUL 3H3BC 1JP5A 1K4CA 5B4MD 1DJSA 2QL1A 4KMTH 3ULVL 3IGAA 1F4HA 4OZIE 3B2VL 5HYJB 2NR6D 4G8GB 3WO4C 5EB9A 4FS0A 4YQXL 4JPIA 4U0QB 1TQCC 1V7NL 4MXQD 5FM8A 4XVJL 3KPPA 1HEZA 4G80B 4BSVB 1BEYH 4OLWL 4Y5XA 2EE6A 2G5BB 1YMHB 2O93L 1VCAA 1BFOB 3MFFA 1FZOA 3AB0C 3H6JA 3MROA 3EIFA 5EIQA 3RBSA 1IKFH 1T5WA 3QDGE 3ZSTA 4OFYD 3GB7A 3G5VA 3SY0A 2VXTH 4XBPA 3ZDYE 2Z93B 4CRPA 1A4KA 1ETZA 5D93B 1OLLA 3HCVA 3VH8A 5MERB 2HTLC 5E00B 1CE1H 1OD7A 4UUJB 3QCVL 1HHGA 5JIHA 5FYJD 4HUWA 5IJKC 4L8BB 1KJ2B 5FAAA 2IC2A 4NPYB 4OCLC 4ZS6D 5I9QC 1DLFL 4P9ML 2VDNL 3T3ME 4PRDB 5JOPE 3G08A 5CIPH 3OGOE 1JZ4A 4GS7B 2FJHB 4PJBB 1CTNA 2X4QA 3U7WH 1C8PA 4Z5RB 1QD0A 4P23B 3WLBA 2E8YA 4N0UB 4KKNA 3MR9B 4MB3A 2EIEA 2ED7A 4QRPB 2MJWA 1FL3B 3SE8H 3TVMD 3BD3A 1MCOL 4CVXA 4U6XA 2GI7A 4D9RD 5IM7A 3GSOA 4JGMA 1U8MB 4FFWC 1XGRA 4K94C 4IRSB 2XPGA 2AK1H 1EEUA 2W1NA 2VLLA 2DI9A 5ADPL 3LH2L 2ZUTA 3QUYD 2PO6C 3TO4A 2DQDH 5CD5C 3P30L 3K0WA 3KGRA 2DQFA 3MV9A 2ADJB 3QT2A 5C07B 3WDIA 3GBNH 2X70B 5FYLD 3QCUL 5FUOH 4Z78A 4JFHE 3DXAD 4OB5L 5E5RB 4L3EB 4WHYG 3PDDA 4TVSa 3RVVD 5TQ2H 4PG9B 1N7ML 1SBBA 3D39E 4PJGF 4XVTL 1HIMH 5SV4A 3ZE0E 4LLQB 1Z0MA 1T22A 1T7WA 1ZHKA 2CLRB 4OGYH 4KJWD 4HS8H 2D2OA 2R0ZH 4OI7A 3F12B 1QLEL 3FRPA 2CKBL 2NY0D 1QKZL 2CR3A 1NCDH 3QIUD 3DUSA 4S1RH 5I1CL 2XWTA 1JZ7A 3DXAA 2XZQL 4PJIB 1CXKA 1L4IA 3VXPB 4LLYA 4LAQH 4IBLT 3WIHH 2GK2A 1X5KA 4C83B 1KULA 3B83A 5C08D 4JRYA 1LEGB 3TCLB 1FH5L 4YDIL 1FSKC 1UCBL 2MMXA 1NC4A 2H32B 3B9EA 4X6CF 4ZNCD 1YECL 1IC7H 2OR7A 3OJDA 4PGZA 5CBEB 2RJMA 2OCFD 2HFEB 3MUY1 1IZKA 5K33A 1U8KB 2EIBA 4MAYA 1KN4L 2FX7L 2IFFH 3MBEC 2GSGA 1W0YT 1QBAA 5IF0A 1T7YA 1OSPL 3QULA 4LLAA 3TA3D 1CVSC 1AHWC 5I1EL 4RIRA 1BREA 3PWPD 5CJQH 4HH8A 1CDJA 1FJ1B 2AJUL 3VMOA 1QO3B 5C0DB 4ZSOE 1KTDA 2HLAA 5ISZA 3VGHA 4ZUSA 5JHDA 3LEYL 5I16A 2WSKA 3FB6B 4NT6B 4D9QE 1P4LA 3ULVE 4LCUA 5JIPA 3MRHB 4FG6D 4PV8B 2HJKA 5IMMA 4X7DC 2IADB 2P24A 3U30B 1N7MH 2B4CL 5FA3A 5J11B 3S4SB 2A77L 3INUH 3VGAB 5MEPB 2LE9A 3RWIA 3KPLA 1N2RB 2PXYB 4W6YB 2UZIL 1INEH 3BWAA 4PP2B 25C8H 3KPSD 1LDPH 2HVJB 4I9WD 5DJYA 5E9DB 1YYML 4F9LC 1ORSB 5HPMA 1DVFC 4KI5C 3MRQA 1BVLA 5ICXB 3TNMB 3IJYA 4KTDL 2XA8H 1JGLH 5HHPB 4Y1AB 1LDPL 4K7FA 1DE4B 5DJ0B 3RJQB 2QKIB 1T83A 3KPQB 4AT6B 4YHLL 1BAFL 1C16B 3WJLA 5J1TC 4U7SA 3T0EA 3KYMB 43CAB 4PJHE 4E42B 5BJTA 4K71B 5DD0H 1DBBL 4D3CL 3S96A 4K7PY 4ZOBA 1NGYB 2H2PD 1MLCA 4JR9H 5TJWK 1IAOB 3IB4A 4JHZA 1X3DA 2QQKH 1R0AL 4A6YH 2DQTL 4KROB 1IKNC 5KSBB 1CGUA 4PY8I 1KCUH 2XWBB 3X11A 4MHHI 3CFCH 2FYYB 1UXWB 3L3DB 1GXEA 3QIBA 2PW2B 1YMMB 3KYNA 4BZ1L 1IQDB 1KT2B 1FVDA 5MP6H 5MEQB 3IVKA 3V0VB 2C4FT 3SDDD 1EEZA 1MIEL 5EU4B 1IARB 2IH1B 4WFED 4HIJA 2DDQL 4IIQA 2C1PA 4NHCL 5I1EH 1FAIH 4XNUL 1T6VN 1CBVH 2NY2B 4QRSB 4RSVA 3EYSL 1NMBH 3GFUA 5JORA 5JPMA 4OFIA 2VDML 3LD8B 3QIBD 3UC0L 3VGBA 4ENED 5KAQG 4YUEH 3AU1B 4LIQL 4PLKD 3VXMB 4CVUA 2A6JA 5H2BB 5IFAL 3OTTA 4UOJA 3RU8L 1U8NA 1T2QH 1V3LA 3O3AB 1NCDL 5GRUL 4GKZA 3TNNA 4ZQKA 5HYEA 2WBJD 3IFOB 3MUGA 3I6KB 3DMMA 4LAQL 5FCSH 1ZVSA 2YD7A 3K74B 1NUGA 1RZGB 3SDDC 4KJPC 3IAQA 3TPUB 2AXGB 4MJ6B 1I85A 4PRIB 4KJWC 4M6OL 1YPZE 4O5LL 1MLBA 1UADC 4LCCB 5SWSB 1W8OA 1H3PH 1TJIL 1FQ9C 1M7DA 4OCXH 1QVOB 2IMNA 1ND0A 2W9EH 3DPBA 2O5XH 1AGDB 4J8RA 4LP4A 4BQCA 2FO1A 4L9DA 4P2RA 3DVFA 3DYMA 5EU4A 4OZFG 4E0RB 5J56B 4F7TB 4KZDL 1SM3L 5FA4B 1L7IL 3QXUA 3SBWC 5FUOL 1CD1B 1NC2A 1ZEAL 1J1PL 1YEGH 5D2LE 1YY9C 3RA7H 3M8OL 4M00A 5EDXA 2JELH 2V7NA 3DXAB 1J0HA 5DJ6B 5C0BB 2VZ1A 3QFJA 3T8XA 3WFHA 2V9TA 4P2RD 4FNLL 1I8KA 5L9DL 12E8L 3LKSB 4JZNB 3EOAA 4NKDB 3WJJC 4AIXA 1EPFA 1F13A 2D0FA 5D1ZB 4DEPB 1SYVA 4ZFFA 2VIRB 1QBLH 1AKJB 4K3EL 5GS1C 2Q8BL 4Y4FC 4PGJA 3IU4L 1JTPA 3PNWA 4YHOH 3D85A 1FZMA 1IFHL 2RCSH 3HZYA 4I5BA 3PWVA 1XT5A 4LLVB 2W9LA 4ESKA 2OZ4L 3HC4H 2ZZUT 3I6GB 1IEAB 4AEIL 4MYWB 1BZ7B 2BFVH 1E27A 4QOKB 3C60B 4X9HA 5AAWA 2K7PA 4KH2A 2ZOLB 3WUWA 5TDPA 3DGCR 5IMLA 2C7UB 3OKNB 1BOYA 5HPMB 4FZEH 2W9EL 3G6DH 3MV7B 4EI5B 1DQLL 1SY6H 3D5OF 5DQJA 1MCEA 2ADIA 4EI6B 2A6IA 4WI5A 1CR9L 2NQCA 1PY4A 3KYMA 4KY1L 4OFPA 2FZ3B 1EAPB 3VFSA 3M17A 4EN3A 2OMBA 4W4OC 2W59A 5BXFB 1P4BH 1MJUH 5B38B 1WAAE 3LZFH 4NQXB 4PGBA 4MNHA 4YQXH 1JVKA 4AEHL 2ITDA 1BVKB 4GXVL 4K7FB 4HQQL 4PJAE 1FSKB 1NCTA 4NGHL 3HMXL 3VXRD 1MHEA 4LCIL 3Q1SL 2VQ1B 4KDVA 3SQOL 2NX5A 1ACZA 3CPLA 2BSTA 1D5XB 4F7CB 4HS6B 4N0RA 1RV6X 2YZ8A 4I2XB 3EYSH 2PNDA 3SHSA 5INDA 5F7YC 5T1KB 4NRZB 5E9DD 4LSPH 3O6LL 5GS0L 2DWDA 4YUEL 1IC1A 1MREL 4KPHH 3ARGC 4RFNB 3V52L 3VXUE 3U9PH 4MA7H 5I8OL 4OLUL 2X4SA 1AHWB 2GCYB 3B5TA 5EZJA 2EXYD 4JKWA 3LRSB 2D3VA 2ORBL 4WY7H 3JSSA 3CLFL 2AJUH 3LSOA 1B90A 4Y1AA 2WUBL 4HZAA 4IOFD 1ZA6B 2JCCE 3IGAB 5EOTB 3RWFA 1FL6B 5DD6B 4WTWA 1TVBA 1XF3A 4R4BA 5B3NA 5HJ3A 3W0WD 5JOEA 5EO0A 3V4VH 5HYQA 3SDDA 2R0KH 1INDH 1U92A 1EAJA 4NNXB 1FNSL 3HNTL 5ELIA 5JW4Q 4MNGA 4V1DB 4LSUH 3Q5OA 4LF3B 3V2AR 1BF8A 1NEZB 5IESH 5F9JB 2IANA 4XRCB 3H8NA 4HK3N 3T2QA 1QFPA 1A3LH 5I1JL 1D7FA 3REVA 4GW5B 1NAML 4LVOC 2ED8A 4U1NA 5J1AA 1JNHB 2VWEE 1J8KA 5DMYA 4C58B 3FMGL 5LGHL 3HNSL 1M6OA 3KLSA 3SCMC 1MAJA 5FYLE 1CICA 3VGFA 5IBTL 4GBXD 2XQBH 1KYOK 4UUJA 4CJ0A 4N8VG 2XI9A 3A67H 4KK5C 4WHDA 5KVGH 3MRFB 2NY4C 4OUUB 4WEMB 1ONQA 2XNAB 5IFJA 1N4XH 3WBDA 1KJ2A 2J4WH 3GMRA 2VXQH 5A40E 3GMRB 1HDMB 5DO2C 3UTTE 1PZUB 4WUUA 5GJTL 3GRWH 3IDYC 3TWCL 4U49A 1R5IB 4U1KA 3NCYS 1XCTB 1A4KB 3S8WA 4OM0H 2BVTA 4M48H 5F9AC 2WBWB 3L3IA 4UT6H 4GRLB 3MR9A 4D94A 2WP3O 4EVNB 5IV2A 2FIRT 1PGRB 3R06A 1NFKA 1I8IB 4Z0BL 2FJFA 2DQDL 4S0TD 3CFBA 4JPVH 1A8JH 1JNLL 4K23L 2HFFB 3MJ8A 2LQRA 4M3KB 1FV1A 4KZEH 1A02N 1T1WB 5I76A 4NNPH 1FN4A 5BRZD 3DI2B 5C0AD 3QI9C 3V6OE 1MCKA 3MV9B 5IT2H 2H2SD 3SGJA 2VDNH 3I85A 5ESQB 1ADQL 1AR2A 1K8DB 3RVTC 5CEZD 5J4MA 2ORBH 4PJFB 5IGXL 4P5MB 1GAFH 2AV1A 5F7WC 1AGEB 2MSPA 3DV6B 3RTQD 5DHXB 5CP7A 5JQ6L 1HOCB 3QI9A 4AH2A 4U6XB 4LU5L 3LD8C 1A6AA 5D7IA 1NPUA 1TQBC 1IBGH 4XAWL 1JWSA 5IVZA 3H0TB 1FORL 4OCNC 2X1PA 4MSWB 4X6BA 1QRND 1CYGA 3SKOA 5B39A 2DQUH 3UTSA 4OF5A 3MV7A 2DQFB 1UA6H 1BEYL 2A6DB 3VI4E 3KYOA 2JJTC 1CXEA 1K8DA 4YAQA 1YECH 5BS0E 3VXPA 4FXKB 4YX2L 5T1DL 3QUMB 4ODWB 5TH2A 3RY6A 5IB5B 4NBZB 4JANB 4P5TA 3JV4B 4M61B 3O9WC 1IKFL 4HQQH 4LBEA 2GITB 1FV1B 3OJ2C 4E41B 1T22B 3LIZH 1SMOA 1J05A 1UFUA 1S7VA 1BLNB 3ILPB 3TJEH 1SJXA 1RIVH 4YFDB 2IG2H 3Q0HA 4YBHA 1MCSA 4I0PA 2J6EH 5E2UL 3U0TB 1ZTXL 3KVQA 4XWGH 4CW1A 4EZMA 5GGRY 1K2DA 2VABA 4FFVC 3H9SD 3LH2H 3TYGL 2BSSB 1D9KD 5JUEH 1VESA 4NN5B 3KLAB 4PJEF 3QIWA 4KV5E 3SKNA 1F4XL 1W0WB 1N59B 1XR8B 1OWRM 3FN9A 1RK1A 1D3CA 4LVNC 1A6PA 3SDCC 1X9QA 4I48A 4JDTL 4Q6IA 4JDZB 5FYJU 1CVRA 4QKXB 3HR5A 3KXFD 1LO5B 2VQUA 1Z3GH 5INDB 4YO0A 2RFXB 2W0PA 5TE7H 4BUGA 3UAJD 2RCSL 5KOMC 3K2UL 3BFOA 3O4LA 1SEQH 5D7KD 5F44A 5K9OB 2V6HA 5FYKE 4FFVD 1GAFL 4R96A 2I5YH 2W0FB 4JY6A 1JNNH 4YNYB 5JXEA 4J2XA 1XIWD 4RGOL 1MCWW 3MSPA 2X4RB 4JAMA 1CGVA 5C0AE 5IQ9B 2XZZA 5EOTA 1I9IH 1MHEB 1DLFH 5D70H 1G0YR 2JJVA 1D5BB 3VH8B 2I60L 5EO0B 2EDXA 2VR9A 4GQ9L 4LMQI 3HS0B 5DGQA 4N8VB 4YDVB 1ZKAA 5EULV 1TZHB 1WICA 2R4RH 4GUPA 4GW4A 1HCVA 4WW2F 2XTJC 4Y5XB 4HKBA 3F62A 3VFMB 3X3FH 2LABA 4RMQA 1KXQE 3I02B 3N0PB 4JN2B 4YDLC 3RVWC 5ACZB 3WIFB 3RIAF 2A9NL 2EH7H 3PV7A 3TBSA 4EN3C 1LILA 2OJEA 5DUML 1DFBL 4XPTH 5IROA 2NW3B 1GC1H 3C5ZC 3SBWA 1WFUA 1QR4A 1F11A 1F8TL 4KK9D 1K4DB 3MRDA 1OGAD 4HS6A 4UQ2B 4V1DD 4R26H 4HWEL 2OM5A 4JZJB 5IFJB 1ES0A 2R2BB 2R2EA 3UTQB 1OM3H 1EEQA 3RGVA 3IFOA 1F3RB 3C2AL 2F58H 1B3JA 3MUGB 4M7JH 5CINL 3RDTB 3NIFE 5IOPA 4HGKC 4QRQA 5LWYH 1KF9B 2EICA 4R90L 1NSNL 1JPTH 4R4FL 4LHUA 3OR7A 2AGJH 1O7SA 3BP4A 3CSBA 3DMMC 2RIKA 1ZT1B 4ONFH 2CDGA 3LKOA 2XZCL 2CDGB 1BQSA 1BD2E 1HYSD 1UEYA 1GOHA 1T89A 4PP1C 3ILQC 4TUKH 4APQD 2ZUXA 1S7QA 4LCYA 2OSLB 4KK9C 3IU3A 4LLUA 3GSVB 2VIRA 3P77A 3WMSA 1IGFL 2FH6A 1G6VK 1Q0XL 3VD7A 2VKXA 4KDTA 5EZIL 2X42A 2ADGA 2NY5H 3M07A 4PJDE 2Z8RA 2ADGB 5ENWB 3QXVA 5DURD 3N9GL 3FO1A 2O61A 5JW4M 4JJ5B 4LVHB 3IJSA 1OAUL 3TV3H 4RAVB 4IOIA 1ND0B 2WBJB 4WRLA 3R1GL 2HKHL 2JCCB 3DMMD 3H7LA 5DT1L 3OAYH 1U91B 1AKJA 3LCYA 4F7TA 2ZJSH 3G6JA 4GLRI 4XP1L 1QRNE 1GJIA 4RAHA 3FTGA 4IEFB 1EO7A 1KNOA 3TIEA 3NZHH 5DZNA 3ROOA 1NBZB 4JM2C 3EYOB 4G43A 5AZ2L 5GS1A 1NFDA 1T3FB 2PTTB 5EU6A 1BQUA 1QSEA 2H6PB 3IJHA 1QNZH 3TWCH 1S9VA 4JCLA 5ACLA 2PKDA 2XA3A 1U0QA 4NQDA 4A6YB 4KHXH 1GC1L 5CS7A 4JHAL 2PN5A 3VXSA 3JBG7 3C08L 4K8RL 1X5AA 2A0LD 4ODHH 3WFZA 4RMTA 1QYGH 3PGFH 5BW7A 1V05A 2XWJA 2NY1C 2XQBL 4TVPL 4LHUG 4EEEA 4JLRA 1WZ1L 2AV7B 1UZ6E 3AMLA 4HK0B 1NQBA 1PG7W 2XRAL 3MRPB 3OXRA 4ODHL 5ANME 4LEXL 5C1MB 4J3XA 5BW7C 2B4CH 1VPOH 4QHNB 2R0WL 3UTTD 3Q2CA 3D2UB 4JQXC 4YLQT 2G60H 2CLVB 2OZ4H 3HC4L 3PWJA 2P48B 2DD8L 4N8CH 2MHAB 4OUOA 2KZ1B 3B5HA 1TQBB 1AIFB 1BZ9B 1ZHBB 4M7ZB 5FKPB 4JQXA 2YBRB 2XKNB 4MA3A 1K2DB 2VABB 3LN5B 4NP4H 3KJ6L 1OT1A 3S96B 4HCRA 3X14B 3ZL4L 3QRFM 5I8EA 4WW2B 3JV0A 1TZHA 3IKCB 3QPXL 1J0KA 3CVHA 3AUVA 4J4PD 1DLHB 5EIIB 3ILPA 4RBPH 4JKMA 1WT5A 4UV7H 4XNYL 1KIQB 1JUFA 4Y16C 3C87A 5ESAB 3DHJA 1NMCC 4ODTL 4K3DH 4K2UL 4D0BA 3VWJC 4PYHA 5L8JB 1CLOH 1F11B 3WXVH 2EYSB 4OLUH 4OZ4B 2XQYG 5EORH 2ZUVA 2R15A 3BAEH 2CDEA 3TIDB 1FFNB 4KAQH 5EBWB 3FN0L 5CBAB 5D8JL 4KJQD 3BESR 2Q3ZA 4KUCF 1K5NB 2G2RB 2XFXB 3BH9A 5T33H 3SQOH 5A2KH 3VXRB 4X80H 4L5FH 1KGCE 4QT5A 1JF5A 5GS0D 2VLKA 3MNWB 4PRPE 3P0YH 4PBVC 5GGVY 1AJ7H 1CFVH 2P1YA 1MNUH 1T20B 2NXZB 2AKRB 3PHOA 1BZQK 4C4KT 2VLRB 3LMJH 4IDJH 4MAUL 4M7KL 5HHOE 3SDCB 4PJDB 4MZ2A 4NSKA 2YOCA 3V6FB 1SJHB 1MVFA 4ZS7H 4KI5E 3BN9C 5E2WL 5ICXA 1FN4B 3MLYL 1KCSL 4P3DA 4U7KA 2BJML 4XZUA 5D7LE 1DP0A 2R9HC 1GH7A 1JGUL 3ZE1E 5E7BA 2X70A 4XPGH 1AGEA 3DV6A 3WFDL 3UBXB 3KLDA 1YJDH 4L3EA 4ZS6C 3L3GB 3WL9B 3MA7A 1CGSL 3PWUB 5J9PB 5ISZE 3OKKB 1ZHNB 4JM2F 2ITCB 4U33A 3KPNA 5E8PB 4FOMA 5D96C 4K7PL 1P1ZB 1IC5H 2HTKD 2K7QA 1OPGL 3KLHD 1NCAH 2R4SH 3BPCB 3NBNA 3VMNA 3X11B 4HD9A 4LRIA 3O0RH 4H20H 4ODBD 3F7YA 4QRRB 2F8OA 1MVUA 2AXFB 1DANU 2ZNXA 4KJYB 3BGAA 1YMME 1QUNA 4G8FB 2R9HD 4MQ7A 3TZVB 3GNML 5ITFB 4Q2ZB 3U82B 4HIEB 4HUKB 1HXYB 2UWEA 1CK0L 1NBYA 2DMBA 4O58H 4RGND 3AAZB 1XCQB 3ZT6A 4UTBH 4LGPB 1EV2E 3MODH 3HE7A 4GRLD 1S7XA 1A6ZA 4MQTB 2YD8A 1WTLA 5L7XH 1AGBA 4P5MA 1UZ8B 2GUOB 5CIPA 1Q94A 3RDTC 1V3KA 1PSKH 4NQDD 5C8JA 5C8JB 5DQ9A 1NGXB 4R0LB 2NXYD 4LKXB 5IHZA 1U8MA 3ARFA 1I1AA 1B0WA 1S7SA 4WO4C 4F9PA 2DM2A 4Y2DB 5JDSA 5DMIL 3DVGB 4OLZL 1HILA 3N1GC 1UACL 2P8LA 4DGYH 3TLRA 3WHXA 3BW9A 3JWDL 5EUOB 3S4SA 4LDLB 1JI2A 4F8QA 1NDGA 4NN7C 5D8JH 5BVPL 1UWXH 1HQ4B 1H8OA 1WTGT 3F7QA 2FB4L 5C08E 3S36X 4AY0A 2ARWA 1KELL 3BEWA 1P7KA 4WFHE 1QRNA 5AYUH 1CLOL 4PS4H 3WXVL 3F7RA 4Y4KD 3EYVB 3VA2C 4LIQH 4OFVA 1FZKA 4OAWB 4NZTL 1ZLUK 1FNFA 1FORH 5EUOA 1G7PA 4TOYL 3WEXA 35C8H 4LSPL 2VXVL 3MJ9A 4PJBF 4PJ9D 4CL7A 4NQEE 1WF5A 2IPTL 4RX4A 4EIGB 1LWRA 4RWYH 5EFIB 1D5XA 1NAKL 1QSEE 2R2HB 3QDAA 2DQTH 1L6XA 3VXNA 5HSFA 4NNYB 1NC4B 4JM2B 3HMXH 1QSVA 1X5YA 5BOPA 5JDSB 1G7JB 4YEFA 3MOQA 5C0CA 1VACA 4GXUM 1J10A 2B8OT 4JFEE 5EBMB 4E41E 5C6WH 3NABH 1MWAL 4JQIL 3WNOA 3STZA 5HGBA 4K23H 4P4RB 3WD5H 4A6YL 3EHBD 4DKEL 5I1KL 1BZ7A 1OGAE 5JXEC 2AKRA 4OV6F 3DX8B 4U1LA 5DD5H 3SDXE 5ISZD 4PJIE 2NY1B 3PDOB 4G8EB 1OP3K 1X5JA 5FUZL 5TPWL 3BP6B 3ZMRA 5EOCJ 3V4PH 4KKCC 4OQTH 3V5KA 1H15A 1T2JA 2P5EE 5F9JA 2HJLB 2N7AA 1D6EA 3I9GH 4IRJB 5HGAB 4KC3B 1EVTC 2BC4A 2VUYA 3PL6D 5J3HD 3O4OC 3QEQD 2J4WL 4R7DA 4K8RH 5B3JF 2G75B 3MLZL 2HAZA 3ULUL 4IOFC 2VLKE 3LKQA 2X10A 4WU7B 4PJ5E 2CKNA 3PJSB 3L5IA 3DVNB 4P2QD 3MFFB 4U6TA 3RPIA 3K80A 2AQ1A 5CMAA 3C9NB 4X6CE 4Z7UE 3GSUB 3T65B 2X4QB 5E8NA 3EO9H 3CXDH 3AS1A 3HE6B 2J88L 5TE6H 4ORGA 4J3VA 5F6HJ 5KVEL 1ZWIB 2Q86A 3SE9L 3SDCD 5JOFB 4NRZA 2EDJA 4HMEA 5L0QC 5EC2A 5E08H 1NMCB 5FHBL 5T3XE 1FBIL 4U3HA 3IFLH 1XR9A 3NA9H 1SJEA 5DJ2A 3QFJE 5CJ8A 3EDFA 3RKDC 3VWJB 1KTLB 1BHGA 3VXSE 1PW3A 1ZVSB 5CGTA 4CN4A 2R0KL 2C1OA 2QLVB 2N56A 3SDYL 1PLGL 3U46A 1NH6A 3BRDA 2ZCKH 1CLYH 3WIHA 2D7TH 3PE9A 3BX7C 1IM9A 2JF1A 3GKWL 1JHTA 1S9YB 1ZVYA 3O3UN 1X6LA 5I9QB 5FCUL 4UAOB 1T20A 1IGFH 3FQTB 3AVEA 5JZ7D 1GOFA 4CGTA 2QQLH 4L3ED 2Y07H 4J7RA 2IQ9L 4B0MM 4KJPD 1JRHI 2ZP0T 4QRQB 5I71B 4ZUWB 2RGSA 4JGJA 4QHLB 1UM4H 5CLTA 3VH8G 4DN3H 1EK3A 2R56H 3I6GA 4Z7QE 1WK0A 2X4UB 2DJ4A 4UZGA 3MJ6A 4GJTB 2F15A 1EJOH 1KPRB 4KHTL 4QOKA 5IHBA 3MLZH 4QHNA 3ULUH 5C08B 3TVMA 3K1KC 4HULB 4RGNB 3KPOA 4KKAD 2VDOH 3CH1B 3WXWL 1CDGA 2D31B 3FT3B 1BQHG 4NQCA 5EUOE 5GS2H 5GGTL 4YC2C 2OL3L 1KN2L 3RWEA 1FCCA 1MLBB 3S3PA 5D96B 5GZOD 4N9GB 4NZJA 4BH8B 2EXWD 3TA3B 1YN6B 4FZEL 4RCAA 2FR4B 4G3YH 1YN7B 2I27N 2FR4A 3QUML 3RTQA 2MQ3A 1I3RB 2DJUA 1C12B 5F89A 3WD5L 5J57B 4HH9A 1A6TA 4HLZG 4Z7NF 3MGTA 2V5MA 5IKCB 1GHFL 1TPXC 1IT9L 5GZND 4X9FA 5JPNA 4Y5YC 1P53A 4G3YL 3ZKMD 4KKAC 2F5BH 5C7XL 1KIUA 2I5YL 4PYGA 5F70A 5BQ7A 4JY5H 5K9KA 2ESVA 1BECA 1GGIH 4NKDA 3D69A 2Q7NA 3VCLB 4CN6A 1Q9OA 3N1QC 3TIDA 2EE2A 1WCQA 2X1OA 2VN4A 5IJVB 5I1AB 3MV7E 3BDYL 3NIGF 3K4AA 1UWGH 1AD0B 2Q20A 2EDDA 3MRQB 2EDYA 4O9HL 4R0LC 4Y88A 1KSRA 2Z8VC 3MCLL 1DE4A 4U1SB 3DRQB 3TYGH 1U95A 32C2B 3H42H 5LQBL 1QR1A 3ZDZF 2ZUUA 5B8CC 3VRIB 3ELAT 4XNZB 3GZKA 4GAGL 3UTTB 3EOBA 4XNQA 3QH3A 3QQ4A 3CMOL 2DI7A 2VR4A 2QTEA 1WC7A 1NDMB 4FQHB 5TDOB 1UM5H 4HCRH 3UAJC 4PTTA 2HJLA 3PL6A 1CDHA 1P4LB 3CXHK 3NCCB 4HGWB 1YNTB 1XAUA 3RI5F 1F2QA 4A2MA 1YEIH 2NPLX 3CMOH 3FRUB 3LEYH 5DJ0A 4C59B 4HUXB 1I75A 5CGYC 1HINL 1UM6L 4W70A 2PW2A 2NY1D 5I19L 3BIKB 4WU5A 5B3JE 3U4BH 1KPUB 4WFHD 3CU1A 1KTDB 2DQHH 4V1DE 1MJ7L 4U1JB 3UTPD 2R2EB 3EOTH 4AMKL 4P2QA 7CGTA 5C6PB 4DAGH 3IDGB 5K9OA 7FABH 3PQYE 3B2UD