4ZTPL

Fab structure of rabbit monoclonal antibody r53 targeting an epitope in hiv-1 gp120 c4 region
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
216
structure length
216
Chain Sequence
GPVLTQTPPSASEPVGGTVTIKCQASQAIDEYLGWYQQKPGQRPKLLMYYASTLASGVPSRFKGSGSGTQFTLTISDLECADAATYYCQNYYVGSSTNYAFTFGGGTEVVVKGDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain of Fab fragment of rabbit monoclonal antibody R5
publication title Structural analysis of a novel rabbit monoclonal antibody R53 targeting an epitope in HIV-1 gp120 C4 region critical for receptor and co-receptor binding.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 50
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2015-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ztpL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ztpL01
3VMNA 4NZDA 3W0WB 1B88A 5GSVA 3SDAC 2JLLA 5DMIL 2YHGA 3KWWB 2WP3O 4JRYA 1BJ1J 1NFIA 4OLYL 3MJ6A 4XPGL 3KPSA 2D31A 4RISH 1Y18B 4JPWH 1YN7B 4HS6B 5LQBL 2JIXD 3JV4A 4HBQA 1A9BB 1FNGB 3VFRA 3QQ4B 2FHBA 5T33H 3WJJC 1AQKL 2X9YA 4LOUC 1BOYA 2WUCH 4Z0BL 2F53E 5CEZE 4DQOH 1VKXA 2A73B 2VZVA 5AAWA 1BECA 4ZFZB 5IHZA 3OHXB 1OAZL 2EIEA 5MERB 3BW9B 2EIZA 4Z76B 4OZHB 4XC1H 1IKNC 4X98A 5DQDH 3S97C 1IC1A 3SY0B 1U3HB 4X4ZA 1TITA 1G6VK 3R4DA 2CUIA 4PBVC 3KPNB 5JTWA 4FFVC 3RNKA 2X44D 5CILH 3GKWL 1K4CA 3IJHA 5ICYA 5KOVC 3MV8A 2VQUA 3NIGE 5E2VH 1FIGL 4GG6A 5LCVH 1FN4B 5HHOD 3WS3B 5K9QI 4XI5D 3T2QA 2NY4C 1HDMA 2V5MA 5F21B 1N8ZB 4MSWB 1TQBC 4J4PA 1NCAH 1FZMA 2OR9H 4OD3H 1HXYA 4X5LA 4ZS7H 2YPLD 3X12A 1TQCC 4PD4J 2OLDA 3CXDL 4HHAA 4FQ1L 5CJ5A 5F7HA 4KVNL 1JYNA 4I77H 2EYTA 3LB6D 4X6CA 5MP6H 3D3VE 4G9FA 1C7SA 3Q5OA 2HTKD 4LCUA 3HZVB 5GZOD 4BZYA 4JREB 3PP3K 5KSAB 4N8PA 4X99B 4G6KH 3QG7H 1UB5A 4OF5A 4QXUH 2VXSH 5GGSB 3BPLB 5HHOE 4TUOA 3B9KC 2DJSA 1JZ3A 4RAUA 2ENYA 3FL7A 5C6PB 5IB1A 3CK0H 3HFMH 3V4PL 3IDMB 6FABH 1KLUB 1KG0B 1ZEAL 5FGCB 1LK2A 4X6BA 2QTEA 1GAFL 2DLEA 3BPOC 3SE8L 3HMXA 1C08B 1WWCA 1QFHA 4M03A 4JJ5B 4BSWA 4S10A 3QUMH 3G6AA 1XIWC 5C0BD 1W72B 3OAYH 1G1YA 1U91A 1CU4L 3EGSB 4G6ML 2JCCA 5GRXG 3SDXF 4XNMA 3ROOA 1YMMA 1OARH 5JW4M 1KEMH 4PRIA 3P9LA 3JV6B 1IKFL 2A6IA 3V79C 4WVRA 5F6HI 3B9VA 2Z31D 3MNWA 5IVOA 3RGVC 2EDYA 1F42A 3QEGH 2JE8A 3BT2L 4WEMB 2EE9A 1CICC 4LSSL 1JHLH 4FTVA 4M7LH 3DGCR 1A1OA 3GNMH 5HVHC 5J6HB 2HRPL 5F9OH 2HRLA 1R3IH 1UKTA 4NZTH 3ZSSA 4PLOB 4ZUUA 4JFDB 4G6AD 2VJXA 3AAZB 5A2JH 2CKBL 1V3KA 1RU9L 1ERNA 5H35B 1M71B 5CUSL 1DEEA 3IJYA 1ZHBB 4Y8AA 3LS4L 1CLZH 1ZXQA 2AK4E 2DQDH 4ODHH 1AQDB 1REIA 2H9GA 5CMAA 2NW3A 2BY3A 2CXGA 3I3DA 5DMGD 1IBGL 4ONGH 3VWKA 4DW2H 4YO0B 3EBAA 2FX7H 4DCQB 2NR6D 3C6LD 2H8PB 5FM5M 4L29A 4HJJH 2BY0A 4QRTA 2BJML 2HAZA 2EH7L 3BE1L 2O5XH 4PRHB 1IZJA 1LO4L 2P24B 4WY7H 3SQOH 1INDH 4B7LA 1YQVH 4F7MA 1UWXK 3UX9B 3WE6B 1OT2A 5HYQB 2VWEE 2J8UE 5FO8A 1YN6B 4F2MB 3PGFH 4N5UA 4S1DC 5J6GA 1N5YH 4ONOA 4HUKB 5EFIB 1JFQH 5E4EB 4WHCA 3ZHDA 4PG9B 3EYSL 2DKMA 1FPTL 4ENEC 4UQ3A 1S8DB 1ED3A 4HC1L 4PJAF 3SE9H 3LKOA 3OGOE 1UZ8B 3O4OB 3RUGB 4ETYA 4GQPH 3LRSA 3K4DA 3VGDA 3KPPA 2VZ3A 4JQXA 3U0WH 5DJ0B 1IC7H 2UWEA 2PYFA 2YPKB 3D25A 4ZUTB 3S37X 1RZKL 4QNPE 4GBXA 2A6JB 1X4XA 2PW2A 3O6FA 1MIEH 4G80B 3WSQL 1KJVB 4PJ9C 5I1GL 1DBMH 2QQNH 4U1MA 4JKLA 4NNXB 3LKPB 2VDQL 3TVMA 1X5ZA 2R9HD 4CVXB 5HDQL 4HWZB 2P5WD 1JWSA 1NL0L 4NN7C 4G7YH 3PV6B 3RWIA 2NYYC 1N6QH 2YPVH 1RZ7L 4WGWB 4HWEH 2AGJL 2W60A 1ZV5A 4GXVL 3H3PH 5IT2L 1MOEA 1BOGB 2NY1D 3VXQB 3BEWA 5B8CC 1J7VR 4AMKH 3W5MA 5KSUB 1P5VA 2E9IA 4WV1A 1D5IL 3VXNA 1A2YA 4PJBF 5JPNB 1MHEA 3IKCA 4LGPB 1OOAA 2R29L 1DQJB 3CU7A 3ZYJA 4NKIH 1P6AB 4UTBH 4H20H 4UT9H 1GXEA 4JKKA 4QTHB 1T20A 1NC2D 1X5LA 3RIFK 5AZ2L 3GB7B 3LIZL 4OD2A 1FLRH 4OFIA 2XN9B 2D4FA 4MA7L 2VXVH 5EBGA 5JQ6H 3OQ3B 1U8HA 5CHNA 2R56H 4XZUA 1MQ8A 5JW5A 3SDDD 2XQBH 3QDJE 3QO0B 3V5DA 3WNNA 3L3OA 1D5MA 3U46A 1AI1H 5C07D 1XGTA 2IAND 1ONQA 2AJZA 3V0VA 4FP8H 3FFCB 4O51A 2YUVA 3SDAA 5GISH 4U1HA 3GMLA 1EBPA 3QUXD 3T04D 1W0WA 3FB5A 1QHOA 3MRRB 1L0QA 5E56A 2OK0H 2Y72A 5IVXF 1XCQA 3DX7A 3QCUH 1EO8H 1ZS8B 5TFSL 3GHEH 4ZPVB 3HMXH 3A6OA 1YNTB 3WJJA 3MLVH 4U3CA 3BAEL 4W70A 1GGBL 3LQMA 2YZ1A 1AY1L 4XPTH 1IGMH 1EMTL 1JWUB 1KBGH 4P2QD 4QRUA 2CDEA 5FO7B 3WFCH 4JAMB 2IANE 1JHTA 4PR5A 4GMTL 1IKNA 1ZT1B 2WBKA 3C5ZB 4NC0B 1T21B 5HDLA 3F5WA 4KRMB 3QXAA 1MLBA 4JM2C 3VW3H 4M9OA 3G5VB 1G6RA 3L5JA 3L5XH 1OWRM 3KVQA 4K23L 4DKAA 1E4WH 4J3TA 5E5MA 2WBJB 3X13A 5C09E 3I6GB 3MSPA 1RZGB 3EOAA 3VDCA 1JL8A 4HUUA 3RVUD 2EDKA 2OSLB 1AGDB 2XRAL 4ZS6D 3HNVH 1IQDB 2X7LA 3T4YA 4CBPA 1FYTD 4QXGH 1CDYA 1JYVA 2XQYK 1D6VL 1MVUB 1WVZA 4PGBA 5IFAH 3T77B 4FXLA 5K9JL 5GS0L 2FBJL 5IKCB 1UWEL 4BSVA 3CXHK 4CDGC 1QFUH 1HH6B 4U1SA 2IQ9L 4XBPB 3WDIA 5TF1H 5E8EA 5LKNA 1EHLH 2E9BA 1INQB 1KNOA 1OTTC 4K7PL 2VQTA 4L8DB 4RAHA 3ARYA 4HIEA 1G1CA 4G7VL 4LBEA 2IEPA 4JB9H 1B3JA 2VQ1B 4CVUA 4Z7QE 3BUYA 4N8VB 2C3GA 1S7UB 4RQQA 2VUOA 1EERB 3RWJB 3ARVA 4O2EA 3RWHB 2Q3AA 5KG9A 2Y5EA 1GCFA 4XCNA 3O8XC 2YXFA 3DIFB 1LO5B 2VL4A 2LU7A 2RR3A 3JV5A 4N0CD 3IGAA 2J7LA 3L3IB 1YPZF 1E4XH 1CXHA 5FECA 3B8YA 2P49B 4YAQB 5J1AB 1QRNE 5I9QB 2GT9B 2PTTB 5TDOA 3VXUB 4N0RA 2AV7A 3F7RA 2VIRB 5I8KH 4DFIA 4KI1A 2C26A 1S7RB 2WINB 1J5OH 4XNXL 3PHQB 2HT4C 1UXSB 5JA8B 1MFBH 2E7HA 5IB5A 1AKJA 1P69B 3L5WA 2E7BA 2ZSVA 1OQOA 2R1YA 4OJFH 1LO0L 1DQML 3P11L 2P48B 3CC5A 3OKKB 2O5YL 2WW8A 2WIIB 1TVHB 4KKLC 4WFFE 4ZAKC 1SM3H 2EDRA 4HIHA 3L7FA 1JZ2A 1FO0L 5I66A 4YXLL 3KYKL 4JPIB 1OAQH 4PP1C 4JFOA 1BREA 2FATH 4BZ1H 1KCSL 5ALCH 3E8UH 1R0AH 4EUPG 2BRRL 5F1SA 3IDXL 3DJ9A 4LLQA 1H8OA 3C6SA 1CFVL 5D2NB 3G6JF 1JV5B 1J8HD 2DBJA 4OSUH 2MTPA 4FMKA 4H25B 2HVKA 3LPFA 4I13B 5GS3A 2P42B 3QFJD 4L9LC 3ARDC 4DN4H 4OTXH 5DEFA 4E41E 2X89A 1ZLVH 3BPNC 4ZFFB 4ZXBB 4DN3L 1BZ7A 1FJ1B 3H7BA 3HE6D 4LHJB 1QHPA 3U30B 4PLKD 3U4BL 2ICWA 3L3KB 3O3AB 3UC0H 4LAJH 4E5XB 1F6LL 1ZAGA 1CK0H 2F5AL 4HUXB 4HFWA 1AR2A 1QSFD 4V1DB 3TBVA 1RZJL 2ZOLA 1V7ML 3CZFA 4U33A 3DGGA 2BNUA 3MRPA 4ODBD 5GIRA 4QY8B 5EC2B 4Z7NF 1TTFA 3PL6D 1J88A 1OAYH 3EYVA 3MV7B 2BVQB 4K7FB 3MFFA 5KANI 3VFPB 2DQTL 2PYEB 3WCYA 1QBAA 1XFPA 2UYLB 1UCBH 4PGJA 1A64A 4RX4A 4WHYH 2X4QB 3QJHB 1Q8MA 2F5BL 2VAAA 4I5BB 2P47B 2C4XA 2DYPD 4HGKC 4YQXH 4F57L 4LSPH 5KSBB 4MGXA 2Z4QA 5B3JF 1H3XA 1G6RH 3VGAC 1FZJA 1DE4A 5B8CA 4HUVB 1HKFA 5KN5A 1A8JH 4X6DB 5B38B 1CZ8L 4IIQC 4Y4KB 1BP3B 2YUXA 4NBZB 3DUSA 3N1GC 1PZUB 2Y36H 3GMPB 3UO1L 4LPVA 4JFFD 3ZYIA 3TN0A 4D8PB 4C56A 5D2LB 4Q9QL 3TBWB 4W6XB 4PB0L 1OTSC 2GIYA 4OCSH 4K9EL 3F6IA 4F58L 3MZTA 5I1DB 4I0KA 2VLRD 4ODUA 3KG5A 5DHYB 1P7KB 1OGAE 4Z7VF 3M1BA 2H41A 1J05A 5KVGH 5CKAA 2VXTL 3QEQA 3PE9A 5E6IC 5C0CB 1HOCB 3DV6A 3ZE0E 5E99H 3HLAB 4NHCH 5SX5H 1O0VA 1CXEA 5LGJB 4NQUA 2MHAB 1QR4A 2JJUA 1JGUL 2F8OA 4MDJA 5I1CL 4R8WL 1MRCH 2GAZA 1ZWIB 3EJZD 1HN1A 4U6TA 5DZNA 2GSIB 4Y4HB 4ORZC 5JW3L 1OCWL 4HJ0D 3CDYA 3BJLA 1FL6B 3RKDD 1RZKC 1H15B 1DN2A 43C9B 2DI9A 5FCSH 3P73B 1FORH 5E2JA 5JXAH 4Z8FH 3SKNA 1NAMB 5KS9F 1YEJH 3LAFA 3MRBB 5IESH 4LCCA 3X3FL 2B5IB 3F7VB 1S7XB 2Y7QA 4XVUC 4CVZB 5B39G 3OR6A 4AEHL 3UPRB 3UTPE 2I5YL 3P4MB 3DUUA 4TTDD 2B4CL 1LP9A 4HT1H 4RFEA 3PDDA 2BNQB 4NBYB 1QACA 4JM2A 4YXHH 5EIQA 3MV9D 4LARL 4R3SB 4RAVB 3RVWD 1QLFA 3GSVB 3T09A 1MHPH 5I71C 1G7PA 1D9KC 3UXFA 3EYUL 4QHLA 4EBQL 4FABH 4OQTA 5FM5O 3S34L 4HAGA 4GS7B 5FDWB 3VDBA 4XXCC 3OKYA 4D2NA 3MRLB 1KIPA 3NIFF 1I1AC 4UAOB 4CMMB 4HK0A 2NXYD 1I9JL 2V5TA 3QWRD 3BMWA 4ELME 4NQCA 4Y2DB 1EAJA 4RGOH 3I6LD 1T7XA 3QAZB 4AEIH 1U41A 4CAGA 4GG6F 4HQQH 3DVIA 4ODSL 4XT1C 2R0KH 2F53B 5E4IA 4AZ8A 5IR1A 4UU9B 1JGVH 1ZVYA 5DZOA 2X41A 3KR3H 4KKAD 2YKLH 3DI2B 1KC5L 4IHOA 3QXDA 4Q0XL 5JNYA 5C92A 3BO8A 1MFEH 5HI5C 1D5ZB 4M1CD 5L6YH 4UIMA 5DJXB 1ND0A 1DLFL 1IGCL 3RA7H 1ZGLA 3ARXA 3B3IB 1L0YA 1IT9L 1QSED 4NCDA 4XNUH 3IRZA 2AEPL 4UTAH 4X6EA 5DT1L 4XCYA 5DS8A 5DUPL 3Q6GH 2CRMA 1N0LA 2RFXA 4PTUB 5FYJH 5HYJA 1N5AB 2FGZA 4AT6B 2PO6B 1MI5D 3TJEH 4U1LA 2XA3A 3N9GH 4XMLL 3K4AA 3V0AC 5IFHH 1OF2B 4XNQB 2EICA 2PUQT 3SCMA 3LD8B 2HT3C 1W72L 2ED9A 5JZ7D 3NA9H 3FZUD 3HE7C 4OM1H 1AFVL 1BZ9B 4OGAD 4UDUB 1U58A 5DEGA 1HH9B 4OB5H 2HJFB 3D3VB 3FQRA 3JSSA 1T0PB 1NCBH 4JZOA 3QFDA 3QH3B 5GS0C 4QRPE 1NBZA 3NFPA 4NQED 1PKQA 2DLGA 1I1FA 1ZT4B 4MHHG 1JYXA 3TWCL 5CLWA 3IJSB 5I16B 4DKDC 3ZE2F 3SOBL 4MX7A 3LSOA 3EO9H 4ZTPH 3P4NB 1Q9OA 4U7MA 3OV6A 3TBSB 1NGXA 4UILL 4P23B 3ZTNH 2FWOA 2XY2A 3FO1A 4GT7A 4OFYA 5FA3B 5B21A 3TNNB 2V2XB 3STZB 1KB5A 3G04B 3O6ML 1IILE 2Z8WC 3QUYD 4GRLC 4L9LA 3ARDA 1A6TA 2QQKL 1KGCE 5BRZA 4S2SA 4ERSL 3TO2B 2C5DC 4MXQC 3GSNA 4XBGA 5DJ6A 1KN2H 2BDNH 1U8JB 5EO0B 4WRLA 4LU5H 2XTJC 1KTKE 2X5PA 1TJHL 4NQEE 2J4WL 4MCZA 5KVMC 3MJ9L 4M4PA 5IG7B 4LSUL 2QKIA 1TCRA 1KTRL 4DUXA 1TETH 2ICEB 1RK1B 3O45A 2EIBA 3UBXA 1D7FA 1K6QH 1Q94A 5F7EH 3M8OH 3BISA 1V3LA 1T1ZA 1BBJA 5CJQL 4LVOC 4BFIA 1MCQA 3SE4C 3LZFH 4M43H 4PRNA 4DZBB 1AXTH 1ZA3A 5ESQB 4JFZH 1KT2A 3SJVE 4MZ3A 5T1DL 7FABH 2NY2B 2AK4B 3UTTD 4M7KH 1L7IL 2CKBA 1SJEA 3OKEA 4QT5A 5CD3A 1C5CL 3S88H 4NO5A 1G0DA 2I60H 4LGSB 2Z31B 1LNUB 1DQQB 4GRMA 5GRUL 3EJYC 2GFBA 4PJ7A 1T4KB 5EZIL 1C1EL 2LU4A 1JGDA 2UWEF 4KUZL 1FP5A 3NIDE 3O3EB 5HTSA 2LAGB 4J3OC 2C9AA 1H3WM 3ETBF 1CDGA 1NCNA 2GCYA 4Y19D 4OQTH 5C08D 3IDJA 2J8UB 3BKMH 5CSBA 5IW1A 1IGIL 4PY8I 3UZEA 3MCLL 5D1QD 2F58H 1N4XL 5FO9B 4R0LB 4YDJB 2IG2L 2O5ZL 3SKOA 4M8QA 3O3DB 1MRFL 5IV2A 1P2CA 1AHWA 2EDTA 3LQAL 5DMIH 1AE6L 3NCYP 5E6IA 1OGTA 4OLYH 3QIBA 4XPGH 1KPUB 3DBXA 3GBNL 1AXSA 4HC1A 4F7TA 2BZDA 4UT7L 5LQBH 4L8SA 4H5SB 3ZO0A 4NQSB 1QSVA 5JW4N 1IARB 3TGXA 4Y19E 2HFFA 3TNMA 1AQKH 5C08E 5F71A 2A0LC 1RZJC 4Z0BH 32C2A 4Q6IB 5CIPA 1GC1L 4RBPK 5E8OA 5I73C 2ZP0T 3S4SA 5EIIB 3T0EC 5INCB 5FB8A 4DWHA 1OAZH 2BRQA 3MRKB 3DX9B 3S8WA 2DIBA 3H9SA 1BPVA 3P9WB 4NRYB 1YMHB 1MWAB 4UV4L 4ZNEA 1ACZA 4HZAA 4OZGF 4R96A 5DVKA 3HG1A 3IDYB 1A6WL 4NKDA 1OP3K 5D96C 4LIQL 1FNAA 3KYOA 2FO4A 5DRZA 3ARFD 4HIIB 3GKWH 5IJVB 4PJIE 3WFDL 4WGVB 5BS0A 2NX5D 4JEGB 3SGJC 4M7LT 5AUMB 1FIGH 2P5ED 3VXSD 3S3JA 1N26A 3N0PB 1PG7X 1U3JA 4UMGA 4YFLI 1CXFA 5F3HA 4MAYC 4MMZC 3MOBL 1EHAA 3E3QC 4RMWA 2ITCA 3C08L 1D9KA 3CFEB 1OD7A 3QDJB 3QT2A 4V2CB 2OTUA 4NZRL 5F44A 1FNEA 1JPTL 3CXDH 4L3ED 4FQ1H 2F8VA 4KVNH 1NMBL 4LLDA 4XXCA 3KPQB 1U8OA 3BZ4A 4NCC2 4RZCA 5FEBA 2G9HA 2CDFB 5I75C 1I1AA 2DLTA 4MNGE 1EUTA 3HPLB 3MRDB 1UQSB 3L7EA 1RUQL 3MRHB 2V9RA 3MCG1 4LHUG 4M5YL 2EEAA 2NX5E 3UTSD 3QQ9D 1DANT 2P5EE 4OD1L 1ZHNB 3VFNA 5SX4I 5MENA 3DV4B 1YEFL 3ULUE 2HFTA 5DMJB 2X70A 4FOMA 3V4PH 1ACYL 3NGBB 1FBIL 5AAMA 2ADIA 1ZEAH 4GKZB 5IBUB 2IALB 5CJBA 2WQRA 4XNZB 5IGXH 3U6RB 1UB6B 3H7LA 3HZYB 1UXWA 2RGSA 3O3BA 3SE8H 3F7QA 4EJ1C 3VFUB 4M5ZL 4Q7DA 2E9WA 2WWMC 3ZT7A 5H37H 5DC0A 4JDVA 4EQ2A 3HZKA 5I1LB 4F7CB 1X6NA 4YLQT 3WO4B 1H5BC 1UZ6F 1CU4H 4G6MH 2D9CA 4M61B 1I7TB 1YY9D 4MJIE 4ZDHA 1NEZB 3QO1A 4ZG1A 1IKFH 2A83A 4X5WB 4N8CL 2VNCA 2R23A 3BT2H 3V5HB 2ZG1A 4LSSH 2B4CC 1I8KA 2NY3D 2ZUQB 1H3TA 4XP6L 5C09B 2HRPH 4J3VA 5F7MC 5I30L 5F89A 2C3VB 4YIQA 2D0GA 4BH8A 4YHIA 2CKBH 1WZKA 1RU9H 2GUOB 1CFQB 5IUSA 1DLHA 4U2ZA 4WUUE 1JF5A 5CUSH 3HE7A 3LS4H 3QUZD 1GH7A 2VLMD 1X5AA 1HNGA 3MREB 1IBGH 4P5TB 4Z0XB 4F7PA 1HQRB 2W07A 3QJFB 4RIRB 3VMOA 2V2TA 1BQHB 1U3HC 4A2MA 2VZOA 1TDQA 1VEOA 2FH8A 4BQ8A 3MA9L 2V7NA 1JMXA 3DRTB 3PG2A 3HNTL 2BJMH 5CBAA 2VR5A 4Y5VA 2EH7H 3BE1H 1LO4H 3IS1X 3IRPX 3WLBB 1HYSD 1M05B 3EDDA 4C83B 3OWEA 4KKBD 4NQVA 2I26N 5TE7L 1QQDA 1F4AA 5FK9B 3HC4L 1U8MA 2ENSA 3RIFF 3V6OE 4HUWB 4XP9L 3CVHB 3WS6C 3EYSH 1FPTH 3ESVF 3HUJA 1VGKA 4HC1H 3UAJC 4KRPB 1ZHKB 1QRNB 5J12B 4XXDA 1M7DA 1XGPA 2JTDA 5K59E 3LN4B 2BOCB 2RBLA 2DIJA 2VDML 4OZFB 1UH4A 3UJIL 3L3HB 5ISZE 1RZKH 2B0SL 2FNBA 5KSAC 5CIPH 3G5YB 2GK0B 4NZUL 4UNUA 3WSQH 5JO5A 5I1GH 3BPLC 3ARGD 4KGLA 5DJCA 2VDQH 3RTQD 5HDQH 3DROA 3SE4A 2YC1A 1WF5A 2G75B 1T1YA 3QWOA 1K2DB 2D9QB 5BXFB 2FR4A 5IEHB 3DVFA 1NL0H 1H3VA 3QDMD 1KV3A 1RZ7H 2C4FT 3C9NA 2AGJH 5IT2H 3N06B 4GXVH 5F7WC 4KAQL 1NC4B 4Y5YA 1N3NB 5F9JA 1AD9B 1MIML 3ULSA 1D5IH 3PJSB 5DURB 2QQQA 1Q1JL 5D9SB 2R29H 4KMTL 2FLBT 3JTTB 1F3DH 1YQ2A 4JHZA 4Z77A 4D0BB 1FL5A 2XZZA 3QUKB 1YYML 4NO2B 4MVBC 1O7SA 5AZ2H 3LIZH 2AJ3A 2VDLL 5JIKA 4G8IB 2P45B 4MA7H 5HGBA 3HKFA 5D5MA 5B3NA 5AD0A 3CCHA 4E41B 4Y16D 1U8IB 4LMQE 4WHYG 4YHNB 1OM3L 3HR5B 5DI8A 1UKSA 4JO2L 4L8CB 1YJDC 2ZWLT 3AU1A 3NZHL 1MLCB 3D69A 2DLHA 1CDIA 3Q6FB 3TCLB 2DM3A 5DQ9B 1I4FB 1QFWL 3MA7A 1U93A 2AI0L 5SWSD 4CADA 4XH2B 2Y23A 3RY6C 1T1WA 3PWPE 1U8QB 5TFSH 4X4XB 3ULVF 3MV11 4Q6YA 3ZKMC 1AP2A 4GQ9L 3C8HA 3TZVD 3TM6A 1F3DJ 3BAEH 4K3JL 1GGBH 3OL2A 4LLVA 2YBRB 1AY1H 3PIQA 2DTSA 4KFZC 5J9PB 2CDGB 4WW1B 3BZEA 1EMTH 3T0EA 2DI8A 2HKHL 5CS7A 4D9QD 5B4MC 3ARRA 1FVDA 3U2SA 3MBED 2ZNWA 2XKNA 5T3ZL 4GMTH 2W9DL 1ZVSA 4WFED 1T83A 1MCOL 1R5VB 3MRFA 4HKZA 1BD2D 3O4OC 3FB8A 1EEZA 4AENB 4JRXD 2ZSWA 1IGTA 3D39A 3CFDA 2XWBB 1PLGL 3SGJA 2VMFA 4K23H 3BIKA 3PL6B 3GI8L 4R97B 1NC2A 3G08B 4JFPA 4PJ8B 1C16B 1X9QA 5FV1L 3LKNB 1MCSA 1I85C 2E7CA 2V2WB 5IIEA 4LMQI 3EHBC 4NNYB 5D1ZA 4MAYA 1NGZB 2XRAH 5FYLL 3SDXE 1NAML 4TSBL 2FLRT 1PAMA 1YUHB 3LH2L 4ZSOA 1JNNL 5LGHL 1D6VH 5DTFA 3GGWA 3D85D 1OGAB 3KPMA 3BX7C 3CX2A 5K9JH 4WFEE 5GS0H 2FBJH 1RJYB 1UWEH 1GOGA 1Q9LA 2CLRA 2IQ9H 3QUXA 2Q76B 2W9EL 3KXFE 1XH3A 2FJFB 4K7PH 5C6TL 2GJ6E 4YHML 1LP9F 1KULA 4P2OD 3FQNB 1MH5B 3LQAC 4G7VH 3IDIA 3G5XA 2FGWL 4HMEA 1HHGB 3MLUL 3IDNA 5DRNA 4YC2B 4X7TA 5T1LB 5HYSG 5IB3A 1CVSC 4GKNB 1SY6A 3MRCA 5DXWA 4N0YL 1H8NA 2UY6A 5GS2D 1PYWB 2AJVL 1A6AA 1ZHLA 4WW2B 2BMKB 4YPGB 4P2QA 2X4RA 2HWZL 2A74B 1GC1C 1TNNA 4F3FB 3ARBB 2ARJQ 4GW1B 4Y4FD 1H3UA 3B83A 4GKOA 4FQ2L 5T3XD 3MUGB 4MQ7B 5IW3A 4LQFL 3CDFA 5F1KC 2LQRA 4XNXH 4Y89A 1YN7A 1A9BA 3WL9B 3QNXB 1I3GL 4LPYA 4JPKL 4PJAE 2Q20A 5J13B 4RMRA 1R3KB 1FYTA 1I7RA 1LO0H 4TRPL 4LRIC 1DQMH 3H8NA 3P11H 4IMLA 2O5YH 4KUCF 2A73A 4EN3D 1NGPL 2I9LB 3L3JB 4ZFZA 3DRQB 1IC5L 3OHXA 3QIUB 3ZZ1A 1FO0H 3BW9A 4Z76A 2H1PL 3HI5L 4YXLH 3BVNA 3KYKH 3QXUA 3KYNA 4OFKA 4OFDA 2DS4A 3BGMB 2XZCL 4ELMB 3SY0A 3C5ZC 4M6NL 3L3DB 2VDNL 1KCSH 4EI5D 3KPNA 4RFNB 3OF6A 3IDXH 3FO9B 1KJMB 2DI7A 1SVCP 2V5RA 4PGEB 1CFVH 5T5FL 5J56B 5HI3C 2AXGB 1KCVL 1RMFL 5HI4D 2CJUL 4WNQB 1A6PA 1FN4A 2WBJC 2ARJB 3WS3A 4GSDL 1NFDE 1X7QB 1YDPB 4JQVC 4BFBD 3FQUB 1T6VN 3MLZL 3O9WD 4PJBE 3AMLA 1KCRL 2BSSB 4DN3H 3WS6A 4K07A 4KKCC 5IJKC 2A9NL 1DTUA 3U4BH 3V0WL 8FABB 2F5AH 1MNUL 2NTSP 4YGAB 1J12A 1CXKA 5K9KB 3RVXC 1VA9A 3HZVA 1RZJH 5KSAA 1GGTA 5HXMA 1V7MH 1J10A 3FJTA 4U3HA 1BJ8A 4O5LL 1SEBB 4L3AA 4G6JL 3K2UL 2VN4A 5CSZA 4LVNB 4PJ5D 4KDTC 1HHJA 5H2BB 4BKLB 4C4KT 2F54E 2DQTH 3IDMA 1KLUA 1KG0A 3MJ8A 2NY6B 5IF0B 1SBSL 3MRNA 4D0CA 2WWKT 2F5BH 5GGVL 1C08A 5DFTA 5IVXE 3U4EB 3OTTA 2BNRE 4JJ5A 1NANI 4M3KB 1E27B 4F57H 5DVNA 1I3RB 2EDLA 1OW0C 5D7JB 4QRPB 2VLKE 1MSPA 1UH3A 1EFXD 3O2DL 1VADB 4FQQB 1CZ8H 5I9QC 2H2SC 3DHJA 4HDIB 4RNRB 3WFZA 4I0PB 4DTGL 1J8HA 4M8VA 3UO1H 1PDKA 5ACLA 1IEAA 4Q9QH 3QFJA 4PB0H 2H32A 4EDWL 4K9EH 4MWFB 1QNZL 2VERN 1KLGA 4Z7WF 5C7XL 4F58H 4XCFL 2HJLA 5IROC 1DVFB 2VTFA 3AAZA 3I75B 1VGEL 3ZE1F 5JOFA 2NZIA 4RRPA 5I8CA 5A1AA 1UA6L 5H35A 1M71A 4JHWL 1R3LB 3QNYB 1ZHBA 2VXTH 4PB9L 1CGSL 1AQDA 4QF1A 2LVCA 3RP1A 1EAPB 4YHYB 1JGUH 2XYCA 3OBAA 4DCQA 4R8WH 3ZLQC 2IWGA 1TZHB 5JW3H 5JXEC 1OCWH 3TJHC 3MJ9A 3GKZA 1AGBB 1FV1A 4PRHA 5D2NC 3VWJD 4XP4L 2IH3B 3F8UB 4YH6A 2G5RA 3SJVB 3WE6A 5HYQA 1DN0B 3V9FA 5C0AE 3X3FH 4F2MA 4OF0A 4POYA 3KYAA 1AGEB 1KTDA 1RD6A 4AEHH 4ZXBC 4PG9A 2UZYB 2I5YH 3U30C 4EIZC 2B4CH 5EZLB 4HX1A 4X8XA 1C12A 5CZXC 5J3HC 5HVWA 2HFEB 4OLZL 1ORQB 4Q58C 4LARH 1A6ZA 1U9KA 3PGCB 4JFFA 2D2OA 2DAVA 4NOBA 4LLMB 2BOBB 1KJVA 3T0AA 1L6XA 1ZE3C 4NNXA 1MJ7L 3EYUH 4MA8L 4HJGB 4CVXA 3HRZA 2EDOA 4EBQH 4WTZA 4E9LA 1MWAL 3JTSB 1IAIM 5M94B 3ILPB 3DXAE 3PV6A 3S34H 2PXYB 3U0PB 4F9LC 3N50A 3RL1A 3O6LL 2Q6WB 1J87A 4Q74A 4R4FL 4Q2ZB 1I9JH 3SHSA 5KSUA 2FIKB 4MJ4A 5FIEA 5JPNA 4AEEA 1P5UA 4Y4KC 1A7PL 3VXOB 1DQJA 4ODSH 1NGYA 4QTHA 4P5MB 3GB7A 3TO4D 3W39A 1PEZA 2P46B 1WZ1L 1JZ6A 3JBG7 1DANU 3VXMD 1KC5H 4Q0XH 3CMGA 5GGQL 2ESVE 2DQHL 4EDXA 4NUJA 3QO0A 2UV3A 3VFSB 2FHCA 1NKRA 4M7ZB 3BN9D 3T2PA 1DLFH 3CX5K 2ATPB 1IGCH 1DZBA 2Z91B 3SE3C 3QB7C 1NBYB 1FQ9C 1IT9H 3I2CL 2AEPH 3BZFB 4NT6A 5KZCB 5DT1H 5DUPH 3RVVC 3VXRE 3MV9A 1U8NA 5BO1L 4XMLH 1EV2E 4RSVA 3P30L 4Y4HC 1ZS8A 1IZKA 4ZPVA 4JZJB 1UJTA 4WHTB 3CFKB 1YYLL 5F7UA 1W72H 3HS0A 1M7IB 5EU6E 4BQ9A 5E7FA 4IRSB 4O4YL 1AFVH 1JWUA 1NDMB 5SWQA 3QZWG 1MHCB 1EUUA 1MCPL 4FQCL 1FCGA 5FO7A 2B5IC 4BA8A 5ICZB 1G84A 4PYGA 4MNGB 3UBXG 4MAUL 1ZT1A 4Z7NE 4OLXH 4QOKE 3MR9A 3C5ZA 3VFWA 1QG3A 3I02A 2H26B 3TWCH 2OX5A 1T21A 4IDLA 3SOBH 3D48R 1H3GA 4Z7UA 4ELKA 5IQ9B 3G5VA 4UILH 5TQ2L 3BXNA 1MY5A 3ECBB 3PQYD 2FB4L 3O6MH 5B3JE 3SDCD 3RWCB 1RZGA 3FB6B 4M6OL 4JQVA 2QQKH 3AB0B 4N90E 2OSLA 1AGDA 2VE6B 4C58B 1ORSA 3O11A 4ERSH 3REWA 3BI9X 3BP6B 1X44A 1Q0XL 2ZPKL 5EH1A 3RVTD 5IJKA 1JPFB 4MJIB 3T77A 4GS7C 1Y6KR 3MODL 5IKCA 3HCVA 1TJHH 5BZWB 2J4WH 3REVA 1HH6A 4PRPE 4XBPA 3FQTB 4UAOC 1XGUB 2FYYB 3MJ9H 4LSUH 4XNYL 4NKQB 3MXWL 1II4E 1RJCA 1E0OB 4Y2DC 4K3DL 4AL8H 1FH5L 2BVPB 1I8MB 3QAZC 2DBLL 3DMMD 4N8VA 5CJQH 4XVTL 3V95A 1WGOA 3GMQB 1QPPA 1C5BL 3OXRA 4MXVF 2X6MA 4OIIL 5IEKA 3CVHL 3RWHA 2WBWB 4WUUB 4IOFC 3V5KB 5T1DH 1TTGA 4U6HB 3E0GA 1XF4A 2BSTB 1L7IH 3O0RL 3TC9A 4TSCL 3V4UL 3KPSD 1C5CH 3DIFA 2Q7NA 4O02L 1OW0A 4N5EC 5CEYA 5GRUH 4NQDE 4QHNA 5ETUB 1ZK9A 5EZIH 1C1EH 4KJWD 5CAYB 4KUZH 2PTTA 1Q9KB 3VXUA 1JF6A 5L2KE 3ZKSD 5KS9E 1KCLA 1MHHB 1XF1A 3S4SG 1WCBB 4KI5D 3UDWC 3GSOB 1U3ZA 2WINA 2PO6C 1ZTXL 2E6PA 3PHQA 1R3HB 2H6PA 4LEOB 5DVMA 3EO1B 4YHPB 1VFAB 2EEDA 4JRYE 1IGIH 5E95B 3LPGA 3MCLH 2VDKL 2GTWB 1N4XH 2IG2H 3LD8C 1GL4B 2O5ZH 5F7FA 2NY7L 3OKKA 1MRFH 2ZUTA 2WIIA 3DX8B 5HHNB 4MHHI 1ZMYA 3FONB 3FT3B 3LQAH 4JG0L 4HPYL 1AE6H 5HYFA 2VDOL 3PWVA 4L5FL 3GBNH 5DJZB 3F12A 4KROB 4JPIA 5ISZB 4I4WB 4RDQF 4UT7H 3UMTA 1CL7L 5GJSL 1EZVY 5F7LB 5C86A 1OSZB 3GM8A 4J4PD 5EO9B 2XACC 5JXEA 1NLBL 3IXAB 5TJWK 3EZJB 5HGHB 5D2NA 1GC1H 3SKMB 4P23C 3NIFE 3HC0B 4PBXA 2C1OB 4HZLA 4H25A 4XTRC 5CSGA 5D5MF 3WD5L 4EQ3A 4LCWE 4M7JL 4G9FD 5DWUL 3UTTA 1DQDL 4J2XA 4UV4H 5EO1B 3MV8E 1P4LB 4ZXBA 3NCYS 4GG6E 3FB7B 4LSVL 1FJ1A 1A6WH 4WI4A 4CL7A 2DICA 4LIQH 1YC8A 2EDJA 2O61B 3L3KA 3O3AA 5IW6B 3C5SB 1R5WA 4LDEB 2D0FA 1F4YL 2W91A 4U6YB 3WFDH 3S36X 4HG4K 3I3BA 3BEVB 3BH8B 3CPLA 3ZL4L 1JPSL 4MZ2A 1WT5A 3MOBH 2R0WL 3RZCB 3OB0H 3C08H 4QY8A 5EC2A 3EOTL 3LN9A 4X6CE 4MCYB 2HP4A 2BVQA 4L3CA 1QVOA 5D1QA 4NZRH 3RL2B 3VFPA 2EDHA 5F9DC 4PRID 1SMAA 1JPTH 3O41A 2UYLA 3TT3L 4PTTB 1T1XB 5F88B 4R4ND 1NMBH 1DFBL 4HWNA 1A1MB 4F9LA 2NY2C 1MCHA 3I9GL 3BP5B 4KXZH 1DR9A 4I5BA 4AH2B 1IGYB 3PHSA 4FTVD 4L1HA 1U6AL 1RUQH 1HSAB 2Z31C 4M5YH 5C9JB 1OAXL 2YSSB 4OD1H 3DPBA 3LKSB 1JGEB 1RIVL 3P77B 3PWPB 1YEFH 1LEIB 1R5IA 4TOYL 1AXIB 4KK6C 4FXKB 5ENWA 1ACYH 1FBIH 3GMPA 4M62L 3WHXB 4D8PA 5D2LA 4JJHA 3K8KA 2VWEC 2MMXA 4MB4A 3S35X 1YMME 3GSWB 3TBWA 5IB4B 4PRIE 3T4AA 3R1GL 4M5ZH 4KK5D 2DL2A 4HEME 3ZE2E 2OS7A 5DHYA 1P7KA 5C70A 3KNBB 4R0LC 5IWLC 2ERJB 4J3WA 4NHUB 1RI8A 4CJ1A 1VERA 3SE3A 3JUYA 2EH8L 5GGUB 5DJ2A 3BH9A 5C0CA 3DTXB 1RAMA 4N8CH 1GIGL 2Y9RT 1OAUL 3HLAA 2DN7A 3VXSA 4LPTA 3LY6A 5LGJA 2Y5TB 4KJPC 3PGDA 5EULV 4XP6H 5EU3B 1ZWIA 4G8EA 2LFGA 1RHHB 5I30H 4A6YB 2GSIA 4Y4HA 5DK2A 3SDXB 4YUEH 1FL6A 1H15A 2NPLX 4Q6IC 3UYRL 5DK0A 5E1AA 43C9A 2WUBL 3P73A 3TBTB 1QLRB 3MUY1 1NAMA 4MJ5B 1LO3L 4S0TD 3UP1A 1S7XA 5BVJA 3KXFB 5HGAA 3O6FD 3UPRA 1G7QB 2GJ6B 5F70A 1WZLA 1P4IL 2AEQL 3IDYC 1E4KC 1A22B 3MA9H 3P4MA 5E00B 3RWEB 3TVMD 1NMCB 1EXUB 1R6VA 3HNTH 3ALPA 4LF3B 3VG9B 2AV1B 1XMWA 4HIXL 3TA3B 3FT2A 4QWWC 2G60L 1UYWL 5TH2A 3TPUB 4R3SA 4RAVA 4P2RE 5D7IA 4FG6D 2NNAB 2IGFL 4XVSL 5TE7H 4JM4L 2EYSB 4U1IA 3HC4H 1RQ5A 4IOSD 4LLWA 4XP9H 4N0UE 2UWEE 4QHUB 5IK3B 3U7WL 4RDQG 1RUPL 5E6ZA 1BAFL 4IRJB 1BVLB 5DFVD 2L7JA 1XZ0A 1FDLL 5F1NB 4U6XB 2VDMH 5KBNC 5ID0B 1MREL 3GSQB 3UJIH 3RWGB 2B0SH 2F74A 2W65B 1PVHA 1U8LB 4Y2DA 4NZUH 2OYPA 4BUHA 5T1KB 3IAGC 2EO9A 3D18B 3LKQB 4C4KO 4PJAB 2GTZB 3NGBC 3ZTJH 1PG7L 2F53A 4XPBL 3SDAD 2QBWA 4XNZC 1IEBB 4UU9A 3QUZA 3RWDB 4WWKB 3VFMA 4Y5XB 2JKXA 4OKVB 2PW1B 4KAQH 4GXUM 2XY1A 5F1IA 3AREA 1T04A 3CFBA 3WO4C 3ZKQD 3DSNA 1D5ZA 1MIMH 4TNWK 3WIHL 2DLFL 2JK5A 4UOJA 1Q1JH 4LOUD 1S9WB 4KMTH 4OLVL 3ABZA 4Q9RL 2QADB 4H1LG 1YYMH 1RJZA 1OB1B 2ICCA 3U7YL 2ZUQC 2PO6A 2VDLH 3R06B 4AT6A 1VFOA 4N0FB 3TBYB 5IM7B 1NUFA 4MNQD 4B50A 4HK3J 4EN3B 5EBLB 4PJBB 3GMRB 2EC9U 1OM3H 4XNQA 1JWMB 1VPOL 5GRYA 4FFVD 3BWUC 4JO2H 15C8L 5E0QA 43CAA 4UBDC 3NZHH 1MY7A 4JGUA 3CSBA 1BZ9A 3AFLA 3MROA 4WFGD 3S96A 4NRXB 4IMKA 4EUPB 4P5TC 2HJFA 3BP7B 1QFWH 4ZUVA 4U05A 5EPMA 2NY4D 1W8OA 3KJ4B 4NUGL 2EO1A 5D7LE 2R4SL 2AI0H 3UTQA 1JHKL 2D7OA 3V6FA 2K7PA 2IQAB 3X11A 5I16A 4P57B 1TNMA 5I17B 1AO7D 4R7DB 4GQ9H 4NQTA 3SKJL 1PJ9A 1F3JB 2F54B 4K3JH 4OGXL 1XCTA 4F33A 3TNNA 5FA3A 2HKHH 2V2XA 1K4DB 3STZA 3T3MF 2V5YA 1S78C 1G7MB 3RDTB 5JOPD 5IVXB 2DQFB 4GAJL 2BNRB 4DVBB 1CWVA 5T3ZH 2W9DH 3KAAA 1PFCA 3FRPG 2XPGA 1J8KA 3TO2A 3ZMRA 1MCOH 4Z5RA 2VLKB 3B9KD 4KRPC 1U8JA 2MJWA 3QDGE 2A6DA 4GH7B 5J12C 2XOTA 1MCRA 2WSKA 3TPKA 1PLGH 1JNHA 4ZYKB 3AGVA 4YGVB 5IG7A 3ZKXB 5MHSE 3GI8H 3GMNB 3O2DA 3ROLB 3K81A 2ICEA 4WI9A 1RK1A 2UUDK 5A2KH 4XWGL 4HWBL 5A16B 1UZ6E 2G2RB 5CWSB 1XIWD 5GRJL 4WDIA 5FYLH 4UDTA 3O81A 1NAMH 4TSBH 4Y16A 5LAXB 3VI4E 3LH2H 4A2LA 2MQ3A 1JNNH 4JR9L 1TZGL 1FGVL 4DZBA 1X5KA 5FYJU 4P3DB 5ESQA 4HLJA 3FN0L 1KACB 1PKOA 3S5LA 4G43B 3RGVD 2AK4A 3GK8L 4M1DL 2QR0B 2W9EH 2HT2C 2E27L 3TH2T 4YHMH 5C6TH 3GJEA 4ZOBA 1LNUA 1DQQA 5SWSA 1I7UB 3QNZA 2FGWH 3OKDB 4JCMA 5JHDD 3MLUH 3WFHA 4M02A 3LS5L 2VLJE 3O3EA 3S37H 5I8EA 1I8LC 4N0YH 2FJHA 4QHMB 2XWJB 2AJVH 5I1EL 3AVEA 5DUBB 2OJEA 5DJ8B 4XHJC 1RHFA 2HWZH 5C0AB 3VG0L 4JKPL 5F97E 1NCWL 4APQA 2NLJB 2BY1A 5FO9A 5IWLA 4R0LA 3X14A 3L3GB 1LGVA 1BD2A 1NPUA 4MA3B 5F9WB 4CU8A 1DP0A 3NFSL 3HNSL 4FQ2H 3RQ3A 2Y06L 4JRXA 3OKLB 4LQFH 1UWGL 2EE3A 4TUKL 1KPUA 5ERWB 1RVFL 4DGIL 2DMKA 2X89D 1F97A 1I3GH 1YPZB 4NQSA 4JPKH 2D7TL 4EEEA 2R69L 5C1MB 1B6DA 4ENED 4PYHA 4J8RB 2VABB 1BLNB 2DWDB 4Q6IA 1JN6B 4TRPH 3RX7A 3D85A 2X4SA 5B39B 1JJUA 1OQXA 3DXAB 1NGPH 5EIIA 4ZFGL 1T3FB 3AM8C 4TUJB 1IC5H 3MRKA 4MQXC 5K93A 12E8L 4DK3A 4ZMAT 2H1PH 3HI5H 4NRYA 4UUJB 1YMHA 1MWAA 3PNWB 1ZLWK 1AH1A 1BBDL 2XZCH 3DOSA 1J9CT 4F15B 4M6NH 2VDNH 2EXWC 3FCTA 5SWZB 1UC6A 1WFNA 2VB5A 2YD4A 4CNIB 1MFAL 5FYJD 4LLAA 4U1NB 4HIIA 2IAMB 5T5FH 4X4YA 4G8GE 1KCVH 1RMFH 4P4KB 4RX4D 5AUMA 2CJUH 2NYYD 3PL6C 1VFBB 1X4ZA 4R97C 4XWOC 3GBML 3LKRB 1HYRC 4PJ8C 4DOHE 1BFOB 4GSDH 2ZUXA 4JANB 1CS6A 3WDHA 1PQZB 2CLZA 1D5BB 3MLZH 4P5KB 1KCRH 1P9MC 2B20A 2ESVB 4YDVB 4Y4FA 1HXMB 2A9NH 1SQ2N 1EGJL 4MDIB 3KPLA 4YR6B 3V0WH 3BKCL 3G6JB 3MRQB 2ZOKA 4KJQC 3SGDH 1CFSA 3M07A 4TNVF 5TQ0L 3VXTB 1MNUH 3VA6A 1NJ9A 4UT6L 3FT4B 4C56D 4NFBA 2IPKB 4GW4B 3VXRB 4OZIF 3ULUL 1TVBB 2DF3A 3UTZA 2HFGL 3RRQA 4GFTB 4UQ2B 4Z7UF 1WWAX 1B0RB 4PIRF 1ZHNA 4O5LH 2FEDC 4PG2C 2N1KA 4YC2C 1HILA 3K2UH 4G6JH 4RRPG 1ZANL 3TYFB 5I1HL 4ZQKB 4O58L 5EU6B 1SBSH 1BQUA 3QEQD 1NFKA 3GSUB 4WW2C 3U6RA 1LEGB 3B9DA 5GRVK 3RPIB 5GGVH 4JHBA 4OLEA 3AMKA 2AKRA 3VFUA 2HG5B 3ARBC 3T65B 4D9RD 1CIUA 5I1LA 1BQSA 5GGTL 3ULVE 4BQCA 3DYOA 2OMBA 4QOKB 4C59B 1QP1A 4C56E 3O2DH 1U3YA 4M61A 3PWLA 3STLB 1SJHA 1MVFA 2YD1A 4NKMA 3W9EB 4DTGH 4WJ5A 3I6KB 3V5HA 5H8DA 2ICWI 3MACL 5HGGS 5FAAA 1QTYT 3U82B 4EDWH 1QNZH 4HGWA 2CK0L 5HJ3A 3FN9A 4P9ML 5C7XH 5J13C 2ADFL 2X9WA 4RBPH 1F13A 4XCFH 1UACL 1TVDA 1AC0A 4YDKL 1VGEH 4FQXB 4LNRA 5D1XB 1UA6H 1BIIB 4D9RE 4JHWH 5D6DA 4BZ2L 1LDSA 2X1WL 4XVJL 4JM2D 3NCJL 4PB9H 1CGSH 3QIUC 2W38A 4PRPB 4Z18A 5EZOL 3JZ7A 1OP3H 4Z0XA 1HQRA 5AG9A 1GHFL 3TT1L 3AS0A 3QJFA 2CXKA 2CH8A 4RFNC 3MUZ1 3RVWC 3DRTA 1ADQA 3KYMB 2DQJL 1FFQA 1YEGL 4WTZG 1RZ8A 3SDCB 4Y2OA 4OAWB 3FQWB 2ZG3A 4XP4H 3WLBA 5JORB 4OI7A 1M05A 4JRWA 4OZ4B 4W4OA 2AABL 3STBA 1Z2KA 4GW5B 3WUWG 2GJZB 1LP9E 2OL3L 5GZNC 5FK9A 2APFA 1OTTD 1LEKB 1TPXB 4NQCD 3LQZB 5KSVB 1MUJA 4NJ9L 4CGTA 1FZKB 3CVHA 5E8DL 4YHKL 1ZT7B 3ARQA 3MGOA 3OXSA 4NQDB 1LO2L 3EIFA 1ZHKA 5F9AC 5IQ7L 4KQ3L 1QRNA 3SPVB 1DUYB 1FE8L 4OLZH 4Y1AD 3ZT6A 3LN4A 2BOCA 5L2KB 5KS9B 4OZFA 4MMXC 3NIDF 1TJGL 1C5DB 3L3HA 4WU7B 3O4LE 1KXTB 2OP4L 3O8XD 4P46B 4PV9B 1KTLA 5GSVB 5A2LH 4RGNB 5C0GA 1MJ7H 1RULL 4MA8H 4JRYB 1EZVX 1WICA 4LVNC 1UJ3B 4YFLF 1MWAH 4HKXA 5BXFA 4F8TA 1DQTA 4HCRA 5TDPB 2EC8A 4NN5B 2NY6C 2LVEA 1WBXB 3MYZA 3IETB 4PRAA 3O6LH 3CSYA 4H26B 4O2CB 3MNVA 5HYJD 5CJXA 4R4FH 1IC4L 2MWCA 1NC4A 5D7JC 1N3NA 3WN5B 4ALAL 1K3ZA 4KK9C 3QULB 1K85A 1A7PH 2WLYA 4ZODA 2EIZB 3JTTA 4I0PC 5I15L 1FSKB 1KIRA 4D0BA 3QUKA 1I8LA 4KKLD 1P7QB 4TPRL 4ZAKD 3CDGA 1OHQA 5DGRA 2V9TA 4GLRI 3AXLA 1J0IA 5IMOB 1WZ1H 1ZSDB 4LCWB 3PWJA 2RCSL 4PJEF 5JZ7C 5KW9L 1I9IL 5JMRA 4LVEA 1TJIL 3IJHB 4PP1D 5GGQH 2N7AA 1DVFC 2DQHH 3GDBA 3MV8B 5ICYB 1RUKL 2QLVB 3HR5A 4GG6B 2UVEA 1FC1A 1IM3A 3M17A 2BP3A 5FGBC 1HDMB 1MLCA 3VRJA 3TCLA 3I2CH 5DQ9A 5DD5L 4OFYD 1DUZA 4LAQL 1FZMB 25C8L 1HXYB 3T0WA 4PJIF 1NGWB 3X12B 1T7VA 5BO1H 4YHYC 2DQGL 3RZWA 3ARDD 5EUOA 5BRZD 4OCLC 2YD8A 4XH2A 3P30H 3IFNL 1JRHI 4RWHA 1K9TA 2EYTB 4X4XA 9CGTA 2MFNA 1FRGL 4X6CB 5DDHA 4WU5B 5KOMC 8CGTA 1NEUA 4LCUB 3DLQR 1YYLH 1ZVHA 5IHUL 2YBRA 5J9PA 4O4YH 5K9OB 1PKQE 4AIOA 2F15A 1UKQA 1MCPH 4FQCH 4TUOB 4LLUA 3ZDXE 2EDXA 3R8BB 1WWWX 4MAUH 1OD9A 3MUHL 4R4BB 5TE4L 4N8VG 2CRYA 4CMHB 1DBJL 4AENA 3HHRB 2N7BA 1MELA 5F8QC 3RFZC 4BSWB 4A6YL 2XWBA 5TQ2H 3IFLL 1JK8B 3G08A 5DEZA 2FB4H 4K71B 4PJ8A 1C16A 1PX4A 5J0BA 1B6UA 3OMZA 4YBLB 4M6OH 3ROOB 1YMMB 2MCPL 2Q86A 2MKLC 3VXMA 4LDOB 3MNWB 1YUHA 4JO3L 3IAQA 3DSFL 1Q0XH 2ZPKH 4KZEL 1KCUL 3MFGB 1IQWL 1QO3A 1A1OB 4LHUB 5CINL 2PXYC 4HV8A 3MODH 4K3HA 4J3UA 4Y7MA 4OIBA 3NAAL 1DSFL 1IAOB 4X9BA 4XNYH 1FIEA 4K3EL 4Z7WE 2FJFA 1CYGA 4NM8L 1IM9B 3MXWH 3FQNA 4O00A 1X5XA 4K3DH 1MH5A 1BHGA 4KGJA 2IF7A 1DEEB 3IJYB 1FH5H 3WXVL 2JJTA 3ARWA 1HHGA 2DBLH 4PG2A 4ETQB 2R2EB 4XVTH 5T1LA 1U2CA 1WK0A 3AC0A 5D7IF 1C5BH 4QRRD 3X17A 4GKNA 4CVWA 3VWKB 4OIIH 2F8XC 4X9GA 3CVHH 4UI2A 3ZHKA 5E6ID 4R2GB 4WW2A 4YNYA 4PJ7E 2BMKA 4F7EA 4QXWA 2CRIA 3O0RH 1X5HA 4QRTB 4TSCH 3V4UH 1T0MA 3OKOB 4G42B 4F3FA 3ARBA 3MV01 4O02H 4OZFH 2QJDA 4I2XE 4GW1A 4DZ8A 3KPRE 4M7ZC 1Q9WB 4NC2B 4XCCL 4FQHB 3QPQC 1DJSA 4PJCF 4MQ7A 5J6GB 4W4NA 1XGRA 4P2RB 1RIHL 1ZTXH 3F7PC 1ED3B 3DETC 3H9SD 4KH2A 1WBZA 1CDUA 3LKOB 4FN0A 3WL9A 3ZYOA 4L1DA 4XVUD 3LRSB 3QNXA 5AG8A 5JPMB 2FX9L 2XIDA 5I0ZA 3KPPB 4L4JA 3BDBA 3EAKA 3HG1D 1R3KA 4JZJC 2VDKH 3UBXI 4JY5L 4N0UB 2UWEB 1TLKA 1FFRA 3D25B 3MYJB 5FF6B 2X9XA 2NY7H 4GBXB 2GYSA 4IRSC 3F58L 2DM4A 3B8SA 4JG0H 2I9LA 5E1HB 4HPYH 5MEQA 3L3JA 3NCBB 2VDOH 3DRQA 4LPWA 4JFYA 4U1MB 1FNHA 4L5FH 4P49A 2AERT 1OVZA 3QXWA 4ELMA 1CL7H 1JWSB 5GJSH 2VITB 4POZC 2D03L 4FNLL 1D9KD 3FO9A 1KJMA 1QZ1A 3C60B 1NLBH 4PGEA 2ARWA 2Y1VA 3SEPA 3ULUC 2AXGA 4ZNEE 2W60B 2NY0B 3BEWB 3OJDA 4WNQA 3WD5H 4JO1L 2ARJA 3VXNB 1A2YB 2A38A 1I1AD 1MHEB 4M7JH 5DWUH 1DQDH 3DX6B 3IKCB 2SEBA 3AB0C 5BS0E 2XFXB 1E28B 4RCAA 4LSVH 4OCNC 4UINL 1IRAY 5MEND 4OD2B 3CH8A 1FHGA 2CIKB 1F4YH 2FECL 2P1YA 3QSKB 3MTRA 1CGVA 4J1UA 1BWWA 1U8HB 5K9KA 5CHNB 3TFKC 3ZL4H 1N64L 3L3OB 4YHOL 2VXQL 1JPSH 1XGTB 2BVOB 4OZGB 4JN1L 1ONQB 4HBCL 3UCRA 2R0WH 3IDGB 1CDHA 4OGYL 3QRFM 2J6EL 1SEBA 3EOTH 2DB8A 3GMLB 5HI5D 4KV5F 3VD4A 3DVGA 2MCG1 3FB5B 1W0WB 3QYCA 5H2BA 3S6CA 3TT3H 2E3VA 1XCQB 1DFBH 1CCZA 3NPSB 4BM7A 4YX2L 3I9GH 3QISA 4JY6A 3U4EA 4OI8A 4IOIA 2DD8L 3TP4A 1U6AH 1FL3B 4L4TD 1I3RA 4DAGL 3VDAA 1KB9J 3CFCL 5D7LB 1OAXH 1EHXA 4QRPA 3L9RB 3RKPA 1VADA 1S7VA 1RIVH 4FQQA 2CO6B 2L0DA 5TDNB 2E7LC 2CDEB 5FFLA 1ITBB 2DMCA 4HDIA 4RNRA 1G0XA 4TOYH 3RWFB 3MZGB 4DEPB 2HT3D 3HE7D 3KLAB 2XG4A 4M62H 5L8JB 2EYRA 4MD5B 3R1GH 5I1JL 3MLPA 3F5WB 2E9JA 3V6OC 5GS0D 1DVFA 2YRZA 3KLHC 5E2WH 4FA8A 4J12A 4OI9A 3X13B 1F02I 3QDGB 1R3LA 3QNYA 3EOAB 2EH8H 3SKUD 1P84J 3U48A 1MFCL 2R0LL 4NRZB 5HDOA 1GIGH 2X7LB 3JWNC 1OAUH 1KPRA 1TTUA 2YPLE 4GXUN 3LOWA 4KROC 2BVUA 1EAPA 1ZLVK 1WTLA 4GRLD 3EOBB 4KKBC 2WZPD 5K33A 4BSVB 2F9BT 3NPZB 1T80A 4GRWF 4U1SB 1AGBA 3IXTB 5E8EB 1JNLL 3UYRH 3SGEI 5EORL 2WUBH 4HWBA 2VYRE 4L4VD 2Z9TA 2XTJD 5I8OL 4HIEB 2Y07L 2R2HB 1LO3H 1S7TB 4G6FD 3BESR 1YEEL 1A7RL 5FOBB 3EO0A 4RQQB 1V5JA 4OLWL 4P4RB 3FRUB 1Z9LA 5T5NF 3E1F1 1P4IH 2AEQH 1IL1A 5ITFB 1A21A 1DBBL 1M4KA 3CFJA 4MXVE 4AG4L 5EZLA 1RJLB 2HFEA 2B39A 4HIXH 4XGZB 5M7QA 5J8OA 2VLJB 1ORQA 2QV2A 4HKBB 2G60H 4X9HA 4TNWF 1UYWH 5C0BE 5BW7C 1WUNT 3TLRA 2FX8L 3PGCA 1CF8L 3BIAX 1U8KB 2IGFH 4LLMA 4XVSH 4JM4H 2XTJE 2BOBA 4NO0B 3RZCC 3WNMA 3UYPA 5TDOB 2M1KA 3N1FC 1WZMA 3EJYD 4YBQC 5GRVL 3U7WH 3ILPA 1RUPH 3B5GA 1VEMA 1BAFH 2XKSA 3NH7L 3U0PA 1AKJB 4ODWA 3L5WB 1FDLH 3SGKA 2ZSVB 1MREH 2CD0A 2R1YB 4Q2ZA 5I1AB 4OT1L 3WKNA 4QGYA 5HYSB 3FKUS 4IBLT 2GEEA 3CC5B 3VRLF 1F2QA 3KS0J 1O7VA 5HHQA 1CFTB 2CK2A 1CLOL 3FO2B 1K5NA 3S36L 2ZCKL 4HIHB 3MC0A 3B2VL 3L7FB 3T0DA 3GBLA 1LD9A 3WEXB 2X1OA 3VXOA 1F4HA 3RPKA 1C8PA 4OF6A 2W0PA 1PG7H 3PDOA 4OM0L 4XPBH 5CZKA 3GSXA 5DC4B 2XXCB 4XAKD 5E9DD 2VLLA 1CFNA 5IMMB 2OQJB 4MLIA 3S3SA 1OTUC 2ERJC 2HVKB 4WTWA 3WIHH 2DLFH 2Z91A 5FYKU 2A0LD 2HLAB 1NBYA 5D5ME 5EU5B 1MAJA 4OLVH 4N9GA 5DEFB 3X3GL 4G8GB 4Q9RH 1FG2A 3T0ED 1CQYA 4YHZL 3H7BB 5E8PA 3K1DA 4ZTOL 3U7YH 4DOHB 2EXYC 2ICWB 3DWTA 5DD1L 3RX8A 4JFEB 2VDRL 1NFDF 4HFWB 4JFHD 1G7HA 1VPOH 3F7YA 4WHTA 15C8H 3TBVB 4LPCA 1GOFA 3S35L 1M7IA 4IRSA 3D39D 4R26L 2VDPL 3PWUA 5FKPB 2AJXL 4B41A 3MRPB 5GIRB 4XX1E 5ICZA 4E42B 1ZGLP 3EYVB 3PV7A 1D3CA 4PRBB 3MFFB 1EGJA 4NUGH 2P5WE 4B5EA 2R4SH 1BGXL 5D1ZD 4MAYD 1JHKH 1NUNB 2H26A 1NMCC 3A6BL 4KPHL 2ID5A 3VG9C 4XAWL 3TA3C 1CT8B 4X7SL 2Z92A 5IQ9A 3SKJH 2Q8AL 3MQIA 4OGXH 3ECBA 4JFHE 3S5LG 1DE4B 4XPHL 5IFJB 5DRWA 3D9AL 1M6OB 5DVOA 4H8WL 3Q5YA 4GAJH 3D39E 2VE6A 2HA1A 1MFNA 2W92A 4AJ0A 5C8JB 3BP6A 3TN0B 2YD3A 4OQ1A 4C56B 4XPFL 1JPFA 2B2XL 4MJIA 1NQBA 4IRJC 2O93L 3H0TB 1JVKA 3EFFB 4YDIL 5BZWA 1BWMA 5F1OB 1YECL 5GGTA 4JZNB 1NAKL 3FQTA 2ZG2A 1L9NA 3CNKA 1XGUA 2FYYA 3N85L 5C07E 5DMYA 4XWGH 4HWBH 1J05B 5GRJH 3TIDB 3ZDYF 3E6HB 1YC7A 1I8MA 3MCKB 2IBGA 4MNQA 3DV6B 1GPOL 4JR9H 2K3TA 3OJVC 1TZGH 5D4QA 1F5WA 1FGVH 1H0DB 4RA3A 3KHOA 4X80L 2W0LA 3W0WD 3FN0H 5T5NG 3QP3A 3OR7A 4I3SL 3V5KA 3TCXA 4EVNB 3GK8H 3CIQA 4M1DH 4WWKC 5IMLA 4PY8J 3MRGB 4Y5XC 4QXTB 1CE1L 2E27H 2P4AB 3RIAF 3RJQB 2L7UA 3FAWA 5ETUA 3C09B 4P2QE 4LCCB 1AO7A 3LS5H 4GAYA 2GSGB 3R0MA 1Q9KA 2Y7QB 2QADC 1KF9B 2P8PB 1UM4L 5ADOL 3S9DB 1I1CA 5I1EH 1F58L 1NCTA 3DUUB 3EDKA 2LU3A 1LP9B 3VG0H 3CFIC 4JKPH 1R3HA 5F96L 2HMID 1NCWH 4LEOA 4EI6A 4LNVA 5C0RL 4EN3C 1KJ3L 1J86A 4YHPA 1VFAA 1U3HD 3O3UN 4YPJA 1HCFX 2GTWA 3OF6D 3B9KA 2BCKA 2XNAB 4PS4L 3P0YL 2OL3A 3FONA 3NFSH 2IFFL 3FT3A 3HNSH 2Y06H 3NCCB 2DWEA 4K55A 3BHBB 4GAFB 1UWGH 1FYTE 4QHLB 2NW2A 4TUKH 2BSED 4LSRL 5ISZA 3O4LB 3KJ4C 4I4WA 2APXA 1RVFH 5SX4H 4DGIH 3CX5J 5I76A 5F3BB 4JFQA 1HHHB 2X4TA 1KYOK 3M45A 1XIWA 3GZKA 2D7TH 2R69H 3D2UB 1QRKA 3IXAA 3UAJD 4HK0B 3SKMA 2EDQA 3HC0A 5I1KL 2C1OA 2YUWA 2BX5A 1HI6A 3ZSTA 4ZFGH 1F6AB 5JLZB 1MJJA 3RDTC 3RGVA 4L8BA 12E8H 4BSJA 3GJFB 3QQNA 1CICA 3GUTB 5KSAD 3JVGC 3GI9L 1BBDH 4N9OB 4AIZB 3MLSL 4HS3A 5BQ7B 5CD5C 5HHXL 2EDBA 4GG8B 5KVDL 2VISA 1MFAH 5JHDA 4HD9A 3OSKA 4IHOB 3QXDB 5J1SC 5EUOF 5BW7A 3BH8A 3ZKXC 1I8IB 2A6KA 3GBMH 1PY4A 1LDPL 4UIMB 1ND0B 2FD6L 2WV3A 3BQUB 2EZ0C 3RZCA 2QHRL 1VACB 1SYVA 3JUZA 4MCYA 3B2UC 4XCYB 5DS8B 3W11C 1T5WB 2NZ9C 4ZD3L 3GM0A 2NXZB 3RL2A 1EGJH 3VJ6B 3QI9B 5AYUL 1GZQA 3BKCH 4XBEL 4KMLB 4PTTA 5TQ0H 5LXGL 1A1MA 3QIWB 3BP5A 4XC3L 4UT6H 4MVBD 4AH2A 4LSTL 4YWGL 3IDUA 5JIIA 5HDBF 5HVGB 3C5JA 4HULB 3ULUH 3SCMB 2HFGH 5C9JA 2YSSA 3K3QA 4JFDD 3P77A 1VB9A 1U58B 1J0YA 3W9DB 5DEGB 2IADB 1ZANH 3FQRB 2W1NA 5I1HH 4O58H 2I9TB 4JZOB 3QFDB 5I19L 3WHXA 1NBZB 3GJFK 1PKQB 3B6SA 2UZXB 1MJ8L 3WMSA 2IBZX 5DO2C 1NLDL 5IB4A 2B1HL 4KTEL 3MMEA 4UB0L 1A3QA 1T66C 4MX7B 4URTB 1JMZA 4UIKL 4X7DC 4AEFA 1Q9OB 1J8HE 1NGXB 5GGTH 1PGRB 4PJ9A 2FWOB 3KNBA 4NHUA 1T5XA 4QCIB 5F9WC 1KB5B 3ZKMD 3QFJE 4PRHD 2FJGB 1A6TB 2BC4B 1X6LA 3DTXA 3OX8A 4WHDA 3T3ME 4K2UL 4S2SB 3T0VA 3U83A 4S1SL 3L95B 3NOIA 3GSRB 1HNFA 3MACH 2X10A 3GSNB 1BVKA 5B4MD 1CTNA 4JCLA 2M26A 1U92A 5EU3A 5FV2A 2CK0H 5IB2B 1RHHA 4P9MH 1B0GB 3DECA 2J3SA 4LP4A 4A6YA 2EDFA 2ADFH 3SDXA 1UACH 3QZWB 4YDKH 1Q38A 1XR9B 1QSFE 2LV4A 1QA9A 3ALWA 1XF3B 1ZLUH 4C55A 3O45B 3UBXB 4BZ2H 3TBTA 3MRIA 2A9ML 4ZO8A 4XVJH 2YD2A 3NCJH 4JFXA 1BEYL 4WI7A 5CP3H 3IF1B 4WI8A 4HH8A 5EZOH 4BFIB 2FH6A 1GHFH 1ZA3B 3KXFA 3TT1H 4Z7WB 5HHVL 2GJ6A 3VGFA 4F15C 3EHBD 1WSST 5E00A 3RWEA 2DQJH 1EXUA 5T1MB 3RU8L 5BZDA 3MXVL 5CGMA 4JY4B 3KGRA 1NGQL 2AV1A 1T22A 1YEGH 2IAMC 3TA3A 4TVPL 3OKEB 4QT5B 2Z8SA 3T1FB 4P4KC 1RPQA 4NO5B 3TPUA 1B9ZA 3DVNA 1S7QA 4QRQA 2A1WL 2AABH 4GRMB 5D6CB 2GFBB 4PJ7B 2R1WA 3ILQC 2EYSA 2GJJA 2FEEI 2OL3H 2P43B 4NJ9H 1BIHA 5E8DH 4OF3A 4YHKH 4D0DA 1Z5LB 4I2XB 4JFFE 5KVEL 1W8NA 1T6WA 3KPRB 5D70L 5IK3A 1LO2H 5IQ7H 4PJHF 4KQ3H 4IRJA 1FE8H 2CGRL 3HAEG 5IW1B 1JBJA 4ZOEA 4B0MM 2VLRE 1OP9A 1PW3A 5ID0A 2J88L 4PJGF 3GSQA 1TJGH 3RWGA 2XN9D 5FYKL 2ZCLL 2OP4H 4M8QB 4MS8C 5IV2B 4PJDF 1AHWB 1FGNL 4ODTL 4PJFF 5T1KA 3D18A 1RULH 2O26U 4PJAA 4PV8B 4YK4B 2APWA 4HFUL 1P7HL 2Y6SC 3QIBB 2GTZA 4LKCB 3FFCD 3ES6A 5LGKA 1GGCL 3VMPA 5C0IA 1IEBA 2FIRT 1OPGL 3WNLA 1TZIA 4L8SB 1A02N 5EA0L 4WWKA 3TNMB 1IC4H 3TV3L 1X5FA 1I1YB 5E8OB 3S4SB 5FM8A 1P4BL 4KVCL 4W68A 4DJMA 4ALAH 5E2UL 4QHKI 3F62A 5I15H 3NVQA 1CGXA 4I3RL 3VFGL 5EBMA 1UG9A 4R96B 4TPRH 1OB1A 3R06A 4I9WD 5CP7A 4N0FA 3KYOB 2RCSH 1J0KA 4UZGA 3IT8D 5KW9H 5IM7A 1I9IH 4ZOCA 1V3MA 2OTPA 4WO4B 1TJIH 2RB8A 4PJBA 5EBLA 3C5ZD 3GMRA 5BS0B 5J06A 3V4VL 1RUKH 3MV9E 4FQXC 5D1XC 4H8WC 4JQIL 3HZMB 5FKAA 5DJDA 1JGLL 5HI3D 5F3HB 4Y1AA 3JWDL 1MEXL 3VE0B 2ITCB 5DD5H 2OR8A 2EIDA 4LAQH 25C8H 5EZJB 2WBJD 3WUZA 2DQGH 3IYLW 3ISWA 3O8XA 4J23A 4KC3B 4BJLA 1J0HA 3IFNH 1SHMA 4JN2B 3THML 1FRGH 4KKCD 4U2YA 3L7EB 4H0GA 4YQXL 2F54A 4U0RB 4X6CF 5IHUH 4OBSA 4PGDA 1YEDB 1NH6A 5DA4A 1DBAL 3T08A 3FFDA 1INEL 2JIXB 3V52L 2J6EA 4OZIE 5GQBA 4CKVX 3I6LE 1G7MA 3RVTC 3RDTA 1Z9OA 1L6ZA 2EEBA 3VFNB 2DM7A 2C7UA 5IVXA 2DQFA 3U9UA 4WCYH 1TPXC 3D0LB 4Z7UE 2BNRA 4DVBA 1LWRA 5EWIL 3UPCA 5FDYA 4KK8C 3EZ8A 1PSKL 1GRWA 5TE4H 2BFVL 2VLKA 1WQVT 1PZ5B 2PN5A 1DBJH 2HLFC 1YEIL 1AR1C 4A6YH 4YE4L 3HZKB 3G5ZB 4ZYKA 4YGVA 3IFLH 1OAKL 4PGCB 4ZAKA 3ROLA 4DKFL 1SBBA 5L7XL 1DBKL 4HEPG 1F45A 4QLRA 2MCPH 1CN4A 4P46C 5EUKA 2C1PA 3QO1B 2HH0L 4AYFA 2G2RA 2JCCF 2D3VA 4RGNC 1D6EB 5IHLB 2A77L 1QSEE 4HKJB 5LAXA 4X8JA 2ZUVA 1DDHA 3PWNB 4JO3H 4JO4L 3Q5TA 5I18L 3DSFH 1UJ3C 5C0JA 3LRHA 3K80A 4KZEH 1BQLL 2FZ3A 2E5EA 1KCUH 1I8KB 4P3DA 1IQWH 5HHOB 2H2SD 1MI5E 2GQHA 2VZTA 5CINH 4ZPTB 1FVCA 3VXUD 1LMKA 4RGMC 2R39A 4G43A 3BFOA 4LVHB 3NABL 4YIQB 2D7MA 2QR0A 3NAAH 1DSFH 4BH8B 4YHIB 4K3EH 2YPLB 1C7TA 4NM8H 1YJDL 2D7PA 5DVLA 3WN5C 3HE7B 3WXVH 2CRZA 3CGTA 1L0XA 1B4JL 1FSKC 2IFGA 5GPRA 4QHMA 2XWJA 5D7KD 5DD3L 2V2TB 2NQCA 4AQ1B 3G6DL 1XR8B 5C0AA 5CBAB 4R90L 4Y5VB 1EH9A 2P8LB 2JB5H 1FFOB 2NLJA 3PXHA 1ETZB 2E6QA 4ZOAA 5IOPB 2HJKA 3L3GA 3GMMB 3Q3GA 5JXED 3WDJA 1EEQA 3TJHD 5I2IA 4XCCH 1QQDB 1IAIL 3OKLA 3WXWL 5C6WH 5C71A 1U8MB 1KUMA 1JPST 5C0BB 4D3CL 3K7UA 1IMHC 1RIHH 2MOVA 5F7DB 4HAFA 1HIML 2IPUG 2ADJB 1BFTA 1CD1A 5D7KE 2XTJB 2FX9H 1YPZA 4ZXBD 1U95B 1M7DB 5DJYB 3FMGL 1GZPA 5ABDE 1HZHL 3OAZH 1F11A 2QSTA 4J8RA 2VABA 1BLNA 4JY5H 1LE5B 1JN6A 5CZXD 5DZLA 5B39A 3F58H 4IIQA 3DXAA 5JO5B 1T3FA 2H2PC 4TUJA 5DJCB 3VFOA 1Z0MA 4UUJA 2YC1B 5HD8C 3QWOB 2FR4B 2XICA 2D03H 4FNLH 5DD6A 5E8NB 1D5XB 5SWZA 4CUCA 3TIEA 1EJOL 4CMHC 4CNIA 4RWYL 3UTTE 4U1NA 1EO5A 3RHWF 2PYED 3C9NB 4QRRA 5JW4R 4QYOA 2JJVA 4Y5YB 5MEPB 1VFBA 4TSAL 5F9JB 4JO1H 3LKRA 3C6LB 4G3YL 2FSEA 3QHFL 1TXKA 4YBLC 1A6UL 5DMKB 2ED8A 4MD0A 2JB6B 5GSRA 1D5BA 4K94L 4R4NC 5E24E 4P5KA 4Z77B 1FL5B 1UM5L 3WLWD 2ESVA 3LV3A 4YDVA 4UINH 2ZUYA 5AWNL 1JTTA 3QEHA 4WEUD 2P7TA 2AJ3B 4MDIA 4Y8DC 4Y4KD 3G6JA 3MRQA 3IAPA 1EPFA 3VXTA 5D5MB 3MJ7B 4OFPA 2VC2L 1EJ6A 3CCHB 1U8PA 3QXVA 3FT4A 4PJEE 1N64H 1A1NB 2IPKA 5DI8B 4YHOH 2VXQH 4JN1H 4HBCH 4UQ2A 1B0RA 2OI9B 4OGYH 2J6EH 1MCWM 4ZNCD 5C0EB 5KJRL 5ANMA 3VWKC 1U93B 5EU6A 5T3ZD 3ULVL 5C0CD 4CADB 1V7NL 4R2GC 4PP2A 2VKWA 4YX2H 1LEGA 3RPIA 3GMOB 1T1WB 5C0DA 3RVVD 2DD8H 4JVPA 1AP2B 3T65A 4DAGH 3CFCH 2P5WB 1QKZL 4QOKA 4H1LB 4Y4HD 5D2LE 2APTA 2GK2A 4NFCA 5D7SL 5A40E 3HA0A 3STLA 1FVDB 3U2SB 4GUPB 2XKNB 3ESUF 1A7NL 3I6KA 1KJ2B 1ZVSB 2NY1B 2D7NA 5EU7E 5FYLD 1MJUL 4HKZB 4DVRL 5INDA 1GSMA 3BDYL 4OUUB 5I1JH 3KHQA 3FB8B 2KDGA 3MLXL 3U0TB 3D39B 3ORJA 1A4KB 2X4OB 2VZUA 3VXSE 3BIKB 5D1XA 1NC2B 4GBXC 1BIIA 3QQ3A 5IIEB 3BD4A 4I18B 5D1ZB 4KJYB 1MFCH 2R0LH 2H45A 5FCUL 3SDDB 1GAFH 5C07B 2JJWA 3LN5A 1GGIL 2IANB 4L3EE 5FYLE 4AY0A 3KYMA 3P4OA 3H9ZA 3DURA 3GHBL 1O5DT 3VCLA 3C60C 4Z7VA 1Q9LB 2CLRB 4NO3B 2V9QA 3QUXB 4E0RB 1A4JA 1N59B 1JNLH 3L1OL 3FQWA 4OAWA 1OT1A 3C8DA 3VI4F 5EORH 2NY0C 5JORA 1JNJA 5I8OH 2Y07H 3UTSE 2UZIL 4J6RL 1L4IA 3IDIB 4K8RL 4XB7A 3IDNB 1YEEH 5DRNB 1FLTX 1A7RH 1LEKA 4L4TA 3LQZA 2OZ4L 4OLWH 2KUTA 4Y2DD 1NBVL 1FZKA 2YR3A 3HB3C 1DBBH 5D7IE 2NCMA 4AG4H 4P2QB 2X4RB 3SPVA 4C54A 3IKKA 2F53D 5CEZD 5L2KA 3Q1SL 2B8OT 4IOFD 1U36A 2FX8H 1C5DA 4WU7A 1CF8H 1JRHL 5GS1B 2AJSL 4JHAL 1Z0NA 2PKDA 4P46A 4PV9A 1UCTA 3ARED 1T2XA 4N5ED 3FQXA 5E2TL 1UJ3A 4PJCE 1IJ9A 5TDPA 4P2CG 2HN7B 5LJYH 1WBXA 3NH7H 3IETA 3NPSC 4H26A 3K2MC 4NDMA 5E94B 4O2CA 5GRWA 1FYTB 2PO6D 1ITCA 1I7RB 4OT1H 4C57C 4GRLA 2VXUL 4IMLB 3WN5A 3JWDC 1CLOH 3S36H 2VLME 2ZCKH 1VESA 3B2VH 3QULA 1Z3GL 4WI2A 3WNKA 4ZFOB 5JOEA 1KCKA 4DEPC 4MXWL 3BVNB 1SYSB 1T0NB 3KYNB 4L4VA 1LE9B 2V5SA 4FHBD 4OM0H 1P7QA 1A3LL 4LPUA 5DR5L 3D3VD 5IMOA 1ZSDA 4LCWA 4JREC 3P9MB 3LMJL 4HXAL 1OL0A 2R15A 4OCYL 1K8DB 4R7NB 5TPWL 1ULVA 3EYOB 1XGYL 1QEWB 4MD4A 3X3GH 1CVRA 3TF7C 4P23D 5C0NC 2G5BA 1S7WB 1FFPB 3OG6B 5ICXB 4XTRD 4JDTL 1NGWA 4YHZH 4OV5B 4ZTOH 4OV6F 4ZUSA 4HH9B 5DD1H 5BJTA 5DHXB 5AZEL 4CN4A 2VDRH 3OB8A 3NCFB 3DO3A 4WU5A 1LILA 3H9HB 1FO0A 2YUZA 3S35H 3VI3F 4R26H 5K9OA 2VDPH 1AJ7L 2XI9A 2AJXH 2ZCHL 4X4MA 3PABB 3IU4L 1KB5L 1KIUA 3NZ8B 5JDSB 5CSZB 2EKSA 1X5GA 1AGCA 1QPXA 1HHJB 3D6GA 3HTLX 1BGXH 4KV5E 4R4BA 3MJ8B 3MRNB 3L5IA 4D0CB 3FOLA 3A6BH 5IGXL 4KPHH 3GSNL 1KENL 3QDME 4XAWH 1SVZA 2Z35B 4KU1A 4X7SH 2GHWB 1JZ7A 1BF2A 2XXMB 2Q8AH 5DFWH 4KWUA 1BFVL 4XPHH 1JK8A 2AXFA 2NY2D 2AK4D 4P99A 4WTXA 2W0FB 3D9AH 4H8WH 4RMUA 5EB9A 5E9DA 3RX5A 1EBAA 1J8HB 2W59A 1IEAB 4XPFH 3WIIL 2B2XH 3BP4A 4LHUA 2X4PB 3QFJB 5IVZA 2H32B 4KK6D 4YDIH 1KLGB 1YECH 3QBTB 1NAKH 4U31A 4FXGA 2HJLB 1IAOA 3QHZL 2EDWA 5JOFB 3FAXA 1FNSL 3N85H 5I8CB 3HE6B 1VEPA 1IM9A 4APQD 3C8KB 2BVTA 4JGMA 5E4EC 2GI7A 5JMOC 3BIBX 1GPOH 1BX2A 2AQ3A 2R2EA 4ETQA 4IM8A 1QSFB 2OR7A 4QF1B 3SGDI 4X80H 1UVQA 1UADC 4I3SH 5SWSE 3OGCA 4MNHB 1DQLL 1WC7B 1S3KL 3U7AA 2Z93A 1CE1H 1FV1B 3OKOA 4G42A 4KJPD 4FFWC 2VH5L 2X42A 3KPOB 5CGYD 4GRWE 1UM6L 5KVFL 2BSRB 4D9QE 2AAVA 3ELAT 4M93B 3ZDZE 1Q9WA 1RFDL 2B7DT 1HK6A 4FQHA 2YEZA 5D71L 1BFSA 2DYPB 1KTDB 5GGRA 1UM4H 1Q0YL 3U36B 5ADOH 1L7TL 4Z9KB 3MRMB 1HKLL 1F58H 1T7ZA 4P2RA 1BD2E 1G7IB 3AS2A 1CBVL 4FFYL 4HX1B 1C12B 3GO1L 4KTYA 4MJ2A 5F96H 5JPMA 4JRXE 5C0RH 3BD5A 1KJ3H 1A6ZB 4N0UA 3QG6B 3MYJA 4JM2F 3V8CA 5FF6A 4JFFB 4PJXA 5H94A 4R6UA 2AJUL 4PS4H 3P0YH 2I07B 4K94C 2IFFH 4RMSA 4QWWD 4O2FA 5JIHA 2VLRB 5TE6L 3HRZB 1CE6B 4LSRH 3KDMB 4XRCB 1RK0A 5EBWB 4MA1B 3BWAB 1WFTA 2VITA 3EYQC 2YMXL 3RL1B 3C60A 1AGFA 3QDJD 1J0ZA 3WUWB 1H5BA 1I7ZA 3IFPB 4P9HL 1CIDA 3W0WA 1AIFB 5I1KH 1KEGL 5F7NC 5L0QB 3KWWA 2VR4A 4LKXB 1Q72L 3T3PF 3DX6A 4KY1L 3VRLE 1F00I 3GI9H 1Y18A 4KKNA 3PDGA 1RSFA 4HS6A 2XFXA 1NGYB 5CEZL 1H8SA 1FNGA 1E28A 3ULVC 3QQ4A 4ZO7A 3MLSH 3TN0C 5HHXH 5KVDH 3W39B 1A5FL 2CIKA 1MCFA 1UEYA 2NY5L 2ZJSL 1W0VB 4EDXB 1K3IA 4NUJB 4EIGB 1LDPH 4U49A 2BVOA 2FD6H 1QBLL 4OZGA 5A3IC 5MERA 4OZHA 3IDGA 1T03L 5T3XE 2QHRH 3VFTB 3WNOA 4NT6B 1U3HA 1NUGA 3BYTA 4ZD3H 4MJ6B 2E6JA 3MV9B 2DDQL 2BRRH 4LCYB 2ITDB 1U8NB 4FFZL 5AYUH 4HPOL 1ZLSL 4XBEH 5ESAB 5DA0B 5LXGH 3OKNB 1A9EB 2AK1L 4XC3H 5DLML 1KN4L 4LSTH 4YWGH 3NFNB 1FL3A 1ZOXA 5C09D 2ATKB 5D7LA 3HS0B 3L9RA 5SWQB 1N8ZA 4MSWA 3C09C 4P3CL 5TDNA 4LCCC 1N7ML 2DQIL 4ZO9A 1NCCL 4S0SD 3RWFA 4UBDD 5EOCL 4R9HA 2NXYB 3KLAA 5I19H 3MR9B 3VFWB 3I02B 4IDJL 5JHLL 2H3NB 4QRSB 3RNQB 4OZIB 1MJ8H 2HTLC 4X7FC 2D7QA 4P5TD 1NLDH 2B1HH 4KTEH 4MD5A 4UB0H 3ZKNC 5C0FB 4Z7UB 4UIKH 3SBWC 4ELKB 4X99A 3ZDXF 3BXNB 5GGSA 1YY8B 4K8RC 4KQ4L 4U6VL 3QDGA 3CUPB 4NRZA 4K2UH 1ORSB 4S1SH 3O11B 4M00A 3REWB 1S78D 3FHAA 2VRAA 4JPVL 3LVEA 3IFOB 1R24B 2WNGA 3PP4L 2C3XA 2MQ0A 3EUUA 4BH7B 3EOBA 1ES0B 3NMEA 3OKMB 3HCVB 1W72A 5HHPB 1QSEB 3REVB 2X4UB 3EGSA 4M1GL 2XG5A 3IXTA 1OLZA 5GJTL 4KRPD 2EKJA 1NMAL 1QRND 2EC9T 3JV6A 1MI5B 2A9MH 5CBEB 2R2HA 1BEYH 2DQEL 3T8XB 2OXHA 1S7TA 5FOBA 4PJ5E 3ZDYE 3OXRB 5HHVH 4P4RA 3FRUA 5J6HA 5IEKB 4ODVL 3OB0K 5ITFA 4JFDA 3RU8H 3MXVH 1RJLA 1XF4B 2ZUUA 4TNVK 1NGQH 4XGZA 4TVPH 2VLJA 2QHLA 4HKBA 4KDVA 4CN6A 4OCXL 4WFFD 5DHVB 3U79A 5CEYB 2A1WH 2R1XB 4NQEB 4QHNB 1U8KA 4KHTL 3BQUC 3WO3B 4GAGL 2HT2D 5I6XB 4NO0A 1NC4D 2YD5A 3MLTB 4PJ7F 4YO0A 4X6FB 3B9EA 5I1CH 2H8PA 1IAMA 5DURD 1QBML 2NXZC 5KVEH 3SO5A 5D70H 3RY6A 3QI9C 1HSBB 2GW5A 2DTML 4DGYL 3QUYB 2P24A 4P59L 2CGRH 3QIWC 2H6PB 2IC2A 1HCVA 2J88H 3K8LA 3CH1B 5I1AA 2F19L 4XHJD 5FYKH 5HYSA 3SCMC 3VXPB 2ZCLH 1N0XL 1YN6A 3QCTL 1TFHA 3B43A 1U2HA 4E41D 1CFTA 1FGNH 4ODTH 5EFIA 4GKSB 3FO2A 3HMWL 2Q3ZA 1URLA 3WEXA 3PWVB 4QO1A 4HFUH 1RIUL 1RUML 1S8DA 2EE6A 2CLVB 3F12B 1UZ8A 4FZEL 3RUGA 4HMCA 3V7AG