4ZTUB

Structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
418
structure length
363
Chain Sequence
b'ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-1
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
pubmed doi rcsb
total genus 88
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ztuB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4ztuB02
4P72C 3R07A 1SERA 3HXWA 1X2HA 3HRKA 1EIYB 4DQ2A 2Q5HA 3EFRA 4KR2A 1JJCB 2DU7A 3TEHA 1BIBA 4OLFA 5KNNA 1H4SA 1NYRA 5K1XA 5K1PA 4P73A 4H2VA 3V8JA 1NJ2A 3A7AA 4YYEA 4P74C 3HXXA 3HFVA 1ASZA 4CH4A 1N9WA 1HTTA 3NETA 1NYQA 4TVAB 1BBUA 3V7RA 3RUXA 3E9IA 4YRMA 4YCWA 1WLEA 1HC7A 2DTHA 2QHSA 4YRFA 3WQZA 4J15A 2E5AA 2CJBA 3PCOB 3HY0A 4K87A 4CS3A 4G85A 1FYFA 4XTVA 2P0LA 3P8YA 3L4GA 4YRNA 1USYA 2QHTA 3LSSA 3NELA 3HFZA 1G5IA 4WJ3M 3HXZA 1SETA 2ZZEA 2AMCB 1W66A 4L87A 4X5OA 1KMNA 2ZZGA 3UGTA 1GGMA 2HNIA 4HWRA 1B70A 2I4NA 3W3SA 3M4QA 2ZCEA 2ZNJA 4YCUA 2E65A 3BJUA 3FJPA 2E3CA 2ZT5A 2ZNIA 3V8LA 3A7RA 4CS4A 1SRYA 1X01A 3HXUA 4YREA 2IY5A 2ODRD 2DEQA 3BFMA 4WI1A 4YRTA 1EVKA 2E41A 2J3LA 1YFRA 1WQ7A 4YRLA 4NCXA 4YRJA 4RMFA 1G51A 1ASYA 2ZT6A 1BBWA 4H2UA 1H4QA 3QO7A 3MF2A 2ZT8A 4P3OA 2ZGWA 4OP0A 2G4CA 3VQYA 2ARTA 4P72A 4XTUA 4RQEA 4P3NA 2DZCA 4YRRA 1USYC 1IL2A 2I4MA 3V7SA 3HY1A 2DQ0A 2AMCA 3MEYA 4XU0A 1LYLA 2E64A 1ATIA 4YDQA 2ODRC 2ZR2A 2EJGA 3PZCA 5ELOA 1X54A 4H2YA 2EL9A 3M4PA 5C52B 3HXVA 4H2XB 2DKGA 3UGQA 4KQEA 4CS2A 4ZTZB 4CH3A 1B7YA 5ELNA 2DXUA 2DZ9A 4XTXA 2E1HA 4G84A 3RKYA 3RKXA 3V7CA 4UPAA 1ADYA 3HRIA 3L1AA 3G1ZA 2CJAA 1EVLA 2ZIOA 1QF6A 1NNHA 3HTZA 3NENA 2ZT7A 1YFSA 4TTVA 3VQWA 4XEMA 4P75C 1J5WA 3REXA 4YRCA 2I4OA 4TWAA 3IKLA 2ZZFA 3KFUA 4Q15A 4UP8A 2RHSA 3I7FA 1E1OA 2AKWA 3MF1A 1WU7A 3TEGA 3A5ZA 3P8VA 1YGBA 3RKWA 5F5WA 4CH6A 1RIQA 1BIAA 3REUA 3V8KA 1B70B 1EOVA 4EX5A 1VQZA 1EFWA 3RF1A 4BWAA 1NJ5A 4YRGA 3QO5A 3ERRA 4YRPA 2CGHA 4BW9A 5C51B 4XTYA 1H4TA 2Q7HA 2PMFA 1HXDA 4P71A 1WQWA 2EWNA 4K86A 5HGQA 2CIMA 3PCOA 1KMMA 4HWPA 4H2XA 3QO8A 3RGLA 1NJ6A 2IY5B 1WNLA 11ASA 4HVCA 3IG2A 3VQXA 4WJ4A 2CJ9A 3UH0A 4XU1A 1B8AA 3TEHB 4YRQA 1SESA 1EQRA 1Z7NA 2ARUA 2EAYA 3IALA 5C53B 4UP7A 2ARSA 1PYSA 4XTZA 2ZXFA 1C0AA 2AKWB 2ZR3A 4UP9A 4YRSA 1Z7MA 4CH5A 4E51A 3UFGA 1X55A 1YB3A 1E1TA 2EJ9A 3TUPA 4H02A 4YP0A 2QHUA 3CMQA 1B76A 4TQDA 4O2DA 1E24A 3L4GB 1B7YB 4HWOA 4EO4A 4KR3A 4HWSA 2J3MA 4P3PA 3A5YA 4TQFA 4Q6GA 1KOGA 4XEOA 2XGTA 3A32A 4YROA 3L2ZA 3E9HA 4ZIBA 2PMEA 2DJZA 4H2WA 2EJFA 2Q7GA 2Q7EA 2ZIMA 1X56A 3A74A 4TVWA 2DQ3A 3NEMA 4RQFA 4WF2A 1H4VB 4YPFA 2ALYA 2RHSB 2DTIA 3OD1A 2DXTA 1WPYA 4H2TA 2DVEA 2DDZA 3A7UA 4H2SA 5E3IA 2ALYB 2C7IA 3EFSA 4YRKA 1PYSB 2ZINA 2LW7A 1NJ8A 3RACA 4PHCA 4XTWA 2E10A 1QE0A 4XU3A 4P75A 3RL6A 1NJ1A 4TVYA 4TVAA 4YCVA 3QNEA 1L0WA 2RHQA 4HWTA 4DPGA 1V95A 2DTOA 3QTCA 2FYKA 3LC0A 2P5IA 4K88A 2C8MA 1X2GA 4P71C 2I4LA 1JJCA 3VQVA 3ICAA 1EIYA 4HA8A 2RHQB 2QHVA 4ZTUB 3HXYA 2ZTGA 1E22A 3HFZB 3LSQA 1YFTA 4P74A 1WYDA 3P8TA 4XU2A 1ADJA 12ASA 3DSQA 2Q5IA 4LNSA 3IKMB 4P73C 3RIRA 4YRIA 3A31A 2XTIA 4RDXA 2DU5A 4PG3A 1G5HA 4AH6A 3VBBA
chains in the Genus database with same CATH superfamily
5ISMA 3H9JA 2I2CA 3CF0A 2FFAA 3KKLA 4MQUA 1K7YA 3SY8A 2JKYA 4X7RA 1AGPA 1JFTA 1JAHA 4BMSA 3TG8A 3ZHRA 4XJXA 2A1UB 4URWR 1AHPA 3L6UA 1X2HA 1EDBA 4I4IA 3HO1A 3D3EA 2Q5HA 5TR9A 2DKOA 1P2UA 5U1PA 1TM5E 8LDHA 1KEEA 3CPEA 2ZRNA 4G8BA 3GLVA 3P7MA 1AB6A 4Q7LA 2F8MA 4K9DA 4HLUA 4ZVPA 2O3SA 3T1QA 3ZE7A 3ZWVA 4EFKA 4P92A 4EX6A 4WGFA 3V8JA 3ZBUA 2VOJA 4ZGWA 4PYRA 1O7JA 3NFYA 1JHVA 2ODWA 3DDUA 3AFNA 2ZB2A 3D6TB 1TC1A 3RABA 3C16C 4XVCA 4IG4A 4EA7A 1XXHB 1EFPB 1T5HX 3LPDA 1NASA 3A1DA 2XTAA 2IX3A 3PA8A 2X0DA 2GEBA 2BONA 4HYTA 1S8OA 2JVJA 3LL7A 1IEQA 1Y37A 2D1TA 4K40A 1V37A 1I3NA 2PKYX 2YR0A 2CVPA 4D4KA 1FLNA 3HEMA 3I5AA 4H6VA 5IYZB 5M5BA 5LL6P 2EBUA 3ERCA 1E2UA 3OJFA 3A4IA 4P38A 4AJ4A 4WNYA 1OPXA 3CVJA 3HZRA 3E18A 2QR3A 4C4RA 3UAYA 1W34A 3WL4A 1KWKA 3WA7A 3WA6A 2V4MA 4QWWA 4BP1A 1DELA 3LUFA 3AYZB 3L0SA 5FUYA 3QX8A 4R5MA 4LXTA 4YUYA 4BZZA 4J76A 4KH0A 2GVNA 5MFPA 1E3IA 3S81A 3JQGB 3WDKA 1R74A 2NNWB 2P6PA 4QEDA 3EXEB 1GT6A 1C4OA 1USUA 5A4AA 2UKDA 3LCCA 3CVVA 4J1NA 3DDNA 4Q4CA 3K53A 4CS3A 3U39A 1O5OA 3BICA 3BTVA 1P9WA 3MVEA 3PV0A 4YXFA 2J9FB 3OPYB 4ML3A 2CFTA 5K3EA 1KU6A 1UMDA 1YR9A 2XYGA 4CG0A 1I6MA 1ZRNA 1VPDA 3G9QA 2XDQB 2JRLA 1IWOA 3KLMX 1S5PA 1L7NA 1GTL1 2YZ2A 4TMWA 1WE2A 3W5HA 2FZCA 4LE2A 1R3UA 1JIVA 5J4KA 2PUBA 2ZZEA 4KSYA 5D01A 3WJ7A 4DJEC 1OIVA 3E5HA 2AIRA 3FB4A 1W93A 2Z6VA 3EQ7A 3RYFA 1GGMA 1LI5A 2PK3A 1GDDA 5DSXA 3O93A 4PNEA 1EZ1A 1T5IA 1GCUA 2V45A 3CZ5A 4G97A 4N3GA 3SMQA 2IS4A 2WJZB 1L4MA 2OLJA 4P7KA 3HSKA 4KO8A 3K0BA 2F6RA 3PDHA 1IXYA 1J8DA 3O9ZA 3SZRA 2VT3A 4RZQA 2I4NA 2R8YA 5B4TA 3G89A 1E2BA 3DLTA 3AY0A 4PLGA 1IWBB 3KHTA 3N6XA 2JGEA 1YHYA 2NXEA 3N8HA 4Q1DA 4Q3CA 4FN4A 3WXMA 3CUKA 2WT9A 4BVHA 1HOXA 1K3TA 1HLPA 3KEFA 4FQ8A 1IK6A 3CRQA 3RAEC 3FHOA 2XWPA 2KWIA 3U9LA 3FJPA 1P6XA 1M5UA 2XECA 2HTFA 2H08A 4MUHA 3FTFA 1CZHA 2BZSA 1KU0A 3FETA 4BFTA 3DFFA 3I42A 5K0LA 4NCBA 1QS0A 3ZVLA 4F3NA 5BR4A 2ZI3A 1L1RA 1TAHA 3OCZA 1N2ZA 5DX1A 4Z3OA 5C4IA 2D7DA 2R62A 3BD9A 2VDMB 7MDHA 3C6MA 4KQ1A 1ODKA 1VJ0A 4CEJB 4MQ6A 2Z6UA 1DC4A 1KS9A 2H7CA 1DAPA 3Q40A 4IZIA 5G4KA 3OJOA 4ZEWA 4AZVA 2ZUDA 3KLBA 3IBCA 4PX5A 3N05A 1RI4A 1V6CA 3NT2A 5IASA 4IFTA 1QX4A 3ND7A 1CUVA 5EZYB 2D59A 3GLQA 5FLKA 3IIMA 4BUCA 2QD5A 1XCMA 3DQQA 4YRJA 1P1CA 1NBIA 2IEYA 1ACMA 1LD3A 4H2UA 2A5LA 5CDYA 1XEXB 1QGYA 4PX9A 1YC2A 3EC2A 2K7FA 1YE3A 2YV4A 4M22A 5SZJA 4QGSA 2VDPB 5FBKA 1THMA 2VP5A 2QPLA 3ZQ4A 2F4NA 3P0JA 3AEQA 4H4DA 4B6SA 5U9CA 4B2LA 2G6BA 4EFMA 3M5PA 5BW5A 5JCPA 4HS4A 5KJEA 3IBGA 4JASB 4M9ZA 1JTVA 3TRDA 1ZI8A 1W52X 1UXOA 2IYPA 4IPTA 1CK4A 1ECCA 4L7VA 5FD8A 5B1SA 3RODA 3DZDA 1D09A 1YKFA 1YR7A 1Z9BA 1I13A 1ZY2A 3BEOA 3G82C 3R3HA 3KCNA 1KI3A 1QH8A 3GAZA 3H1EA 2VTVA 3QBVA 2NX2A 3G5TA 3MEYA 4UUOA 4HK4A 1NLZA 1QV6A 3VZDA 3WWCA 4BNIA 1PK8A 2OG1A 4OLAA 1ZGBA 4L8GA 3IUQA 4AXBA 2E64A 1OYVA 1DXQA 1P1IA 2DG2A 1RXEA 1WMDA 1GA1A 2CLDX 1WUTA 1N7IA 2A5FA 1ENYA 3BMOB 1XDUA 2IYSA 2RBGA 1Z15A 3CF4G 1NBWB 3DFUA 3HB7A 2OAEA 4JY7A 4KQ9A 1Z4LA 1NUAA 2GTPA 3N87A 2JFWA 1O77A 4GZ3A 4NNOA 4Q9IA 3DUWA 4XEUA 4CQLA 5KWIA 4FZVA 2Z95A 1QV7A 5HMLA 3TPZA 3M4PA 4BB9A 2LKDA 1QIJA 4WY5A 3RVJA 2YCLA 1R88A 1M67A 2CJWA 2QTRA 2X4LA 3A6GA 3C41J 3HWRA 4P3XA 5CNJA 2OMKA 3MLEA 3SS9X 1JP7A 1DXOA 3IQZA 3K1AB 2PUAA 1Q74A 1KNXA 8OHMA 2BFCA 1YIAA 3OO1A 1BMQA 4LQLA 2FFHA 2NIPA 3OSZA 1UK9A 1XUOA 3I2KA 3H1FA 3RSOA 2HRZA 4W8OA 1JAYA 3U1TA 1C1DB 2JKVA 2QMHA 2QNBA 2XUFA 2HJSA 4JFRA 3C87A 2H7VA 1K5PA 1AG9A 2Y0BA 1NXWA 3M6LA 4TZKA 2NZWA 5K8CA 1IL0A 5AHRA 1T2DA 2B5VA 2CVOA 3CCFA 2H1WA 3HYCA 4M2LA 2DPYA 4TTIA 3HUEA 4GF5A 3SF0A 4WN3A 4ZHSA 5FV4A 1SB8A 1LI4A 4WLNA 3S2YA 4C4OA 5DI9A 5G0WA 1RTKA 1T3HA 3PL1A 3QLUC 1SC1A 4MVXA 4CIVA 4MS4B 5AK6A 5FWYA 1SWWA 1YTLA 4Y6OA 1W6UA 1KOLA 5CBPA 5C8YF 2Z6AA 1QQ7A 1VHTA 4NF2A 4R51A 2OSVA 3N2LA 5IAOA 3IJPA 4KPGA 2QRVB 3RBXA 3MXTA 4EELA 5HRUA 1LBSA 2ZZFA 1YR2A 2WQ6A 2QRMA 5CPFA 2GKSA 3DVQX 3I83A 5CXSA 1QYIA 3H17A 1LLFA 4JUBA 1QHSA 4G07A 4TKVA 2PL5A 2KLBA 3GUHA 1GPUA 3ZE8A 3THYB 1RHQA 3E7DA 5K09A 1YULA 1SBIA 4NP6A 3MYYA 1LW7A 1Z45A 2VRCD 2N47A 3I09A 2ZQYA 1YUBA 4NENB 1D1SA 2HFKA 2R6AA 4U2GA 1L7RA 1S4QA 1G21A 2QN9A 2DWUA 4JVOA 1HETA 4NH0A 4D9EA 2RHWA 4II7A 3DEIA 1E1NA 3AR8A 5FFFA 1VLLA 3UAVA 1Y4UA 3BFXA 3V5NA 4BO2A 2IPXA 2QX8A 3F6SA 3R20A 2OCDA 4Q1VA 1LSJA 1ZQ1A 4TXMA 4U0KA 4UFOA 3W8EA 4F0JA 4ARIA 2NYRA 4LYDA 1M2VB 2VEDA 1NJGA 4O1MA 3L1UA 1NW6A 2X1MA 4MVJE 1C80A 3NI2A 4LX0A 1HQDA 5C51B 4CM8A 3M4NA 5C1PA 1H4TA 3N2GA 4P3YA 5EMLA 5YASA 4YQFA 3ZVKA 4P71A 1JPNA 1C8BA 5HFNA 1T4CB 2BGMA 2I3ZA 3B6EA 4RCZA 1M1UA 3LY8A 3E5MA 1YI1A 4AMYA 3V8NA 3C3JA 1E6KA 4TWBA 4AYWA 3P9KA 2PLAA 3UAWA 4ZPXA 1H2WA 1N2IA 3RRNA 3FG9A 5CLQA 1QYRA 3C7KA 2C7PA 4PY2A 5G40A 3QU4A 1VECA 3A9CA 1OZ0A 2B2CA 3AIIA 1IXKA 3IRVA 1E89A 1U2DC 1DEHA 1NQWA 1NXXA 3ONFA 5FYQA 1V8ZA 2IYZA 2ZB3A 3ELDA 5DNVA 2JFBA 2PNJA 3RGWS 3KSAC 4INPA 4HVCA 4UNNA 2CUTA 1RXUA 3VQXA 2O05A 1I6LA 3CRVA 3JR7A 3TIIA 1YJBA 2BMJA 3BK7A 3K9LA 3OESA 3SYTA 1XROA 2RGUA 3VR3D 4K9NA 1ODSA 1VKJA 2ILVA 1ADGA 1OQAA 3L3BA 1FDUA 4EAAA 4CTNA 4E7OA 5JYCA 1CQXA 1Z7NA 1KR5A 4OXNA 2X4IA 4NCIA 1X7XA 1KH2A 3UOAB 3TBFA 3ECAA 4JUAA 4II3A 2VNKA 3HE3A 2EKZA 2LNDA 3DA8A 3FJ1A 4I1SA 4QVIA 3GZNA 1JVBA 5IK2D 1IY8A 1FJGB 1FU4A 1SC4A 3KYJB 4EL0A 4WHMA 1E1RD 4ITUA 1USIA 1VFNA 4KO3S 1NKTA 2JGAA 1H0SA 2UZ4A 2JJQA 2MT9A 4ZJYA 2HF8A 3C7DB 2AKWB 5IDWA 5JY6A 4XDHA 1LA2A 5D7BA 2ZTMA 2NVBA 5JSFA 3V3KA 1EJ6A 3AU9A 4DV5B 4UUNA 2ZANA 4O25A 4J7CA 3WIBA 1QZXA 4L3VA 4YP0A 4XYGA 1QG4A 4GZLA 1F51E 1MW9X 2D06A 2GPSA 3P9SA 3H65A 2QTTA 1GU0A 1MU0A 4TQDA 1AA9A 1H2BA 1N6RA 1RM3A 2X13A 3DUFB 3G8DA 2QROA 2WF7A 4DLLA 2AW5A 4F4UA 3VSCA 3NVMB 1YUMA 3Q3CA 3BZWA 5CUQA 4DG9A 1T2UA 3YASA 1E3LA 5LQRA 4BEWA 1DWQA 2P2ZA 5DLPA 3A5YA 4FU0A 4L8LA 5FLYA 1P19A 3E5NA 4BXOA 3LGSA 4H31A 1GDHA 2XOEA 3SC3A 1NVMB 2HR1A 1S02A 1ULZA 3CG0A 2Q3DA 3H1PA 3UN1A 4X20A 1TEZA 2HLDD 1BS9A 3BXGA 2WI8A 3ONWA 1M2NA 1MXFA 3NT5A 5JATA 4C88A 2I2BA 2FX3A 3L2ZA 2ZYUX 3DM9B 5HQ3B 1C2YA 1W0CA 4GHWA 3MGAA 3TOCA 1LFAA 4CWAA 4D4HA 4ZQEA 1R37A 4P83A 2FHSA 1OZFA 1U3UA 5C0OE 2MCFA 2AFVA 1AKTA 2HQSA 4JITA 4ZAYA 4ARZB 1J8MF 1X87A 4Z7JA 3J80A 3W7VA 1P91A 1JQ3A 4WL0A 3NHPA 4LTDA 5E7IA 2RJNA 1K4YA 4TVWA 1GKKA 1LCIA 1YB6A 3AM5A 4BQPA 4BO6A 5C8XA 1TK3A 4Q82A 3LQKA 3I04A 3ADKA 4LS3A 5KYYA 3CRW1 2A6PA 1QHIA 4ESVA 3BWXA 3ZTTA 1NW7A 1HZJA 5G1PA 1ZUD1 1AKQA 4LV6A 1GG5A 1NPYA 3OTHA 3T0GA 1PHPA 1VOTA 3SDBA 4CKCA 5LP6A 3WX0A 3NZEA 2DHDA 1NSFA 3OPYI 2Z43A 3CB2A 4YP9A 1FDSA 4M1OA 1NVDA 3QELB 1U94A 3ORFA 1SUPA 4DKXA 1ZH2A 2FSSA 1I1NA 2BE9A 2IEDA 3D3KA 3JQCA 2FA9A 3OZCA 4W1PA 5CD9A 3OWOA 1UJ6A 2Y1KA 2OXTA 4EDFA 4ABYA 4EPYA 2LW7A 5AM4A 3R0XA 2EBHX 1GUDA 2XGMA 5GZ3A 4MRPA 1RJ9A 2SKDA 5KNDH 3ELBA 1OX4A 5T57A 1G6KA 2VK1A 3AR4A 3H4TA 4MCAA 4TTRA 2AMFA 4UTXA 3ZCXA 2VQEB 2VKTA 3JRXA 5KQPA 3QOYA 2ORVA 2I2WA 2VHXA 1RQNA 9GPBA 4KN6A 4Y6GB 1UJCA 2OENG 2H4HA 3VKGA 2JAUA 1MBZA 2P0EA 1FRNA 5LMNB 4UUPA 3WKAA 4MGYR 4KWCA 4CTMA 4HWTA 1YI0A 2C2YA 2I1LA 4P82A 5CIWA 4B3JA 5H9WA 5K8TA 1JZTA 1VFPA 5EEGA 1NBEA 2FEWB 2O8BA 1QNLA 2VO1A 5B6PA 1Z2CA 5DWDA 1A8QA 5EHNA 5CNKA 3TRJA 1J2EA 2Q2VA 3EGDA 2XE4A 1SOVA 4DUZB 3KBOA 3TQCA 2PXXA 3ER8A 1JTFA 3BD6A 2UDPA 4Y2SA 5HVNA 4N8DA 1O4WA 4I8DA 1ZGJA 4GUDA 2CXXA 2I6SA 3RRJA 4BKMA 1G8KA 1LBEA 1K7EB 3CLTD 1U5CA 2I87A 3HR7A 2PD3A 4QTUB 4AG6A 2A33A 2WWTA 3FZGA 5CR9A 1PGPA 3FVVA 3KFXA 1TEXA 1XZMA 1ZC3A 1N5LA 1X38A 2WEKA 4IEEA 4JENA 2R7NA 4QODA 3BM5A 4X94A 3THRA 5TGTA 3WYFA 4UM9D 4M4SA 2HXGA 4LGVA 1OI4A 2JRCA 3A9VA 1EVJA 4WV3A 5FQOA 3VNQA 4IO0A 4LYYA 4A26A 2HJVA 2PPLA 4PC1A 2JBAA 1GR0A 3AEKB 4R3WA 1FYWA 2A9OA 4C76A 1YMQA 4OL0A 3DXYA 4JOSA 3KB2A 1I32A 1YZUA 3EG5A 4AIRA 2QRGA 4P73C 5AXAA 1XN1A 3PRKE 3DULA 4YRIA 3QHPA 5I9SA 4CDMA 1DG1G 1KI9A 1Z29A 2FG7C 3PLNA 4OOFA 4MK4A 1Q83A 2V1UA 1ZP6A 1YS2X 1D03A 2VJCA 1W94A 2I80A 1FYXA 1Q7BA 3C7AA 3AUUA 1J7JA 3E3OA 1EK0A 4U8GA 4RA9B 1HLFA 2R87A 4PAQA 2NU8B 5GOZA 3GFGA 3LU1A 4GC9A 4W7IA 5EZYF 4YCCA 3KP1A 1H0HA 3CH6A 2XMQA 4KWHA 3VSEA 5IHPA 3QA9A 4CM7A 3HXWA 1XZKA 3G88A 4FUTA 5KTPA 3C4JA 4GX5A 2I4TA 1SXJD 1BU5A 3B1JA 3GBPA 3NJ8A 5GJBA 3U7QB 2MSCB 3V55A 1ISPA 3M7IA 5GIPE 3NBQA 2O3TA 1ZD4A 4C08A 5L45A 4DQUA 2ATXA 3IUEA 1OIXA 4I4TA 4FHZA 4Q6WA 4ZQBA 3TKLA 3WJ1A 5F3WB 3PCTA 2X8AA 4BMVA 1TJNA 4LBVA 1SKQA 2PGDA 3GLGB 3LQYA 2CMHA 1PR9A 3O38A 2DGDA 4UNSA 3ZV6A 2SCUA 1TJ4A 2DY0A 3HSSA 3V1YA 3DEJA 1T1JA 1SH7A 1ZJJA 3N3AC 1N9WA 1T5BA 3EDOA 2BFPA 3HCPA 3EVFA 5DK6A 2DHRA 3HNOA 3WXBA 4C4TA 3CIFA 5ELXA 1UPTA 3V7RA 4LPSA 3PUZA 3K94A 4MPTA 3OIUA 1CIVA 1Z37A 2D62A 2SCUB 3GD7A 1AH2A 1EZZA 2YXDA 3ANTA 4ZVRA 4WK6A 3KQQA 3UV3A 3MWDA 3ACDA 4KDEA 1T4CA 2ACEA 2C00A 2VF2A 1CP2A 4UFPA 5DNCA 1WZIA 4GUAA 2FW7A 4HAWA 2QE7A 2CB9A 3A0RB 1AM4D 2WHRA 1M2KA 4G5XA 4QX6A 5EMMA 3C8ZA 2E21A 4RWZA 1AQYA 1YJ5A 2EQBA 4WEQA 4BYGA 1FFEA 1TJ3A 1ADFA 3MJTA 5BPFA 1UPUA 2IKQA 4GMXA 2B0CA 4FT2A 1KK2A 2J08A 3NW9A 4XDZA 4BN5A 1JSLA 4G85A 1ZSNA 2XSZD 4LSWA 4MS3A 4XX0A 2WTNA 1NRJB 3ELYA 4OCZA 4BLTA 2GLUA 5LQSA 2CXQA 2IY7A 4EHDA 3HFZA 1Q2UA 4C4PA 5JZSA 4F2DA 2R11A 1PK7A 2W6ID 3BXOA 3LV8A 1K8YB 2XKAA 3F96A 5J4LA 4B4UA 2Y99A 5DB4A 4H1UA 3TDKA 3W77A 1TVKB 3H2BA 3PFGA 3WSWA 2HHHB 4J43A 3BSSA 3NEPX 1FSFA 2TMYA 4R8VA 2XB6A 4BKUA 3G9ZA 2AMLA 5IJ0A 1RWNA 3EXAA 5EJ6A 2ZVJA 3QKSB 2I54A 2B3TA 4OQYA 3M6FA 4MRNA 4YGYA 3CUTA 2Y0PA 5H81A 2ETXA 2CNOA 2VJBA 2L82A 1NY5A 1JI0A 1RMTA 4ZZ2A 4LDRA 2AKAB 4JI0B 5AESA 4LDQA 1A4XA 1KEWA 1ZGCA 2YRWA 1A5ZA 1FX0A 1SK9A 1X7GA 2ZBRA 3MCTA 4OAOA 4U7FA 4UVIA 4X41A 5JBQA 1H05A 5LXTA 4FX5A 1JZQA 3JWHA 4X1YA 4E1BA 5JROA 2JLUA 1E2IA 1QCZA 3PS9A 1F12A 4BV2A 3PFNA 4OQNA 2GXSA 4MS1B 3M6AA 2TMKA 4JMLA 4Y9SA 1IHDA 4FHFA 2J4DA 5DP2A 1CTQA 1R12A 4AW9A 4V1CI 1J06A 2IP4A 1VYHA 3FNFA 2NAPA 3ORSA 5BXQC 1FSSA 3AF0A 2WU3A 4S1NA 2OGSA 2P3SA 3R5KA 3AVQA 2P9QA 3PIDA 5JPIA 1WHSA 4LG1A 4DJDC 4ND6A 4NR0A 4PHHA 1P7PA 4P6VF 2XB2A 3FDIA 3RSCA 7REQA 1M2FA 2JGNA 3CLVA 1OA1A 4OPMA 4RZXA 1JF8A 4ZO4A 5AW3A 5IANA 4IJWA 1V35A 2FP3A 2AFIB 3NEYA 3V8VA 4BMDA 1DT5A 4E2FA 3VJRA 4S1TA 3R41A 4NDNE 4BVLA 1Q0ZA 3M6WA 3KXKA 1KSHA 7MHTA 3EA4A 1KP9A 2QV7A 2QZ4A 3KTDA 2J3LA 1ZRHA 4L16A 3HXOA 4TZ6A 1I2DA 4C1NA 5JCOA 1QGZA 4Z4CA 4DXAA 2P3LA 2EZ9A 1NZDA 3IVCA 3O1IC 1ASYA 4RA9A 2Q8NA 5B1DA 4H7EA 4JC0A 4DSOA 3K71B 1RCFA 3FNRA 4RNCA 1E2DA 5DCUA 4OTZA 4BJ1A 4BMZA 3MQZA 3BXEA 3D4OA 3GUCA 1XZGA 4OBWA 3ZWKA 1T6XA 2JLWA 1J90A 4BZPA 2C3MA 4IGFA 3FCXA 2PLWA 4Z4IA 4EQ6A 4TYWA 1J09A 2FSFA 4DVJA 5GOTA 4BX2A 1KTIA 1I24A 3CXUA 4DNQA 1EEHA 5IJ9A 3LUHA 4XIJA 2QAJA 1WXGA 3JVIA 2X7JA 3GK3A 2HHJA 1P4RA 1KMQA 2OD7A 1UK8A 5F1KA 1Y6GA 5FPTA 3WO1A 1QWSA 4L6IA 2LTAA 4JI2B 2VAPA 4RXMA 1PJSA 5FJJA 3IJEB 1LGYA 4LSZA 1Z0UA 2C5HA 2ZVDA 1GL7A 3LM8A 3NYIA 4NYIQ 1DAEA 3IT3A 4L4SA 4A0HA 1GRNA 1LU9A 4RELA 1P39A 3C39A 1XVTA 1GNTA 4O3FA 3VNAA 3WOHA 4H1TA 4OY3A 1SG9A 1B14A 4B1FA 5L4SA 1PS9A 2XGSA 1LNQA 5KOHA 3PZCA 1U3TA 3CCBA 3K20A 4RZSA 4EHFA 1SG0A 1B8UA 4ZMSA 1JQ5A 1QZUA 2RGEA 4V2IA 1FY2A 1PT7A 4WMLA 3STWA 1VB5A 1TO1E 3UGQA 1E7MA 1QHXA 2DR0A 2XNHA 1VHQA 3P2OA 5DBGA 1DHRA 4A8JC 5HK8A 1CR4A 4IKEA 2GZRA 4AF8A 5ELNA 1U0HC 2IUSA 1XZ8A 3QJYA 3LUBA 1DJLA 1RXIA 4BO9A 3DVSX 1VHLA 5CT5A 1RJFA 3BUSA 4R7ZA 2GEFA 4UPAA 4R1SA 1H8HA 1G5QA 1ZU4A 2C2BA 2OQRA 2F3SA 3AHHA 1NFFA 3U6BA 1KKLA 3GAAA 2VHTA 4MKFA 3FCEA 1XRJA 3CC8A 3OP4A 1G20E 1NULA 4QARA 1IPFA 5E6RA 1JFVA 3CZMA 3S40A 1VJ1A 5CCEA 2AKEA 4W5NA 5LB4A 1ZPDA 1E3SA 1RI5A 1W9MA 2HKIA 3GQVA 1KAQA 4M99A 3TQRA 4LF8B 2R751 2FK8A 5DISB 4PGMA 3HO6A 4KV9A 4MYDA 2GEDA 2OUIA 1RYHA 1J5WA 1WNTA 1QSGA 1X3LA 2COUA 3DC2A 3KPYA 4TTAA 5GPBA 1YQEA 4ZWNA 4BFYA 5GTDA 3AVXA 4TWAA 1R0XA 1J6UA 2OWDA 1QORA 4KFUA 5E8RA 1A9ZA 1E2NA 1WW3A 2YIMA 3G85A 5TF0A 5E9AA 4AN1A 1PJZA 4PSKA 1XBTA 2HRDA 5TJ9A 4C0XA 2O8CA 2IHVA 3U7FB 3IUYA 4ZEVA 2A7QA 2QNIA 1GNPA 2VA8A 3ACBA 2QU7A 4M0DA 2RHSA 4KGXA 2O1EA 3HXMA 2Y66A 3KZKA 4S1OA 5TQ0A 3NHJA 1GFIA 3N2ZB 4QJ4A 4AG5A 4Y6PA 4HY3A 3FF1A 2ZUBA 3OZBA 2DJ5A 1YA4A 3ETEA 2IY8A 2YH2A 2WSMA 3D8TA 1NFRA 3F49S 1FB5A 4IHKA 3ZNPA 1KC1A 1UJBA 2VYNA 4OQLA 4ALIA 4CODB 1YB7A 4PPGA 5TGZA 1HK7A 5HIMA 1K8RA 3FPCA 5BQXA 3JPYA 3QITA 4MV7A 4FFBA 4WVFA 4FMDF 5D51S 1ZOSA 3VC7A 1GQSA 3HYSA 3UG7A 3VPBA 5TGDA 3QMMA 1BCSA 1FVOA 3DBHB 3HBAA 3DO6A 4UNQA 3R40A 1TYZA 4Q02A 3WYAA 2O8FA 2FETA 1PKXA 2I03A 4EHHA 3KEGA 2WTXA 4XIIA 1ULTA 3SLRA 3RWMB 1EX7A 3ZIAA 1BJTA 2RGXA 3K5WA 3CSUA 5DM2A 1RE0A 1XKXA 1ZM9A 2BEJA 4K86A 1E2LA 3K6SB 1ABEA 1LBHA 2EX4A 1FTWA 1U0JA 2JFUA 4RO0A 2ECOA 5G53C 3WK6A 5AVJA 4AJHA 4HTAA 5JJ5A 2E4VA 4XJVA 4D9CA 1DOZA 3KLPX 2PX4A 4TLCA 3FLAA 4WLVA 2PGOA 5EXXA 5FULA 1YBMA 4Q34A 5TLSA 2WKSA 1PJRA 1Q84A 3NJ4A 3S5JA 1LRJA 2IY5B 3TQTA 4R8SA 1G8JA 3VMFA 3FHTA 2QVGA 4YP7A 5B3AA 2HQ1A 3ZY2A 4A9AA 1ORRA 4BO7A 2RH9B 2O59A 4EMBA 1L5FA 2VEOA 1ZBQA 3IG2A 2SBTA 1QMGA 3ZD8A 4A0GA 3MTIA 4N3BA 2RHTA 5AM0A 3RS4A 4GDFA 1GAQA 4JR0A 2XADA 3N2NA 1W9HA 4HOYA 1V43A 2CLLB 2O19A 3NP9A 1W581 4Q4AB 3TM5A 1A72A 5F35A 4IILA 3VU9B 2BFOA 2FPPB 2HJWA 2ZWIA 3ST7A 4BCBA 1DJOA 4PX3A 4M7PA 3L7NA 3CVXA 4DWWA 3D3QA 1L5GB 3R76A 4OX9Y 2OGUA 1XTZA 2WVAA 2Q7XA 1Y89A 4MUNA 1NU8A 4C0WA 4B3TB 4AB1A 3EAQA 2CN1A 2XNKA 1I2BA 3GEIA 3KUKA 4IJMA 2X5JO 4KKXB 3C3EA 1DFHA 1M54A 1Z39A 3UKDA 3QQ5A 4PICA 5CBKA 4KYIB 1POWA 4MV9A 5KINB 2IXFA 1ZN7A 4JI6B 1WUHS 2YQ5A 3A70A 3ENQA 3EN0A 3OO0A 4LDNA 3UFGA 3JQFC 3VNBA 3WIDA 4J0FA 2Y77A 3V2GA 5DASA 3LWDA 1NRWA 1B76A 2GYWA 3UJ7A 4C4YA 4PLPA 2R6HA 1FDOA 5HIJA 4B2IA 4YYZA 1SHZA 4O2DA 4LTNA 4O4IF 4ID9A 1KYVA 1R8JA 3IQXA 3LZCA 3IESA 4DV2B 1P5RA 2IE8A 4O63O 2NUPB 2YXEA 2ZUSA 1XTPA 4L1KA 4HQ6A 4G65A 3AYXB 3GRCA 4WW0A 2Z2KA 4Q6BA 3GGGA 2D5IA 3I2GA 4RFVA 1RC8A 3L01A 3CSSA 4G41A 1VL1A 2ILTA 3WP0A 2R6JA 3LP6A 3HYRA 4JT8A 1T43A 1G55A 3UENA 4MQEA 1GN9A 1SC9A 2ZSHA 3M6IA 1FEZA 2XA1A 3IE0A 1WPRA 4IOMA 1UAYA 1OGJA 4QBTA 4I55B 4P4LA 5EE9A 121PA 3T3EA 4RLHA 1M75A 1CZNA 1T8TA 2BWJA 2IU4A 3C1AA 1AKVA 3EYWA 5ALRA 1NMXA 1KE1A 1IUOA 2LV8A 2I9KA 1TQDA 4HDSB 3SWWA 5ALNA 1YJ8A 3VYVA 4DA4A 2I2DA 2YWCA 1U1CA 2OM2A 3FKJA 2DT8A 3RPEA 1SOUA 1XK7A 2R6R1 4GGPA 2WT4A 1XJ0A 3QUAA 2RIPA 4PGGA 3SQMA 2YL2A 1RXVA 5E7QA 1I14A 3EGWA 2A59A 4JL8A 4WZAE 1X1RA 2ZSIA 3FSGD 2HY7A 3MCAA 2I7TA 3T5BA 5IKMA 2D2IA 2IHJA 2DTDA 3L4BA 4WBNF 3OJWA 1NZFA 3KS9A 1OBCA 4WZZA 4QPZA 3O4RA 3OF3A 5FWXB 4UKDA 2I3DA 5LKRA 4NJMA 2JCGA 1JGTA 5DTIA 1L7QA 1D2CA 3L46A 5EIXA 1WZ2A 3R5TA 4H7FA 1E8DA 2ZDHA 4D42A 1Y8ZA 4UM7A 4OFXA 4F12A 4MWBA 1O9GA 3D1VA 4OYHA 4CKEA 1CPYA 1T1EA 4ODIA 4UM9B 3OJEA 4JLAA 3EMVA 2VDLB 2FLVA 4QVKA 3ZXUB 4CL0A 3GUVA 1KK0A 3QU7A 4JBNA 2VWPA 3T0FA 2AHOA 3IBSA 1X86B 3BZUA 1GUFA 1YVEI 4NABA 1XXHE 5H16A 3OIWA 3NHSA 4LHVA 1Z5OA 1M73E 2WFZA 3KG2A 1X1CA 3QY9A 4GWKA 5KZMB 1XGKA 1IJKA 1MX9A 2PCLA 3HR4A 9ABPA 4EI8A 2IF0A 3O7MA 4CMHA 3DOJA 5DM0A 5K3DA 1YMVA 3RYIA 3ZZUA 4EBBA 3O9VA 1GO2A 4HTFA 4OHMA 4D26A 1XI2A 4L78A 1C3VA 2F2TA 5HM6A 1BYIA 1D5WA 4LOAA 3FOCA 5LP1A 2GF2A 3PEVA 4WXHA 1BH6A 5DN6D 1Y6ZA 4NJMB 3Q8WA 2RHQA 3RTAA 2P4QA 1G63A 2QW0X 4DPGA 4F2GA 1V95A 2YZKA 1VRVA 5GGYA 3ADCA 1GFZA 1UDRA 1BSVA 4PZYA 3AHFA 3SMVA 2LRHA 4BRSA 2YZMA 3JYNA 1NQVA 2H5EA 4JC4A 4ALNA 1U7HA 5JBNA 5FB3A 2VBGA 4MVJP 1L5WA 3EVAA 4WZBB 3DJFA 2ZSDA 3R8CA 1ENZA 1R9JA 3THYA 2J87A 4K9OA 3GPDG 3HKCB 1VQ1A 4IH1A 3S2FA 3T1OA 1CU1A 2ZROA 5FCDA 1Y9JA 3WDLA 4G0VA 1CVLA 2FW1A 3CW9A 5CFRA 4QTYA 1M9NA 5BVHB 4NG5A 2OXRA 3PQDA 2WPDD 4IW3B 1DQYA 4S12A 5B4UA 3IB6A 2RGAA 5B2EA 2UU9B 1K4MA 4NPCA 4DLAA 4MUAA 1IATA 4U3JB 4L95C 5FX2A 5HW0A 3DYIA 3BILA 2ZOSA 1R66A 1QDLB 1UM8A 2P4SA 3P97A 1YONA 1WYDA 5JNSA 3GLTA 1ADJA 3T5CA 1S8AA 3HRHA 3L8HA 3HKEB 12ASA 1XHLA 1TYAE 1Z0JA 1RWVA 1OIWA 2AR9A 4GKVA 4YALA 1TA0A 2GD2A 3JQ6A 3LCJA 3UPDA 1D8TA 2RB5A 4EZIA 4RTOA 1F60A 1Y9DA 2HNBA 2RHHA 4G6ZA 4KJXA 4V3CA 3E9ZA 2QPTA 5EVCA 1W19A 3D5TA 4E12A 2ZRFA 3PFBA 4PG3A 1NA5A 3IEIA 5LXTB 4F3RA 1UAAA 2BKLA 2A5DA 4KEAA 1V8OA 3GLGA 2B6HA 3GMSA 3AGQA 1H5UA 3DOIA 1KVTA 4LCEA 4RSHA 5EE3A 4AKHA 2RK3A 4X61A 1HE8B 4OB6A 4CM5A 3K96A 4G09A 1EWQA 2QY9A 2JHAA 3M33A 1DX9A 3PP8A 5EHGA 3FYTA 3PQEA 1KOJA 1G8GA 5FH9A 4RD3A 4X1KB 1POXA 2HA0A 4R3UC 3GJ3A 1CS0A 4S2EA 3R0QA 4ZOBA 2PUDA 2DLCX 4RXUA 4WCFA 1TAUA 1K6XA 2NTYC 3CGWA 4D4GA 3AJAA 3C3AA 1H4SA 3SQNA 2HK8A 5TV2A 3VX3A 1A71A 1QLWA 4LHWA 3W4IA 4N6NA 4O1HA 3X1KA 1DEKA 1K66A 3ME5A 1RAHA 3RWOA 1AA6A 5IJWA 3QQPA 3ABZA 3O3NB 1IBSA 2XXBA 5A05A 2P0AA 1D1TA 1ISMA 2DUWA 4TX1A 5MDHA 1DRVA 3ZCQA 3MJRA 1QK3A 5KX5F 1W73A 3OMLA 3UK7A 3QVXA 4RAQA 1XQ1A 3TCKA 5BWLA 2GN8A 3VU9A 1GYRA 4BLOA 1R8XA 1NYQA 1R0ZA 1YC5A 4TSRA 5JYBA 2ZJAA 2DBYA 4FE3A 1HX7A 1KZ6A 3B78A 2OO3A 3A0UA 4AAYA 1THGA 1W0KD 2MYNA 1NATA 2PRKA 4ZREA 5E1BA 1OY1A 1RTTA 5DYYA 3EXG2 1V39A 2P2SA 4W1RA 1RYFA 2E49A 4TRRA 3VI4B 1W2WB 2C8LA 1Y5RA 2CL0X 3GJ5A 4LA4A 2OV4A 3CLKA 4UNPA 2YVKA 4BX0A 1NVGA 4MB0A 3X43A 4BNHA 4GBGA 4JLOA 3H5RA 4H59A 3H13A 1KYWA 2ZYAA 1UWKA 1QOZA 2HWUA 2QK4A 1MG5A 5FOXA 1U28C 4LZAA 5B4VA 3C2QA 2BLLA 3I6YA 1X42A 4RM2A 3BCHA 4PTLA 4Q00A 5BSRA 4B3HA 421PA 1GRQA 1CP3A 3FYUB 3LT0A 1OX6A 3PVCA 4AP5A 2JIZA 2QLFA 1VGQA 4P08A 4FEEA 1XHFA 3CVOA 2GSDA 5D5HA 4WBNA 2XCSB 2DBQA 2XQVA 4OP3A 1J5XA 5FLXA 1IN8A 4IHJF 4CV1A 4RE6A 2PEYA 4P33A 4RYDA 4YNBA 4YV7A 1H8ED 5CP8A 1Q1AA 1B6RA 4M6WA 4FCWA 4OXXA 3TW8A 1KMNA 3RIGA 1S2DA 4U9IS 2IXBA 3KJZA 3GELA 1BGXT 4S1WA 5HMMA 4ZYYA 2VVTA 4DLKA 2N1BA 1PJQA 3P19A 3PHCA 2O2IA 1PJCA 5FV7A 2EJVA 2Y76A 4OQPA 2VF5X 3K70D 1XR3A 3PDWA 1A5TA 1WSAA 2H1SA 3R6GA 2X76A 3GVCA 3VH1A 3CLTC 3PFFA 1OI7A 2VL7A 2ZJ6A 4HQFA 4HRXA 3ZGZA 3FVWA 1QHGA 3H2YA 2F1IA 4TSFD 3VBEA 3RKSA 5CJ2A 4ZVVA 2NGRA 5F4BA 4UVGA 4QU8A 3HWWA 3LOPA 4JLSA 4JQOA 2JJ1A 4KI7A 3G5AA 5MFZA 1ZICA 3EUEA 1D6MA 3B7GA 3E84A 2OPBA 4MWDA 2ZR8A 3HB0A 1EE2A 3VDNB 4DCNA 4EGQA 2NXJA 2YWHA 5AXDA 2LKCA 3R9IA 1A9SA 4BTVA 5D6OA 2X22A 3CEAA 4H08A 6REQB 1D2EA 1P3Y1 3D7SA 5CLGA 3ZZTA 3CMMA 2CKDA 4FOTA 1ZEJA 4FJ1A 2BZGA 5E1DA 4E2YA 2QRHA 3V7WA 1QIKA 1PYDA 2Z3WA 2CD9A 4Q47A 3L43A 3MINA 4KXVA 4M0UA 4E21A 2CWDA 4RXTA 1NHGA 1XP5A 2P62A 4AURA 3QWAA 5CXQA 1UXHA 4A8JA 1B4DA 1L8AA 1NXSA 1SJ9A 2HB6A 5KVAA 3GAMA 1Y1SA 5K4AA 3MOGA 4KPFC 2LE0A 1ONBA 4NCXA 2J59A 4P34A 3OZGA 3R4VA 1SXJC 4GOXA 1Y7PA 1PVVA 4RPGA 1G9XA 4D3ZA 3D0OA 1NVVQ 8ATCA 2LIPA 2XCLA 5E9JA 3WWOA 1L9KA 3JQGA 2PANA 4OXYA 2Z1NA 2ZT8A 3TRIA 4JLUA 4IEFB 2ZJ4A 4ZV4A 1XCOA 3W5IA 4YMTA 4QHTA 5CA1B 1RC0A 4EBFA 4JLPA 1SUWA 3PKIA 4RVSA 1Z2PX 1CUDA 1E62A 2XGOA 5B37A 4ND3A 4WLUA 2B35A 3ZE2B 5A4MS 2PD6A 3PXXA 1FTGA 3LDHA 4MEJA 4W9RA 1LBQA 4EW3A 1K89A 4B7XA 3K09C 5BUSA 2JDIA 1F0KA 1MG0A 3NHUA 1ID8A 1IL2A 2CLMB 3DEYX 4MV5A 5HPYB 4X24A 4X84A 3VR4D 3PQ3A 1O95D 5BUQA 4XU0A 1JYEA 2YTZA 1I5EA 3FKSD 4OEHA 3K1YA 4I14A 5TMBA 1UBKS 4DY6A 1LS1A 3JQEA 5IMBA 3TTXA 5J58A 4F86A 1MEJA 1MJFA 3AQ4A 3CZPA 4HDKB 3TNDA 1AIPA 3RIHA 4N40A 5J2UA 1HDEA 2ZR2A 4UU0A 3EPPA 1BE0A 3EZ7A 4EECA 2ID4A 2MSNA 4PN7A 5K0SA 1XD2A 2J5XA 4WNIA 1U4SA 1C1YA 2I1QA 4RJ2A 1O08A 4ILKA 2FRXA 1XZLA 2CVHA 4Z0PA 4L4ZA 3NHLA 4CR7A 5KYKA 1SU4A 2QQ0A 2WJWA 3WLLA 1QK5A 1ZAYA 2QSUA 4L2IA 1QRSA 3THSA 4INOA 2D0PB 2DZ9A 3G8YA 3QF7A 4O4LA 5TQJA 1E1YA 2NACA 4IDNA 3STVA 3NC0C 1ZD9A 4HT3B 1QFYA 5LLDA 3THXB 1RQGA 4RFSB 1KFCB 1K2VN 5HDQA 4QXAA 2PZBA 4KN8A 1VE7A 4LHXA 4MI3A 2CFRA 4JIGA 5NLLA 3TLZA 2J48A 3CEJA 3BGWA 1NNHA 1CJSA 2PS3A 2VHQA 2YXPX 5CFLA 1ZONA 3M4YA 1L7BA 4FE4A 3G2OA 2W6ZA 3QXCA 3KVRA 3NHFA 4NZZA 4ZKDA 3PEFA 1JFRA 1KYXA 1NF9A 3HCDA 1D3AA 2C92A 4JUFA 2CB0A 4F1WA 2JLVA 4GS5A 3PNVA 3W78A 4JT9A 2VDJA 1Z0FA 3DE5X 5ER6A 3DKRA 1NE7A 2Q9BA 4HH1A 1JEAA 2HSWA 2HWWA 2VXBA 5AOVA 3JD3A 2RHRA 3V42A 3ZX5A 4I46A 3HKBA 5L3QA 3K0AB 3NTRA 1DBIA 1W48A 2BKEA 3TL2A 4Q15A 2CNLA 4LY9A 4UP8A 5B3LA 1YACA 4LCJA 1IQ0A 2HNKA 4NDAA 3ZY6A 3MT7A 4MP8A 5FA5A 1UBNA 1XXLA 3IQHX 1V5FA 2GBIA 3KQWA 3EIEA 5KAMA 3VO9A 1HEYA 4AXXA 1IOVA 4NFYA 3KFVA 4FKZA 1WAMA 4RSGA 5BRNA 3F8TA 3VPFA 1KXZA 1LPSA 3K8OE 2WDPA 2IBMA 1CULC 4PLFA 1UR5A 3W04A 4Z2AA 3DMPA 1QPZA 1PSDA 5LYJA 2YKGA 3NBYC 1EFWA 1G41A 2OKGA 1G1AA 2WP8J 3C8UA 3WWDA 1CUEA 2IXTA 2VHJA 3OEWA 2I6FA 1G6Q1 4RVDA 4TXJA 3ZHOA 4YRGA 1QQTA 3QO5A 1I7LA 2GN9A 3N53A 4IS3A 4V0RA 1SCDA 1FP1D 3HDJA 4GR9A 5J5VA 5AW6A 2WHQA 3JAKA 5IEJA 4DMUB 2BF7A 2SNIE 3H75A 1P77A 2AR7A 3IQDB 2QGNA 1LC3A 4PM4A 3DE2X 4RF2A 1ZG3A 2WJ4A 2CLHB 4FD3A 1QB8A 5DNAA 2C84A 4I50F 5EZ5A 5KNCA 3WTCA 5CDUA 1QP4A 2DWOA 2DT5A 3PJEA 3ZHUA 4DNFA 2FUG1 1RQXA 3LPNA 3OTGA 5LJIA 3W6NA 5HYVA 1N6IA 3UQZA 4GXTA 4QBIA 2GXQA 5F21A 1BWQA 2QVCA 4ACAA 4AMVA 4EKEA 3UYLA 1ZO8A 3BMOA 2NSHA 2YOFA 2JASA 1GT91 1D6JA 3WBKA 4HXEB 4WD3A 3RU7A 3T0IA 3DZIA 1XU7A 2QORA 3PNYA 4XTRA 3AEUB 4HADA 2QPOA 5CDGA 1U4NA 2WK1A 5F7ZA 721PA 2DE0X 2H2GA 2PZLA 1G6HA 4JOCA 4LN1A 4AMGA 2B1RA 2YDXA 2G9ZA 4BJHB 4KR7A 1NSTA 4UCQA 3BDIA 1K3FA 3W3AA 1OVGA 4HFRA 1YNOA 4RK0A 4JUCA 2FN8A 2O7RA 2XTJA 3AZPA 4MJ7A 5K2MA 2C5FA 2AN4A 1T9GS 2OVFA 3AETB 1EUDA 2VNJA 1XG5A 2WIDA 1N8TA 1UBEA 4F5DA 1K7XB 1JJAA 4NH4A 1YRBA 1ZHFA 4J6EA 1LLQA 3PWSA 2WHXA 5IU6A 1F2UA 2OE2A 2JAXA 3ONEA 1NPDA 3AUTA 3PUYA 2JFVA 5HCIA 3ES9A 4XAQA 3RS2A 1KEVA 3GFPA 4ECEA 2UUCB 4LF5B 4LFBB 1BVUA 3IHLA 1S2IA 3DR5A 3QTLA 2ADOA 1Q7TA 4UP7A 3PC7A 1M8KA 1A9OA 1J70A 1QF7A 1TUIA 1U3CA 2FMHA 2NO0A 3A1TA 3NNDA 1KQPA 4OL9A 4Q3AA 3ZW7A 3ZLJA 3RVBA 3QMPA 3A3PA 3TE6A 3RNLA 5K5EA 1NGSA 1WB5A 3HVHA 2FPSA 3KUDA 2JD2A 3NH9A 5FBWB 3ZLTA 1V1JA 4TXNA 1K08A 4E51A 1G8PA 3RF6A 2FWNA 4CCYB 4Q01A 1OTYA 3RYCB 7ABPA 1CVIA 3TUPA 1Z36A 2I3GA 3G5LA 2G40A 2RSLA 4MI6A 4TM7A 3RRMA 2BLNA 3WRYA 5GJCA 3L7AA 2ZJYA 3IDAA 3Q0EA 3U3KA 4UDOA 3ZWPA 4V1CA 1GOTA 4C4XA 3ZZNA 2A0KA 5KHOC 3KZXA 4M0CA 2JAOA 3CVWA 4D6YA 4EK9A 2YVUA 5AI6A 1CS0B 2Y2VA 2J3IA 1QLHA 1NY6A 3JVEA 3T35A 1BFUA 4F7DA 1KPGA 4IUBS 2JFNA 5LXTF 1E9DA 2QM0A 3T15A 2AZXA 1N2SA 4R31A 1KOGA 3TCXB 4EI2A 1Z33A 1ZIXA 4R2JA 4D8XA 2ZRHA 4KNYA 2G08A 3VISA 3C14C 1Z4QA 3U44A 2A92A 1U9CA 2W6NA 1Q77A 4LHEA 4AYXA 1GG9A 4PZPA 5AI5A 3RW9A 2GJ9A 4HSEA 4KITB 4UREA 1V25A 3ZWQA 2CLKB 3GLSA 4KWEA 1BFKA 2G4LA 3R5FA 4HAYA 5AVUA 1NQUA 3KYBA 1ZVQA 1Y3CE 4PPNA 3WWYA 1QF9A 1X9GA 9LDTA 4PAMA 4HPJB 2V6MA 4TS1A 2IIVA 2XMRA 2C95A 4F9EA 3KQLA 2QHXA 1E2KA 3UUFA 4L4XA 1MV5A 4JQSA 3KWMA 3JASA 3TTSA 4EVRA 4YECA 2LCFA 4RQFA 1EYZA 1E77A 1FYEA 2V59A 4JJIA 5LU9A 3L2OB 1JEOA 1K9VF 4QU0A 3H0EA 2C5EA 1SD1A 2EBFX 2ZQ5A 1JHXA 3R7DA 1E2MA 5EIAA 3WWEA 3U4HA 4HWKA 4TTJA 1X9HA 3D54D 5DXJA 5AI4A 4IIUA 3WGHA 3PKZA 3BXXA 5JZBA 3IP6A 2D74A 4H0FA 3UTDA 4X1IB 5BMVA 2WF8A 4HZUA 2CUZA 3TYXA 4DJ5X 2FUCA 5EFZA 1T1RA 3F47A 1JIIA 3H9QA 3N28A 3JATB 4TUYB 5JDIA 3CXRA 4HRYA 3OLVA 3IKTA 3X3HA 3A6HA 4BEVA 2WIJA 2VHZA 4ENPA 1N5RA 1IJEA 1R0LA 3KAQA 1Y5NA 5L4NA 1T4GA 3DS8A 3PC3A 5EMKA 2RH8A 2BGGA 2PUFA 2W70A 2CSXA 3GGOA 2C54A 1JE0A 1MFZA 1S0UA 2UYGA 2ZIGA 2Q8QA 3CX3A 4MR8B 4MWCA 4QDZA 3ZVRA 5IAAA 4FS8A 1ZK3A 2DR3A 3AETA 2H1RA 3W8NA 1RZ3A 1JL3A 3WYBA 4GNKA 1MTZA 5B1YA 5CYFA 3QTCA 4GEGA 3T7KA 1D04A 4F2PA 1FSPA 3EQ2A 3URMA 4AZ3B 3EGXA 1L5SA 1P29A 1R5BA 3CTMA 3NDPA 1KDPA 4QREA 1PN3A 3V7FA 4E11A 3SXJA 5DW3A 4C4AA 1EVYA 3CZAA 3JWJA 1KMIY 2HA4A 2OMEA 3A36A 3KJQA 3MWKA 1JPUA 5ESWA 2WWXA 2XXAA 4FLMA 1YJQA 4FQ7A 2QZZA 4OXKA 3MYRA 4KVAA 4X54A 2G25A 2EJTA 2NZUG 1E4YA 1P7WA 4GGMX 1D2HA 1GZ7A 4TV8A 4W9NC 2VJLA 1FFSA 3ESBA 2BPOA 2FE1A 3KHUA 4P22A 4YQZA 5FA6A 3LXRA 3L49A 5E6SA 3C3DA 2WIKA 2WQZA 4JP2A 5AIBA 4OA5A 4X20B 3Q88A 3W2EA 1N1MA 1TTQB 4HFJA 2ZW9A 3QKWA 3GGJA 1T25A 3TAHA 1YRHA 4FUQA 2HA5A 3I1YA 3KKQA 1L7VC 5EYPA 3QW2A 3RLFA 4B82A 4B35A 3ILXA 2VZLA 4RCYA 2JIMA 3IAS6 1QIMA 2EKDA 4Y0NA 5ER9A 3QLEA 2RAVA 3HI4A 1CLEA 3S2ZA 2AG0A 4FMBB 3SCZA 3KD3A 5IDXA 1UMCA 1AT1A 2A30A 4IOKA 2JS7A 4W8GA 5HOQA 1CETA 3N8KA 4LF9B 1GL3A 1NMEA 2BHRA 4IVQA 2ZSJA 3SSAA 4RTRA 3K4HA 2VQDA 2J9RA 4PZZA 2IHYA 3BFJA 1XC7A 1A97A 1K27A 2E18A 2JGJA 2YJTD 5GVRA 2HV8A 3J81k 2YUTA 2EKQA 3LYHA 621PA 5K0CA 2JLYA 1G291 1P5ZB 5H0IA 2FDXA 5SICE 3KT6A 3LTNC 3RSQA 1C14A 1W2HA 3U61B 3O4IA 5E2AA 2WUVA 3K0HA 1V7PC 3SI7A 3PXAA 3ECCA 4MQMA 1BMTA 1T13A 4QUGA 2G7ZA 4EJSB 5FXMA 4CF7A 1L7EA 2J5BA 3CLUD 1DNPA 3D6MA 3AR7A 3MJVA 5JXIA 1T34A 1Y0BA 3A7AA 3GZNB 3V80A 4PAWA 3MWEA 5BWMA 2V9ZA 4LYEA 1WSWA 1ONOA 3AR9A 4NU6A 2H2AA 2F59A 4L7QA 1D0IA 1KGDA 2FP4B 2H5JA 5AFSA 4IXMA 1MAUA 1MPTA 3ER9A 3BHJA 2XSZA 4FDVA 2GZ2A 2OOKA 1G2IA 1J5PA 1GPAA 1J0DA 4NOJA 4NBSA 2DQ4A 5ANRB 4BNLA 4QTZA 1SXGA 3ICPA 4XOIA 5EPEA 3B52X 3CMCO 2YVQA 1N0IA 1S1MA 5AJTA 3CURA 3C70A 3SIPA 1QFMA 2G1UA 2EATA 3UMRA 1U5BB 3VC1A 4YJ2B 3COSA 4HAOA 2HWXA 2VYCA 5D1HA 4ZP1A 4JWKA 2NU8A 3SNHA 5KIAA 6PFKA 4JCOA 4YCNA 3ZGNA 2MMGA 2AJCA 4NE2A 4WLOA 5JQGF 3HZHA 4N49A 5LP6F 4PCLA 4J15A 3ASVA 1MJ5A 3LT2A 3UJ8A 2VSXA 4DA8A 1O5TA 2WJ3A 2CHQA 3VPAA 1T0PA 3V4SA 3ON5A 4RANA 4RAOA 4DSNA 4E5DA 4WINA 5TF4A 2OZPA 1ZD8A 1VCNA 2A1TR 2DFVA 2H1LA 1HKUA 2P27A 5DLQC 3WL5A 3GY0A 1Y5IA 3DLHA 3Q85A 4R83A 2IFTA 3VZBA 3OIGA 1SBCA 4HLDA 3U3ZA 4EB0A 3QEBZ 2PXAA 1G5IA 2FMFA 1CQWA 2X14A 4G5OA 2E82A 2W48A 4N4AA 3L07A 3J7TA 4C5CA 3R74A 1J49A 3CR7A 4RKFA 4HAIA 1XL0A 2QJOA 2B25A 4NBUA 4KE6A 3AB8A 5JWHA 4I55F 3AJ9A 4HQRA 4PZEA 2CLEB 2PZFA 3WADA 4B4WA 3PQ2A 1LW6E 5HZKA 1OBHA 4DL9A 3TSYA 1EA5A 2Q3LA 3D4LA 5I4KA 4C87A 2M9MA 1BWSA 2EFGA 3CFYA 1TZ2A 1HNZB 1R5JA 5CA1F 1TC2A 3UAGA 3SZGA 2ODPA 5BNTA 1HDYA 1Z68A 2PNFA 2WC1A 4MARA 4BVAA 5BYKA 3E23A 5ETJA 5JJBA 4KREA 4YLGA 2C98A 1X7XB 3CKKA 2BUAA 4MUFA 2EFHB 4ERXA 1RLJA 1U31A 5HUHA 3SD7A 1AQ6A 1GZSA 2JZOA 5ALMA 2PG3A 3IE2A 2IZ0A 3BEDA 3UHAA 3EPKA 1XNQB 2A9FA 2CK3D 1WETA 3O9MA 1DT3A 2IYXA 4JJEA 4YXWD 4IHAA 3BWDD 3TMKA 5AM3A 5B2FA 1V5IA 3CWCA 3K0KA 2GBLA 4YIKA 4JFAA 4E0BA 3F5SA 2FSGA 3SZOA 1HTWA 2G63A 1K2WA 1PJBA 3OBIA 2H17A 2VP6A 2IOHA 4YLEA 4Z5XA 3S7ZA 13PKA 1B8PA 4E5VA 4Q7MB 1Z88A 4RKRA 1NN5A 5CXXA 3JAMA 4GT1A 4OHOA 1W36C 2A14A 4BNTA 4L8FA 2AYZA 1SXIA 2GFHA 3TQFA 1H9BA 1Q1NA 2YDYA 4ENUA 1GCOA 2C9MA 5KYGA 3NIBA 4GOOD 4RA6B 3W8DA 4ACBA 2W2VA 4REOA 4RMFA 4KTTE 2QRPA 4MLZA 4N82A 5DHPA 1IBRA 1UEJA 2R5WA 1VE3A 3BAFA 2BTOA 2GCGA 2OCLA 3K6KA 1HDOA 2Z98A 2RHDA 3KTAB 1Q3TA 4MUXA 4TKLA 1E98A 1WY7A 1KA9H 3QVLA 2DX7A 3ZDZB 4R1UA 5I7AA 2X9NA 1ONNA 1XLVA 2QUHA 4FQ5A 2NMVA 3P94A 3TRFA 1NUUA 1N3YA 3P9CA 2ACWA 1UT5A 4XTUA 2Q07A 3KDPA 4IDPA 4RQEA 3DTYA 2GEVA 4PAOA 4DLXA 5CURA 2DPMA 4HXFB 3UFXB 2X15A 3OLXA 5JALA 2TECE 1YVPA 3P2JA 3P2IA 4DXHA 4FFVA 3IQEA 4KP7A 4R69A 4JYCA 1OLUB 3H8VA 3N5CA 1HDGO 1S7CA 1TRHA 2VNHA 3LKBA 4LOIA 3HCRA 3D1JA 5BSGA 2HDNB 4MUKA 1PG0A 2ERCA 1E20A 3SS7X 3FNBA 3JVDA 5K05A 1DBQA 1MAHA 4RVNA 3HA5A 4HN9A 2Q4EA 4RIIA 3OT4A 3TQSA 3CRRA 4WBNB 2HFJA 1OFUX 1JDBB 3KQUA 1JIUA 4BEJA 4OFWA 4B4DA 3ECSA 2A9JA 3BE5A 1DRKA 4GP7A 4JKIA 5KTTA 2YJZA 1G42A 1GKUB 1QANA 3EZGA 5FTJA 1Q3HA 4Q3NA 1IHPA 4OYYA 1M0SA 2OCKA 4CLOB 2Q45A 4CNBA 5JMOA 2DKGA 4GW3A 2Q5EA 3UB3A 1D2GA 2X8BA 4IH9A 3ROQA 1R4MB 1XKLA 4D8TA 4QOJA 5DYIA 4KYVA 4XWWA 1SA0B 2XEDA 2LCIA 3ILSA 3MA0A 5EL0A 3U3XA 2E1PA 2W2OA 2ZPUA 3JYLA 1KJWA 4GZMA 3O5AA 2YJNA 1F6DA 4EITA 2FPGA 3V8BA 1RNLA 1KI8A 2P3OA 3K92A 1SCAA 5FWNA 4QUAA 1GQYA 4QBFA 2HREA 5BSEA 5IC4A 2YWJA 4C14A 4CLHA 1XTVA 2YYSA 5I4IA 2WIBA 4KOAA 4I99A 1E0SA 3FDXA 4K2HA 1D1PA 3MJ4A 5CH3A 3UMCA 4AIIA 3GJZA 4D9NA 4CIYA 4P75C 2A57A 4FI3F 4FT4A 3SYNA 3EFHA 2QSYA 2CJWB 3B48A 3QLVC 1IN7A 1R0RE 2CLCX 3P4UA 4GKKB 2J9ZB 3PHLA 1OMOA 2V7TA 3BXFA 2KX7A 4WERA 1RBZA 2L17A 3IDZA 4YDSA 4RU1A 1TB4A 4INAA 3PSHA 2WJHA 5ALSA 5J5AA 4DV1B 3EJ6A 4OLJA 1W85B 4WZAB 1T0JB 3I53A 5CVVA 1SQ5A 2VJOA 5GJVC 4B73A 3ZWBA 4MIYA 3JASB 4PPYA 3ZWDA 5LQDA 2BBTA 3NBZC 4ASUA 1TU3A 4ZVSA 1YZVA 4ES6A 2HEGA 3EMDA 4AKIA 1KS2A 1P8AA 1OHHD 1P9OA 1X7HA 1RIQA 4GEKA 2HBRA 4EPWA 1RMQA 3GNTA 2YYYA 3L1IA 4C7JA 2PX2A 4B0OA 1LQUA 4Z54A 2NOAA 1AMNA 1JE1A 3AM3A 3DBVO 3W05A 1KEPA 2W83A 2ZJ1A 3E9MA 1F2TB 3RTDA 1IPHA 1JDPA 3SX0A 1XTQA 3PPWA 4J29A 1UDAA 3PWKA 1H2FA 4ZODA 2B7BA 1EFHA 1QAMA 1XFDA 2OTCA 3GARA 4Z0TA 1TD1A 4TPKA 2P35A 5IDVA 3PI6A 2G17A 2VHYA 2H1HA 1QX3A 1YRYE 2ANBA 4GECA 3V1UA 1NX9A 1M76A 4LJ4A 3AVUA 2Y1FA 4UD2A 2YZ7A 1GAJA 2ZUFA 2ZITA 3KCQA 1PZMA 3QZUA 1US8B 4FYVA 3UCXA 1Y3FE 2IYVA 2DBZA 2CCKA 1EUCA 1JG1A 1X19A 3JWPA 3IUBA 3MTQA 3QI2A 4KDRA 2G3YA 2VBIA 5A6SA 5DW0A 4IHJB 1N75A 1VPVA 5ICMA 1XZFA 2BFBA 2OO7A 1N34B 1HWYA 1CRLA 1QKKA 2FR8A 2HSZA 4R8LA 4TMFA 1Q14A 3ICCA 5NULA 5P8WA 4BFVA 4D6XA 5JWOA 2OHGA 1DTWB 3HCAA 4JLVA 4JQYA 5K0TA 3KKEA 4N8SA 1VYUA 2GZ3A 2WUDA 4JOBA 5EWMB 5CB4F 2I33A 3UQYS 5EKDA 4KQKA 3EH2A 3CO0S 5EOVA 3F9IA 4WZBE 1NI4B 3PCRB 4URVR 2XOKA 3W5VA 3OOHA 3B1VA 5EP3A 1Y42X 3AUFA 1Z5UA 2VLIA 3DMHA 4OH1A 1N92A 3ULKA 4OSOA 4QG3A 3QG1A 4OAPA 2YIDA 4PC6A 1RWBA 3V1MA 3JQAA 2FLKA 2JBAB 3AEKA 1QVWA 4Z6KA 2O3UA 2EAYA 1KEZA 3GN1A 3BWEA 4U63A 5IC6A 1JIQA 1BDMA 1FL9A 4R3NA 2BR5A 4V0MA 4Q3OA 3NM5A 5KPDA 3WV4A 1QUEA 3DEZA 5H3HA 4YJ3F 5F2KA 5BQOA 1CJCA 2GNPA 3ZN2A 2YHSA 2BGJA 2DU8A 4XVRA 1XVIA 2QB5A 3H1AA 1SCJA 4EG3A 1XMIA 4EEXA 3ZU3A 4RLSA 3RTBA 4YRSA 1J8VA 4BV8A 1HBJA 4K1LA 3OE7D 5CFPA 5BQ5A 5DN6A 1LLDA 1XCGB 1ZUNA 3OFKA 1B0UA 1FC0A 2QRNA 1E1RA 4JP5A 2O7QA 1EP1B 1VIDA 2XCOA 3EZ2A 3V00A 1UJ4A 1E3JA 1PQPA 2H2DA 4MKIA 4OKIA 5DT2A 4AKGA 1O94A 3BGIA 3KLNA 3I64A 3L8DA 3WGVA 1UMDB 1ORHA 1JDJA 1U2GC 3LC1O 1D2RA 3FWHA 4TKZA 1XLTC 4H27A 4LOHA 3VU8A 4J16A 1KDYA 1I7QB 4KR3A 2WHYA 3X1YA 2D2XA 3L7KA 4HYQA 1Z4JA 3QYFA 2GBFA 4PZDA 1E5TA 3COVA 2JK1A 2Q6TA 3KSDO 4YCSA 3RYCA 2XUJA 4BVEA 1X2BA 3DE4X 4FC6A 1HRDA 3D4BA 5JNTA 2G5GX 2PBLA 5KJ1A 2BGUA 4Q6GA 2AX3A 3JWIA 1COZA 4G81A 4LZLA 3TW6A 2B21A 4JZYA 4BBAA 2BCGY 4EW2A 3LUAA 3TMAA 3KXPA 2QRKA 2H7XA 4GLJA 1GFWA 2ZCJA 3HU3A 3MWFA 2RI6A 5AW5A 3NTVA 4YV0A 3HFGA 3QELA 4JI1B 2PUHA 4LGYA 4ZIBA 1PDWA 1DO8A 3NWBA 3OZSA 1N0WA 5MN4A 3QUCA 1OKKD 3NM6B 2AOWA 2AR0A 1TVMA 2HO4A 4K9QA 2WRZA 4RESA 4UUBA 5C8YA 3SIWA 3C1OA 1HYGA 1TM4E 4GWLA 5KCMA 2H4YA 4W4TA 4QTXA 3IP1A 1T36A 5AJHA 2MSWA 4ZV7A 3EPJA 3UJNA 1E1MA 2PGNA 3L0PA 1M2OA 4JLBA 4KRGA 4BECA 4E94A 1X56A 5A04A 3A74A 1U6IA 1I4TD 4W82A 3PPYA 1EUDB 2NUPA 3UUEA 5AO9A 2K2WA 4PINA 3PNLA 4N65A 3IODA 2ZWMA 2VLBA 2R8ZA 3BA6A 1AS3A 4IV8A 3W9BA 2V6IA 4IOLA 3ZTWA 1V6AA 3SXUB 3ZI7A 4EY8A 1YBAA 4RPIA 1ZW6A 4FWTA 3R9KA 4FFLA 1IC6A 4QJIA 5JCJA 4EYGA 3PF9A 5LQCA 2FEPA 4ID3A 1VSVA 4LQ4A 2C0QA 3D43A 4U6SA 3S44A 1KORA 1DXYA 2DVEA 2J3HA 3EODA 2DDZA 2REOA 4KO1S 1L2TA 3L8CA 5E3IA 3OD5A 5HQ3A 2NUAA 1G0NA 3AY3A 3EY4A 1Z5VA 2I29A 3D7KA 4G9EA 4BQSA 2C5LA 4E2WA 3ICVA 3HABA 3U4MA 2O0MA 5AD1A 4MB6A 4ENWA 1T3LA 5ADVA 4E1VA 4PC2A 4A6XA 1MVOA 2BFNA 2P8JA 5AJVB 2IZZA 4KXUA 1I2AA 3S70A 2VP9A 1E8MA 1YWGO 2HJGA 2B5OA 3PRJA 2YNMA 1FDIA 4Z9AA 5EIFA 3SQLA 1NZJA 1QE0A 5EXDA 5B7PA 4YIHA 1ECFA 2C5GA 4J7AA 2WJVA 4B44A 4K0KB 5C8DA 3SXUA 3THXA 1EHCA 3WFJA 5AICA 1LZKA 2IXEA 1W0KA 1OOEA 1ZCFA 1F17A 3D6NB 3SYMA 4B8ZA 4P32A 4W5HA 1KY4A 4DN6A 3OM1A 1Z2NX 2DTOA 3HVJA 3UHOA 1GQRA 5FEMA 2EF0A 2QL9A 1U3DA 2CGEA 3C5CA 3LC0A 1WNFA 3W5UA 3ZVNA 1XVAA 1GQOA 2HCTA 1C7RA 4FP9A 4Z1OA 3OJXA 5BV0A 1PUIA 1SXJB 3W9SA 4X66B 1N32B 4N7RA 1WCYA 2JJ2A 2P9EA 3BB3A 1T9HA 3D2AA 3N0WA 2AV6A 4G0MA 4DR3B 2J0UB 5BT9A 3PFHA 5HKKD 4KQCA 1WVIA 4MP6A 1PNRA 1UKEA 2QP9X 4CQMA 5C5IA 4IDFA 4JYBA 2PH3A 1KARA 5D86A 3Q2OA 3UWSA 4BGIA 2IHZA 2DH5A 4LUCA 3CF4A 3HA7A 1VMKA 3LC7O 3QUSA 3H1TA 4RL6A 1T10A 5IBQA 5IYZF 3RJTA 3REQA 4B46A 2PRYA 3IOEA 3RS7A 2GK3A 4EGJA 1A5SB 4WPGA 5B53A 4D82A 2JFGA 4RTPA 1JIXA 1L7MA 3TPFA 1DRUA 3NUGA 4RDHA 4V38A 4ZJPA 4DREA 4MQFB 1JR2A 4ANFA 4CG3A 1FNNA 1U8UA 3UMJA 3G2IA 2V7WA 4CTKA 2HA7A 1QIFA 5HNKA 1ZK0A 3LGXA 3A31A 1RSZA 2XW6A 3OCJA 2G1KA 4NYJR 4XPZA 3I62A 4MUYA 2PRJA 2GRJA 5HA5A 4H0NA 1WDLA 4XIGS 2L19A 1SOAA 2B1QA 3BH7A 4ZRNA 1C8LA 5P21A 3DV2A 3UAZA 3ZE0B 5L4LA 1O89A 4PQFA 4D99A 2V7PA 4K9RA 4NBLA 5E7MA 2QENA 2QLBA 1E1CB 2E4AA 2ONKA 5H59A 4QPNA 3GFOA 4BC1A 2IZ1A 1RCUA 2DU7A 4P7BA 4OLFA 4QJBA 1UP4A 1U8AA 4MGEA 4KQJA 2QMZA 1J39A 2WVHA 3E7FA 2WKQA 1HEIA 3LCVB 4R40A 2IYEA 3I61A 2HMYB 1AC5A 4Z7QB 3WLTA 4NBTA 4NWIA 3LHSA 5GONA 4AS1A 1QG2A 3ANMA 1P0QA 2ZYGA 3FLBA 1KJQA 1RIFA 4G1MB 4YYEA 3HDTA 3QVTA 4UM5A 4P74C 5DFAA 5FL7D 5U4XA 5AHXA 3VDMA 4B3BA 3JQAB 3LOUA 4TL6A 1B1AA 1P72A 3T38A 4IMRA 3DOFA 1GPH1 3BULA 1GVHA 2JZNA 3ZJUA 3OX1A 1W5TA 2HF7A 3Q41A 1E94E 4H1VA 4RVHA 4GRAA 2FFRA 2BGLA 3JQPA 3ESZA 1TVKA 1OTXA 2RGCA 3UOGA 1A82A 3D3NA 5FA8A 3U4IA 1ZRMA 2M2IA 5GMOA 1PKEA 2A1UA 1V5GA 3DQPA 4GMFA 4LNHA 1A9TA 3L7OA 1FU7A 4PYMA 3USES 2WD8A 4BWVA 5JI2E 4F3TA 3RSGA 2QHSA 2GB4A 2PYDA 3A4YA 2ZS8A 3PL5A 1UM9B 2HW8A 5JFTA 4W5RA 1Q22A 3S99A 2RC5A 2CSUA 4LNUA 2JAWA 2C3UA 5FOWA 1L4UA 4ZI7A 2QZJA 1E9EA 1FSZA 3EBPA 2B1IA 1ZZEA 2G1JA 1O54A 1ODLA 2QL6A 4N41A 3LG2A 4RENA 1FYFA 1FCJA 2D5AA 3N70A 3W2IA 1SVIA 2HIGA 1ISRA 3AJDA 1GCGA 2H9IA 4OFBA 1N4AA 4HAVA 2HQOA 3JSAA 1TLFA 4XQGA 1F9EA 3WGMA 2FNAA 4ZMRA 5JAZA 1ESMA 2XE7A 3UT5B 1EH5A 2IOQA 3HO8A 3PQ5A 3WGOA 5JNVA 4MS4A 1ECBA 2P6MA 4KR0A 3N2EA 4Y2YA 1NWHA 1L5ZA 2Q3CA 2XUHA 5DM4A 3SSOA 2C0CA 3TQIA 1AGYA 3U4CA 4Z4FA 2J1LA 1UC5B 4TYNA 4ZZ0A 3RC2A 3DYBA 1C5KA 3ZXYA 3T7RA 3H2IA 4JA0A 2BZ0A 1TTTA 6REQA 4AWBA 4JU9A 5IT4A 1UDXA 3N2IA 3JYHA 1T2NA 2WV9A 5IZ4A 1MB0A 3OOEA 3VSDA 2FUNB 2JFXA 3T5TA 1TO6A 1Y3HA 4IFBA 4DDHA 3OT1A 3ADDA 1HNWB 1KE2A 5COAA 3O0TA 3MTEA 3D7RA 1IZZA 3B1KA 3E27A 3NANA 2X9VA 4NEGA 4KN5A 1X74A 1WXXA 1RT9A 2WW8A 2Q9AA 2XVAA 4C89A 2XXJA 1Q12A 1P44A 3TW0A 2GAJA 2E3CA 3DL0A 5J63A 3BORA 2R66A 1FFYA 3RGGA 4LOKA 1B74A 3G2QA 4BTLA 1GPJA 2AJBA 3L8FA 3UMSA 5A7FA 4PXAA 5HHTA 2FPKA 3V8LA 3QXSA 1YZNA 2IDZA 2OD9A 3A7RA 3BFVA 3KQPA 4H6WA 4I9NA 4EVIA 4MLDA 3HBNA 2OPHA 4KB5A 3OFND 4MGZR 5EIOA 1FFHA 1LK7A 4TUYF 3LJKA 1ZUWA 1XZPA 2HX1A 2BDTA 4JSRA 4IIDA 4KXFB 1SBZA 4GFDA 4YJFB 3OU2A 4NEHB 4RD4A 3R9XB 2PA0A 2QLJA 3GEMA 2NU6B 4MDEA 3BMNA 1MENA 3AZQA 4IHJA 1B8VA 3W9YA 4YRTA 3F6RA 4KH1A 1H2XA 2JGRA 4JJ4A 1EVKA 2UZIR 3I28A 1EUCB 3M4JA 5FNVA 4DF3A 5B6IA 1VPEA 4GI7A 4FBMA 4I1RA 4YAKA 4RPLA 4YRLA 1FBNA 1P9NA 3FUVA 3U6KA 3H8SA 1AU9A 1XELA 3BHIA 4ZJZA 2UUOA 1WXIA 3LUJA 3QUQA 3CLRC 3QVOA 2Q1XA 4PSAA 1WB9A 1OI2A 1QCYA 3UAXA 4GKAA 4MULA 3JYOA 1B2RA 1RADA 1TQ4A 2RHCA 4JT4A 5TXGA 1BA3A 1IAVA 1NI5A 2C9YA 2GK7A 4OP0A 2OFOA 1JHUA 2W2TA 3BC1A 1XQVA 3DC7A 3MMNA 4OG2A 4EX7A 4EUNA 2CUNA 4AF7A 3IMKA 1KHTA 5AOBA 2EF1A 1MKYA 1KEKA 4WLEA 2V5AA 3IQIX 1GNVA 1SN7A 3KHSA 5F52A 1V3VA 4TQ9A 4HPWA 5C8YB 5HBRA 4KK4A 5HGXA 1Z2OX 1X39A 2M1ZA 5J2TA 5J4YA 2KB0A 1RHJA 4IIXA 3JQQA 1UKBA 1WMEA 3BWVA 4KLNA 1RKXA 4D44A 1J8QA 5IT9A 1OXSC 3R3VA 3R6LA 1K5GA 1OBVA 2UYQA 2VQ3A 3RC9A 3WNCA 1RLTA 3AHIA 1CJUC 4PIMA 1BHQ1 3BQNB 5C34B 2OY0A 1M8GA 3PI7A 4CU5A 3GLHB 1SEPA 3HXKA 4LXYA 5AKGA 1TYDE 3RU3A 4H2YA 2ONZA 4DPMA 5CU7A 5C52B 3IT0A 4BY9E 1T5LA 4N0PA 3I2HA 2P78A 4RV4A 3NH6A 4M9UA 4UBJA 2JHCA 3BXZA 3RU2A 2WYHA 1JWAB 1JX6A 1RKUA 3BN3A 3C8DA 1NG1A 3ZX4A 2OORC 4DNOA 2F9FA 3M6UA 3FOZA 4HMPA 3GLFB 2N9UA 5PNTA 4QBKA 1USVA 5IZCC 1YR8A 3JYPA 4YP1A 3EFEA 1KVRA 3JALA 1PZXA 3AEZA 1EDEA 2ZB7A 2ZYWX 3NYRA 2IYYA 2V3VA 4RZ2A 3ZH9B 4D3FA 4D3SA 4CKCB 4WNAB 1ITZA 3S8EA 2I8LA 2NYUA 3KR9A 1GQQA 4FCTA 4F4DA 1EVLA 3WAKA 3M2PA 3PTLA 3RS5A 3GWZA 1GPBA 4KYUA 2O8NA 1DOAA 5LZ4A 1P7YA 3AG5A 5CX4A 2XZTA 5A02A 4B09A 4F5ZA 3RU9A 2NUTB 1FP6A 3KJHA 2Z58A 3HXLA 2YQZA 2J3DA 3R23A 3TEJA 1XCPA 3BH6A 2GOYA 3DBRA 4QQKA 4AG3A 3JWGA 3E22A 4NQRA 5E7JA 3P2YA 3TZ6A 4QXOA 1AMUA 3IQWA 2MYUA 3WISA 2VYND 3DP9A 3FMPB 4V02A 1QQ5A 3NWEA 3EUWA 5F9HA 2BM1A 2I66A 3CJRA 3I9V6 3GW8A 1QC5B 4PWYA 1ZCBA 4Q12A 1DIGA 4K28A 1QDEA 2FMIA 4ED9A 5B7NA 5CFZA 2LUOA 5KVCA 1JQBA 1PS8A 1QHYA 4DSAA 2OCGA 4QD3A 4IOJA 3IOYA 1PVOA 1A9XB 3NJRA 1WRBA 4Y2RA 3W2HA 4EYQA 4CH6A 5EMJA 1VCHA 5FUWA 4DAOA 5EWMA 3U3JA 2HGZA 3RAGA 2Q7DA 1Y8RA 2BBWA 3QNWA 4JELA 4XVQA 1QM5A 2ZS9A 4R8KA 3W7AA 3HY3A 3K16A 1VLVA 1F8XA 4PLWA 1OX4B 3FTNA 4YDRA 1WPQA 3NRBA 2C3YA 2P30A 5G0UA 3WK8A 1G38A 1J22A 1KL7A 1U0FA 1I33A 3WGTA 2HYIC 3OC0A 1LDYA 2DAPA 5FO1A 3MJDA 2O6HA 5KUTA 2ZAIA 2CVZA 2Y05A 5CM8B 1P1JA 2ANCA 1EX1A 3OPXA 3PTZA 4JHLA 1VMDA 4PSUA 5AIAA 4L8WB 2IWRA 3DVRX 5ALVA 2RKBA 3CX7A 1IZ9A 2P1DA 4HDCA 1GPNA 4DQDA 1GEGA 4C2TA 1UBOS 2VDUE 1EM8A 1YGPA 3AIOA 1XK6A 3COZA 4MVJH 4MV4A 3VVBA 4JJFA 3W8FA 3V4RA 4A0RA 2DPXA 2GO7A 3F71A 3FUXA 3K5IA 3PPXA 4IQ0A 3SAJA 2O8EB 1BC5A 1BEZA 3EZNA 4PG7A 4PV7A 2WF9A 1AUPA 4QDXA 4Q1EA 3K6SA 2WLTA 3OTWA 2J3JA 3PNMA 1WNLA 2G4VA 2E1RA 4QFBA 2SHKA 5K3SA 3UT5A 3AB3A 3T3IA 3ASZA 3LX5A 3QBTA 2IS2A 4MVCA 4TROA 4NG4A 3AILA 3KKPA 1TAQA 1VYTA 1BEEA 3EF0A 3DBHA 3OEED 1NXTA 4J03A 4OBXA 2JLZA 2HBZA 1H6AA 2P9FA 3ESCA 2ZYHA 5AW1A 5I7SA 3Q8KA 2C78A 2PEZA 3G9XA 4C6TA 3R44A 1QBKC 2GJ8A 3NHWA 3R7BA 3RIXA 4BRUA 4HX9A 4EHLA 4RBNA 4ETNA 5IBRA 2GNAA 3Q87B 2GEJA 3DMDA 4P4UA 2WSLA 4RKEA 1BHSA 3ZQJA 1QJ4A 3REQB 1IEWA 2X4DA 4MI9A 4BFCA 3V1LA 2ORIA 2PQ2A 4KSBA 2H2FA 3OKCA 2XVXA 3WJAA 1CB0A 1GZ4A 1IOLA 4PRKA 3R7SA 1MC1A 1NC3A 1NVUQ 1VPLA 1ML3A 1T8PA 3W4JA 1M66A 5ELMA 5TQ0B 1D1QA 4NBRA 3UGJA 2ORWA 3BFKA 3O4FA 4X8OA 4YT4A 1SBHA 4UTRA 2Y4OA 4I55A 2FUG6 2NSYA 3NHBA 3DV9A 3FFTA 2OD2A 4AS3A 3AB7A 5JQGB 1WOMA 4YAUA 1Y8QA 4L27A 4OX9B 1XEWY 4YMIA 2BRUC 3DHWC 3SJ7A 3EASA 4CMGA 5DPMA 3O03A 3FBGA 5KYWB 4YJGA 3IMEA 1UOPA 4HDOB 2FFJA 1XE3A 1KJYA 2WD9A 3AF1A 3MCUA 1GITA 3SFZA 5L7TA 1Z3CA 1IY0A 5JWRA 5LMZA 3EPLA 4UOZA 3LBAA 4NK4A 1WCIA 4NZNA 3NAMA 5IM4F 1KMHA 3HUFA 1AGNA 3FDFA 4CM9A 1P1RA 2G5PA 3B70A 1M2VA 4YAEA 2Z1DA 3BRWA 1Y81A 3LXUX 4JQCA 1X7WB 4XD7D 1G9SA 4G0PA 1RU3A 3OZWA 4FVTA 1H2HA 4KQMA 4B85A 1E1CA 2QQEA 3RUFA 5K01A 2NWQA 3LK6A 4GXQA 5L6MB 4BQFA 3VYUB 2RH4A 1XL1A 3PR2B 1N9ZA 4Y9DA 3SYRA 3L4JA 4CLEA 3LVFO 1MQSA 3FIUA 4WA8A 1JN0A 2W8BB 2QAGA 2D54A 1DMSA 2XD4A 4Y6RA 3PUHA 4WOBA 3H9UA 1DFGA 3JQRA 3AL0C 4MNTA 2WG2A 1QC5A 2CNNA 4O2RA 2XYQA 4IR7A 4OK3A 1L5HB 4XYMA 4QAQA 4JX8A 3QUBA 2WY2D 2FMUA 1DQNA 3LHIA 4LI0A 5KQLA