4ZTPL

Fab structure of rabbit monoclonal antibody r53 targeting an epitope in hiv-1 gp120 c4 region
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
216
structure length
216
Chain Sequence
GPVLTQTPPSASEPVGGTVTIKCQASQAIDEYLGWYQQKPGQRPKLLMYYASTLASGVPSRFKGSGSGTQFTLTISDLECADAATYYCQNYYVGSSTNYAFTFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of Fab fragment of rabbit monoclonal antibody R5
publication title Structural analysis of a novel rabbit monoclonal antibody R53 targeting an epitope in HIV-1 gp120 C4 region critical for receptor and co-receptor binding.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 50
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2015-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ztpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ztpL01
3GMRB 2F5AH 2X44D 3Q6GL 3NCYS 5DZNA 3UJJL 1JVKA 5FO7B 5A16B 2OS7A 3PWLB 2X9WA 3ZHKA 4MJ5A 1YC8A 4NJ9L 5ICYA 3AMKA 5TDNB 5LQBH 3HZYA 2P24B 2DLIA 4J3OC 4RFOL 4Y5VA 1U0QA 4YDKH 1P4BH 4Q9BA 3T0EA 1U6AL 2FWOB 1W72L 5IW1A 1FO0L 3H6JA 4OLZH 3V4PH 3VE0A 3DECA 2JJVA 1RFDL 3EKCA 1RZ7L 3BXNB 3ZKQD 5EFIA 5IJKA 4MA8L 4PFEA 1UKTA 1JZ2A 5BRZA 4DKEL 4HT1L 4P5TD 5DVMA 1K3IA 1ZVHA 2BNQD 3QNYA 4BKLB 2ADJB 1NBYB 2CPCA 3NCJL 1H3UA 3MRPA 1UXSA 5L2KB 5DK0B 5CD3A 4CU7A 4Y4FD 3JXAA 4X5XB 3RVTD 3AY4C 4RBPK 4OZGE 1AR1D 3MLXL 5DMGC 1XCQB 4G8FB 4YFLI 1CBVH 4P2QA 1G6RA 1H15A 3U4AA 1QTYT 1UJ3B 1NAKL 4JG1L 1XCTA 3TNMA 5D2LB 2R1WA 4Y2DB 2D7MA 2BVOB 5DXWA 5CGTA 1EFXB 4F7CB 4QTIL 2W9EL 3WFEL 1FAKT 3G6JE 4NO3A 1UM6H 4I8DA 2Y9RT 1BM3H 1EBPA 1SJEA 3AU1A 4OV6F 1U93B 3VXSB 3R06B 1BJMA 2WUBL 1AO7B 5IB5B 5HYEA 1WFUA 1RVFL 1RD6A 1U2HA 2HT3D 1FC1A 3CU7A 4S0SD 1XGPB 5BZWB 5C0AA 4AG4H 4U33A 4G6JH 2NZIA 3QI9D 4I48B 3QCTH 3X3FL 4IM8A 3QQ9D 3WUZA 5C6TL 4YUEL 4OIBA 4P5KB 1WAAE 3KPNB 4XTRC 3CSGA 4QWWD 4LQFH 1E27B 1IC5L 1RJZB 4OLYL 4OCRL 3EFDH 4KKNA 2FLRT 4HW6A 2QQKL 4QHLA 3B5TA 1QSEE 1H8SA 1OWWA 2EH7H 5EOTA 2NMSA 3RGVA 4JEGB 3VU2A 5DJ8A 5D6CB 4IS6B 3VI3E 3D9AL 5HDLA 1RUQH 5D7LB 4KRNA 2XY1A 5T3ZL 4O2EB 1CD1A 3MO1B 3WFCL 1T0NA 15C8L 2H6PA 1V5JA 1VDGA 2UWEB 3CU1A 3LIZL 4LCUA 4XT1C 1YEFL 4OUUB 3SDXF 5I75C 2FZ3A 3MLRH 3B6SA 4P57A 3G04A 3LPGA 4K2UL 4JKKA 4HS3A 5DHVH 5ENWA 1MHCA 3D39E 2AQ1A 2YD2A 4JGUA 1ETZB 5DD5L 5DVNA 2JCCB 3IJHA 3MUZ1 5JR1H 5KW9H 4QRRA 1YNTB 4HJJH 4LHUB 1BQLL 4HFWB 5E99H 4L4VD 4PGCB 5JIPA 3V2AR 1NCWL 4L3CB 1YMMD 1RUPH 2RCSL 2ZCHL 3VXPB 5IV2B 4OKVA 4GKZA 4U31A 4N5UA 4KGJA 3MOAL 4ELKB 5I1JL 2OX5A 5IG7B 2NW3A 1XMWA 2UZXB 4F33A 1ZHKA 4GG6F 2Y72A 3UPRB 4KZEL 4KUZL 3GFUA 4L3EB 1CL7H 4H5SB 5EZOH 1KCVH 3MGAA 1NGPH 4RWHA 4ZS6D 3VXRB 3I6LD 4UOW0 1G7LB 1M7IA 3WLWC 4UV7H 2CKBA 1JUFB 4U1HB 5HYSA 3GMNA 2Y23A 2LU4A 5E8OB 1E28B 1LO5A 3UYOD 2BY3A 1QSZA 1XGTB 1C7TA 4L9LA 4WI5A 4WI3A 4MAYC 4DTGL 3T77A 2CDFA 4K3GA 4OI7A 4JZNA 2CIIA 1EHLL 4NRZA 4BSJA 3MA7A 3ULUD 3QISA 2OL3A 2Z8WC 3G5YA 3RWHB 3SGDI 1TITA 5IVXE 3CSBA 3N85H 3Q5TA 3IJYA 2VLJD 3HUJA 3ILPA 3IETB 4MDIA 3GJFK 4MNGE 3MODL 2H3NB 4KRPB 2JELH 1T0MA 4XPBL 1DQTA 1X5FA 1REIA 1OD9A 4PS4L 3S34L 4P3DA 2FATL 1EX0A 3S5LB 4YHML 2G60L 2XN9D 4KAQH 4UT6L 4WGWB 5D72H 5IR1B 3HFMH 1XGYH 4HC1A 1PVHA 1JWUB 4Y16B 4PJDA 4HDIB 1QQDA 1ODAA 1SQ2N 4KK9C 5M95B 4FQJL 3UTQA 4XMKL 3JZ7A 1E6OH 1K8DB 3PWJA 3KYNB 2AXGA 3WFBL 1HSAB 1OTUC 4P9ML 4TVPH 1CD9B 3I3BA 3NFNB 2G5BB 1WK0A 2YPKB 3VFWA 5EOQL 1DUZA 5H2BA 4UV4H 1GPOH 1C08A 2IG2L 2N7AA 2AI0L 4IRSC 4K3DH 4P2OA 4PJ9A 1LK2A 2CR6A 1FNSH 4R4FL 1RUKL 3OJMB 2XPGB 3T65B 3ZE2E 3HE6A 4PJGB 5JZ7D 1S7RB 1SM3L 2DWDA 3IDIB 4MDJB 4YO0A 5F7EL 1MHEB 1FFRA 5T33L 1JGUH 2MJWA 3IDGB 4GW5A 3RPIA 5CBAA 5I1EL 4G7VL 3QRGH 3ARDD 4KVNL 4MHHI 3K1DA 4HIXH 4A2LA 4TNVK 3SDAA 4YHYC 5KANG 4TQEL 2AABL 3QRFM 1SY6H 5HHMB 3LN5A 4NQXA 4Y8AA 1Q9OA 4LCWB 1R3IL 5CD5C 1RIHH 3H2WA 2B1HH 3U0PA 2APTA 4IDLA 4L4TB 5FYJL 3GHEH 5CZVH 5TE4L 4X6DF 3O9WC 1CICB 3LV3A 4IOFC 1S3KL 3MC0A 3NIGF 3FO1A 4YWGL 5JXED 4MS8D 5I1AB 5TF1L 2EXYC 5IOPA 3QFJA 1R24B 3FQXB 2CK0L 1SEBA 3SY0B 3TFKC 3ZDXF 1QLFA 4LDLB 1N4XL 4Z7WB 3A6OA 1DBAL 1OPGL 4G8IB 5A1AA 3EDFA 2GSGA 5IMKA 3SCMB 4O5LH 3WHXA 1F90H 1EJOH 4KKBD 3MNZB 5DWUH 4KJQC 5AUMB 1K2DB 2BZDA 4XBGB 4UDUB 5IBLC 1RY7B 3GB7A 3CSYB 4P2RE 1OP3K 4LSTL 4IMLA 2V17L 1NUGA 1VEPA 1G1YA 3KDMB 4M48L 1PSKH 4BZ1H 2RB8A 1LO0L 1NGWA 4KZDH 3AXLA 3QXTA 5IFAL 2X1XR 1B0GA 1KC5L 2LABA 4HUVB 5BJTA 1BFVH 3C6SB 1QR1B 5GSRA 3KS0J 4MJ6A 4XAWL 4ZUWA 4NWTH 4P4KC 1EHNA 2HT4C 2XZAH 4GO6B 4D0CA 4ODTH 4YHNB 1U92B 3QIBA 3V7MA 5F70A 3MZGB 3LHPL 2XFXA 2AK4E 4NHCH 2JK5A 4D0DA 5I1IH 3OB0K 1KB5A 2UUDK 5J1AB 3QHZL 1VPOL 3QQ4B 2HLFD 5FM4A 4PLJD 1DLFH 1ZGLB 2MKWA 4N1EA 2FNBA 1XT5A 4LSDA 4K94L 4M1GH 5DQJB 43C9A 1ONQB 3EYUL 1QSFE 3L6FA 4U1IB 5I2IA 2CIKA 1C7SA 2P44B 3MACH 4E41A 2F54D 1TJHH 2QR0B 5J6GA 3SEPA 3SHSA 3VXMA 5E6IB 1TQBB 3HUJF 3FT4A 5JHDA 4PJFE 2W60B 4ISVB 4NO0A 3VWJB 5CUSL 3AREB 1CXHA 4WUKH 4DZBA 3L3GA 1X4XA 2UY6A 4JANB 1TVBB 1QNZH 2HH0L 3PV6A 1AFVH 2YK1L 2C26A 3BZEB 5HVWA 5LWYL 1MCDA 4LLDB 4M7ZB 1K4CB 4JN2B 2GK2A 3QH3A 4X99A 2DQCH 4PJDF 3D0LB 5I30L 5FUOH 1FRGH 2B39A 3LKQB 4ZQKB 1Q9LB 4NBYB 4NQEB 3VXUD 1V3LA 1B4JH 5I8KH 1M7XA 1XF1A 2C3HA 1UWGL 2E27H 3VDBA 1OAYL 2GY5A 3F62A 4Z7VA 2GITB 3TZVB 4RAUB 3DUSB 4O2CB 2XTJE 3FQUA 2SEBB 1DVFC 4EI5D 1RZFH 4XVUC 2I07A 2YMXL 2W1NA 1FSKC 4OLUL 5DC0A 3VFGH 1MCQA 5H94A 5I16B 1LE9B 1DLHB 2JIXA 1TDQA 3HMXL 4XNUH 1YEGL 3B2UD 2BNRA 1Q9KB 1I8MB 5KS9E 3FQNB 4BQBA 4N9GA 4LGPB 3UTTD 2QSQA 3KNBA 4Q97A 3VFPA 1QPXA 3KPRA 3WO4B 2YKLL 4PP2B 4NM4H 5DGQA 1A6ZA 2IGFL 3B9KA 1R3HA 5BZDB 1HYSD 2EE2A 1INQA 4NBXB 2ITDB 4MXWH 5J12C 2AJUH 4X98A 3WIHL 4GQ9L 1PEZA 4MXQC 4L29B 2ADGB 2CD0A 2BFVH 5MEPB 1C5DA 3VD7A 1FE8L 3O6LH 5GJSL 4R4BB 1JN6B 4X8XA 3V5HB 1P7QD 1NCNA 2VLKB 4GRLA 1RV6X 2AJZB 1KJ3H 1SVZA 1OLZA 3NPSB 4PRHB 1TVHB 4KPHH 5E9DA 4YHZL 2PR4H 3WS6A 4PUBH 3QDAA 4L1DA 4YDJA 5LGKA 4S1RH 4G3YL 5JOFB 1YPZA 2AV1B 5IKCB 5AAWA 5ABDE 4WI2A 4HPYH 3D25B 3GGWB 4Z5RA 2HN7A 3ILQC 4HHAA 1NAMB 2IAND 1U3HC 4X83A 4XP5L 1IKNC 4HH9A 2WUCL 1SYVA 2ATKB 5JPNA 1MCEA 1AJ7H 3PDOB 5HYQB 1KFAL 4C83A 1UM4H 5GQBA 5DD1L 4PB0L 3I3EA 4BH7B 1S7TA 3NCMA 4LSPH 3X3GL 5BO1L 1RUML 1T83C 4TVPE 4LVNC 5KSBA 1NMBL 3L3HB 4NIKB 3GJFH 2DQHL 3T08A 4LQ1A 1LO3L 2CLZA 1OT2A 3MLPA 1DBBL 2H32A 5KSAB 4PJ7B 3T0VA 1Z9SA 2VN4A 2BY2A 3LS4H 3X14A 5M7QA 2ZUYA 3FN0L 3QXAA 3EJYD 5ACMA 2BVTA 2Z31C 5TGBB 2YZ8A 4DN4L 1B0RA 5F72S 1P6AB 3E0GA 3DV4B 1UCBH 3PQYD 1RZIB 3C60C 4JKWA 2A2QT 4XC1H 3C8DA 5IBTL 2Q8BL 2FGWL 1NL0L 1HHJB 4WNQB 1VB9A 3P4OA 2OMBA 1BIHA 4NQCE 2MHAA 1CE1L 3S35H 3PGCA 4OV5A 3PJSB 3V0WH 4M03A 4OGXH 2XWBB 4NQDB 4U0RB 3E2HC 1T1WA 2AJSH 4GRMA 3WNOA 5C0NC 5DMKB 4IRJC 2VQ1A 4GAGH 3SDCD 1EEUA 3RWDB 3BT2L 4BK5A 4Z7QE 5J11C 1A64A 32C2A 3MJGX 3Q6FB 4OZHE 4P4RA 4OCXH 4PGBB 1D6EB 2YD8A 1I9IL 4JRWA 5C0CB 1A22B 3ARGB 1LMKA 3VFOA 4NZUH 3C8KB 1BFOB 4OKDA 6FABL 5SWQA 2D0GA 2QQKH 1OP5H 1MSPA 4POZC 2EYSB 4JY4B 4AIXA 2M2DA 3G5XA 3UTSB 2APWA 1XR9B 4AK1A 2X70B 3QUML 3U4BH 4BFIB 4KJYA 1H8OA 3EGSA 1QPPA 4OCWH 5DYOB 1Q72L 3OR7B 3QUXC 2YD5A 3DVFA 4MXVF 3U7YH 2HLAA 4GAJH 3LN9A 3IDXL 1MWAA 2KBGA 2NY7L 2ZOKA 4ZYKB 3HZMA 5LJYH 3LRGA 1AP2A 4R7DA 1I3UA 4XX1G 1MAML 5DZLA 4DN3L 3MRDA 3W5MA 3ZT5A 3F6IA 3KPSA 4DW2H 5EZIL 5GGVL 2J8HA 1BIIB 1AO7E 4RZCB 3SDDC 1FFPB 3MV8B 4EI6A 4OD1L 3LSOA 4S1DD 2OBGA 3QEGL 5DK2B 2ENYA 4OM0L 1F45A 2ZCKL 5FM8A 2AJ3B 3ABZA 1DN0B 3L3JA 1W0VA 1C1EL 2AKRA 5CJBA 1FORH 5E1AA 1X5JA 1E4XH 1G6VK 4TNWK 1GGBH 2HT2D 4CN6A 1EGJA 3BI9X 1Q9WB 1NMAH 1P1ZA 1M6OB 2PXYA 3O41B 3F12B 5B39A 4X5LA 2P5EE 2ZSWA 1K5NA 1ZVYA 5TQ2H 5FO9B 1TNNA 4JPIB 5EZJB 3BQUB 4D2NA 2X4SA 4NM8L 4ZFFA 1EUTA 3JUYA 4KJPD 5FCUL 5GGRA 1H5BC 1QFWH 3VWKC 1P53A 2PO6D 4NQVA 1UACL 1FL5B 3GBNH 3MV7A 4OQTH 1YYLH 1T3FA 5CILH 4MVBC 1ROWA 3Q2CA 2WP3O 2NLJB 3VFNB 4IDJH 4R7NB 1WEJL 5I8EA 2X6MA 4Y5XB 1P7HL 3EHBC 4JFPA 3TIDA 3PV7A 4PRDA 2P7TB 4YBQC 2APXA 5FEBA 3FB6B 5D2NC 2CUHA 3A6BL 4AY0A 4JR9L 1YY8A 5CBEB 4QCIB 2ICES 3T3PF 3KVQA 3PIQB 5EU7E 3PWPA 4JJ5A 1AXIB 1JNLH 2H2PC 1KG0B 2OQJA 5EZLA 3MLUL 5CSZB 3OB0H 4OCSH 2BK8A 5F96H 4Y7MA 4NN7C 4AMKH 3WL9B 3VJ6A 1XIWD 1HZHH 1SYSB 1L6XA 3FB5B 4FXGB 4CDGC 4U6TA 5FB8B 4FFYH 3TO4B 4LHQB 4CJ1A 5B8CC 1HI6B 3DRTB 1QRND 1RI8A 2W92A 3C09C 3KJ6H 4XXCC 5E7BA 1A14H 2GJ6D 1JHTA 4ZD3L 2G75B 3QDMB 3SOBL 3HLAA 1YN6B 1YEDA 2QQLH 2VDNL 1RJYA 4OFKA 4QRUB 4JZOA 5KSBF 1AKJB 3ZKSD 3LKPA 5GGVY 1MCPH 4KKCC 2B8OT 1II4E 2MFNA 4JO4H 5TQ0L 1R5WA 5I1CL 5DUMH 1F8TL 5ID1B 1IAIH 3DBXB 1FNAA 1Q0XH 5EA0L 2N4IA 3INUL 1OCWL 4R0LB 2FEEI 1BJ1J 3OTTA 1D5IL 3ULVL 1KCRH 4WDIB 5I73B 5ADOH 4JB9L 5BS0A 5IT2H 3QNXA 2IPKA 5E00B 1L7IL 1MI5D 1SHMA 4HZLB 4ZFOA 1JZ4A 3D87B 4KDTA 1JF1A 1ZWIA 1NAMH 3G5VA 5HYJD 2AXFB 3LEVH 4LSQL 2NX5D 1KJ2H 4KUCF 1F4WL 1UVQA 4Y4HA 1PZ5A 3RVUC 3UBXI 3CGTA 2Q3AA 2YPVL 4HUXB 1VGEL 5DJZA 4HWBL 2GTZA 3CCHB 3GSUB 3QWOB 2QSTA 3L5WA 3GMMA 2BNQB 4UQ3B 1IGYB 2E7HA 4YHOH 1DQDH 5GS0H 5C07A 1NQBA 1YEJL 3MRRA 2NZ9D 5FOBA 5KSVB 5CZKA 4KK8D 1XF5A 3B5GA 5CWSA 5ILTL 4XGZA 3RWGB 4P0DA 1MEXL 1MVFA 5EUOB 3R0NA 1R0AL 3STLA 1HHHA 3DXAE 1BOGA 3QUYD 4GFTB 3RKDD 3D3VE 3CZJA 4PJIF 5IP4A 3FAXA 4JFFA 1NCDL 2EE6A 3DRQA 4PJBF 3F7YA 1JF5A 3HE7D 4FFVD 1J8HD 1CQKA 3W39B 1T20B 3NH7L 2NY6C 3REWB 1SJVA 4XAWH 1HHKA 4PJHB 1H3VA 4L4TE 4N0FB 2J5LB 3BVNA 1F2XK 4HS6A 4X7SL 2BY1A 1MREL 4WWID 4NKMA 3RVXD 1NGYB 3RZWA 1KEGH 3NA4A 3F7QA 4MJIE 4ZS7L 4JFEB 4JFYA 4LCYB 5CJQL 1PY4A 1FYTE 5IIEA 5C7XL 5JLZB 1UADC 5L88L 4AH2B 3F5WB 3CMGA 5B4MD 1OTTD 2NXZD 1N6QL 4KDVA 3IXAB 5GGTA 1T2QH 2L7JA 4Q9RH 2XZQH 4NPYA 4XWOC 3S36L 5CMAB 5HHOE 3TVMD 4MQ7A 1OM3L 3WIIL 3TBSB 2UVFA 1L0QA 3CLFH 1SMAA 4NGHH 3OAUH 4JN1L 1G7MB 4JFDD 1DE4A 5GS3A 1NJ9B 3LMJH 2VZTA 2DQFA 1A3LL 2J6EA 4C59B 2WM0A 2YC1B 2H8PA 4HLZG 4Z7UE 5LGHH 1CK0L 5EBWA 5GS2H 1I1CA 1A5FH 4HIEA 4I3GA 5EULV 4KRMB 4WO4A 2FEDC 1EEQA 3BYYA 1R3JA 2OR7A 4L4VB 1MCLA 4CVUA 2E6PA 5DVLA 2J7LA 5FECB 3MCG1 1LD9A 4K3EH 4BJLA 5J13C 5MENB 2XA8L 4LFHD 1INDL 1OW0C 5HD8D 4NC0B 2YPLD 4S1QH 2IAMC 3QCUH 3HI1A 3LN4B 3OKLA 4G9FB 2VR9A 4NSKB 2ESVA 1JGLH 1QG3A 1HDMA 4QXUH 5DD0L 3KYKH 1YUHA 4P4KA 4U6XA 4XXDB 4H26A 2DQIL 4N0YL 3P73A 2E9BA 1JTTA 5FYKL 1JHKH 4M6AA 3NABH 1XF4B 2R9HC 3UP1A 4CVXA 1OGTB 2CLVB 3VG0L 5C0BE 4U1KA 4XI5D 3FRPG 5FM5O 5SWZB 2ZJSH 2GKIA 4KTDH 4JDTH 1T5WB 3BKML 4DZ8B 5CSBA 4OF6A 2O26U 4NJAL 4X7DC 1ERNA 2J8UB 4MNQA 4JPWH 5F1SA 1CU4H 3CH1B 3RTQB 1IEBA 5GHWH 1HEZA 1XEDA 3KHQA 4WV1C 4QXTB 4P5TC 2DDQH 4X6CA 4WFFE 1MY7A 3FOLB 4QHMB 2WINA 1JZ6A 5EU5A 1LEKA 4Y4FC 3OX8A 4M93B 3DLQR 3RVTC 1AR1C 1D5ZB 1KF9B 3L3KB 4Q0XL 1P2CA 1CFNA 3BN3B 4JQVC 1OAQL 3UJIH 3V0AC 1QHOA 3TA3D 2HVJB 4XVSL 3QDGA 1A1NB 3RZCB 1PQZA 3K7UA 3VD5A 5HGBA 4I0PB 4APQD 1YQVH 1JBJA 4P3CH 2VDML 3MRCB 1IRAY 4XNZC 2R0KL 3N1PC 1U41A 1IFHH 3QBTB 5IGXH 1JPSL 2CDGB 4JCMA 1BLNB 4MA1B 2V7NB 4EDWL 1BGXL 3A67L 3QI9C 5DT1L 2WANA 4ZFZA 2NR6C 3DOSA 3QQ9C 2CGRL 4JY6B 1L9MA 3REVB 2AJXH 4N0CD 5TF0A 1EDQA 5F3HA 4MD5A 1I4FA 2AK1H 4OAWA 4F7PA 4QWWC 4MD4B 1IZKA 2HG5A 3RHWF 2A1WL 3DHJA 1VACB 5SWSB 4NZTH 1FL6B 2IALA 1CGVA 1KIQA 3HI5H 5DC4B 1S7QB 2F74A 3SJVA 4OZ4B 5CJOL 4XVJH 4M00A 3DVNA 5FAAA 5JHLH 4L3AA 4U2ZA 1T2JA 5C09E 3UTZB 3RUGA 1T1XA 3BPOC 4XNQA 1S9VA 4G9DB 4V1DE 4N8VG 4WFEE 5HDOA 1BVLB 4UT7H 1IQWL 3MXWH 4LRNL 5EOCJ 1AGFA 2R69L 3RIFF 4JRXD 4PRHE 1G9NC 5JUEH 4HXBH 4J6RH 4UUJB 5GRUL 2HA1A 3U1SH 4NBZB 2A74A 3O4LA 4X6BA 4EOWH 4P2OB 2P5WD 3HS0A 5DQ9A 5ANMB 4YXHL 3IS1X 4PG2C 3RA7L 2R8SH 4OLWH 1UB6B 1W0YT 3QIWB 3FFCB 3LQAL 3U4EA 3WE6B 2VDQH 1IM9D 2P4AB 1GAFH 3A6CH 3ES6B 2DL2A 5E6ZA 3NIFE 2D9QB 4AT6B 1B6UA 5D96B 3R8QA 4Y1AA 3EYQD 2KH2B 4YK4C 1VFAA 5CIPH 3VXOA 2EECA 3VW3L 2HKHL 1S7SA 3IDNA 2WBJA 5IB4A 2NXYB 1WBZA 2X4TB 3OKDB 1FFOA 1HKLH 1T83A 4YDIL 3LN5B 1GL4B 5E2VH 2AEQH 2ZKHH 2QSCH 4Y5YC 1LGVA 2FLBT 5MERA 4NNXA 3NPZB 1U8NA 1PFCA 12E8H 4FQCL 3RWCB 3H3BC 3AB0B 4E42B 1A21A 3UO1L 3WS3B 3T2NH 4PJ8D 5LAXA 3SKUD 3OHXB 1WBYB 5BRZD 3MV9E 2PW1B 3SBWC 3ULUC 5SV4A 1N7MH 4CMMA 1U8JA 4HD9A 4G6KL 2IBGA 5A2FA 4P5MA 3W9DB 4EN3B 1FIGH 4JQIH 3QFJB 5EWIH 2R2BA 5DTFB 1A4KB 3TYGL 1Q0YL 1WCQA 1OB1B 5C0FA 2EC9U 4P49A 2VE6B 3QQ3B 2VLRB 1D5BA 5H37G 2IH3A 3U7WH 3BEWB 5KSUA 1WBXB 2Q1EA 1QFOA 1EJ6A 4DEPC 1GC1H 3BKCH 3AAZB 4I3RL 3K8KA 5CAYB 1HHGB 1OQOA 1TETH 2DMKA 2VDOL 3SO3B 5AG8A 2F54B 5D4QA 1G9NH 5J4MA 3CVIH 3DURA 3ULVC 4P23C 2OCFD 1Q8MA 1FAIH 2GY7B 1FVCB 2IJ0C 1UB5B 5B39G 5C0AD 2Z8VC 3JV4B 1UACH 2VISA 5IESH 3T1WA 2MOVA 1NGWB 5B38A 3WSQL 3FQRA 4X6CF 2ZG3A 4O9HH 4G80A 2A83B 3RDTC 3V0VB 3QUXA 1CGWA 3L5XL 4XMPH 1S7WA 4LP5A 3P0VH 3H7BA 4MA7H 2QHLA 3I9GL 2VSCA 3ISWA 2BDNH 1Q1JL 4LSUH 2ZCLH 2LU3A 4CU6A 3MFFB 1JP5A 5C08B 3RGVD 1I9JH 5LBSH 1GZPA 1U8LA 3EYSH 4MHHG 1BF8A 2KZWA 3TESA 3ARDC 4WY7L 1BPVA 1FV1B 4UILH 3O2WL 4XZUB 3KJ4B 1WWBX 4L8SB 2V7HB 2VL4A 2XG4A 3ESVF 1HCVA 1IGJA 1WTGT 3ULUH 4P2CG 4ZD3H 2XRAL 3NACH 2ZUWA 3TWCH 4Y19B 3QEQA 3HNTH 4PG9A 5F71A 4WW2B 4QRRD 2NY3B 1U8HB 2ZZUT 2VIRA 5DRZA 1EAPB 1M71A 1F3RB 1KIUA 5IEHA 1Y6KR 4N8PA 2CMRL 4IJ3B 4ODVH 3EJZC 1CL7I 1NBZB 5E2JA 5CEYA 5I1CH 2EZ0D 2XWTA 1T22A 3GMOB 4NP4L 1BD2E 3INUH 3TV3H 3N50A 3QUZA 3TBYB 1MLCB 3QDJD 3DYPA 1DDHA 4KKBC 5CZXD 5EPMA 1UKQA 3LKSB 3O6MH 5HHNB 3EOAB 4M6ML 3HZKB 1R3LB 3RUGF 3IF1A 4F37F 3CX5J 1VKXA 3V6BR 3EO1B 4UMGA 4HEME 4ZOAA 4NO5B 5D2NA 3HMWL 1NDGA 2DBLH 4RGND 4QRPE 5IEKB 3MRIB 4HK3N 5JW4M 5CEXA 3G5ZB 3QFDB 2WIMA 1A7RH 2EDTA 4ORGB 1ZA6A 4J12A 1P5UA 1F4WH 4AL8H 1NC4A 3CXDH 1KIPB 3MYZA 1I9EA 5IB1B 4P9HH 5J3HD 3FO9A 4GW4A 3Q5OA 2I07B 4DOHB 4FQ2L 4U3CA 3KPQB 5HHQB 3FHQA 4XXCA 3PP4H 3H0TA 1WAAA 1AD0B 2F53B 2J3SA 5I1GH 2AJYL 2F5BH 4Z7NE 2C1PB 2P8LB 2HFGH 3C5ZA 5DMYA 4NHUA 2VXTL 4YJZL 3MRLB 1AIFA 4YZFE 3QB7C 1NC2D 1A6ZB 4PD4J 4LLQA 5J6HA 2DLFL 5ACZB 3QSKB 1FLRH 2K3TA 4OF5A 5INCA 4ERSH 8FABA 4PLJC 4OQ1A 5ITBL 3BW9A 1S7XB 4KTYA 1TQCC 2AV7B 2WBKA 1LP9B 3MGTB 4NCC1 4I13B 5EN2B 1N64H 1HNFA 4HIJA 2EO1A 3LZFL 4PY7A 4FFZH 1AY1H 3FMGL 3FFDB 4EVNB 4XH2B 2Z91B 3MRKA 4ODXB 4PRIA 2VABB 4PJ9D 1UZ8B 1HOCA 5D5ME 1P6FA 4R9HA 2VKWA 4LKXB 3HE6D 3BP7B 4Q74A 4KMQA 2EH8L 2GEEA 4B5EA 1U3YA 1ZGLP 5DFTA 4NFCA 2FJFB 4R96B 1BQHA 1FL3A 1G7HB 1C16A 1BZ9B 1MHHA 4E5XB 3EO9H 3VRLF 2BNQE 1YQ2A 35C8L 3T4YB 3BEVA 3TNNB 3SDAD 4PJEA 2NY2D 4N8CH 5IFJB 4LSVH 2Z35B 4DKFL 1NEZA 1JZ3A 5E08H 2VITA 1RJLB 1I7RA 4ELMB 5CEZD 5E2WL 5GGSY 3O3AA 4WU5A 2F58L 1T2XA 1E4WL 5KZCD 3IFLL 2PYEA 3CFCL 2A6JA 3KYOB 3U9PL 1KPVA 3OGCA 1CDJA 5AG9A 4N8VB 3SE3C 1S9WA 1RMFH 3KPOA 4YFEA 3WNNA 3GJEA 4BFBD 4EI5C 2NY4B 1MCJA 3FB7A 4Z0BH 4XCCL 3IVKB 5KG9A 3RVVC 3RNQA 4AEEA 5D7IE 3DX7A 1MJUL 5H35B 3TT1L 5IVXA 5I1LA 3ESUF 5DJCA 4WI7A 1MELA 2P42B 3IFOB 4NKQB 3QCVL 3P9WB 5D7KD 3IKKA 3PABA 5L2JB 5FXCH 3TF7C 3U2SA 3DSNA 5DFVD 3DETD 1G0DA 3O6FB 1JTOA 3WJLC 4H1LB 4ZTOL 4TYUA 3JWDH 2CJUL 5EUKB 3PL6B 2VOTA 3L3IA 2QHRH 1DTUA 1X5ZA 3ZL4H 4Z76A 3WNLA 4GKNB 1TLKA 4JREC 4HLJA 1FGNL 3L3DB 1IKFL 4LARL 3X12B 5FFLA 2ED8A 1FN4A 1JZ8A 1H9VA 1O7SA 4X4ME 3VG0H 4OZFA 5HGHB 2PO6B 3EIFA 3HMXA 2Y5TB 1N5YL 5D7JC 1KTRL 5IVNA 3AUVA 1GZQA 4X0KB 1P4IH 1DUYB 3T09A 5FF6A 4K23H 2FIKB 2X1PA 3U6RA 5TE6H 3QZWG 4LKCB 3QIBD 1X7QA 1BAFH 4HKXA 3BPNB 4Z18A 3HPLA 5IWLA 3C6LB 3R1GH 1LE5A 2V5SA 1FZMB 1I1YB 3UZVB 5J57B 4BFGA 3V4VL 5KVEH 1RK1A 4L4VE 4Z78A 1H8NA 1YMME 3BHBB 1EEYA 1CIUA 1NFDE 1T89A 4JM2A 3EW3B 4JHBA 4LLMB 4NQUA 3UCRA 3W82A 1DP0A 4FXKA 1XIWB 2IPUG 3KS0H 5HGAA 2OJEA 1VESA 4X7TA 3VFSA 4HGMA 1P5VA 3QP3A 4LLAA 4F7EA 1S9XA 4M5YH 1F58L 3LQAC 4HXAH 4E41D 3RU8L 5DS8A 5DA4A 2DQTL 3TIEB 1F3JB 1OW0A 4KK6D 2P8PA 5EIIB 3I6LE 2IAMA 2NY0D 1IAOA 4GRWH 5JHDD 1QLEH 4NO0D 3ARFB 3WMSA 3MRNB 2DD8H 3HG1A 4LEOB 2D31B 2E7BA 3SDCC 4JDZA 3V5KA 5I71C 1OAKH 3KPLB 3WJJC 4JDVA 4PJCB 3ULUE 2ZOLB 3H9SB 2D7TH 5CKGA 2HJFB 1CZ8H 5DJAB 4KROD 1MPAL 4K8RD 1RZJL 4WHTA 2VLJE 1B9ZA 3P9MA 4F2MA 1OGAA 2X4RB 3HC3H 5FDWA 5E8DH 4XNMB 3WFZA 5E1HB 4Z8FL 5EZLB 4QTHB 1C8PA 1QFPA 1A6PA 2HWZH 3BKJL 4NNPL 4K3JL 2OYPA 1IL1B 3EYFA 2XN9E 3O3UN 1PLGH 5F21B 2EDLA 4CL7A 3IDMB 4PGEB 1IJ9A 4WV1A 3V6ZA 2CRMA 4YIQA 4TSAH 4MX7B 4GKSA 2NTSP 2BJML 4H25B 5E8EB 3MLWH 1AGEB 2GW5A 3TJHD 1QUNA 2Y7QB 3SKMB 2X5PA 3FQWB 3DUHA 2JIXD 3DO3A 4LEXH 3NAAL 4KQ4H 1TMCB 5GS1B 5DI8B 2R1YB 3RL1B 1PJ9A 3CFKA 3KPRD 5D1QA 3BE1H 3STBA 2EO9A 2MCG1 1XGUB 5FKPA 5K9OB 4PJEF 2DQJL 4S1DC 1CFTA 3UC0L 2NW2A 3LKPB 3BGMA 5E94A 3GMLA 2AK4A 4I9WD 1INEL 3DROB 3GMQB 1A7PL 1ORSB 2ED9A 3SQOL 3NZHL 4HMDA 1G0XA 2Q6WB 3QUYB 1S7UB 4KH2A 1BEYH 4JAMB 5I76B 3FB8B 1YECH 5GSVA 4XP4H 4OD2A 3CFBA 5IK3B 5FGSA 4A6YL 3LS5L 4GRLD 4MSWB 2R56H 5C3TA 1HINL 3V52L 3MGOB 1KBGH 4HS8H 5E6IC 5I17A 1NBVL 3MYJB 1NGQH 4NT6B 5F7NC 4PRPD 3SKJL 1FVDA 3CC5A 3OV6A 2H26B 2FB4L 4KJPC 2FX9H 2UZIH 3JTSB 5JW4N 1K6QH 3QPQD 2CKNA 5I66A 4LSRH 3P4NB 3QPXL 5EU6B 4M7ZC 4WW1A 1OARL 1KCUH 5DJXB 5EIVA 3C5JB 1Y18B 4TULL 4FQHA 3LCYA 2ZUXA 1FJ1A 2QQQA 5INDB 2CR3A 1QKZL 3O4OC 4ALAH 3CLEH 1A4JB 3NCEB 5TDPA 1KTLA 4FQLH 2A6IA 5ESVA 1IEAA 5JMRA 2YSSA 2B5IC 2BVYA 4FZ8L 4OZIA 3DWTA 3AM8C 2GSIA 4X6FA 2K7QA 5I18H 1A8JH 4HG4J 1ZHLA 3BKYH 7FABH 4FMKA 5DURD 2W0PA 3PXHA 4JVUA 3U0TB 3ZKXC 3TZVC 4YHIB 3BD3A 4LVHC 1PG7H 3BIKA 4PG2A 1TJGH 3BGFB 1PY9A 3PWUB 4DAGL 4YX2L 1VADA 1BFSA 2FX8H 2R39A 5DVOA 4YC2C 1AQDB 4JO3H 3I75A 5A43C 3X11A 3RAJH 3S88L 2ADIA 3C2AL 5AD0A 3F7YB 3HC0B 4B7LA 4RDQG 1U58B 3UYRL 4R3SA 2NY1C 3EOTL 2W9DL 4QYOB 3IDUA 2ZP0T 3HAEG 3QIUB 3DX6A 3F7VB 4KUCD 1BREA 2FO4B 1ZLSH 1G6RL 4JM2F 2CUMA 5C8JA 4JRYB 3IKCA 5JXAL 43CAB 4DUWA 3WNPA 2NYYD 3DO7A 4XCEB 3T4AA 2EICA 4DUVA 3OAZK 3P4LA 1DSFH 4H1LH 4M6OL 4KTEH 1EO8H 5TFSL 3VFTB 4JZJC 4UU9B 4J3XA 3M8OL 2Q20A 3Q1SL 1XFPA 1QBLH 1HXYA 4MCYB 4C56B 5HI5C 3L7FB 3R4DA 2F19H 1OVZA 3I2CL 1JYXA 3NPSC 4OCLC 3L7EA 2KKQA 4ZODA 3ZDYE 2BOCA 4TSCH 2MNUA 2XNAB 3CDYA 4PJ5A 5JNYA 3P30L 4LSSH 4KI5C 3KPSD 4NWUH 2BSRB 3SKOA 2F54E 4J8RA 4HMEA 3UBXG 4HQQH 1DBJL 3Q5YA 4XP9H 4UQ2B 4F57H 2FBJH 5EU3A 5IHLB 3O2DH 4LIQL 4FS0A 3BOVA 3TEUA 3C5SA 4NKOA 2IPUK 1E4XI 5GISH 5HPMB 2VC2L 1QYGH 2XACC 4MD0A 4G6MH 3E1F1 3N1MC 4P23A 3WLBB 1U8IA 4PJXE 4OI9A 1KEML 3VXQA 1U8QA 4YEFA 1EK3A 3PHSA 1UA6H 1I8LA 1BBDL 5DEZA 1TCMA 1QFWI 4GUPA 4W81A 3RDTA 2PXYD 4XTRD 5CP7B 4L5FH 4G8GA 2HFEB 2QL1A 3GZKA 3RKDC 3VXTA 5D1ZB 5K59F 3VXUE 2Z0BA 2NTFA 2EDXA 5JQ6H 3T0XA 1FBIL 2J4WH 1BP3B 3MV7D 3GMRA 3I50L 4HWBA 1KLFA 4HIIB 5I74C 1KXQE 4ONGH 5FO7A 2E6JA 5A16A 2OP4L 3WXVL 1G0YR 4YGVB 3PWLA 2I60H 4OFYA 2D7PA 4M43L 4FQ2H 4WEUD 1HYRC 1H3PH 5IHUL 3JV5A 5TDNA 3QZWB 4ODUB 2P24A 4NNYB 1RK0B 5IF0B 4OT1H 4GS7B 2R4RH 3RVXC 4UOW1 5I6XC 4GRWE 2FWOA 3PWPD 1RURH 3UTTE 1NUDA 3H9HB 4OSUH 3BXNA 1HIMH 4K71C 3LD8C 2YN5A 1VHPA 4QNPE 2BP3A 2ADJA 1NBYA 2NXZC 5L2KA 1A1MB 4OFVA 5DK0A 4D9QD 3WDIA 4X5XA 1E4KC 1GH7A 4R2GB 2OL3L 2JJUA 3GM8A 1XCQA 3L5HA 4G8FA 1G9MH 4YQXH 2WWMC 3OMZA 2ORBH 5GRJH 1FPTH 1UJ3A 1FH5L 5EBLB 4AYFA 5D2LA 5F7WC 4Y2DA 4MLIA 4F9LC 1ZA3B 5I19H 2BVOA 3HNSL 1ADQL 1IAII 1EFXA 3KXFB 1MJ8H 4F7CA 1HQ4B 1IM3B 1IBGL 3TN0B 4GMTL 4NOFA 4JG0H 3C08H 3O11B 5C0IB 4PLOB 1IARB 3K4AA 3IU4L 1U93A 3VXSA 4AEHL 3R06A 2IANE 1AO7A 2DQEH 4OLXH 4R8WL 4ZUSB 5TPWH 5IB5A 4OZIF 1MUJB 1F4XH 1XGPA 3MLYL 5BZWA 1KELH 5LKNA 4MAYD 1R6VA 4I48A 1YYMH 4NN6C 4M6NL 1BQHG 3PHOB 5K9JH 3MLTB 4P5KA 2BERA 4HKJB 2J88L 5EH1A 3KPNA 3V8OA 5HHXL 2FD6L 1AE6L 1E27A 5BS0D 1RJZA 1I1FB 5KOMC 2JJTA 1LK3L 4BH8B 4FQXB 4XNXL 5CFHA 4WEBL 3OXRB 3ZSSA 4JVWA 3PQYE 5D6CA 2BVEA 4IS6A 3MJ9L 3CVHH 1BJ1H 5D7LA 2FJGB 1F5WA 1ZS8B 4M3KB 4XNQB 4O2EA 3MO1A 3O2VH 1UC6A 4I18C 2MKLC 2KZ1B 2BHZA 5I1KL 2UWEA 25C8H 2PTUA 2VXSH 4OUUA 5C07D 4KK9D 4P2YA 2WLYA 1F6AB 4POUB 5TJWK 1TJIL 4WI4A 2IEPA 4HBCH 5CINH 1Z9LA 2M1KA 4XMLH 1OTUD 2X05A 3MREB 1CLZL 1ETZA 4NRYB 2JCCA 1CGUA 4YHKL 1D6VH 4JFHD 1SEQH 2AAVA 3HS0B 1A6TB 1YNTA 1I7UB 5ALBH 1T21B 4LHUA 4QHKI 4U1NB 4HFWA 1FDLH 3TO4C 1YA5A 4PGCA 4L3CA 3VXPA 5IV2A 4YE4L 3GO1L 1SJHB 2LTQC 4JFFD 4WWKC 5ALCH 4ELKA 5SX4H 1RZJC 1YEIL 5E56A 3O8XB 4ZSOE 1H3TA 5IG7A 1QO3B 2FX7L 3HTLX 3KR3L 4LARH 3MBEA 1PAMA 2ITCB 3KYAA 3TA3C 1SJXA 1L4IA 4IRZH 3UPRA 4APQC 1JMZA 1N5YH 4L3EA 3TM6A 4H5SA 5DD3L 4MQTB 4X6DB 1ZT1B 3VXRA 5EG6C 3ULVF 1G7LA 3V6OA 5C71A 1JUFA 4U1HA 3U0WL 5CD5D 5E8OA 1E28A 1HN1A 5MI0B 1XGTA 4N0CC 4X9HA 5E2UH 4PTUB 4PJAF 5I73C 4QOKB 2WP3T 1RUAL 3DUUA 3RWHA 5DSCB 3GBML 4CN4A 2EXYD 3TH4T 3B5HA 1UCTA 4MQXC 3IETA 1I85A 2W07A 3EDKA 3SGJA 1A7NL 2H3NA 5GRXG 2XKNB 3EBAA 1EV2E 1MJ7H 3WN5C 2O61B 1D5BB 4UTBL 5CSGA 5MP6H 2GAZB 5DUPL 5BCAA 4QXGH 5T1KD 3QO1B 1EVUA 3MQIA 3PGFH 3W0WB 4OIIL 2A6DB 2UY7A 7CGTA 5IBLD 4OTXH 4FZEL 3BGAA 4WO4D 3NIDF 2VLLB 4JM4L 1GYAA 3THML 5DA0B 1JWUA 4Y16A 3BN9D 4HDIA 1WZMA 3FRUB 4HCRH 3GHBH 1OLLA 2MSPA 3HAEB 1K8DA 4NKIL 2E6QA 1JGVH 3KYNA 5A2JH 1HSAA 1NCCL 4RGMB 2DTMH 3NFNA 2G5BA 2YPKA 2YWZA 1MPAH 3BESR 4EUPH 4EDXB 4NQTA 3QDJB 2NQCA 1A1OB 3BPCB 3K2UL 5T3XL 3OAZH 2XPGA 3T65A 4P4KD 2HT4D 3H9YA 5EORH 5FUZL 3EYQC 4PJGA 3DPBA 4YBLB 1S7RA 1N26A 3IDIA 5KBNC 2R0LL 3CDGB 4MDJA 5D2LF 1QVOB 2OZ4L 1MHEA 2VXVH 4N9OB 2VXUH 1KJMB 2KQNA 2VDKL 3MUGB 5DLMH 1LVEA 1OOAA 4RWYH 1QRNE 4Y5VC 2J5LC 3UXFA 3MLSL 3T0EC 2GJ6E 1C5BL 3UBXB 3KPTA 1AQKH 1MFBH 3NAAH 3OQ3B 1BZQK 4MNQD 4LCWA 4H88H 3BAEL 4DVBB 5IJKC 2H1PL 3LB6C 3GDBA 4ZFGH 4L4TA 5HI4D 5EO0B 3UTPD 1CICA 5C6PB 1TZHB 1RU9L 3T8XB 4HAFA 1X6NA 1M05B 3P11L 3PWNB 5CHNB 2EDHA 5I1AA 1NC2B 3KPMB 1IAKB 3MTRA 2A77H 4PJCE 5HVGB 1R24A 3FQXA 5F3BB 3ZYIA 3SY0A 3CDFA 3RX5A 4Z7WA 3N9GL 2MPAL 1A6WH 3P0YL 2WK2A 1DQMH 4OZGB 4G8IA 3IFNH 4A6YH 3OKKB 3SCMA 2D9CA 3BP5B 3KWWB 1HSBA 3MNZA 5HHOA 5AUMA 4Z7OE 4BSVB 1K2DA 4XBGA 1NCAL 3EDJA 4UDUA 1KULA 2UWEF 4PD4K 5DMJB 3CSYA 3CMOL 1MI5E 1YNKH 5D6DA 3G6JB 3STZB 1BQUA 3JTTB 5J56B 5DEFB 1JFQL 5HYJE 2OK0L 2JCCF 3KDMA 1CLOL 2NX5E 4GXVL 1V7MH 4HUUB 1OARH 4FQ1L 5KVDH 2BMKB 3UZQA 4LAQL 1BX2B 4HUVA 1DANU 1WWAX 3C6SA 1QR1A 3WXWL 1DVFD 5IROA 1KCKA 4GSDH 4LRIC 4RFNB 3RGVC 4TUOB 3VFMB 2O5XH 4YHNA 1U92A 4UINL 2XV6B 5F1IB 3U7AA 1QSEB 5HHVH 2I9TB 4BK4A 1I3RB 1MFEH 5J1AA 3SDYH 5TDOB 5L0QC 3QQ4A 1CR9H 3W9EB 1RJCA 1MRFL 3ZYJA 1OSPH 4MXQD 1ZGLA 1R3KB 1PKQE 2R2CA 4X4ZA 5DQJA 1I1AB 5CCKL 1ONQA 2EYTB 1R5IB 4U1IA 1J8HE 3GI9L 3O4LD 1G6RH 2R29H 2QR0A 3QT2A 3D39B 5HTSA 5E6IA 4TTDD 5T5FH 4KY1H 5C86A 2YUVA 4IIQB 2B7DT 3GNMH 1UENA 2W60A 1KUMA 4ISVA 3VWJA 5T3ZD 2EZ0C 3DV6B 2X4UB 1X4YA 3AREA 4XCFH 4ZXBB 1KENH 5EU6E 4Y1AD 4JANA 1TVBA 1N0XL 1U3HD 5EOCH 5KVGH 5FHAH 3BZEA 1A9BB 3CZFB 1Z2KA 1I7ZB 3QA3B 5CZXC 3PNWB 2CQVA 5KOVC 5BV7H 4LLDA 4XP1L 4I0PC 3VCLB 1K4CA 2HKFL 4FOMA 4JN2A 1T04B 5E5MA 3T3MF 5IFHL 3O6KH 3D0LA 3QXDB 3CFDB 4KC3B 3LKQA 4RGNC 4MAUH 4ZQKA 3HB3C 1Q9LA 1AXSB 2X4OB 1L7TH 4NQEA 3P4MB 5F1NB 1LNUB 2B0SH 2EE9A 3VGAB 3AM8A 3SE8H 1TZGH 4UTAL 4JFDE 1DBJH 1HILB 2VDRH 4J23A 3LKOB 2R2HB 5J3HC 5DO2C 4M7KL 5C9JB 5JOEA 2A9NL 1CGTA 2GITA 4LHJB 3TZVA 1KNOB 4P3WA 5KJRH 4CDHA 4RAUA 4EZMA 4XPTL 3DUSA 2BXZA 4O2CA 2ADFL 3CFJB 4KVCH 2SEBA 3VMOA 3V4UL 4M62L 1U9KA 4PJGF 1B90A 1KEMH 5IQ7H 4FG6C 5I16A 1LE9A 5DJCB 5C0ND 1DLHA 1HCFX 3LPFA 2DI8A 5T1MB 1Q9KA 4MNGB 1IGML 2D0HA 1I8MA 1S9YB 3FQNA 4Q6YA 1MIML 2QKIB 2IFFL 2YPLE 3EFFB 5AZ2H 4MZ3A 2OJZL 1UM5H 4PP2A 2BX5A 1F02I 3V8CA 5M94B 4UI2A 1VEMA 3WFDH 5BZDA 3ZTJH 4DKDC 1AHWB 3TGXA 4OIAA 2ITDA 4POZD 2WLZA 1MFCL 3ARUA 1VFUA 4L29A 1GXEA 2A73B 2ADGA 3H9ZA 2Z93B 4H0IA 5GGQH 2JB6B 5MEPA 4KQ3H 1T80A 2Y36L 1Z3GL 1MFDH 4R4BA 1JN6A 3V5HA 3HZVB 2VXQH 2VLKA 3QUXD 4P2OC 2AJZA 2DQDL 4PJ9C 5CGYC 4PRHA 1TVHA 3QIWC 4WRLA 3DNKA 1ZTXH 1I1RA 5JOFA 5IKCA 5FF6B 3SE9H 3HE6C 1BMGA 3D25A 4UAOB 3GGWA 3ZYOA 4ODHL 3N1GC 1NAMA 4Z7WF 4HPOH 1ZHNB 3BZFB 2O5ZH 1FNEB 2ATKA 2CKBH 4CMHB 3PDOA 5HYQA 4XPGL 1I3GL 3SDDD 4M7JH 3MJ7B 4BH7A 4G5ZH 2NXYC 5MEQB 1IGIL 1P9MC 1F4YH 2AGJL 1LEGB 4JVPA 3L3HA 4JHAL 1NLDH 2DQGL 3BJLA 5KSAA 3OR6A 2X40A 2V5TA 3QEQD 3CH8A 3OL2A 5TGBA 4G42B 1EAJA 4HJGB 3DV4A 2HRPL 3HNSH 3BX7C 4YXLL 1RZIA 1JRHH 2D7OA 5DJDB 4OLVH 2Q86B 3GEWB 3K3QA 3F6LA 4YNYB 5ITFB 2JLLA 1XGQB 3GSNB 4ODSL 1HHJA 4K9EL 3SE4A 3VXNB 3VFVB 4WNQA 5IMLB 1J5OL 3SDXE 2C3VB 4HK0B 3S96B 1F4HA 5FHBL 3PJSA 2H2SC 3GKWL 2HJLB 2VN7A 1H3WM 2XWBA 4NQDA 4HC1H 2MQ0A 3KPPB 5DMKA 1XF3B 3HHRB 2X1OA 3AMLA 3RWDA 4LLWB 3Q6FA 4MVBD 5L9DH 1M1SA 1I7TB 4WHTB 2VDPH 4X7FC 4PGBA 3NZ8B 1D6EA 3FN9A 3QHFH 1WFTA 2AEPL 4LU5H 5C0CA 5FYJD 2Q76B 3ARGA 3SO3C 3EHBD 3D6GA 3DETC 3C8KA 3GKZA 1BFOA 2VZVA 1S8DB 1BVZA 3RWIB 3QG7H 2EYSA 4YEEA 1B2WH 4JY4A 4BM7A 3MCKB 3UTSA 3WEXB 4PRPB 4P2RB 3BRGC 4GG6E 1XR9A 4Z77B 1X5HA 2X70A 4X9FA 1RIUL 5TE7H 1NC4D 1WICA 1MCOL 4BFIA 4DGYL 3IDYB 4BZ2L 4UIKH 4ZUVB 2CRYA 2K1MA 3OR7A 5DYOA 5ERWB 3S3SA 3G6DL 5F9JB 3NGBC 2VUYA 1YEHH 5ADPH 3F65A 1A6VL 3VI4F 5AZEH 4C55A 2FYYB 2Y07H 4ZTPL 4DWHA 4ZYKA 2B1AL 4JRXE 4GBXB 3TT3H 3V6FB 1J0YA 3QIBC 1F6LL 3C5ZD 5DMIH 3ELAT 1BIIA 2P5WE 4RZCA 5CEZH 1FFPA 5D71H 5KTEL 3P3YA 2A9MH 1I9RL 3MV8A 2AK4B 3KJ4C 4OF0A 4XVTH 5DURB 5DK2A 4O02H 4KKCD 1UWEL 4HJ0C 4D0BB 1VEOA 4G6FB 5J8OA 5GGRY 1TFHA 2N7BA 3MLZL 2AJ3A 1DN0A 5ESAB 2ATPB 3G9AB 4I3SH 1CF8L 4PRID 2GYSA 1QSFB 3FKUS 1Q9WA 3OZ9L 1M6OA 3O41A 3F12A 4J3WA 3AS3A 5EC1B 1RAMA 4KI1A 2VYRE 1ZANL 5FO9A 4JPIA 5EZJA 3BQUA 4PJFB 3WNMA 1NH6A 3B2VL 5BRZE 1NFIB 3GK8L 1FL5A 1AGCB 4C54A 2W0KA 5D93C 4U7KA 3B3IB 1DBMH 1H0DB 2AQ3A 2EDBA 1DEEB 4K8RC 3RVUD 2N56A 2NLJA 5DK3A 3VFNA 4R7NA 4Y5XA 4LASL 4XP6H 2DM7A 1GIGL 2P7TA 3RX8A 2VDLL 3LEYH 3FB6A 2RJMA 5DHVB 4HF5H 5HDQH 5CBEA 1J1XL 4QCIA 4XCNB 1IT9L 4LCCB 1T7WA 2XTLA 2E3VA 4X80L 2CDEB 2PYED 1KG0A 1OF2B 5BVPH 4PJIB 4V2BA 1C5CH 5CSZA 4BUHA 2XQBL 1TCRB 3WL9A 4PRNB 3FB5A 1SYSA 4YBHA 4JPKH 4FXGA 2PKDA 5FB8A 1DFBL 3S7GA 3TO4A 4K3HA 4F3FB 3TJHC 2KDGA 1HI6A 1KB5H 3DRTA 2QSVA 5C0AE 1U8KB 4JY5L 3S37H 5LCVL 2XTJB 1KXVC 4G7YL 4KI5F 3QDMA 1V7NH 2FHCA 2D0FA 5B3JF 1YN6A 4DVRL 4NUGH 3DIFA 3HI6L 5L8KB 1T5XB 3D85B 5HDBF 1CLCA 4FTVD 1S5IH 4QRUA 4TUKH 3B9KC 5KS9B 2NY6D 3NIGE 2HTKD 5FYLL 3GI8L 3V7AE 1AKJA 1EH9A 4H8WH 4Q2ZB 2Y06H 3L1OH 1MCWM 4RISH 4P59L 2AXJA 4PJ7F 5F9OL 3F58H 1IC7L 3ZDXE 2J6EL 5ID1A 3DBXA 3WBDA 3L9RB 5A3IC 4R0LA 4OJFL 1NCTA 2R2EB 4KK5C 4GRLC 3BPLC 1NSNH 1WZLA 3WS6C 1CGSL 4UT9H 4WDIA 3GIZH 2OTUB 1MQKL 1IC4L 5JW3L 5E2TH 3F8UB 2ID5A 3RWEB 4BZYA 3BDYH 5E00A 4HZLA 4IEFB 4K8RH 2EE3A 3MBXL 2ZPKL 5I75B 3OJDB 1EEZB 4Y89A 4C58B 4QGYA 4QRRE 4LLYA 1JYNA 2AXFA 3VGDA 3KLDA 1K4DB 2QADD 3FN3A 5JA8B 1PG7X 3C5SB 1OAZH 1A6AB 4JM2D 5DR5L 2PCPB 5E03A 1WT5A 4HUXA 1UYWL 4U6VH 3CCHA 3GSUA 3QWOA 4YDLC 2BNQA 5GXBB 1IGYA 4HX1B 3ME0A 4ZAKB 4KHXL 3QDJE 1GGIL 3I6KB 4ONFH 1FFNB 5KSVA 1CFBA 1OTSD 2YEZB 2APVA 1OHQA 4FQIH 1MFAL 3SPVB 2IAMD 4NZDA 3RWGA 5EUOA 2A6KB 4MB4A 3HG1D 3NA9H 2XG5A 4RGNE 3BIAX 1YEKH 2MMXA 3H3PH 1JFQH 2MQCA 4PPTA 1Z5LB 5CP3A 4AEIH 4NQCB 1ZLWK 4GXVH 4MMZC 1HKFA 4JFZL 2R9HD 3W39A 2EDRA 3HUJE 4F8QA 4K7PL 1T20A 4UB0L 1OGAD 4OZHB 3REWA 3ZTNL 4PJHA 4RAVB 2AS5M 4W6WB 2NYYC 4N0FA 1FGVH 2EKJA 4D9RD 3PL6C 1K85A 1NGYA 5JPMB 4JFEA 5I1HH 1AD9B 4LCYA 4OB5H 4OM1L 1ZSDB 1ZT7B 2FH8A 3K80A 5EBGA 1PZUB 1MIEH 5JLZA 4M5ZH 1NLBL 4JKMA 4AH2A 4LLVB 3EO0B 3F5WA 3G9VA 4PJDE 2YD1A 4NN5C 2P48B 3IGAB 3AVEA 3TJEH 3IXAA 4JHWL 2H45A 4U1MB 4UDTB 5CMAA 4BSWB 4FNLL 3TBSA 5AWNH 5D1QD 3C6LC 1G7MA 3OKNB 1Y0LB 3NFSL 3B9DA 4XPAL 1BHGA 3BUYB 1NJ9A 2EDWA 2HMIC 1CWVA 4RGOL 5JW5B 3HRZA 5LXGL 2YC1A 3CXHJ 1U2CA 4TPRL 4DGIL 4IRSB 3E8UL 3LH2H 4L4VA 4DGVL 3W2DL 4DQOH 4MMXC 4TOYL 3EZJB 5FECA 2NR6D 2BRRL 2FECI 2LAGB 1IGFL 5FA3B 3OPZL 4LLUB 5MENA 1OAUL 4HWNA 4B53A 5HYFA 3AROA 2PXYC 1G84A 1YY9C 1WSST 2IQ9H 3FO0L 2Q8AH 1NFKA 4DFIA 3LN4A 4GKOA 4G9FA 4NSKA 5D1XB 1OWRM 3HC4L 5CEZE 3MV11 4R6UA 4YHYB 4LRIA 4QRQB 1VSCA 2P5EB 4PR5B 4XXDA 4M9PA 4Z95H 4F58L 3H8NA 1JZ7A 1MHPL 4WENB 3O3BB 1LO4H 1XF4A 1OGTA 2CLVA 4XC3H 4OCMC 4Y4KB 3O9WB 4X7EC 5SWZA 3KAAA 2AJVH 3OSKA 2ADFH 1QBMH 3V4UH 1T5WA 4MA3B 1A7QH 4DZ8A 2JTDA 1DANT 2HFFB 1CFVL 3MLVL 4D3CL 3GSXB 4HFUL 3VD3A 4K9EC 3CUPB 4K7PY 3NCFB 1O5DT 2J8UA 1N2RB 1MWAH 1QA9B 1JJUA 3CH1A 3RTQA 1E0OB 2N1KA 5D7KE 1JWMB 1NGXB 4QXTA 5T1KB 1AI1L 1TZIB 4U49A 3FOLA 2OR9H 4QHMA 1WZ1H 3OBAA 1U91B 2OI9C 1OAXL 1D5ZA 2XZCH 3BSZH 3D18B 1I8KB 3L3KA 3MBEB 1CIDA 4U6HB 5L6YL 1UZ6F 3BZDA 2HVJA 3EYOB 4JFQB 4OCYL 5F1OB 1A1NA 3RZCA 2VWEC 4I0PA 2E7LA 3B43A 2IC2A 2ZUQB 2D03H 3WCYA 3MRCA 1YNLH 5HJ3B 1EGJH 4XBEL 4XWGL 4M3JA 4PRBB 5IJVB 3WKML 4ZDHB 1WV7T 2CDGA 2X42A 1BLNA 2V7NA 3ARBB 1U8MB 4ZNEE 1GJIA 2CO6B 4JY6A 1N3NB 2E9JA 3REVA 4JO2H 3DUUB 4O58L 4R26L 1F11B 5EUOF 1SBSL 2R23B 2YUZA 4GAFB 4U1LB 1WGOA 4KHTH 4MD4A 3FO2B 4O51B 5DFWH 5AYQA 2C3GA 1VACA 5SWSA 4JKPL 1ADQA 1FL6A 4KDTC 4PJ5D 3NMEA 1G7IB 1KOAA 3TLRA 4E41E 4L1HA 1S7QA 2FEEL 4NQSA 4OZ4A 1X9QA 1GOGA 3ZKNC 1MVUB 3QAZC 1AC0A 1JPTL 4Y4HC 3MA9H 1YJDL 3U30B 5GJTH 3DX8B 5JHDE 4MXVE 5T1LB 4OI8A 3UTZA 4ZOEA 3MRJB 4PJHF 4J3TA 3H3KA 3ULVD 2OR8A 4P23D 1F4AA 4G9DA 3QDHA 1QR4A 4XHJC 1BVLA 1RULH 2GUOB 1DQJA 2I5YL 4LCIH 1AC6A 2DYPB 3JWOL 5AYUL 1WVZA 4UUJA 2YUXA 1TPXC 3H42H 5J06A 3I02A 1NPUA 3MFGB 3RDTD 4FA8A 4KMTH 2QQNH 1AXTH 5HVHC 3QWRA 1LDSA 4G8GD 5DRNB 1T66C 5ANMA 3ZE1F 1W72B 1UB6A 3QIWA 1FO0B 3FFCA 5I8OL 2GFBB 2O5YL 3WE6A 1WFOA 1C12B 3MJ9A 3ES6A 2C3XA 3QEUB 4WCYH 1OP5K 1K9TA 3HNVH 4B7IA 4AT6A 5C0RL 5FK9B 3DXAB 2YXFA 3D3VB 3QG6B 1W0WB 4RX4A 4OFYD 4R90L 2G9HB 3GJFB 3VRIB 3W5NA 3MCLL 4OGYL 2VQUA 2X4TA 4PLKC 5HY9B 5D9SB 1P9MA 3OKDA 1IGCH 3TBTB 1ITCA 5KVFH 1XR8B 1T0PB 3O45B 2LVEA 3UEZA 5JORB 4EEEA 3UJTH 3PHQB 5C2UB 1DVFB 3RWCA 4E42A 1JHLH 3WS3A 3LY6A 3KPRE 2BSSB 1WF5A 5D8JH 4V2CB 3OHXA 2V2WB 1WBYA 2FDBP 1ZLUH 3VH8G 2PW1A 2BVUA 4MJIB 3MXVH 1NMCC 3OKEB 1FYTB 1PKOA 5L2KD 3W9DA 4I9WE 4EN3A 4IOIB 5D70H 5LGJA 5DTFA 5DJ2B 3EJZD 1A4KA 4D9LH 1JNNL 1OB1A 2F8VA 3T3PE 2R4SL 1CFQB 4XNYL 3CNKA 1A3RL 2VE6A 4TRPH 3ARPA 3QQ3A 4MNHB 4YDVB 1LO2L 2VLRA 2OLDA 3ZDZF 1A0QH 4Y2DD 2KUTA 1HSBB 3GSRB 3BEWA 1WBXA 3L3OB 5HHOB 2EIZB 1EFXD 3AAZA 5T1DH 1S5HA 5ID0B 4M1DL 1EO5A 1HHGA 4WO4C 2F54A 4PGDB 4PRPE 1MAJA 3VXSD 4TSBL 5DQDH 4QHNB 3MUY1 3BN9C 1ND0B 1FVCA 2VAJA 4Z7UB 1ZLWH 1UB5A 2J8UF 4CGTA 3JV4A 5GIRB 4GXUN 1KN4L 4OF3A 3DARA 1KN2H 1U3HB 2JB5L 2R0WH 3LKRB 1NCBL 5KSBE 2A83A 5DF0A 1F00I 3L95B 5C2BH 3JWNC 3V0VA 3SN6N 5F89B 3K46A 1CI5A 3BRFA 1QFUL 1K8IA 1WWCA 4LVNB 3MFFA 3DSFL 5C08A 1KSRA 1MRCL 2NY5C 1E6JH 3RI5F 4JGJA 5D7LD 2ICWJ 2Z31B 4MWFB 4LNRB 1AH1A 1FV1A 4GMSL 5D7SL 3C60B 4XZUA 3NTCL 2FIRT 2DQUL 5IVZA 4L8SA 2V7HA 5C0BB 2IMMA 3Q3GB 5LCVH 4GS7C 2B2XL 1MCBA 5IHZB 3M07A 1CLYH 3DHMA 4S1SL 1CE6B 1EA9C 1D9KB 2R1XB 2IPTL 1LDPH 4Y19A 5HI4C 1JNHB 5GGTH 4ESKA 3E2HB 4WW2A 4U1SB 2HJKB 4IRJB 5SX4I 1ACYL 1EHAA 1OL0A 1S7VB 1U8HA 1DL7L 3BIBX 5FKAB 3ZE0F 4LHUD 1EAPA 5FYKD 4FABL 2OZ4A 3B9VA 1RIVH 1EBAA 2DLGA 1IC7H 4OD3H 1NBZA 5IMMB 4R2GC 4XPFL 3HR5B 3GMOA 4P46B 4LP4A 3DGGB 3NFPB 3M45A 1KCSH 3TBYA 4NZRH 4M8VA 1MLCA 1F97A 4L3ED 3LKSA 1MF2L 5HHNA 3EOAA 5E5MB 3HZKA 3U9UB 1R3LA 4GJTB 3P77B 3CK0H 4U6YB 4HH8A 1OD7A 2VJXA 3VXRD 5GRVK 4WFGD 4O4YL 3EO1A 4KXZH 3NCCB 4PJIE 4NO5A 1F13A 1J87A 1XH3A 5IEKA 5BMFH 1A6UH 1KIRB 3KPSE 3MRIA 3FRPA 3G5ZA 3QFDA 4PJBE 1BZ7B 4ZG1A 4ORGA 1IILE 2IANA 3RPKA 1YDPB 1KIPA 1CD8A 2L7UA 5IB1A 2R0ZL 3MJ8B 4DK3A 4JO1L 2NY5H 3SDDB 2YD9A 3KPQA 5HHQA 2CLRB 4JFXB 2X89A 4RMUA 3RVVD 4FP8H 2W65B 1GHFL 1AD0A 2F53A 1GGIH 1ZEAH 2GT9B 3ULSB 1J1OL 1YEEH 5HVFB 2C1PA 5CJXA 2P8LA 5DJ0B 4R4NC 4YHLH 3MRLA 4CRPA 1IEHA 3V9FA 2ZUVA 3NCBB 4NCDA 1PD6A 4I2XB 5ACZA 4I77H 2YRPA 4Y16D 3RBGA 5GZNC 1XF2B 5C09B 2WV3A 2DICA 3Q6GH 4HUWB 4HWEL 2LU7A 1DBKL 1S7XA 3MV7E 5F6IC 3UJJH 2AV7A 1LP9A 3MGTA 3WD5L 4V1DB 5FV2A 5EN2A 5C0DB 4Q9QL 1G7PA 1X5GA 2MCPL 3VWKB 4NJ9H 2EC8A 3FFDA 4EVNA 4XH2A 2Z91A 5D7JD 3QJHB 3IU3B 4ODXA 1MRDL 2VABA 4TTDC 5L7XL 4RFOH 1UZ8A 4M8QB 2Y6SC 1U6AH 3CFEB 1W72H 4YHPB 1FO0H 3PWPE 4LKXA 3BP7A 1RFDH 3O8XC 1RZ7H 3UTOA 1KACB 4MA8H 2FJFA 1KJ2B 4R96A 1JI2A 1G7HA 3GSNL 3TPUB 3IJSB 1BZ9A 4DKEH 4HT1H 4E5XA 2WBJC 1V8HA 1CDIA 3NCJH 2F5AL 3T4YA 4C4KO 5IQ9B 3TNNA 4D9QE 4JCLA 3MRMB 2YRZA 5IFJA 3MLXH 5HHMD 2Z35A 2V2TB 3OR6B 1NAKH 4LCWD 4JG1H 5KAQG 5LQBL 1RJLA 5GGUB 4ELMA 5MI0C 1TIUA 3C09B 1I8IB 4F9PC 4YDKL 1OT1A 1CICD 1P4BL 4QTIH 2W9EH 3WFEH 4QRSB 3KYOA 4XB8A 4OLZL 3V4PL 4N8VA 2WUBH 3MV9B 2WAHA 1RVFH 5DHYB 1TENA 3HRPA 1ED3B 2XA3A 3IVKA 5HHPB 3X3FH 2RHEA 5H35A 5C6TH 4U3HA 4YUEH 3RGHA 2Z8SA 3TYFB 4XAKD 2P1YA 1OY3B 1CBVL 3IFOA 1Y6MR 3T0DA 3IYLW 1RHHB 1IC5H 3QXVA 1VFOA 4OLYH 1QEWB 2BC4B 4OCRH 5L2JA 5BS0E 5F8RC 1ACZA 3MOBL 3PE9A 3O6FA 1J0IA 4H1LA 1UM6L 5E0QA 1BM3L 2DLTA 5EUKA 3PL6A 3D9AH 4WW2F 3KLAB 4GKNA 1PEWA 3L3DA 5SX5H 4RGMC 5T3ZH 4RMWA 3X12A 3WFCH 5JDSB 15C8H 4AG4L 4HK3J 5HGHA 1MJJB 2PO6A 5CJ5A 2ZG1A 4G6JL 2Y5TA 3LIZH 3QCTL 2QV2A 1YEFH 3GRWA 4NYLB 2YA0A 5F88B 5C07E 4K2UH 4X0KA 1YJDC 3BUTA 5JIKA 1DUYA 3VH8B 2FIKA 4LQFL 5DD5H 4AIZB 4YBLC 5J1TC 3S6CA 4LKCA 3EFDL 4JFHE 2Z4QB 3C6LA 1EIBA 1HXMB 1BQLH 1FZMA 3S98A 3DMMB 1I1YA 1IQDB 2EH7L 3D69B 1NCWH 2RCSH 2ZCHH 1RQ5A 4F7MB 3BHBA 3MOAH 4LLMA 1RUQL 5I1JH 4JFFE 4RRPG 1XIWA 1GGUA 4RFEB 5AEAA 5F6HJ 3S9DB 4KZEH 4KUZH 3DTXB 3MLRL 2H9GB 4Z7VF 2FJHB 2GJ6A 1U3JA 4EQ2A 3TIEA 1F3JA 3RY4A 5E6ID 5EIIA 4L8DB 3LPWA 3E6FB 5JR1L 5KW9L 3ARFA 3WKMH 3MRNA 4FTVB 1VCAA 3PUCA 1T7ZA 4HJJL 1L9NA 4LEOA 2D31A 5E99L 1KYOJ 2B20A 4DTGH 3QUZC 1RUPL 2OTWB 2PYFB 5K9KB 4YFLF 1PDKA 1EHLH 3KPLA 2DLEA 4PJCA 2ZOLA 3H9SA 4HBQA 4UIMB 2FO1A 1BD2B 2HJFA 1WWWX 2V9TA 4LVOB 5DJAA 4DKAA 4H0GA 2VZSA 3MODH 1CL7L 5EZOL 2X4RA 1KCVL 4NQED 3RX7A 1LP9F 2ZUSA 4XPBH 4PS4H 3S34H 2WIIB 3LDBC 2NPLX 1JPFB 4XNMA 1JV5B 2FATH 1FLTX 4QTHA 4YHMH 4UV7L 2G60H 4UBDD 4QRPB 1IL1A 4UT6H 1CT8B 4LPWA 3IDMA 4PGEA 3TZVD 4WHYH 1YPZF 4ZPVB 4MX7A 5C0GB 4H25A 5E8EA 4FQJH 1AGEA 3GM0A 4XMKH 2VR4A 2Y7QA 3SKMA 3FQWA 3WFBH 3N85L 4P9MH 4RFNC 2NNAB 4JPVL 3C5ZC 2P43B 3DIFB 5GS1A 5DI8A 2R1YA 5EOQH 4L8CB 1XZ0B 3RL1A 2NY1D 1D5XB 1KLUB 4HUKB 1QP1A 2IG2H 5I9QC 2AI0H 2JELL 5J13B 1XGUA 5K9OA 4M61B 4R4FH 4AQOA 1RUKH 1GGCL 5DJ6B 5IHBA 4KAQL 3T0WA 3UAJD 1SM3H 4ELMF 2XXMB 5D72L 3C2SA 5F7EH 3DROA 3GMQA 4YXKL 5BOPA 1ORSA 3HFML 5T33H 2CK2A 1XGYL 2Q6WA 3QUYA 1S7UA 5I1EH 1PX4A 4G7VH 1BVKB 3FB8A 2UYLB 2IBBA 4JAMA 4JKLA 4Z0XB 2EYRB 3FHAA 4Z9KB 3MRGB 4KVNH 4PY8J 5HI5D 1E6OL 5IK3A 3G08B 5CGMA 2VLKD 4MSWA 4RMVA 2C7UB 3N1FC 2DRUA 4TVPL 1M4KA 4TQEH 2K7PA 2AABH 3MGOA 4W68A 4HIHB 3O81A 3MYJA 2BRQA 4NT6A 1R3IH 4UV4L 4MNQE 4MB5A 1R5VB 2H26A 4K3DL 5FYJH 2XKUA 3JTSA 5TE4H 2WQRA 1KT2B 3CD4A 5D5MB 1FNSL 4LLYB 4KI5D 3UTPE 1UH3A 4X6CE 5J7CC 3VFRB 1S3KH 3P4NA 4K94C 5EU6A 3RKPA 5FV1L 4YWGH 5DJXA 3C5JA 5FA4B 5TF1H 1Y18A 6CGTA 1JGUL 3P9LB 5BXFB 4P5TB 5INDA 2VUOA 1PYWB 3QRGL 2CK0H 1IAMA 1A4JA 1JRHI 2WQ8A 2Z92B 5KSAD 3S37X 1N4XH 4LF3B 3MPCA 4HIXL 1DBAH 4Y4FB 1OPGH 1VFBB 2YS4A 4N0UB 3VGGA 1SY6L 2X09A 3MRHB 1A2YB 5E4EC 1RIHL 2B1HL 4KMLB 4LOUC 3NN8B 1MCKA 3U0TA 3GHEL 5CZVL 1M7DB 4YHIA 3MRBB 1ULVA 3S97C 1QSVA 3KYMB 1WCBB 2OXGA 4LSTH 3PWUA 2V17H 3GIVB 4QXWA 3QUMB 5C3LD 3QUKB 5CIPB 5JW4R 4NQDD 4M48H 4U05A 1AQDA 1XGRB 2BSTB 5E8PB 1LO0H 1IC1A 3HKFA 4CW1B 3BP4B 4QF1B 5IFAH 3HC0A 1KC5H 4LVEA 1U58A 5D7IB 3IFPB 4JFOB 2ERJB 4QYOA 3QI9B 1D7FA 3QIUA 5C0CD 2HTKC 3F7VA 3ARGD 2FO4A 3ECBB 3Q0HA 3QEHB 5I1DB 4O5LL 1F90L 1EJOL 1AHWC 4JRYA 5DZOA 5DWUL 4MCZB 43CAA 2GK0B 4TUJB 4XCEA 2FHBA 3CXHK 4XRCB 3UTSD 1G9EA 1A9EB 5A2IH 3LHPH 3VFTA 4UU9A 4F15B 2EDNA 3ARRA 3RUGE 4MCYA 1AGDB 4C56A 3L7FA 3QHZH 1VPOH 4BZ1L 1PSKL 4EBQL 2JKXA 4KZDL 2XYCA 3C9NB 3QXWA 1ZGLM 2P8MB 2XNAA 3BPOB 4K94H 1BFVL 1JK8B 3EYUH 5FGRA 4M9OA 2WWMD 3D2UD 2MQ3A 1UWXK 3HR6A 5IWLC 5ISZD 3O4LE 3HPJB 2LQRA 4QRTB 2BSRA 4POYA 1L6ZA 2XZAL 4W6YB 4ODTL 2QADC 3HRZB 1T89C 4UQ2A 4JM2C 4NUJB 3S3JA 3MV8D 5CUSH 4NHCL 3WHE1 5T3ZE 3GSVB 5I1IL 5HPMA 4FRWA 4K7FB 2HH0H 4Y1AE 1YMMB 1NFDB 2YK1H 5LWYH 3WLBA 3WYRA 1JGDB 4IHOB 2Q7NA 4W70A 1OTSC 1DLFL 5F9WB 2VZ3A 4YK4B 2BCKB 4QHUB 4M1GL 5MEOB 1EO7A 5I30H 2QTEA 4AQ1B 1MH5B 3MACL 5CP7A 1T7YA 2HFEA 4WFHD 1TJHL 2WWKO 2ZSVB 4JQXA 5D1ZA 1A7BA 4CVZA 3B4NA 1EPFA 4YR6B 4Y5YB 5BQ7B 4TVSa 5MHSD 1UWGH 3VA2C 1OAYH 4OGAC 4WUKL 4HIIA 1QNZL 1AFVL 3VRJB 4YGVA 2X4PB 2YMXH 1EFQA 4OLUH 3QZWA 4HV8A 4OZFH 1ZVSB 5BVJB 4ODUA 1H3XA 3HMXH 4NNYA 1YEGH 4OBRA 1RK0A 2VLJB 5IF0A 1GHFH 2ARJQ 2RFXB 3EDDA 3ZMRA 2DQCL 3WFHB 5FUOL 1NBQA 1FRGL 3FZUC 3H9HA 1FZOB 3EOYG 2YKLH 3VRLE 2ZUTA 4NDMB 4WEMB 1B4JL 2IGFH 2XQYG 4WTZG 5I8KL 3N0PB 3IDYC 3TCLB 4GQPH 3TO4D 4ZUUB 2E27L 2XN9B 1MCWW 2Q7YB 4GQ9H 2V2XB 1IAIM 3WIHH 1A1MA 1I75A 4WUUD 4WWKD 1CXLA 2YWYA 4GBXC 3D1MC 3QDMD 1FE8H 1RZFL 4Q7DA 5GJSH 3P0GB 1G7QB 3K74B 5D1QC 3T0BA 3VFGL 5EBLA 3H7LA 4RIRB 4RAHA 4YHZH 1ZA3A 4O2FA 5JDJA 1IGTB 4G3YH 3KXFA 5IB3B 1HQ4A 1IM3A 2YRLA 3TN0A 1Q94B 5KN5B 1NGZB 4J1UB 3O11A 4PJAB 2JF1A 5C0IA 4NM4L 4XP5H 4ZUSA 3BP6B 4NO2B 2WUCH 3S8WA 2VZ1A 3AFLA 1MUJA 5DUBB 4KKAC 1KFAH 4MXWL 5DD1H 1KLGB 2AJUL 4PB0H 3X3GH 2IH1B 5BO1H 1RUMH 1L0XA 3PHOA 3MLTA 1NMBH 2DQHH 2BFVL 4HKJA 1LO3H 3O6LL 3ARDB 2DJSA 1DBBH 4MQXD 2C9AA 1I1FA 1KJ3L 3QULA 3FN0H 4KPHL 4BH8A 2PR4L 2G2RB 4FQXA 3BH9B 4PUBL 4DN4H 3QEQE 4NQSB 3RY6A 4S1RL 3VDAA 3OXRA 4I2XE 3TCXA 4HPYL 3LRSB 4Q6IB 1ZHBB 5IBTH 2Q8BH 2FGWH 1NL0H 1FG9C 2DWEB 2A38A 2APBA 2DIJA 4PJ8A 2FJGA 1WZKA 1ZS8A 1AJ7L 1CE1H 4CADB 3MRFB 3FONA 1UM4L 4RMTA 4LSPL 3LKNB 4BQ6A 1F6AA 1DQJB 3BT2H 4LPVA 4LCCC 4AM0B 3M1BB 3MNWA 3I02B 1I9IH 3MREA 2ARJB 3LS4L 4NRYA 1SBBA 3NBNA 3SKNB 5FYJE 1A6TA 3T2QA 5I76A 1I7UA 3LOWA 1T21A 3LRHA 2EXWC 6FABH 1N8ZB 4U1NA 5D2NE 5E5UB 2RAMA 1UCBL 4FQQB 1CTOA 3MOBH 5BW7A 4XC1L 5T5NG 3FT3B 1SJHA 2ICEB 4I0KA 1J9CT 1UQSB 2X4NB 3QWQB 1JPGB 2XTJC 3O8XA 3QUMH 4MGXA 2C4FU 4HAGA 1QO3A 1X5XA 1CDHA 3JV6B 3S35L 3CPLB 1JGEB 2ITCA 4H1LG 4I5BB 3V0WL 4OGXL 2AP2A 1Q72H 2FHFA 5IBUG 2AJSL 4ODWB 1D5MB 5IM7B 3MMEB 4GAGL 3IDXH 3I6GB 4D8PB 2NY7H 3EDEA 4X6DA 1ZT1A 4OCXL 3TBVB 2WBWB 3T0ED 2YXMA 1JL8A 3K2MC 2X7LB 5FO8B 1MAMH 1FNGB 4DN3H 3MRQB 4NZUL 4UOJA 3LB6D 4JFED 5EZIH 4X6EB 3DI2B 5EO9B 5GGVH 4AENB 4IBLT 4F9PA 1MLBB 2E8YA 4PTUA 1HE7A 4OD1H 2XICA 3QEGH 4HGWB 4QOKA 4OM0H 3U4BL 5DSCA 5LGJB 2ZCKH 5F7HA 4IOSD 4OCWL 4P2QD 5DD6B 3OJ2C 4KV5F 1C1EH 3U7YL 2XKNA 4GAJL 2O61A 1RSFA 3TP4A 1TQCB 2GAZA 4PRIE 3RWJB 1S5HB 4G43B 3O3DB 4XCYB 3QO1A 4HKZB 3W0WA 4PGJA 5FM5M 4S0TD 2A6DA 4BQ9A 4DW2L 5ETUB 1TTGA 2V6HA 2VLLA 4NM8H 5FCUH 1PX3A 3FRUA 4ZAKC 3HAEA 3VFUB 5ESQB 3OF6A 1VGKB 1I8LC 4OF7A 1RPQA 5MEND 1KCLA 1CFSB 4PJXB 4WHDA 1WEJH 4PJEE 2AQ2A 4EDXA 1FORL 3QDJA 1E4XL 1FVEB 4G9FD 3A6BH 1GGBL 1K8IB 4JR9H 3IRZA 1A1OA 3BPCA 2F15A 3QO0B 2IQAB 1NMAL 3RWFB 4MLSA 1H3GA 3RY5A 2PUQT 1A7OL 2PYEE 3MLUH 3EZ8A 4MQSB 5TQ2L 3CDGA 3VXUB 1QVOA 4HUMB 2G5RA 1KJMA 2QJDA 1QFWL 1CG9B 1WIOA 5SWZD 4OQTL 3GBNL 3MUGA 1S78C 1YYLL 5IVZB 5DRXB 4I1NB 5F7DB 5CILL 1ES0B 4J2XA 4IDJL 3SOBH 3UBXA 3LAFA 4EI5B 1UWXH 4JPVH 2VDNH 4DVBA 3RTQD 1FFQA 4U1JB 2XQYK 2X41A 4FTVE 2ICWB 4G6AD 4GRWB 5EO0A 1VA9A 3HCVB 3LEXB 3UTTB 1TZHA 3T8XA 1KPRB 1RZ8B 1JNLL 1GGYA 2EIEA 4YAQB 1GGCH 1M05A 2BVPB 3PWNA 5CHNA 4OCSL 4E0RB 5F96L 5TQ0H 1NC2A 2EEDA 3KPMA 4AMKL 1IAKA 1F8TH 3RNKB 1HZHL 4YXKH 3GUTB 5EO1B 4FFYL 5EA0H 1UJ3C 5F3BA 2CO7B 1OCWH 2VZOA 1D5IH 3ULVH 3KJ6L 4Y2DC 1IMHC 3DX9B 4OZGA 5HGDB 3RZCD 4WGVB 1A14L 3OKKA 3SGKC 4ZOCA 4I0PD 4JREB 3BP5A 3KWWA 4CAGA 1YMHB 1F3DJ 3AS2A 2QQLL 4BSVA 1P7QB 1QBBA 4JB9H 1IVLA 1L7IH 1T7VA 4PREB 5D7JB 2PW2B 3HB3D 1XH3B 3G6JA 3STZA 3GSQB 3JTTA 4LSQH 1WC7B 5DEFA 3GMPB 1TTUA 1QHPA 1MCPL 2IANB 5DDHB 1J18A 2FR4B 3C87A 1F2QA 4JO4L 4HUUA 5DUML 1CS6A 1U8OB 4KWUA 1IAIL 5DO2D 5IMOB 1Q0XL 2YPVH 2BMKA 1VGEH 2Z9TA 1BX2A 4HWBH 1Z0MA 2C1OB 1T6VN 2JJTC 2ZNXA 5SWSD 1YEJH 5D1XC 1KCRL 4FG6D 1T1ZB 3FOMB 5ADOL 3BDXA 5GRVL 3T2PA 4TUOA 4KKLC 3VFMA 5IT2L 5ILTH 1MEXH 4GW1B 3RL2B 5F1IA 1QSEA 3OJVC 3RIAF 5LVEA 1R0AH 2F8XC 4Y4KC 2I9TA 1NAML 3M17B 3PQYB 1I3RA 3LEVL 1NUFA 3HG1E 2EDOA 5TDOA 5J9PB 5IW3A 4HKBB 4ETQB 1KJ2L 4C57C 3SQBA 4RMQA 1NCDH 3W9EA 2DN7A 2JJWA 1R3KA 4NFDA 1G7PB 1I1AA 2EYTA 1R5IA 5GS0L 4YHOL 1DQDL 3O3EB 5FGCE 3SDCB 3NH7H 5I71B 4HEPG 5EU7C 2DB8A 1OGAE 3QWRD 4P2OD 3D39A 5CGYD 3QIWD 3FFCD 4JLRB 5C9KA 4X7SH 1MREH 4IIQA 4D9RE 3JVGA 3DV6A 2X4UA 1V3KA 4ZS7H 4ZXBA 4LFHG 5EBMB 4RCAA 2E7CA 3MBEC 5CJQH 1EERB 5C7XH 2YD3A 4RX4D 4A2MA 2JE8A 3NCYP 3LQZB 1A9BA 3CZFA 3QA3A 1I7ZA 4ZSOB 5L88H 3PNWA 4EBQH 2IADA 2GJZB 2NXYD 3VCLA 4LNVA 1T04A 5C0JB 2XWJB 1N6QH 1N59B 2ZUQC 3V6OC 4RDQF 4N0UE 5K59E 3QXDA 3S36H 3CFDA 1NUNB 1OM3H 3WIIH 1AXSA 2X4OA 2FL5B 3P4MA 3ARBC 5F1NA 4JN1H 3ROOB 1LNUA 4WTWA 4HGKC 1Z9OA 2VB5A 2I24N 1HILA 1A3LH 1KEGL 1L0YA 2BSED 1CK0H 3LKOA 2UZYB 2R2HA 1EXUB 4F8TA 5C9JA 4EN3D 4ORZC 4ZNEA 1KNOA 3OKOB 1I85C 3EOBB 3QFJD 4BUGA 3CFJA 3DVGB 3SGJC 5I0DA 3WUWG 2GCYB 2H2SD 1U42A 2W0FB 1CDYA 4KRPC 4R97B 3ETBF 1UKSA 4RBPH 2VLRD 5T1MA 2XA8H 1INDH 4MNGA 4B50A 1J0KA 1S9YA 1T2QL 4Q9RL 2XZQL 2QKIA 4K7PX 3EFFA 3U30C 1JWSB 4LBEB 2OSLB 3OG4B 1OP9A 1GSMA 3CLFL 4EUPG 4NGHL 4BQCA 3OAUL 1RZGB 4Y16C 2DI9A 2D7NA 1OSZB 3K8MA 5DD0H 1AHWA 3LMJL 4QY8B 2J1KA 1CYGA 1P4LB 2DQIH 4N0YH 5IBUB 5LGHL 5FYKH 1KXTB 2V5MA 1A5FL 5CJ8A 2FCBA 2A73A 2X4QB 2Z93A 1LEIB 5C0EB 2JB6A 3S4SG 3HZVA 3VGHA 4K3EL 3BKMH 2BOBA 4PTTB 4GAYB 5HI3C 3KHOA 4W4OA 4NJAH 4S1QL 2BVQB 3QCUL 4OZIE 1UEYA 3O4OB 5ACLA 1J0JA 4HWZB 5C08D 4OZGF 1JGLL 1ZHNA 3BZFA 5ICXB 1KYOK 1X5IA 1FNEA 1BBJB 4QXUL 2B5IB 3GSWB 3KYKL 1B4RA 2JJSA 3MJ7A 4FFWD 2EKSB 5FYJU 5MEQA 3BD4A 1JHKL 3FTGB 5I0ZA 1LEGA 3NABL 3ZKXB 2BNUB 3G6JF 1CGYA 1WQVT 4LVHB 4Q0XH 2CXKA 2ZJSL 4HJ0D 4KTDL 2AXHA 5F8QC 4JDTL 1OAQH 1QRNB 1D3CA 1AGBB 2WW8A 4XVSH 4YC2B 4Y19D 2L4OA 2GJ6B 5T3XD 1CICC 4G42A 4HJGA