4ZU7A

X-ray structure if the qdta 3,4-ketoisomerase from thermoanaerobacterium thermosaccharolyticum, double mutant y17r/r97h, in complex with tdp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
MLYNVALIKFKDIADKRGHLTPIEGKIDIPFDIKRVYYITKVDKDITRGYHSHKKLHQVLICLNGSVKIRLKIPDEEKIIELNDPSVGLYIGPLVWHEMFDFTEGCVLLVLASEYYDETDYIRNYDFYIDEAKKRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial Sugar 3,4-Ketoisomerases: Structural Insight into Product Stereochemistry.
pubmed doi rcsb
source organism Thermoanaerobacterium thermosaccharolyticum
molecule tags Isomerase
molecule keywords QdtA
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4zu7A00
2H6CA 3RZZA 3CJXA 3G7DA 4XFGA 1NXMA 4HLTA 5KHKA 4PJYA 4CYDA 3D82A 4R52A 4I0BA 3S0MA 4HMZA 4LUMA 3UKVA 3BPZA 3MYXA 3E97A 4AXOA 2QVSB 2VECA 3C3VA 4WVZA 4I3PA 4BH9A 3PLQA 3RNSA 1NE6A 4O9EA 4B29A 4FAHA 4YRDA 4IEQA 5C6CA 2BGCA 1WA4A 2IXIA 1UD1A 2ET7A 2GU9A 4Q0QA 1ZRRA 1YFWA 4JV4A 4XFIA 4AVBA 4F8AA 1RUNA 5I0UA 2PHLA 3FWEA 1I5ZA 3CEWA 3WW1A 2FQPA 3O14A 4IEPA 4E2SA 2ATFA 4X6QB 1UW8A 3FE5A 1IPKA 4I01A 1ZX5A 2GC1A 3MPBA 4JVAA 4H7LA 3TNPB 4HSLA 4FBFA 3OGJA 4LLOA 4XF0A 1ZREA 3ES4A 2UY9A 4UBHA 3RDIA 3L2HA 1WLTA 3SCGA 5I0SA 4IEYA 1Q3EA 4QXKA 4AQ2A 4F7ZA 4XFBA 4UXAA 4MUVA 2GZWA 4TLFA 5C8WA 1CAXA 1ZZ7A 5JAXA 1QXRA 4XF3A 2IC1A 4LA2A 4R8HA 1OFNA 1NE4A 1O3SA 3RPQA 5EZWA 1CAWA 3EQEA 2XL7A 4MX3A 2GAUA 4EV0A 3H1WA 2PHDA 1XE8A 4XFFA 2IXKA 1VJ2A 4IETA 3U11A 3ELNA 1J59A 1SEFA 4NVPA 4Q0SA 3ETQA 3SCHA 5E1RA 3LA3A 1ZVFA 3BU7A 3WW4A 2BNOA 4J1XA 5I93A 3I59A 1YLLA 4META 2XHKA 3WW3A 2VQAA 3SMHA 4MGKE 5FQ0B 1O3TA 1FI2A 2GC3A 5LRRA 4BYYA 5FLIA 3UKTA 1VP6A 3NSTA 1PMIA 2B5HA 4QX5A 2DCTA 2GH2A 3HT2A 4EWEA 5LEKA 3M70A 4A2UA 3U10A 1RUOA 4QGMA 2BYVE 5FLJA 1EY2A 4HN1A 4WZCA 4QM8A 1Q5OA 2OZJA 2FMYA 3LA2A 4KL1A 2Q0AA 3KGLA 4LA3A 2PAMA 4Z07A 4QM9A 3PNAA 1GQGA 3SXWA 3E5XA 1FT9A 2ET1A 4IEUA 3B02A 4MH0E 4N9HA 3KSCA 2IXCA 4JTOA 4YSFA 2HJIA 1LKNA 3H8UA 1O7FA 1J58A 4QGNA 3LA7A 3IWZA 4HVRA 3HQXA 4KU8A 4ZU4A 3IDBB 5JSPA 5LRSA 3SHRA 2D40A 4HZFA 5JR7B 4ZU5A 3USSA 3ACLA 4D7TA 4PIZA 4RD7A 1EYBA 1CGPA 3D0SA 3GYDA 1VR3A 3EBRA 3OTFA 2PFWA 2MNGA 4XF9A 1RTVA 2Z2SB 4EWAA 3R6SA 3ROUA 2O1QA 1YHFA 4QGLA 4IEVA 1J3QA 3KCCA 1ZZCA 1L3JA 1ZZ8A 2H6BA 1CAWB 1YWKA 3S7IA 4L2NA 3FFQA 5K8SA 2BEOA 1DZRA 2UYAA 4O9GA 1ZNPA 3DL3A 5KHHA 3PVBB 4HSJA 1H1IA 2XLFA 5KHGA 2ETEA 5J48A 4PIYA 3M3IA 3SCFA 5KHJA 1CX4A 3I54A 3LOIA 3ES1A 3BB6A 1X8EA 4XFAA 1O4TA 1GQHA 2KXLA 4ONUA 2I45A 5FCCA 5J7MA 1EP0A 4N9IA 4ORFA 3HIFA 5JCTA 1Q43A 3DKWA 4K8FA 1UIKA 1OMIA 4P9GA 4X6RB 5BXXA 2XGXA 3E5UA 4HVOA 1XE7A 2D93A 2IXLA 3FJSA 1V70A 2MPFA 4LEJA 1LR5A 4XF1A 2PTMA 4GULA 1PM7A 1CAUB 4UBGA 4IEXA 2OA2A 1X7NA 2HKXA 3RYKA 3MZHA 1Y3TA 4AQ6A 5I8YA 4I02A 1Y9QA 3NL1A 1JUHA 3CF6E 4EROA 4IERA 1J1LA 1OI6A 5BUVA 1CAXB 4I09A 5FLHA 3TNQA 2Q30A 1LB2A 3CL1A 3LAGA 1NYWA 2BNMA 3OD0A 1QWRA 2ZCWA 4BHPA 2C0ZA 5I8TA 2XLGA 3E6BA 2QNKA 3BCWA 2MHFA 4L11A 4XF4A 1X82A 3N4MA 2O8QA 1OD5A 1UIJA 3H50A 1X8MA 4EWDA 2OPKA 3H3UA 3EJKA 5I0TA 4AVCA 1IPJA 1CAVA 4MGIE 3ZDSA 2PAKA 1J3RA 2BNNA 4MV2A 3UKNA 3CO2A 5CU1A 5EFUA 1YFUA 4FAGA 5BV6A 3DV8A 1G6NA 4XETA 4I2OA 2D5FA 1U12A 3LWCA 4XFHA 5T3NA 3IBMA 5I8SA 5LEJA 1CAUA 1WGPA 3JZVA 3IDCB 4XFCA 3H7JA 2V09A 2K0GA 4LTAA 5FDBA 2D5HA 4Q0PA 1O5UA 3D0JA 2Q1ZB 3FHIB 4IESA 5CVRA 2EAAA 2XL9A 4QMAA 2ZKLA 3U0ZA 2CV6A 2EVXA 1RC6A 5JSRA 4MGYE 4HVQA 1YFYA 5FQ0A 5E16A 1H1MA 4AVAA 2VPVA 5J3UA 1FXZA 5HI0A 4XEZA 2CAUA 1HW5A 3H1YA 3H1MA 5AVPA 1UPIA 2PA7A 1TQ5A 1DGRA 3NVCA 2IXJA 4HN0A 4LUKA 3H9AA 1ZZ9A 1CAVB 4HBNA 1YFXA 2XLAA 1UCXA 2XKPA 1RGSA 4KU7A 4E2QA 3QACA 2XKOA 2N7GA 3I7DA 1NZCA 1SFNA 1O3RA 1ZRDA 2WC2A 3RYPA 2Q4SA 3CLPA 3BALA 1J3PA 4MZUA 3RYRA 4Z82A 3FX3A 2QJVA 2PQQA 4OLLA 2IXHA 3E6DA 2QDRA 4YARA 2WFPA 2CAVA 1O5LA 2OYZA 2GC2A 4YYOA 4KWKA 5I0RA 1QY4A 3H3ZA 3EO6A 5BPXA 5CADA 1ZZ6A 2B8MA 4IEOA 4Q0VA 3I59B 5D1IA 3EHKA 4PIXA 3S7EA 4LULA 2QCSB 3WW2A 3GBFA 3NJZA 5F1RA 1ZRFA 2GC0A 4WBBA 4J1WA 2B9UA 3E5QA 2EA7A 3ST7A 1EPZA 3LZZA 1RL3A 1ZZBA 2CGPA 2E9QA 3E6CC 5FPXA 2K9ZA 3H7YA 3KGZA 5BY5A 3DN7A 4Q0UA 1DZTA 3IIAA 4Q29A 4KWLA 3OCPA 3VHRA 5FPZA 4E2GA 1QXJA 2Z69A 1O3QA 4YNIA 3NKTA 1I6XA 2F4PA 2PAEA 4DINB 3FZ3A 1DGWA 3KMHA 3NW4A 1ZRCA 4ZU7A 5KHIA 4KWJA 4IEZA 1SQ4A 4I0AA 2UY8A 4BIFA 1LRHA 5KBFA 2PYTA 3MDPA 1XRUA 2UYBA 2P17A 5JSOA 4FT8A 3HT1A 4IEWA 1YUDA 4JTNA 2Y0OA 4OFGA 3OF1A 5I91A 2OZ6A 4MGZE 2H0VA 4D7SA 3QOPA
chains in the Genus database with same CATH superfamily
1O59A 4ASMB 4XFGA 2DCZA 3A21A 4CDUA 1NCQA 1S0FA 3J8F3 1NXMA 1ULDA 3Q8BA 5F5IA 1YQ2A 1UN1A 3WOGA 2EXIA 2VZUA 2W9XA 1IZ3A 2WYSA 4W6WA 3AKRA 2ZGMA 1GNYA 4I0BA 2AACA 2WBKA 3VB9A 3V64A 1R093 1IQAA 3UKVA 4HKWA 5F9TA 2JWPA 1LGNA 4QPGC 4NRMA 5CFDB 4AXOA 3W59A 5GZEA 1O6UA 1OA3A 1OQ1A 3KV4A 1PX4A 4O9EA 4Y3OA 1S55A 1Q8VA 4B29A 4FAHA 1FX5A 4LORA 1BK0A 1VBE2 3O1TA 5JZGA 3NNFA 4W65A 1POQA 1MS5A 3TN92 2X10A 3POYA 2EALA 5FP4A 3SH5A 2AEZA 1R091 3BTXA 2SBAA 4DEQA 2B7YA 5JXIA 2YPDA 2WA4A 3PIJA 5GJ6A 3CEWA 1AR82 3N9LA 4XVHA 5EPAA 4O65A 1FV3A 2NMOA 2WNUB 1JZ4A 2R49A 1R083 4BCUA 4X6QB 1UW8A 4BWOA 1VAVA 3FE5A 2WWJA 4IE0A 3CMGA 3WZ1A 2BTVC 5FZ0A 1ZX5A 2QQUA 3AKSA 2XOMA 2WR9A 4FPOB 4GXLA 1OF3A 2EIDA 2ID4A 4NR1A 2SLIA 5FP3A 2CSGA 3OPTA 4FTBA 5E88A 1PGL2 4IE4A 4FBFA 4G4FA 4OI1A 4LLOA 3MF9A 5EIYB 2ZMNA 1QJU3 2B9VA 2OS2A 3VKFC 3WG1A 4FTEA 2FCUA 4C1WA 3RDIA 5LASA 2BBAA 3V0AB 3JQXA 4LO4B 1HX6A 4MXWA 4IEYA 5FWJA 4QXKA 2CTVA 2JE9A 3CHXA 4FQ4A 4LK7A 3OGRA 2YGLA 4XFBA 5CFDC 5FZHA 3RSJA 3WP4A 3AZVA 4B4RA 2GZWA 2VZPA 4R9CA 3T09A 1Y9GA 5KXEA 1RUE1 3WF0A 1XB9A 2QFEA 1RUE2 3VBSA 4IE6A 4OULA 5D2AA 1MEC3 1F2NA 2HWC3 1EAH1 1JHNA 4LA2A 4Y1XA 1OFNA 1K5JA 4OMDA 5IVCA 3AJZA 1UMHA 3RPQA 2ZHMA 4EZHA 4NIHA 1AUYA 2XL7A 1ULCA 1JOBA 3RMYA 3AM2A 4EE2A 2GAUA 5IVBA 3MIBA 4XFFA 3RGBA 3HNYM 4IETA 3U11A 1J59A 1REDA 5J1XA 3N9PA 5CA6A 4Q0SA 2JENA 5T5PA 4CEWA 3MI8A 4X8NA 3T2PA 2JKBA 4GA9A 4P08A 4A6SA 4LO8A 2WLQA 1QGLA 3ZOIA 3C8XA 1UXZA 3MGUA 4PLMA 4JQTA 4UW6A 2D3SA 4XMAA 3SH3A 5FYSA 1V00A 3VBOC 2MEV3 1D4M2 3A22A 3NJYA 4YW6A 3DXUA 1TEIA 2HWF2 4RHV1 3NNLA 4Y1ZA 1SBDA 2RJ2A 5F8PA 1O3TA 1POV1 2W2IA 1QJU1 1FI2A 2GC3A 2IFWA 2A3YA 3R4SA 1M06G 4A3XA 2HWC1 4OUMA 4BYYA 1HXS2 4ZHNA 3ZVXA 3NAPB 4XACA 3VBFB 1HB4A 3KB5A 4IE7A 4LR4A 5C70A 3RZHA 4YPJA 1YI9A 2WA3A 2WWSA 3MFCA 4DFSA 2JD9A 5A7SA 3TN93 2WO3A 1UL9A 3U10A 3M8LA 4GWNA 4XBNA 1TVGA 4TYSA 4HOOA 4QGMA 5FKCA 3MIDA 5FZGA 4LBMA 5FLJA 5K4LA 1KRIA 1SPPB 5FZBA 4JGZA 4QM8A 1Q5OA 3LA2A 2FMYA 3IMNA 1GWKA 1TNFA 2WT0A 4KL1A 3RZJA 4LA3A 2PAMA 4DXSA 4QM9A 3OGVA 4XILA 2LTNA 3SXWA 4COZA 3E5XA 2R043 3PJQA 3POBA 3IB3A 4XDQA 3VHPA 4XMIA 2AZ5A 2ZMLA 1QHDA 1WLDA 4V2WA 4DUVA 4LE3A 4COUA 2P3YA 1MPXA 1QNYA 2WWUA 3D8CA 2ZAHA 1TME1 5FXZA 5LATA 1KS5A 1E5RA 4I0WB 1JU3A 4CVUA 3LA7A 4QQPA 4BB3A 4CEWB 5IUQA 3AP4A 1JW6A 3B9CA 4PQ9A 4JHZA 3WF1A 4D3WA 4IGQA 1MVQA 5JR7B 2EXKA 3P1IA 4XAAA 3AYCA 4QQHA 3SC7X 4OQ9A 1JYWA 2F17A 1EYBA 3MIFA 2ZEWA 4CP9A 1S0CA 1ZBA1 4AI2A 1UZWA 1TME3 2G9GA 3OTFA 3SQOA 4XF9A 4EWAA 2A6XA 5IWFA 3MIGA 4CDWB 3MV11 1YHFA 4QGLA 2HH9A 1J3QA 4QQ2A 4Q4W1 3UGHA 3PU8A 1L3JA 1H4HA 1ZZ8A 4Q4W2 1CAWB 1UZYA 1JZ3A 5C3SA 1YWKA 1JI6A 3S7IA 4MG2A 1VBA2 2LALA 3FFQA 2BEOA 4JDNA 2IZWA 4CEYC 5A1AA 5FZLA 2QQLA 2E32A 1L7LA 3AL5A 3KWVA 2FD8A 3JD73 1SPPA 2ORZA 3KV5A 3PVBB 5KHHA 4YVWC 2RS12 4CCNA 1ZBE2 2W68A 3NWKA 3I2KA 5DZEA 1QEXA 4OHZA 3N7KA 1WBFA 2JG8C 2A1XA 3T0BA 4IV3C 2QDNA 1C1FA 3LOIA 1FOD1 1QDOA 1SCRA 2A5ZA 4COWA 4CEWC 1RMU2 5JXGA 5DABA 2B39A 5M0TA 4QB1A 2Q1FA 3BIEA 1GZ9A 2YBSA 4EN6B 1AR71 1D2SA 1NQDA 5BNNA 4FXKB 2ZEXA 4UFHA 1Q43A 4Q27A 5AC91 1VBA1 1V6JA 2W95A 5A7QA 4RS5B 3UETA 4JC1A 2IFRA 4YVSB 3VHNA 4IUGA 3VBSC 2Y60A 3VD5A 5BNOA 2EIBA 1HRV2 1OMIA 4JDMA 4LOTA 4X6RB 2VM9A 4XQWA 5T52A 3RJRA 4A42A 5F3CA 4Q1PA 2BOJA 5J36A 3LD8A 3E5UA 2W39A 1SLAA 1JODA 1AXZA 4HVOA 4NAOA 1GLHA 2D93A 3FJSA 2XBO1 4C1XA 2ENRA 1P8JA 4XF1A 2PTMA 5LY2A 3THDA 3ZMOA 1GP4A 2OX0A 3IPVA 3O7OA 2XG3A 2RE9A 3FN9A 5EHDA 1VAKA 5D8AA 4UBGA 3ZN6B 2OA2A 2WS92 1CESA 4YVWA 3MZHA 5T54A 1Y3TA 1EAH2 3T1LA 3U1XA 1Y9QA 3NL1A 2VW1A 4PT6A 4EROA 2BGPA 3C7FA 1CAXB 3DPRB 5FLHA 1W9YA 4INDA 4CEYA 2BU9A 2Q30A 1PO12 3LAGA 1PVC3 3WCRA 3FUQA 3OD0A 3V56A 3L9JT 2CGNA 4PDWC 3M3EA 4Q1RA 5JWPA 4XXAA 3W20A 1K5MB 2AR6A 4RYDA 5C71A 1ASJ2 3E6BA 5DAPA 1JOPA 1S2BA 4A4AA 1J83A 3OSDA 1X82A 5FZOA 2O8QA 1OD5A 4Q4X3 4LJHA 3AYEA 3ZYPA 2CWMA 4Q26A 5FZ8A 3H3UA 4NHKA 3EJKA 3VDBA 3O1PA 1F4AA 4AVCA 2WNUA 1JZ2A 1D7PM 2R073 4IV1A 2WO2A 2NN8A 3LSDA 1UOJA 4OZXA 3UT0A 2DUOA 3CKHA 2VOVA 1XOYA 5FKBA 5FMDA 2C24A 4CE8A 2BZDA 4I3GA 4CDXB 4OHYA 3WF2A 3IAPA 2BVBA 2UWAA 2X8KA 3HNBM 5EFUA 3WHTA 4B1MA 3OEAA 3NAPA 3NJXA 3VBFA 1S0IA 2R32A 2FCTA 2VTFA 3IIIA 3KD4A 2QE3A 4CDUC 5J96B 5FP7A 2A73B 4AI9A 3VKMA 1U5YA 1PO23 1UZVA 2B45X 5IYYA 5I8SA 1S1AA 3N36A 1YIFA 3OGSA 2Z42A 5DAWA 3UJQA 3GJAA 3VZNA 4AI0A 5DUWA 2ZAAA 1OUXA 1DCSA 3M3OA 4AHXA 4JKMA 5FY1A 4QDQA 4LKFA 1E5IA 3HBZA 4P5YA 2VNOA 4XZUG 4Y1YA 1CQ9A 2V09A 3I3EA 5GLVA 1RJ7A 4LTAA 5FDBA 2FDIA 2Z4FA 1W8WA 4MYEA 4ZXEA 3BOWA 1O5UA 3ILNA 2Q8OA 2DVAA 5E8AA 5EQUA 5ABJA 2PMWB 3NV1A 3FUOA 4LBKA 1MACA 5F5CA 1JBCA 1X9PA 4IESA 1OA2A 3WNNA 4QKDA 2JDYA 2ZKLA 3IDAA 2CV6A 3KCXA 3I4IA 1AL21 4HVQA 4QU2A 1KD7A 5FPUA 4DY5A 1WW7A 2FCVA 2K46A 3VZOA 5FQ0A 2RMU1 2KR2A 1RUC3 1RITA 3J7HA 4CU8A 3Q8EA 5HI0A 1LULA 1F31A 1Z7S2 2ZACA 3K4DA 4XEZA 1Z7S1 3H1MA 3JBG3 2E6VA 3KS7A 4KG0A 3POIA 5FREA 4CDXC 5FK7A 2ZX3A 3C7OA 1GUIA 1MQTA 1UKRA 2IXJA 4XHXA 1GMMA 2VO5A 1TMF2 2YYOA 1N3OA 3H9AA 1ZZ9A 2Y6JA 5SV5A 3EXUA 1K12A 4HBNA 1QJY3 1YFXA 2OW4A 3HD8B 1BEV2 5LB6A 2VQTA 2Y6KA 1UCXA 3LDKA 1RGSA 4KU7A 4CUAA 3BTYA 5IJRA 2ILMA 1ZRDA 1YJKA 2Q4SA 2VCAA 1AVBA 3I3BA 3CIHA 1BBT3 3SLIA 3FX3A 3PVEA 3IMMA 3LF7A 2DCJA 4DNYA 1DQ0A 4QPGB 1T6BX 5FZKA 2PXJA 1ZBE3 4W8JA 1UF2C 1BMV2 1MEC2 1UYPA 2C6SA 1RUE3 2WNUC 2BBVA 1MZ5A 2ZGKA 1QNWA 5DAVA 1MZFA 2OYZA 1BJQA 3HNMA 4KWKA 4NAMA 5CFCB 3JBG1 3JBG2 4SBVA 1LCLA 5BPXA 5A6YA 2JIJA 1HLCA 3DF0A 4AI8A 4N7UA 5CADA 3TEWA 4AQTA 4IEOA 3POJA 4Q0VA 1AXKA 2YV8A 1AJOA 4PIXA 3O1UA 1HKDA 4LE4A 5FXWA 1NQJA 2BDRA 4KBBA 2VU9A 3ILRA 3I2GA 4H3WA 1BYHA 4DMIA 4DUWA 3CBNA 4C0HA 2DVBA 1DBNA 1XC6A 1SLLA 4CZSA 3WNKA 2JDAA 4Y26A 1KQRA 5IK7A 2EA7A 3BVCA 2WNEA 3JXSA 1NCRB 3ST7A 3O1OA 2CGPA 2CDPA 2DBIA 4EN0A 4BLIA 3BPSA 4XUOA 3ZFGC 3E6CC 4LOSA 1XE0A 3H7YA 2ZGOA 4IL7A 3D4KA 4Q0UA 4FPCA 1MS8A 1GWLA 1UZ0A 2X29A 3MW3A 4YG3A 3OBAA 3CNAA 3J4UH 1UQXA 1B35A 3FLPA 2HEYF 4RN5A 1V9U2 5D8AC 1RJ8A 3HWJA 1BKZA 4MXWB 4AFCA 1ENRA 4Y4YA 1OC1A 3UGFA 5EXOA 3IPVB 4RS5C 4ISQA 5FXVA 2DF7A 4FOVA 2ZBJA 1ZRCA 5A3MA 1Q8QA 3POGA 1C4RA 2XWBB 3I3DA 1LESA 3IN9A 1OQDA 1SQ4A 2FZ1A 2GP5A 4YG0A 3SKVA 3KVAA 1AR72 3GZEA 4YGCA 2R6QA 3MIHA 2D3RA 4QPGA 1VBD2 2NMNA 5HCBA 4NIAA 1UWWA 2CYFA 1ZM1A 1COV1 2PYTA 5KBFA 3RZLA 3MDPA 1HJFA 2FDGA 4PLNA 1PMHX 2UYBA 1YC61 3C7EA 4WVMA 3RZGA 2VOTA 5JSOA 4AEMA 2GN7A 2Z79A 4MHRA 4W6YA 1XJAA 5FYMA 2R041 2J1SA 4MSVA 4X8PA 3WDYA 3J8F2 4AEDA 4RQPB 1HQLA 4BMEA 4G3YC 2WZPP 3TRSB 2VZSA 3CQOA 1NZIA 4Q4Y2 4NMIA 3O0VA 2YROA 5C3OA 1WMDA 3GM8A 4M3CE 4FPGA 2H6CA 3OY8B 4LKDA 3RZZA 1XSQA 3ZIWA 1LGCA 1K5MC 2LW8A 3U4XA 4IV1B 5KHKA 4PJYA 4YVSA 4D7YA 5BNOB 2B46X 4P02B 2E53A 2FHRA 5CEHA 2XJQA 5FY0A 1C8NA 2B4KA 1FNYA 2J42A 4NIGA 1OH4A 2LRPA 4JRAA 2ARXA 1W99A 4RA0A 1UU4A 2MEV2 5FZ9A 1GU3A 1KDKA 3BPZA 1AL23 4NROA 1CJPA 5CKQA 1W8ZA 4QKNA 1COV3 2IVJA 1ZA4A 4WM7C 3RNSA 2D6LX 3ACFA 2X53S 4Z2AA 5CAZA 5C33A 3AFGA 4YRDA 3DPRA 1UD1A 2DWRA 2GU9A 1O4ZA 3B93A 3DCQA 3JD71 5DZFA 3WDVA 3ABZA 1UU6A 3JB8A 3KVBA 4AW7A 3O1SA 5FZ7A 2HWF1 2VAUA 4RHV2 3WW1A 3VL9A 5BNNB 1OLQA 5FMOS 3ZFFC 4W50A 2WZ8A 2ZOEB 2LM3A 3ZFFA 3PUIA 4Y5TA 5LY1A 2LS6A 1F5JA 1Y7BA 4S2HA 2GC1A 2QQWA 4PHZA 5DMYA 2D6NA 1SACA 4Z92B 2D6MA 4HONA 1AYN2 1JXNA 2VUCA 3MLLA 3TNPB 4HSLA 3ZX7A 4R4ZA 1DZQA 1US2A 1I3HA 1C3HA 2WZR2 3SH4A 2YZ4A 3ES4A 4XJ9A 5F6LB 3JD72 2W1WA 2W0XA 4NHXA 4AQ2A 1QF3A 4CDXA 2WSVA 2RDNA 1W9TA 4MUVA 4FPYA 4TLFA 1CD3G 5C8WA 3VZKA 4ARXA 4FXGB 1YQ6A 3U75A 1CAXA 5JAXA 2NP0A 4YW1A 2GNTA 4OVEA 4IXLA 4R8HA 3K75B 5ACA1 4L99A 4RFRB 1OBNA 4AGRA 3VBRC 5FUIA 5FV3A 5EZWA 1CAWA 3NV2A 5EJ3A 2XBO3 3EQEA 2TEPA 3KLSA 4K21A 2IWGB 4EV0A 1TME2 4QB6A 3ZO0B 4MGSA 2IXKA 3OBRA 4LBNA 3AC0A 3PIGA 2WJSA 3QLQA 1NY72 1SEFA 3ZR5A 5ABJC 1QQP1 4MGQA 4QKBA 1RUJ1 1ND3C 2A6YA 3ETQA 4OMCA 2BRTA 3C7HA 2AC1A 4RGKA 5BYNA 1ZVFA 1EV13 3BU7A 3DUIA 2WKKA 5L73A 3WW4A 4AHWA 1B09A 5JOXA 1N47A 4YW7A 1N3QA 1R092 2VULA 4NIIA 1OH3A 3APBA 3DEMA 4XURA 4XW3A 4E27A 5IAXA 2DCYA 4META 3CJIC 3WY6A 3WW3A 1N1TA 4CCMA 2J7MA 2JG9A 4Y20A 2P3KA 5FIXA 5FQ0B 1ND2A 1I1EA 1BZWA 2I2SA 3GGLA 4GB31 2FZ2A 4GB32 5FLIA 2XH6A 1VP6A 1SLIA 2VBDA 2B5HA 5I0DA 4ZZ8A 3WDWA 4H55A 4GAZA 1YQCA 3HT2A 3J8F1 1YCIA 2VZTA 2WQ8A 4C8DA 1SFPA 2B42B 4AG4A 4ASLA 1PK6A 4UW4A 4B3NA 5JR2A 2BYVE 1RUI1 1YRZA 3HQRA 1R1A2 1EY2A 1KJRA 1W6NA 4HN1A 4WZCA 4CXXA 1CZSA 2OZJA 2XJTA 3V0BA 2Q0AA 1UX7A 4Z07A 5E6HA 3NO8A 4JCKA 5IK5A 2XB6C 5ABJB 1SBFA 5FJKA 3WCSA 5JMOA 5FFOC 4CXYA 4COYA 1IS3A 4MH0E 4N9HA 1AYM2 1UYYA 1Y43B 2HWD1 4P9XA 4O7XA 1ZRIA 1VBD1 3AP9A 4AVVA 5A3NA 2WYFA 4YSFA 2DDUA 1LKNA 4ES9A 2HYXA 1S0EA 1O7FA 1J58A 2VNVA 3D5OA 2Z5WA 4XJUA 4FQZA 4XJ8A 3K46A 1K5MA 3VN4A 2WZR3 3IDBB 4OUEA 3R4DB 1GOFA 3K77A 4WVMB 5FZOB 2AREA 5BNPA 5K0UC 5FYCA 1HB3A 4DIQA 4Q4Y1 2R30A 3F2ZA 5CIRA 4URAA 5LA2A 3WQ7A 3AK0A 3JQWA 4PIZA 4BIOA 1IKPA 3VDAA 2L9LA 3LPGA 5ANNA 5FY5A 1A8DA 1LEMA 3KM5A 1VR3A 5A7WB 3J7LA 2Q1MA 1MS4A 2PFWA 5G04L 3MHZA 1H2MA 1RUC1 3R6SA 3RG0A 2D97A 2HWB1 2BWCA 2O1QA 3POFA 4IEVA 5IW0A 2MEV1 3KCCA 5LA1A 4B4QA 4AGGA 1RHI3 1ZZCA 2HWC2 4LHKA 1GNHA 1PZ7A 2G9FA 1RUG2 4PF5A 5K7PA 1MZEA 1W6QB 5JOYA 4H7MA 2BW8A 2QZ2A 1DZRA 4HK9A 1W8NA 1YXWA 1H2NA 2QQVA 3MV01 5C9AC 3FBMA 1BQPA 4ASKA 2WZR1 5FYVA 5JVVA 3USUA 4HSJA 4Q5OA 5KXCA 3BTZA 3BTAA 2V72A 3V0BB 4XDPA 3I2FA 5HCHA 4A6OA 2ETEA 3N7JA 5LBBA 2QQJA 4LKSA 4QPWA 2XUMA 3M3IA 4PIYA 4A7YA 3I54A 2VCCA 1RYYA 4XFAA 4WM8A 3VDDA 1BHGA 1VBC3 1GQHA 1VMHA 3AMHA 4ONUA 1FATA 1JTZX 4E9KA 2I45A 2FDKA 1R64A 1CPMA 2BGOA 2KA3A 5C5TA 1OFSA 1GR3A 4WVVA 5FCCA 5IHRA 1X9TA 3MUZ1 1R082 1UO9A 1XNKA 5KXDA 1ULGA 4AFAA 2O0OA 4ORFA 3I2IA 4AOCA 1YEWA 4QPIA 5FYTA 3DKWA 1RUD1 4N53C 2JECA 2ADEA 3SEEA 4RQPA 3AZYA 4CUCA 2A6WA 1UY1A 3KT1A 1E5SA 2EIEA 4QT6A 4XCBA 4S2GA 4YGEA 2J1VA 1Z0HA 1HIXA 4OQ8A 2JDNA 4CP9B 4YW3A 1MQTB 5ERLA 1W8FA 3AYDA 4CRQA 4EZ4A 4GULA 1M4WA 1PM7A 4XPVA 3WNPA 1CAUB 1W28A 1UY2A 3W9AA 2AYHA 5F3GA 2FDHA 3VKLA 1OLME 4HPKB 2WZEA 2VUJA 2ZZQA 3K48A 3RYKA 3UNPA 3AXDA 5T5JA 5FY7A 4C0BA 5I8YA 4PBPA 1NX9A 4GIQA 3H3LA 1OI6A 4R4XA 1FMD2 2D6KA 3KHCA 4AR2A 3J26N 1UU5A 4DXTA 4LPLA 1LOBA 5FUNA 3AP6A 4B4PA 2JE7A 1C5IA 1QWRA 2VMIA 3IAQA 4BHPA 1F4HA 3O0XA 5F6KA 4JHTA 2C0ZA 1F9KA 2VY0A 2HWB3 1V9U3 3J7MA 5A32A 3S6PA 5JI9A 4AL9A 4WZFA 2QNKA 2MHFA 4L11A 4XF4A 4YM1A 2X09A 3DPRC 1UIJA 4TTGA 3H50A 4AAXA 3TEZA 5CFCA 4NPLA 2OPKA 5FZ6A 4Z8BA 4FVVA 1ZYBA 3JU9A 4K1ZA 2VUDA 2WNVC 2YGMA 4WM7A 5A33A 3R05A 3VBOB 4QX0A 1QJFA 4C90A 2YG0A 5B2GB 2NQYA 5K0UA 2XVLA 3ZDVA 4HETA 1XNDA 1RUH1 1GQPA 4FFGA 2D98A 4AEJA 4A7KA 2VW2A 2AH2A 1LENA 2VD7A 3ZDSA 5LA0A 1J3RA 2BNNA 4MV2A 2RS32 3CO2A 3UKNA 5IVYA 1PMJX 1NCRA 4M0NA 5CU1A 5DUXA 5B4NA 2E7AA 2Y38A 5FBZA 4DRRA 5BV6A 2RVAA 1G6NA 2E33A 2IUWA 4XETA 3ZYGA 2Q8CA 4FOQA 2CY6A 2KD7A 3T4HB 2D5FA 1DIWA 1U12A 2JICA 1ZBA3 4BQYA 4CCKA 2WRAA 3C7GA 5FBJA 1X36A 4DS0A 1LJ7A 4GWJA 1LOCA 4XOGA 5F2WA 1G9DA 2R0FA 3BI3A 1CAUA 1QQP2 1WGPA 1C28A 1H8TA 3PUQA 4XJZA 5D8AB 1JYVA 4WV8A 3IDCB 1GP5A 1RINA 1BBT1 3LFMA 1BBT2 2ARAA 4LHSA 4XBLA 3U07A 5A3UA 2F4LA 2WS91 3P5BA 5EWSA 3D0JA 1JS9A 2WAOA 3GJBA 3BN6A 2HWD2 5DAQA 2Q1ZB 2LROA 3OGGA 4TLGA 1G9AA 1JYTA 2UWCA 2QBXA 4CP1A 1MS3A 1IG3A 3U0ZA 3S30A 5JSRA 1ACCA 4QPIB 4ZPIA 1RUG1 5JPMB 4JZRA 1FPN1 3SISA 4QDSA 1H1MA 3PTYA 4PI0A 4W6XA 5FZFA 4AVAA 2VPVA 5FPVA 4IV1C 3FL7A 1ULPA 2EICA 4BE3A 2CAUA 2VW0A 3B3QE 4UAPA 1PGL1 2C9AA 3WUCA 3WV6A 1UPIA 3OPZA 1UY4A 1DGRA 2VXRA 1H8TC 1ND2B 4FP3A 4FPJA 2Y34A 2VTXA 1SCSA 4CCOA 4EN9B 5BNPC 4R9AA 2EIGA 1VB2A 3LCPA 1WLWA 2VMCA 2XLAA 3LIGA 2BP6A 2BQPA 2PHFA 1AJKA 1DQ6A 1FPN3 5GALA 1N1YA 1UZZA 2E26A 4OZOA 4KGGA 5A7WA 2BWAA 3WP6A 1Y9MA 1R1ZA 1UMIA 4M0HA 1SFNA 4CDWC 2RR12 1G9CA 3DGTA 1WD4A 3BALA 5LW9A 4MZUA 4AFMA 1S0GA 4A7ZA 2JDPA 2VMFA 4RGGA 3FC0A 3URFA 1COV2 3GBGA 2WT2A 3TYJA 2PQQA 4CPBD 3GALA 1RUF3 2IXHA 4YG6A 3E6DA 5J37A 1W6QA 2J1EA 5A32B 1YNAA 1CVNA 4QHOA 1UMZA 1N1SA 3MPPG 2GC2A 5KC5A 5I0RA 3AL6A 1U0AA 2VCBA 1XYPA 1QY4A 1DHKB 3JCIA 1G86A 3EO6A 1Q56A 1S0JA 3N9QA 3ZYRA 5FK8A 3ZSKA 4LMFA 4Q4V3 2ZX4A 4V1PA 5D1IA 3KZ4C 1HB1A 2YDEA 2BFUS 3W21A 5IFTA 4WM8B 3VDDB 4QX3A 1OLRA 2ZEZA 3I2JA 5EJ1B 3WLUA 5F1RA 4FPHA 3WQ0A 1ODNA 2XVGA 4Q4Y3 5F2SA 4BQ4A 4FO9A 5FMBA 2EXHA 4J1WA 5BNNC 1NA1B 3E5QA 2RMU3 3ZFFB 2YFUA 3ME2A 3LEKA 3KHBA 3I3QA 1RXGA 5JOWA 2HYKA 1C8M3 2RMU2 3N35A 2QQOA 3WQBA 5FPXA 3OJBA 1CR7A 2C5DA 4L0PA 3W5MA 1GV9A 2YMZA 2C26A 3ZFEB 4GKYA 4KI5M 1VLNA 1I9RA 2QQPA 5JDBA 1W6NB 2R063 3WG2A 4QQOA 1ENXA 3NKTA 4YNIA 1W2OA 4RSUA 2D7FA 2DVDA 2CWSA 5FWEA 3WP3A 2P5BA 1UYZA 3A23A 3LE0A 4K40A 2O8OA 2VZRA 1HJGA 1VRH1 1T6GC 1OT5A 1VRH2 4CPBA 3Q8CA 4BQ3A 1V6IA 1XPWA 5KHIA 4IEZA 1K45A 1H1AA 3RZMA 3OPWA 1AXYA 2BPA2 5ACA2 4R9DA 4QDRA 3ZPOA 2OKXA 2WDBA 1JYIA 5GZGA 2BJSA 1IS6A 1LRHA 3NV4A 3ZYJB 4BIFA 1FOD3 5C7GA 1DYOA 4QHZA 2OT7A 1PGSA 5EYYA 1XRUA 2DFBA 3ZXJA 3AMNA 2RDSA 4FT8A 2K2SA 1H0BA 1V6OA 3LPFA 3JB4C 3ASIA 1F5FA 1NLQA 3VBUA 5L7OB 5L9VA 3LEGA 1D0HA 1CX1A 1DP0A 1H6XA 1RUJ2 2UU8A 4K20A 4XBQA 2VTXJ 5I91A 2X5IC 3WNXA 3ZN5A 2VZVA 3QD6A 5BNQA 1VBC1 2OZ6A 2ZGPA 4MGZE 4D7SA 1MS0A 4Y5Z0 4K1YA 3QOPA 4J6GA 2Y8KA 1C8M1 1XU1A 1T2XA 2ZX2A 3PMSA 5FZCA 3H42B 5A6XA 4AEDC 1MS1A 4Y33A 4HLTA 3HJRA 3DKQA 1F15A 2ZXQA 4HL0A 3ZFEC 4CYDA 3D82A 1OURA 3NNGA 2XJRA 3UGGA 2CNAA 1ULOA 5LBFA 4M3CB 5A80A 5FOBB 3K3OA 4LUMA 5GM0A 4CA9A 1GZTA 4URTA 2GSYA 1TZOA 4FOWA 1HN1A 2QVSB 3C3VA 3U37A 1H8VA 2QQKA 1RHI1 1VBB1 2R1DA 2RS13 2YBPA 1REFA 2HLEA 5F5AA 3EMRA 1O8PA 5FYUA 4E4SA 4FSJA 3ZN6A 2XXZA 1NE6A 4HPKA 4JGZC 3VBHA 4QQLA 2E7QA 1W8HA 2R7EB 2VXJA 5FO9B 2V4VA 1AR92 3LGRA 4B1LA 5C6CA 2A6VA 1WA4A 4YM0A 4DO0A 2W52A 4FCAA 2W1SA 3A0KA 2H0BA 1E5HA 1ZRRA 2GNDA 1YFWA 4Q0QA 4Q4W3 5DDJ1 1GICA 4JV4A 4AVBA 4RFT0 5IATA 5I0UA 4AVTA 1QJY2 2ES3A 4KGQA 5A6QA 1CN1A 1QJY1 1W2UA 4IW3A 1JN2P 1QJX3 1QQP3 3T0DA 2PHLA 5L7OC 3TAYA 2A3XA 1RUH2 4NN0A 3F95A 4DY3A 1PVXA 3Q8AA 2WO1A 4QXCA 4XIOA 2OIIA 3AJYA 4IGOA 5IVEA 1HDKA 1SDDB 1VMFA 1RB8G 1IPKA 1POV3 3B9IA 4D6SA 3B94A 4I01A 2UWBA 3MPBA 1QOSA 4JVAA 3ZXGA 4ZZ5A 5L7OA 4AEDB 1JZ7A 1NOVA 1GNZA 1VE0A 2DCKA 2RS33 2VZ1A 2WABA 3AKPA 4H7LA 4YM3A 2HBTA 1WLCA 4Z2WA 4XF0A 1GOHA 1ZREA 3MO4A 4Y5SA 4AWDA 1OUSA 2WT1A 5K0UB 1HRI2 2UY9A 4UBHA 3L2HA 3TN91 1Q8PA 2W08A 3A4UA 5A1FA 1L7QA 1Q3EA 1WWYA 1W06A 3MICA 4ISRA 4QXBA 5CG8A 2YB7A 3UJOA 3GF6A 3UL2A 2V5DA 3AKQA 2HWE2 2VOXA 2XVKA 4QKFA 1ZZ7A 1NT0A 4OCTA 3OYWB 1QXRA 4UFMA 4XF3A 5C9AB 2IC1A 4BPZA 2QQMA 4CCCA 1NE4A 1O3SA 5HXMA 3PTRB 1H9PA 4MX3A 2VNRA 1H8TB 1ND2C 3H1WA 1PO22 5GKAC 4Y1UA 2HWE3 5FJHA 1W8TA 3NJVA 3ELNA 3VBHB 2I74A 1WUVA 2YU1A 4MVTA 4QPYA 1NCQC 4IE5A 3OOXA 1D4VB 4NVPA 5EV7A 1FMD3 2A3WA 4KH9A 1ONAA 4CUBA 2JG8A 1DDLA 3GZAA 2ZGLA 1HRI3 1ENSA 4HFSA 2BNOA 5KWRA 3NV3A 1NLRA 1OQEA 4EJRA 2AENA 1HXS3 4J1XA 2OVUA 1ND3A 1W8OA 5FPAA 5I93A 5IAVA 5C3RA 3N7LA 3I59A 3DYOA 5CKMA 5IT6A 1S4CA 4OHXA 2DFCA 4YW2A 4L97A 3VGIA 2VQAA 3JUUA 3ITQA 3CZJA 1QJEA 4FPEA 2JDKA 1GOGA 2RG4A 3WX5A 5LRRA 2RM23 4P9WA 3UKTA 1QH7A 1RUH3 2A71A 2DTYA 3N9MA 3QH6A 1NCRC 4YM2A 3ZXFA 1PMIA 4AFDA 2JIGA 5DUUA 1RUD2 1EPWA 1V6MA 2RS52 3DXTA 4HKLA 3OUIA 2GH2A 3AZXA 3QCWA 4EWEA 3CJIB 4A2UA 5HCAA 4ATFA 1RUOA 2RR13 4ZS3A 4CCDA 1TMF1 1LTEA 2OUJA 2BOIA 4AK3A 2Q5TA 4NO4A 4BXFA 5LCWL 2DUPA 4LQRA 3O1VA 5FZ4A 1UAIA 4LHLA 3OYWA 3KGLA 4JX0A 2ZGNA 2XHNA 5DN2A 4JQRA 5JIAA 3S5QA 1GQGA 1V6NA 2DBNA 2GMEA 1AHSA 1LHVA 4IEUA 4A41A 4NPRA 3B02A 3PMEA 5CNAA 3T2OA 3THPA 1CZTA 1VALA 4BK4A 2G1MA 3PL0A 1OLMA 1UNBA 2IXCA 3NAPC 3VBFC 1IPSA 5A7OA 3D3AA 4AAPA 3IWZA 1AYN1 2PLV3 4KNCA 1BMV1 4KU8A 2WQ4A 2W87A 5JSPA 3VLBB 5LRSA 3G6JB 5CZKA 2D40A 3WSOA 1GZWB 2PHRA 1Z78A 5LK5A 4HZFA 4AI3A 4ZU5A 5GLZA 2R071 2X5IA 2GP3A 2JE8A 4XE9A 4PF1A 1OKOA 3ACLA 4AZZA 2HWD3 4D7TA 3ZXEA 2WNVB 1SHWB 5JLVA 1CGPA 4IV3B 2JG9B 4Y20B 1NA1A 4F83A 1RMU3 3RRDA 1AL0G 3GYDA 3ZN4A 5CBLA 1FOD2 3LB9A 2MNGA 1BEV1 3LQCA 4AYUA 3ZSJA 2Z2SB 1GSLA 2RJKA 3RZKA 2RDQA 3M7AA 4Q8LA 3ROUA 4OI2A 1XNBA 2ZTNA 5FTTC 3WHUA 1MVEA 4XUTA 2GALA 1WD3A 4W4ZA 2A75A 2H6BA 1B35B 1HV1A 2YFZA 1WCDJ 4PBOA 5LBEA 1VBB2 3LDRA 4YVSC 3GZTB 2WL1A 4E4HA 3HMYA 1W2AX 3FMGA 1AX0A 4ZKTB 1PGW1 1IHMA 1VRBA 1Q8SA 2UYAA 3VDCA 3DL3A 4XTMA 2G19A 5CYYA 1OPMA 4CTEA 4D6RA 3WF3A 1MEC1 5FAXA 1H1IA 1VBE1 4AFBA 1W6MB 3WNLA 4OUSA 4ZONA 1GKBA 1XSRA 4A44A 3SCFA 5A6ZA 3AZZA 4D0QA 2ORXA 5HCFA 5HV4A 4L9BA 2XWJB 2W94A 3ES1A 3WG3A 1CJDA 1O4TA 2KXLA 4P9IA 1A78A 2W5FA 1C8M2 5C3PA 2VVFA 3ZLIA 3LEMA 5D21A 2D44A 4XCAA 1VIWB 4NPMA 3I2DA 1EP0A 4Y22B 4B8EA 3OG2A 5FP9A 3ZKYA 4N9IA 3ZYFA 3MF6A 2TUNA 1EV11 5JCTA 5AC92 1QXPA 4XUQA 1KFXL 4GH4B 3WUDA 1CIWA 2WN2A 2ZMKA 3FHQA 1UIKA 5L36A 3P3NA 4NHLA 4P9GA 3T08A 2HEWF 4XHBA 1H6YA 5C4WC 3IDEA 1HRI1 2VBBA 2A6ZA 4ARYA 5FY8A 5A7PA 5CISA 3KQ4B 4DPNA 1QJX1 1V70A 2MPFA 3EYPA 5CFDA 3OUJA 1K3IA 4E4DX 2JD4A 1MR5A 3D6EA 5DG1A 5H9RA 4FFHA 1D4M1 3OD4A 3RI8A 2V4AA 3NRUA 1OKQA 4IEXA 4M3CA 1X7NA 2HKXA 4YWAA 3ECQA 2D6PA 2DUQA 4CCLA 1G9FA 4AQ6A 1VPHA 4I02A 1UYXA 2TNFA 1J1LA 4IERA 5BUVA 5FZDA 4JAAA 4BMBA 4UFJA 3W5NA 1NYWA 1PO11 1LHWA 1JHJA 1LOGA 2E31A 2VMEA 4HKOA 1LGBA 4TXWA 5FYIA 3B5LB 3VHOA 1DLLA 3POWA 2FBEA 4Y1VA 1ASJ1 1HQNA 4JDOA 2GN3A 3VBUB 2CGOA 3BCWA 4TZDA 3VD9A 1NA1C 1W9WA 1C5HA 1LAJA 4LBJA 3FFZA 3PJYA 4LO5B 3VD7A 2WINB 4KWUA 1W9SA 2HWF3 3I3MA 1IPJA 2YHJA 1NG0A 2ZGSA 4P00B 5A3OA 2VVEA 3LDBA 4EYUA 3WF4A 2Y33A 1C1LA 1TG7A 1V0AA 3I49A 2WLPA 1FAYA 1CAVA 1OOPB 1QOOA 2PAKA 3SEPA 4CU7A 1G8WA 2VZQA 2W47A 4GH4A 1XNAA 2P37A 2HBUA 2ARCA 5FZIA 1YFUA 5DUVA 3SKJE 3IZOA 5DPNA 5FRAA 4FAGA 1W90A 4QWNA 4XTPA 1ULFA 1RUG3 1GBGA 4CXWA 1H4GA 2GMMA 5T3NA 5FZMA 3IBMA 3ZFEA 2W1UA 3KV6A 3AZWA 4BQXA 1WCUA 4UF0B 4BM8A 5JOZA 1YQ5A 5LEJA 2BV4A 5LZ6A 1ST8A 3ZXDA 4ZS2A 1KITA 3THTA 3QBQA 5JXHA 1AR63 5AFBA 3ZMNA 3JZVA 1W6MA 5FYHA 5IK4A 1JOJA 2ZGTA 1ZBA2 2YY1A 4LO6B 4Q0PA 4YFWA 4D69A 4HANA 3VBUC 1LOFC 2JDUA 4XC9A 2IVIB 3I8TA 1XNTA 5HV0A 4YW5A 2EAAA 1V6LA 2D43A 3KF5A 1NAEA 4JRLA 3EB7A 1W0OA 1US3A 3ZYIB 3DYPA 1QJU2 4NHMA 3Q8FA 3GXUA 4UT5A 4ITCA 1QMJA 2EVXA 1RC6A 4MGYE 2VZOA 3IT8A 3K4AA 1HXS1 2DYCA 5HXVA 5CG9A 1YFYA 1XXNA 2RM22 5F39A 1TNRA 4KMQA 1G7YA 2EXJA 2JXAA 3KF3A 3VKNA 1LOFA 5JMCA 4LBOA 4WVWA 5J3UA 1FXZA 1VMJA 5L19A 2RS51 4TN7A 1HW5A 3H1YA 1REEA 2NM1A 2RS11 3AMMA 3AVSA 1RIRA 3C2UA 3O5SA 5J98B 1UX6A 2DVGA 2QUOA 3ALQA 4P14A 4CDQA 3PUAA 3VBOA 1AYM3 1ZA7A 5CFCC 1DYKA 2VZ3A 2X5IB 3NVCA 5IK8A 1AR83 4M4PA 4HN0A 4LUKA 2WO7A 1KGYA 5AC93 3MLJA 3ZSMA 5C9AA 2XQRA 2FDFA 2XKPA 5DAXA 4AVSA 3ACHA 2Y6LA 3QACA 1DG6A 4TWTA 2VMHA 3W58A 5JIUA 2XJSA 4JGZB 3ZYBA 1WW5A 1IG0A 5FZAA 3WXPA 2N7GA 1NZCA 3GCXA 4PI2A 1O3RA 3BU0A 2WC2A 3HN3A 3VZLA 3RYPA 3VKOA 5CB7A 1POV0 1PX3A 3CLPA 3MW2A 4EN7B 1QJZA 4Z82A 1PK6B 4NUBA 4OLLA 4UF0A 2GNBA 1AR73 4V2VA 5EJZB 2JEMA 2VMDA 4LITA 3WDUA 3IKWA 3GBWA 3WNOA 2WFPA 1R1A1 2LUWA 3ZYHA 1KJLA 1O5LA 4YYOA 5H9QA 4CCJA 2E7TA 2QKDA 4DQAA 1V9U1 4ET7A 4XAEA 3H3ZA 4QX2A 4FOYA 2PHTA 1MS9A 1ZZ6A 2B8MA 2P1BA 5IVVA 4FFIA 3I59B 1UPSA 3EHKA 4LBLA 5CKNA 1QU0A 3KV9A 1IS4A 2PQSA 2QCSB 4P9YA 3HR9A 3WW2A 1W6OA 3GBFA 4LIVA 4PCRA 2D3PA 4HK8A 5DG2A 3U4SA 1X33A 3NQHA 2GC0A 1EV12 3ORJA 4IDZA 4O61A 2B9UA 5FXXA 4ES8A 1EPZA 3T0AA 5JUVA 3LZZA 1ZZBA 2XQXA 4BJ0A 3ATGA 4QX7A 1DLCA 1J1TA 1YO8A 4CDWA 1WKYA 3M2MA 5BY5A 3DN7A 5T50A 1DZTA 4WM8C 3VDDC 3IIAA 1EUTA 1IOAA 4KWLA 4UFLA 2XBO2 2ZS6B 5FZ1A 1QJX2 4FFFA 3VHRA 1AR62 1BXHA 2RV9A 4E2GA 2P2KA 1O3QA 2PLV2 5AFEA 3AFKA 2PLV1 4GZ9A 1I6XA 4BU2A 3OB8A 5L9BA 4E8CA 5C5UA 4NRPA 1U5ZA 1J84A 1PK6C 2F4PA 3HN1A 3ILFA 3RVHA 1D2QA 5C4WA 5IVFA 3O1RA 2PAEA 4LLFA 4K9SA 4SLIA 3VBHC 2YUEA 3LOBA 2W3JA 5FYBA 3BOPA 1ENQA 2J1TA 3KMHA 1OD3A 3NW4A 3J7NA 5FYYA 4HG6B 2QQIA 4KWJA 5FY9A 5EYXA 2OQ6A 5BNOC 1AR81 3PHMA 2VQ0A 2JDMA 2NZ9A 4GMP0 1WBLA 1IS5A 2AGSA 3ACGA 5GLTA 2ZGQA 2CL2A 4MXVA 2UY8A 3NMBA 3USUB 3ZFGB 2C9KA 3BKZA 1STMA 5FUPA 4YZ5A 4FPKA 2P17A 1FYUA 1YI7A 2VL4A 3HT1A 1PM4A 4IEWA 5K9YA 3HPNA 1YUDA 3ZSLA 1BLZA 4RS5A 5H9PA 4JTNA 3OF1A 5JPNB 4QX8A 1RUD3 4RHV3 1TMF3 1PNFA 1WA6X 2ZZJA 4FPLA 4JKKA 2BFUL 4ZXKA 1XNCA 1SG3A 3CJXA 3G7DA 3RJ2X 3TEXA 1H30A 3FBYA 2VH9A 4COVA 2GDFA 3MFAA 1Z7S3 3AMQA 4UW5A 3N7MA 1RUC2 3GHMA 4NOTA 1KXGA 4GMP3 4R52A 3S0MA 4HMZA 4DXRA 2V73A 1D0GA 3B69A 3J9SA 1SLTA 3MYXA 3E97A 4NRQA 4CEYB 1LOEA 2VECA 2XJUA 3CDZB 4WVZA 4BK5A 4I3PA 4BH9A 1JZ6A 1W2NA 1WW4A 4Y4RA 4BOWA 3PLQA 1OF4A 5A7NA 1DGRN 1PIV1 4UW3A 2KM2A 5JZGC 3TBDA 2VVDA 2VUAA 4XABA 5GZDA 4IEQA 5HPOA 2BGCA 2ARBA 2IXIA 4UI9L 2ET7A 1LODA 1OVPA 2O14A 3BUCA 1OXCA 4XFIA 4F8AA 4KBZA 1RUNA 4RR3C 1LHUA 3M3QA 3MW4A 3CZUA 3ZIXA 2ZHNA 3FWEA 1I5ZA 3OBZA 1PHMA 2R0HA 1W6OB 4XUPA 1W39A 2YC0A 4MOAA 4YGDA 5E89A 4EQVA 2FQPA 4IGPA 4CUGA 3O14A 4IEPA 4TSVA 3VD3A 4E2SA 2ATFA 2WFF2 4Q8KA 4QAWA 3IM0A 5LA9A 5GZCA 4PLOA 2ZHLA 2G4IA 1W0PA 3M4FA 2JG9C 4GMP1 5GLWA 1F35A 2VMGA 4UYBA 3U78A 4QD2A 4LT5A 1DQ4A 1AX2A 4WM7B 5A33B 2ZA9A 3E1F1 3OGJA 5LBCA 1OSGA 3ACIA 2DU1A 2BUKA 1JUIA 2J22A 3WG4A 3M1HA 4M00A 4CDQB 4YZ1A 3OEBA 1WLTA 1CIYA 2R072 4PQQA 3SCGA 5I0SA 1F8VA 4F7ZA 5DZGA 2YPJA 1YJLA 4LIUA 3TWIA 2BERA 3BODA 4UXAA 2W1QA 3WR0A 1VBB3 3H8XA 1PZ9A 2PN5A 2VGDA 4DB5A 2RS31 4YGBA 1RUF2 1DU3D 1WCSA 2VR4A 1DGWX 3O12A 3T1MA 4CU9A 4XQ4A 2ZABA 1E57A 2EF6A 2ZGUA 3WEZA 3ZSEA 4N53A 3WQ1A 1BVVA 4QPIC 2GNMA 3HBKA 5DDJ3 1C57A 1SMVA 3ZXAC 2PHDA 1XE8A 1W03A 1WMFA 4P9JA 2XDVA 1VJ2A 1PO13 4P9LA 1W8UA 1AR61 1GZCA 1RVF2 4Q2FA 4BQ2A 1GYKA 2E63A 1HQWA 3SCHA 5C4WB 5E1RA 3LA3A 4YZ3A 1AR91 1S2EA 4OHWA 4AE2A 2WS93 3FHAA 3WT3A 1FNZA 1RUI2 3B7MA 1W6PA 5A3TA 3BIWE 4AGVA 1IGOA 1AYN3 3RFRA 3GHNA 3RMXA 4AEKA 3O1MA 4MADA 1YLLA 3L2YA 1OVSA 4CU6A 1NCQB 2XHKA 3K4ZA 3SMHA 4MGKE 4RL7A 3P6BA 5AVAA 3AYAA 3KT4A 4C91A 4GWIA 3VBRB 1SDWA 5FMOL 1AYM1 1SLBA 1A34A 4P5HA 4K3UA 2Y64A 5FZEA 3NSTA 1U5IA 3NNMA 4QX5A 4OI0A 1AF9A 4GH4C 1KDMA 2DCTA 1RUJ3 1HRV1 3LEIA 4DXZA 1RVF3 3M70A 3DECA 1PGW2 1WCKA 5JI7A 2GMPA 3MIEA 5LEKA 1Q8OA 4CSWA 2WAAA 4YW4A 5C8CA 1ALYA 2FDJA 4XIKA 3LSEA 1ZBE1 5A3PA 3VUOA 1LECA 4UWDA 3S5AA 1NLSA 3S57A 5DDJ2 2P3JA 5FOJB 4GJZA 3R0RA 2RS53 1BEV3 2WN3A 1JYXA 3PNAA 5ACA3 2AEYA 2ADDA 1RMU1 3LKJA 1FT9A 2ET1A 2QZ3A 1JMUB 2NYYA 1U5XA 4LK6A 5A3LA 1Y4WA 5F3IA 3K3NA 3KSCA 4PDWA 5B4XA 2E51A 4JTOA 4LBQB 3SITA 5KXBA 2HJIA 1JZ8A 3VZJA 3H8UA 2F6BA 3VV1A 2OUHA 4QGNA 3T3YA 4HVRA 5FPLA 2NLRA 3ZXLA 4QB2A 3HQXA 4ZU4A 1PZ8A 5FO8B 5IVJA 4OHVA 2EAKA 3SHRA 1OOPC 3GCWA 1BVP1 3HOBA 3WDXA 1PIV2 2XR4A 3BYWA 4M01A 2VBPA 4M4RA 1CWPA 1O91A 2VE1A 2DU0A 3USSA 1DYPA 5C8CC 4RD7A 2A7AA 4NWVA 5F37A 5LK7B 2R16A 2D6OX 2W92A 2WFF3 3B00A 1LNSA 5FP8A 5KR7A 2P6CA 3D0SA 3EBRA 1GWMA 1KEXA 2RDRA 1RTVA 1JZ5A 1OHFA 1VBD3 4YVWB 4JGYB 1NKGA 2HWB2 3RI9A 1A6CA 5APAA 2JJ6A 4AI1A 1PO21 3T4VA 5EP9A 4N53B 3CJIA 4L2NA 5K8SA 3WD5A 4DRVA 1LU2A 5FYZA 4A3ZA 4O9GA 2FMDA 1ZNPA 2ZX1A 4L92A 2I07B 2OQ7A 1LU1A 4JKLA 5J09A 2XJVA 2R042 2XLFA 5KHGA 4DEVA 4BA6A 3N3HA 4CP2A 1SBEA 2J1UA 3ETPA 5J48A 4DUXA 1B35C 5FMCA 1CX4A 5KHJA 2ZHKA 5FZ3A 1QKQA 1CONA 3BB6A 1SZBA 1X8EA 1S2KA 4HT1T 1VB4A 3NKGA 1W9FA 3UYJA 3ZFGA 2JB4A 5J7MA 2DURA 5F5QA 3N9NA 4Q4X1 4YLZA 4Q4X2 3VBRA 3HIFA 1S0DA 5DXDA 1PIV3 4K8FA 1ASJ3 1GANA 1DQ1A 4XDOA 1BCXA 2JDZA 3OBTA 5LWBA 3HAGA 3TB0A 3FLTA 5BXXA 2DVFA 2RM21 3A7QA 4RR3B 3PVNA 1W3VA 4NHYA 2PHUA 1S0BA 1XBFA 2XGXA 1LHNA 1AR93 5ISLA 5A1LA 1XE7A 4JGYC 4D8MA 2IXLA 4QX1A 5F3EA 1LHOA 1VBC2 2WNVA 4LEJA 1GP6A 1LR5A 3MLKA 3WINE 1OA4A 3A0NA 1OPOA 4YZ2A 1EAH3 3ZM8A 1K42A 3FLRA 2ZX0A 2VC9A 4E8DA 3U14A 1TE1B 1JUHA 1XYNA 2JX9A 3CF6E 1H2LA 4I09A 4XXPA 3K2OA 3TNQA 2J1AA 2R1BA 3ZR6A 2PHWA 1LB2A 3CL1A 1YYNA 2WQZC 2BNMA 1DF0A 2VCMA 1AX1A 2XMLA 4J25A 2ZCWA 4UFIA 3VL8A 1NUKA 4QXHA 2DV9A 2ERFA 5HBAA 4ZY9A 1RHI2 2ZPXA 1HRV3 1UY0A 2XJPA 4FPFA 2WSUA 5I8TA 1W05A 4LBQD 2WUHA 2XLGA 1YIPA 3AX4A 4N7IA 5L9RA 3WNMA 1UOFA 3RS6A 5FPBA 3N4MA 2G9ZA 4S2DA 4N43B 1JYNA 3I2OA 1NXD1 3HQUA 5T5LA 3AP7A 1X8MA 4BISA 1MQTC 4EWDA 1WMXA 4N8MA 5I0TA 4I30A 3O0WA 4NWWA 4E4ZA 4F3JA 4CDUB 4Y22A 1QOTA 4QHBA 4LHNA 4H2AA 1CPNA 2Y26A 1UXXX 1BK1A 5G05L 2C1FA 1H9WA 1RUI3 2Y6FA 4MGIE 2XPJA 3H8RA 3LIHA 1WCQA 3VD4A 2YXSA 3MBWA 1O8SA 4XZPA 3DV8A 5H9SA 4AF9A 3Q9OA 1VRH3 4NIDA 1LOAA 3B01A 3HVDA 1A8MA 4KG8A 3NNJA 2PHXA 4I2OA 2Q8EA 4XFHA 3LWCA 1SFYA 4GD4A 4KQ7A 2WNOA 3HEIA 5ANQA 4D94A 1NY71 2R062 2P3IA 5GZFA 3RWNA 1LEDA 3OUHA 4XFCA 1EUUA 5IFPA 3H7JA 4EN8B 2K0GA 3AB0A 3H0OA 3GZUC 3T2QA 1MZ6A 1W04A 2TBVA 2D5HA 4CP0A 1VBE3 1FV2A 1V6KA 2A70A 5A3WA 1IKQA 4XQDA 4M3CF 4N43C 4DOUA 3KQRA 5KC6A 3FHIB 2Y0IA 2UURA 4RGAA 5CVRA 4BXSV 2XL9A 3PDQA 4YZ4A 3SNMA 5A70A 4OYUA 4QMAA 4BZ4A 4MO3M 4BDVB 4LBQA 2JG8B 4XJAA 4GB33 4GWMA 4N43A 5E16A 4N90A 2AUYA 4Q4V1 4Q4V2 4GJYA 5T55A 2Q8DA 1UOGA 1HN0A 4DZGA 5FR3A 3TEYA 2XUEA 1W0NA 2YC4A 4K6BA 1ND3B 3N9OA 1UOBA 5AVPA 4YFZA 1I5PA 3INAA 1KS4A 4U2AA 3PVOA 2CHHA 2PA7A 2P34A 4NE9A 1O4YA 1TQ5A 4B7EA 1XQNA 4CCEA 4FTSA 4BQ1A 3PUSA 4OI4A 2CDOA 5C3QA 1PNGA 1ULEA 3THCA 1W3XA 4ATEA 1CAVB 3I2HA 1L7RA 1OOPA 3VBSB 2X05A 3WDTA 1YQ8A 3AP5A 4LNVA 3AKTA 5DQ0A 4BLJA 2XKOA 4XYXA 2C4XA 2JKXA 1R081 3AMPA 4H14A 5SV8A 2RR11 2W91A 3I7DA 1PVC2 2ZEYA 1J3PA 3RYRA 1FPN2 3X29B 2YU2A 4BQ5A 3BGAA 2QJVA 2V5YA 5C8CB 3H8OA 2ZJCA 2BVVA 1G9BA 4R9BA 1A3KA 3RWKX 1QH6A 2QTWB 2QDRA 2Y6HA 4GALA 2YBKA 2ZGRA 3UESA 3ENRA 4YARA 3PU3A 1JU4A 2CAVA 2P4EA 1JYCA 1CZVA 4LXLA 3UV9A 3RQ0A 4UOJA 1QDCA 1W6PB 1DQ2A 5JZGB 4Y24A 3KCYA 1XU2A 4Z1VA 1RXFA 3UK9A 3WP5A 4U36A 1HV0A 2OXBA 4K7JA 3KT7A 4PDWB 5BNPB 1WZXA 4HXCA 1D4M3 3S7EA 4LULA 1WW6A 4A45A 4BQWA 2P6HA 2VOKA 2HWE1 4AHZA 1H2KA 3GNEA 4MHUA 3NJZA 4MLOA 3VZMA 3DYMA 1PVC1 3OY8A 5F7UA 1ZRFA 2RHPA 2ZKNA 1WMEA 4WBBA 2J1RA 5FY4A 4XUNA 1JH5A 3ON7A 2JDHA 1QIQA 4B7KA 3AVRA 1GZWA 2VOWA 1RL3A 4AQSA 4AHYA 2E9QA 2WFF1 2PELA 4FP2A 5F32A 1DGLA 4K8RB 3POSA 3ZXKA 1DFQA 2K9ZA 2VG9A 3KGZA 3AXEA 4IQPA 4Q29A 1GFF2 1N3PA 1N1VA 3CU7A 3M3CA 3OCPA 1APNA 1SLCA 2RJLA 2VNGA 4IV3A 4LO7A 1VAMA 4RR3A 5FPZA 2JB8A 2VJXA 3WVJA 1QXJA 3V0AA 2Z69A 4CDQC 2OPWA 3T2TA 3PURA 1ODMA 3GDBA 4JGYA 4D6QA 3K51A 3LFIA 1W2TA 1UKGA 3P3PA 1DQ5A 4S2FA 4GQ7A 3T30A 4DINB 3I97A 1VBA3 3FZ3A 1FMD1 3MUY1 1DGWA 4ZU7A 4E2QA 4FI9A 4L8QA 1IQDC 4RQPC 5TSWA 2CU5A 1AZDA 4NJ4A 1AL22 4MGTA 2HEVF 4G9SB 1RUF1 3V65A 4I0AA 1X50A 1KFUL 2DTWA 3MEPA 1XYOA 2XONA 5GLUA 2Y6GA 3PUHA 1R1A3 3QH7A 4LKEA 4UFKA 2NPIA 3TOJA 5T5OA 3ZPYA 3POEA 2GH8A 2WIIB 2YC2A 2R061 4GKXA 1RVF1 4XJWA 4QU1A 2Y0OA 2VQUA 3ZKUA 4OFGA 1HB2A 1UY3A 2W46A 2H0VA 5FO7B 2QQNA 1URXA 3R4UA 5JXJA
chains in the Genus database with same CATH topology
4ASMB 4XFGA 2DCZA 4CDUA 1NCQA 1S0FA 3J8F3 1NXMA 1ULDA 1UN1A 3WOGA 2EXIA 1IZ3A 4W6WA 3AKRA 2ZGMA 4I0BA 3V64A 1R093 1IQAA 3UKVA 4HKWA 5F9TA 4QPGC 1LGNA 5CFDB 4AXOA 3W59A 5GZEA 1OA3A 1OQ1A 4O9EA 1S55A 1Q8VA 4B29A 4FAHA 1FX5A 1VBE2 5JZGA 4W65A 1MS5A 3TN92 3POYA 2EALA 3SH5A 1R091 2SBAA 2B7YA 2WA4A 5GJ6A 3CEWA 1AR82 1FV3A 2NMOA 2WNUB 2R49A 1R083 4BCUA 4X6QB 1UW8A 4BWOA 1VAVA 3FE5A 3WZ1A 2BTVC 1ZX5A 4FPOB 3AKSA 4GXLA 4NR1A 2SLIA 4FTBA 5E88A 1PGL2 4FBFA 4G4FA 4OI1A 4LLOA 3MF9A 2ZMNA 1QJU3 3VKFC 3WG1A 4FTEA 4C1WA 3RDIA 3V0AB 3JQXA 4LO4B 1HX6A 4MXWA 4IEYA 4QXKA 2CTVA 2JE9A 4FQ4A 4XFBA 2YGLA 5CFDC 3RSJA 3WP4A 4B4RA 3AZVA 2QQPA 2GZWA 5KXEA 4R9CA 1RUE1 2QFEA 1RUE2 3VBSA 4OULA 1MEC3 1F2NA 2HWC3 1EAH1 1JHNA 4LA2A 4Y1XA 1OFNA 3AJZA 3RPQA 2ZHMA 1AUYA 2XL7A 1ULCA 3RMYA 3AM2A 2GAUA 3MIBA 4XFFA 4IETA 3U11A 1J59A 1REDA 5CA6A 4Q0SA 2JENA 5T5PA 4CEWA 3MI8A 4X8NA 2JKBA 4GA9A 4LO8A 2WLQA 1QGLA 3MGUA 4PLMA 4UW6A 3SH3A 2D3SA 4XMAA 1V00A 3VBOC 2MEV3 1D4M2 1TEIA 2HWF2 4RHV1 4Y1ZA 1SBDA 1O3TA 1POV1 1QJU1 1FI2A 2GC3A 2IFWA 2A3YA 3R4SA 1M06G 4A3XA 2HWC1 4OUMA 4BYYA 1HXS2 3ZVXA 3NAPB 3VBFB 4LR4A 3KB5A 1YI9A 2WA3A 2WWSA 3MFCA 4DFSA 3TN93 1UL9A 3U10A 3M8LA 4GWNA 4XBNA 4TYSA 4QGMA 3MIDA 4LBMA 5FLJA 1KRIA 4JGZA 4QM8A 1Q5OA 3LA2A 2FMYA 3IMNA 4KL1A 1TNFA 2WT0A 4LA3A 2PAMA 4QM9A 4XILA 4COZA 2LTNA 3SXWA 3E5XA 2R043 3PJQA 4XDQA 3VHPA 4XMIA 2AZ5A 2ZMLA 1QHDA 1WLDA 4LE3A 4COUA 1QNYA 3D8CA 2ZAHA 1TME1 1KS5A 4I0WB 3LA7A 4QQPA 4CEWB 5IUQA 3AP4A 1JW6A 3B9CA 4PQ9A 4D3WA 1MVQA 5JR7B 2EXKA 3AYCA 4QQHA 1EYBA 3MIFA 1S0CA 1ZBA1 4AI2A 1TME3 2G9GA 3OTFA 4XF9A 4EWAA 2A6XA 3MIGA 4CDWB 1YHFA 4QGLA 4QQ2A 1J3QA 4Q4W1 1L3JA 1H4HA 1ZZ8A 4Q4W2 1CAWB 1UZYA 1YWKA 3S7IA 1VBA2 2LALA 3FFQA 2BEOA 4JDNA 2IZWA 4CEYC 3JD73 5KHHA 3PVBB 5C4WB 4YVWC 2RS12 1ZBE2 2W68A 3NWKA 5DZEA 4OHZA 3N7KA 1WBFA 2JG8C 4IV3C 2QDNA 1C1FA 3LOIA 1FOD1 1QDOA 1SCRA 2A5ZA 4COWA 4CEWC 1RMU2 2B39A 1GZ9A 4EN6B 1AR71 1D2SA 1NQDA 5BNNA 4FXKB 1Q43A 4Q27A 5AC91 1VBA1 1V6JA 4RS5B 4JC1A 2IFRA 4YVSB 3VHNA 5BNOA 3VBSC 1HRV2 1OMIA 4JDMA 4X6RB 3RJRA 4XQWA 5T52A 4Q1PA 5J36A 3E5UA 2W39A 1SLAA 1AXZA 4HVOA 1GLHA 2D93A 3FJSA 2XBO1 4C1XA 2ENRA 4XF1A 2PTMA 3ZMOA 3IPVA 3O7OA 2XG3A 2RE9A 1VAKA 5D8AA 4UBGA 3ZN6B 2OA2A 2WS92 1CESA 4YVWA 3MZHA 5T54A 1Y3TA 1EAH2 3T1LA 1Y9QA 3NL1A 2VW1A 4EROA 1CAXB 3DPRB 5FLHA 4INDA 4CEYA 2Q30A 1PO12 3LAGA 1PVC3 3WCRA 3FUQA 3OD0A 3V56A 3L9JT 2CGNA 4PDWC 3M3EA 4Q1RA 5JWPA 4XXAA 1K5MB 2AR6A 1ASJ2 3E6BA 1S2BA 1X82A 2O8QA 1OD5A 4Q4X3 3AYEA 3ZYPA 2CWMA 4Q26A 3H3UA 4NHKA 3EJKA 4AVCA 2WNUA 2R073 4IV1A 2NN8A 3LSDA 4OZXA 2DUOA 2VOVA 4I3GA 4CDXB 4OHYA 2BVBA 2UWAA 2X8KA 5EFUA 3WHTA 3NAPA 3VBFA 1S0IA 2R32A 3KD4A 5J96B 2QE3A 4CDUC 2A73B 3VKMA 1U5YA 1PO23 2B45X 5I8SA 1S1AA 3N36A 1YIFA 2Z42A 3UJQA 3VZNA 4AI0A 5DUWA 2ZAAA 3M3OA 4AHXA 3HBZA 2VNOA 4Y1YA 1CQ9A 2V09A 5GLVA 1RJ7A 4LTAA 5FDBA 4MYEA 3BOWA 1O5UA 3ILNA 2Q8OA 2DVAA 5E8AA 5ABJA 3NV1A 3FUOA 4LBKA 1MACA 1JBCA 4IESA 1OA2A 2ZKLA 2CV6A 3KCXA 3I4IA 1AL21 4HVQA 4QU2A 1KD7A 4DY5A 1WW7A 3VZOA 5FQ0A 2RMU1 1RUC3 1RITA 5HI0A 1LULA 1F31A 1Z7S2 2ZACA 4XEZA 1Z7S1 3H1MA 3JBG3 2E6VA 3KS7A 4KG0A 5FREA 4CDXC 2ZX3A 1MQTA 1UKRA 2IXJA 4XHXA 1TMF2 2YYOA 1N3OA 3H9AA 1ZZ9A 5SV5A 3EXUA 4HBNA 1QJY3 1YFXA 2OW4A 3HD8B 1BEV2 1UCXA 4KU7A 1RGSA 2ILMA 1ZRDA 1YJKA 2Q4SA 1AVBA 1BBT3 3SLIA 3FX3A 3PVEA 2DCJA 4DNYA 1DQ0A 4QPGB 1ZBE3 1UF2C 1BMV2 1MEC2 1RUE3 2WNUC 2BBVA 1MZ5A 2ZGKA 1QNWA 1MZFA 2OYZA 1BJQA 4KWKA 5CFCB 3JBG1 3JBG2 4SBVA 1LCLA 5BPXA 5CADA 1HLCA 3DF0A 4AI8A 4N7UA 4AQTA 4IEOA 4Q0VA 1AXKA 2YV8A 1AJOA 4PIXA 1HKDA 4LE4A 1NQJA 4KBBA 2VU9A 3ILRA 4H3WA 4DMIA 1BYHA 4C0HA 2DVBA 1DBNA 1SLLA 4CZSA 4Y26A 5IK7A 1KQRA 2EA7A 2WNEA 3ST7A 1NCRB 2CGPA 4EN0A 4BLIA 3ZFGC 3E6CC 3H7YA 2ZGOA 4IL7A 3D4KA 4Q0UA 4FPCA 1MS8A 2X29A 3MW3A 4YG3A 3CNAA 3J4UH 1B35A 3FLPA 2HEYF 5D8AC 1V9U2 1RJ8A 3HWJA 1BKZA 4MXWB 4AFCA 1ENRA 4Y4YA 5EXOA 3IPVB 4RS5C 4ISQA 2DF7A 4FOVA 2ZBJA 1ZRCA 5A3MA 1Q8QA 1C4RA 2XWBB 1LESA 3IN9A 1OQDA 1SQ4A 2FZ1A 4YG0A 4YFZA 4Z1VA 1AR72 4YGCA 2R6QA 3MIHA 2D3RA 4QPGA 1VBD2 2NMNA 5HCBA 2CYFA 1ZM1A 1COV1 2PYTA 5KBFA 3MDPA 4PLNA 2UYBA 4WVMA 5JSOA 4AEMA 2GN7A 2Z79A 3ZSJA 4W6YA 2R041 4MSVA 4X8PA 3WDYA 4AEDA 3J8F2 4RQPB 1HQLA 4BMEA 4G3YC 2WZPP 3TRSB 4Q4Y2 3O0VA 2YROA 1WMDA 4M3CE 4FPGA 2H6CA 3OY8B 3RZZA 3ZIWA 1LGCA 1K5MC 3U4XA 4IV1B 5KHKA 4PJYA 4YVSA 4D7YA 5BNOB 2B46X 2E53A 2FHRA 2XJQA 1C8NA 1FNYA 4JRAA 2ARXA 4RA0A 1UU4A 2MEV2 1KDKA 3BPZA 1AL23 1CJPA 1COV3 1ZA4A 4WM7C 3RNSA 2D6LX 2X53S 5CAZA 5C33A 3AFGA 4YRDA 3DPRA 1UD1A 2DWRA 2GU9A 1O4ZA 3B93A 3JD71 5DZFA 3WDVA 1UU6A 3JB8A 4AW7A 2HWF1 4RHV2 3WW1A 3VL9A 5BNNB 1OLQA 5FMOS 3ZFFC 2ZOEB 2LM3A 3ZFFA 1F5JA 1Y7BA 4S2HA 2GC1A 2D6NA 1SACA 4Z92B 2D6MA 3ZX7A 1AYN2 1JXNA 3MLLA 3TNPB 4HSLA 4R4ZA 1DZQA 1I3HA 1C3HA 2WZR2 3SH4A 2YZ4A 3ES4A 4XJ9A 5F6LB 3JD72 2W0XA 4AQ2A 1QF3A 4CDXA 2WSVA 4MUVA 4FPYA 4TLFA 1CD3G 5C8WA 3VZKA 4FXGB 1CAXA 5JAXA 2NP0A 4YW1A 2GNTA 4OVEA 4IXLA 4R8HA 5ACA1 4L99A 4AGRA 3VBRC 5EZWA 1CAWA 3NV2A 5EJ3A 2XBO3 3EQEA 2TEPA 3KLSA 4K21A 2IWGB 4EV0A 1TME2 3ZO0B 2IXKA 3OBRA 4LBNA 5ABJC 2WJSA 3QLQA 1NY72 1SEFA 1QQP1 1RUJ1 1ND3C 2A6YA 3ETQA 5BYNA 1ZVFA 1EV13 3BU7A 3DUIA 2WKKA 5L73A 3WW4A 4AHWA 1B09A 5JOXA 1N47A 1N3QA 1R092 2VULA 3APBA 4XW3A 4E27A 2DCYA 4META 3CJIC 3WY6A 3WW3A 1N1TA 2JG9A 4Y20A 2P3KA 5FQ0B 1ND2A 1I1EA 1BZWA 2I2SA 4GB31 2FZ2A 4GB32 5FLIA 2XH6A 1VP6A 1SLIA 2B5HA 3WDWA 4H55A 3HT2A 3J8F1 1YCIA 2B42B 4ASLA 1PK6A 4UW4A 4B3NA 2BYVE 1RUI1 1YRZA 1R1A2 1EY2A 1KJRA 1W6NA 4HN1A 4WZCA 2OZJA 2XJTA 3V0BA 2Q0AA 4Z07A 5IK5A 3NO8A 4JCKA 2XB6C 5ABJB 1SBFA 3WCSA 5FFOC 4COYA 1IS3A 4MH0E 4N9HA 1AYM2 1Y43B 4P9XA 2HWD1 4AVVA 1VBD1 3AP9A 4YSFA 1LKNA 4ES9A 1S0EA 1O7FA 1J58A 3D5OA 2Z5WA 4XJUA 4FQZA 4XJ8A 3VN4A 1K5MA 2WZR3 3IDBB 3R4DB 4WVMB 2AREA 5BNPA 5K0UC 4Q4Y1 2R30A 5CIRA 3WQ7A 3AK0A 3JQWA 4PIZA 4BIOA 1IKPA 1A8DA 1LEMA 3KM5A 1VR3A 2Q1MA 1MS4A 2PFWA 1H2MA 1RUC1 3R6SA 3RG0A 2D97A 2HWB1 2BWCA 2O1QA 4IEVA 2MEV1 3KCCA 4B4QA 4AGGA 1RHI3 1ZZCA 2HWC2 4LHKA 1GNHA 1PZ7A 2G9FA 1RUG2 4PF5A 5K7PA 1MZEA 1W6QB 5JOYA 4H7MA 2BW8A 2QZ2A 1DZRA 4HK9A 1YXWA 1H2NA 5C9AC 3FBMA 1BQPA 2WZR1 5JVVA 3USUA 4HSJA 5KXCA 3BTAA 3V0BB 2ETEA 3N7JA 2XUMA 3M3IA 4PIYA 4A7YA 3I54A 4XFAA 4WM8A 3VDDA 4E9KA 3AMHA 1GQHA 1VBC3 4ONUA 1FATA 1JTZX 2I45A 1CPMA 2KA3A 1OFSA 1GR3A 4WVVA 5FCCA 1R082 5KXDA 1XNKA 1ULGA 4AFAA 2O0OA 4ORFA 4QPIA 3DKWA 1RUD1 4N53C 2JECA 4RQPA 3AZYA 2A6WA 3KT1A 4QT6A 4S2GA 4YGEA 1Z0HA 1HIXA 4YW3A 1MQTB 4CRQA 3AYDA 4GULA 1M4WA 1PM7A 4XPVA 1CAUB 3W9AA 2AYHA 3VKLA 4HPKB 2VUJA 2ZZQA 3K48A 3RYKA 3AXDA 5T5JA 4C0BA 5I8YA 4PBPA 4GIQA 1OI6A 4R4XA 1FMD2 2D6KA 3J26N 1UU5A 1LOBA 3AP6A 4B4PA 2JE7A 1C5IA 1QWRA 2VMIA 4BHPA 3O0XA 5F6KA 2C0ZA 1F9KA 2VY0A 2HWB3 1V9U3 5A32A 3S6PA 5JI9A 4WZFA 2QNKA 2MHFA 4L11A 4XF4A 4YM1A 3DPRC 1UIJA 3H50A 5CFCA 2OPKA 4Z8BA 4FVVA 1ZYBA 3JU9A 4K1ZA 2WNVC 2YGMA 4WM7A 5A33A 3R05A 3VBOB 4C90A 5B2GB 2NQYA 5K0UA 2XVLA 4HETA 1XNDA 1RUH1 4AEJA 4A7KA 2D98A 2VW2A 2AH2A 1LENA 3ZDSA 1J3RA 2BNNA 4MV2A 2RS32 3CO2A 3UKNA 4M0NA 1NCRA 5CU1A 5DUXA 2E7AA 2Y38A 5FBZA 4DRRA 5BV6A 1G6NA 3ZYGA 4XETA 4FOQA 2CY6A 2D5FA 1DIWA 1U12A 2JICA 1ZBA3 1X36A 4DS0A 1LJ7A 1LOCA 4XOGA 1G9DA 2R0FA 1CAUA 1QQP2 1WGPA 1C28A 1H8TA 4XJZA 5D8AB 4WV8A 3IDCB 1RINA 1BBT1 1BBT2 3U07A 4XBLA 2WS91 5EWSA 3D0JA 2HWD2 2Q1ZB 3OGGA 1G9AA 2UWCA 4CP1A 1MS3A 3U0ZA 3S30A 5JSRA 4QPIB 1RUG1 5JPMB 3SISA 1FPN1 1H1MA 3PTYA 4W6XA 4AVAA 2VPVA 4IV1C 4BE3A 2CAUA 2VW0A 3B3QE 1PGL1 2C9AA 3WUCA 3WV6A 1UPIA 3OPZA 1DGRA 2VXRA 1H8TC 1ND2B 4FP3A 4FPJA 4EN9B 1SCSA 5BNPC 4R9AA 2EIGA 1VB2A 3LCPA 1WLWA 2XLAA 2BQPA 4E2QA 2PHFA 1AJKA 1DQ6A 1FPN3 5GALA 1N1YA 1UZZA 4KGGA 3WP6A 2BWAA 1R1ZA 4M0HA 1SFNA 4CDWC 2RR12 1G9CA 3DGTA 1WD4A 3BALA 4MZUA 4AFMA 1S0GA 4A7ZA 4RGGA 3FC0A 3URFA 1COV2 3GBGA 2WT2A 3TYJA 2PQQA 3GALA 1RUF3 2IXHA 4YG6A 3E6DA 5J37A 1W6QA 5A32B 1YNAA 1CVNA 1UMZA 1N1SA 3MPPG 2GC2A 5KC5A 5I0RA 1U0AA 1XYPA 1QY4A 1DHKB 3JCIA 1G86A 3EO6A 1Q56A 1S0JA 3ZYRA 3ZSKA 4Q4V3 2ZX4A 4V1PA 5D1IA 3KZ4C 2YDEA 2BFUS 4WM8B 3VDDB 1OLRA 3WLUA 5F1RA 4FPHA 3WQ0A 2XVGA 4Q4Y3 4FO9A 2EXHA 4J1WA 5BNNC 1NA1B 3E5QA 2RMU3 3ZFFB 3ME2A 5JOWA 2HYKA 1C8M3 2RMU2 3N35A 5FPXA 3OJBA 1CR7A 2C5DA 1GV9A 2YMZA 3ZFEB 4GKYA 1VLNA 1I9RA 5JDBA 1W6NB 2R063 3WG2A 4QQOA 1ENXA 3NKTA 4YNIA 4RSUA 2D7FA 2DVDA 2CWSA 3WP3A 4K40A 2O8OA 1VRH1 1T6GC 1VRH2 1V6IA 5KHIA 4IEZA 1H1AA 1AXYA 2BPA2 5ACA2 4R9DA 1JYIA 5GZGA 1IS6A 1LRHA 3NV4A 3ZYJB 4BIFA 1FOD3 1PGSA 5EYYA 1XRUA 2DFBA 3ZXJA 3AMNA 4FT8A 2K2SA 1H0BA 1V6OA 3JB4C 3ASIA 1F5FA 3VBUA 5L7OB 1D0HA 1RUJ2 2UU8A 4K20A 4XBQA 5I91A 2X5IC 3WNXA 3ZN5A 5BNQA 3QD6A 1VBC1 2OZ6A 2ZGPA 4MGZE 4D7SA 1MS0A 4Y5Z0 4K1YA 3QOPA 4J6GA 3PMSA 1C8M1 2ZX2A 1XU1A 4AEDC 1MS1A 4HLTA 3ZFEC 4HL0A 4CYDA 3D82A 2XJRA 2CNAA 4M3CB 5FOBB 4LUMA 5GM0A 4URTA 2GSYA 4FOWA 2QVSB 3C3VA 1H8VA 2RS13 1RHI1 1VBB1 2R1DA 4AG4A 4E4SA 1REFA 4FSJA 3ZN6A 1NE6A 4HPKA 4JGZC 3VBHA 4QQLA 2E7QA 5FO9B 1AR92 3LGRA 5C6CA 2A6VA 1WA4A 4YM0A 2W52A 4FCAA 3A0KA 4Q0QA 2H0BA 2GNDA 1ZRRA 4Q4W3 1YFWA 5DDJ1 1GICA 4JV4A 4AVBA 4RFT0 5I0UA 4AVTA 1QJY2 2ES3A 4KGQA 1CN1A 1QJY1 1W2UA 1JN2P 1QJX3 1QQP3 2PHLA 5L7OC 3TAYA 2A3XA 1RUH2 4NN0A 4DY3A 1PVXA 4XIOA 2OIIA 3AJYA 1HDKA 1RB8G 1IPKA 1POV3 3B9IA 3B94A 4I01A 2UWBA 3MPBA 1QOSA 4JVAA 3ZXGA 5L7OA 4AEDB 1NOVA 1GNZA 2DCKA 2RS33 3AKPA 4H7LA 4YM3A 1WLCA 4Z2WA 4XF0A 1ZREA 4AWDA 2WT1A 5K0UB 1HRI2 2UY9A 4UBHA 3L2HA 3TN91 1Q8PA 2W08A 3A4UA 4ISRA 1Q3EA 5CG8A 3MICA 3UJOA 3GF6A 3UL2A 3AKQA 2HWE2 2VOXA 2XVKA 1ZZ7A 5C9AB 3OYWB 1QXRA 4XF3A 2IC1A 4BPZA 1NE4A 1O3SA 1H9PA 4MX3A 2VNRA 1H8TB 1ND2C 3H1WA 1PO22 5GKAC 4Y1UA 2HWE3 3ELNA 3VBHB 2I74A 1WUVA 4MVTA 4QPYA 1NCQC 1D4VB 4NVPA 5EV7A 1FMD3 2A3WA 4KH9A 1ONAA 2JG8A 1DDLA 3GZAA 2ZGLA 1HRI3 1ENSA 4HFSA 2BNOA 5KWRA 3NV3A 1NLRA 1OQEA 4EJRA 2AENA 1HXS3 4J1XA 2OVUA 1ND3A 5I93A 3N7LA 3I59A 5IT6A 4OHXA 2DFCA 4YW2A 4L97A 3VGIA 2VQAA 3JUUA 4FPEA 3WX5A 5LRRA 2RM23 4P9WA 3UKTA 1QH7A 1RUH3 2A71A 2DTYA 3QH6A 4YM2A 1NCRC 3ZXFA 1PMIA 4AFDA 5DUUA 1RUD2 1EPWA 1V6MA 2RS52 4HKLA 2GH2A 3AZXA 3QCWA 4EWEA 3CJIB 4A2UA 5HCAA 4ATFA 1RUOA 2RR13 1TMF1 1LTEA 2OUJA 4AK3A 2Q5TA 4NO4A