4ZU7A

X-ray structure if the qdta 3,4-ketoisomerase from thermoanaerobacterium thermosaccharolyticum, double mutant y17r/r97h, in complex with tdp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
MLYNVALIKFKDIADKRGHLTPIEGKIDIPFDIKRVYYITKVDKDITRGYHSHKKLHQVLICLNGSVKIRLKIPDEEKIIELNDPSVGLYIGPLVWHEMFDFTEGCVLLVLASEYYDETDYIRNYDFYIDEAKKRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QdtA
publication title Bacterial Sugar 3,4-Ketoisomerases: Structural Insight into Product Stereochemistry.
pubmed doi rcsb
source organism Thermoanaerobacterium thermosaccharolyticum
molecule tags Isomerase
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05523 FdtA WxcM-like, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4zu7A00
4XFFA 3O14A 1ZRDA 4GULA 3E5UA 3BU7A 1DZRA 4EWDA 4D7TA 3I7DA 3M3IA 2O8QA 1NXMA 4MUVA 1QWRA 4YNIA 4I02A 2PQQA 3NW4A 2BYVE 4YSFA 1CGPA 3I59B 3DN7A 5K8SA 3RDIA 5KHHA 5JAXA 1EP0A 1YFUA 4F8AA 5KHIA 1PM7A 3B02A 4HVRA 4Q0SA 1H1IA 1LKNA 4ZU4A 1IPKA 1CAWB 2KXLA 4IEUA 2VECA 3FWEA 4I01A 2BGCA 4BIFA 4PIYA 2ZCWA 4XEZA 3D0SA 1DGRA 2GC1A 3GBFA 4FBFA 4QGMA 2V09A 4QM8A 4XFGA 4P9GA 1YHFA 4HLTA 1LRHA 1RC6A 4MV2A 2PFWA 2GAUA 3H50A 1O5UA 1NZCA 2XKPA 3CF6E 3LWCA 3OTFA 4YARA 5BUVA 3EHKA 5FQ0B 3IBMA 1L3JA 2OZJA 1ZZCA 5I0TA 5BPXA 1XE8A 5T3NA 2E9QA 1O5LA 1X7NA 3WW4A 1YUDA 2QCSB 1GQHA 4LA2A 4E2QA 3BALA 1JUHA 1OFNA 2D5HA 1OD5A 3UKNA 3CJXA 4TLFA 4R52A 5C8WA 1Q5OA 3E5QA 2HKXA 5C6CA 3DL3A 1IPJA 2IXCA 5J3UA 4AQ6A 2WC2A 3IDBB 1CAUB 3LA2A 4X6QB 4ORFA 4HVQA 5FLIA 2OZ6A 3ES4A 1O3TA 4J1XA 4PIXA 3CO2A 3E5XA 1RUOA 3SMHA 1G6NA 1U12A 4JV4A 4B29A 4Q0PA 4IEYA 3LAGA 1LB2A 4J1WA 3MZHA 3H1YA 2GU9A 1CAXA 2H6BA 4XFCA 4AVCA 5F1RA 3SCHA 4EWEA 1ZVFA 1ZRCA 4XFHA 3ES1A 5LRRA 5BV6A 3I54A 1QY4A 2UYAA 4IEXA 1UPIA 2C0ZA 4LA3A 1UCXA 1V70A 4IEPA 3H3ZA 1WLTA 5I8SA 4JTNA 4HN1A 2MHFA 2Y0OA 3SCGA 2IXLA 5J7MA 2XLFA 3BB6A 3KCCA 2QDRA 5JSOA 2VQAA 3ELNA 1QXJA 1ZX5A 2BNMA 3EQEA 3NL1A 1CAVB 1ZREA 5KHJA 2IXHA 5I0RA 3LA7A 1NE4A 3I59A 3C3VA 3HQXA 2UY9A 2B5HA 5I93A 3R6SA 1RUNA 3N4MA 4FT8A 4HSLA 3HT1A 2PTMA 3ZDSA 4WVZA 2IXJA 2K0GA 3D82A 4I0BA 3TNPB 5LEJA 2ZKLA 2EA7A 1WGPA 1CAWA 3ACLA 1J59A 2GC2A 1GQGA 4HSJA 2H0VA 5FPXA 3PLQA 4LEJA 4BH9A 4Z07A 1FI2A 2ETEA 4IEQA 1TQ5A 2PYTA 3BPZA 3CLPA 3RZZA 1OMIA 1YLLA 1RL3A 2I45A 3KSCA 3PVBB 1NE6A 4QMAA 2N7GA 1ZZ7A 2Q4SA 3FX3A 5FDBA 3GYDA 2D93A 5FQ0A 4IERA 1QXRA 3FFQA 1O7FA 1UD1A 3WW3A 4OFGA 5I8TA 5I0SA 1SFNA 4Q0QA 3USSA 3U0ZA 4H7LA 1RTVA 1Y9QA 2OPKA 4LULA 2H6CA 3H1WA 1O3QA 5BY5A 4O9GA 2PAKA 5JSPA 4WZCA 4XF1A 4XFAA 4KL1A 5CADA 4JVAA 4AVAA 3FZ3A 5CU1A 4KWKA 2BNNA 4R8HA 5FLJA 1Q3EA 3ROUA 2OYZA 5KHGA 3ETQA 1SQ4A 1EY2A 3IWZA 5I0UA 2DCTA 3WW1A 3QACA 4PJYA 4MZUA 3LOIA 1ZNPA 3S0MA 3E6CC 2GH2A 5I8YA 2XHKA 3MPBA 2XLAA 1CAUA 3EBRA 3IDCB 1H1MA 1X8MA 2IC1A 3IIAA 3PNAA 4XF9A 4EV0A 1ZRRA 3E6DA 4I0AA 4CYDA 3EJKA 3NVCA 2HJIA 1ZZBA 2ET1A 3U11A 1HW5A 5AVPA 3KGLA 3CEWA 4IETA 1X82A 2EVXA 5CVRA 1UW8A 3RPQA 2PA7A 5JSRA 2GZWA 1J3RA 4XF0A 3NKTA 2CGPA 1VR3A 2BEOA 5LEKA 3FHIB 1O3RA 3NSTA 2O1QA 2UYBA 2XLGA 1YWKA 3M70A 4QX5A 3EO6A 1XRUA 1ZZ8A 2Q0AA 3ST7A 2WFPA 3S7IA 1XE7A 2B9UA 1X8EA 2CAUA 5JCTA 2Q1ZB 1PMIA 3RYPA 2P17A 5JR7B 3H8UA 1O3SA 4K8FA 1DGWA 5E1RA 4Q29A 4LTAA 4MX3A 1EYBA 2EAAA 3H7YA 4AQ2A 4YYOA 1RGSA 1CAVA 2UY8A 2CV6A 4KU7A 1UIKA 4ONUA 4EROA 4XF4A 1ZZ6A 4I3PA 5LRSA 3OGJA 4DINB 3LA3A 3OD0A 1O4TA 2GC3A 4JTOA 1OI6A 2BNOA 2QVSB 1SEFA 1WA4A 4QXKA 3RYRA 4KU8A 3JZVA 4XFIA 4Q0UA 4MGYE 1ZZ9A 4HBNA 3FJSA 4LUMA 5EZWA 4FAHA 1J58A 4EWAA 4E2GA 4QM9A 4NVPA 3H9AA 3RNSA 5FLHA 4FAGA 5FCCA 3UKTA 4QGLA 1YFWA 4E2SA 1J3QA 1Q43A 3HT2A 1LR5A 1J1LA 5E16A 3KMHA 2PAMA 5J48A 2FQPA 4X6RB 2QJVA 2VPVA 3NJZA 5KHKA 4LUKA 3U10A 3VHRA 3QOPA 3TNQA 4N9IA 5EFUA 1I5ZA 2MPFA 4LLOA 3H7JA 1FT9A 3H3UA 4XETA 4MGIE 1VP6A 3HIFA 3MYXA 4UXAA 3SXWA 1J3PA 2OA2A 4AVBA 4ZU7A 2Q30A 4META 2IXIA 3L2HA 5KBFA 4HVOA 4PIZA 1FXZA 1YFYA 3UKVA 2Z69A 4HZFA 4KWLA 2IXKA 4L2NA 1VJ2A 1Y3TA 4N9HA 5HI0A 2F4PA 3KGZA 4MGKE 2D40A 2PHDA 5I91A 4IEZA 2ATFA 3WW2A 3MDPA 4L11A 4Q0VA 4I2OA 2CAVA 2FMYA 2XKOA 4XFBA 4Z82A 3SHRA 2XL7A 4I09A 4O9EA 3H1MA 3DKWA 2B8MA 4F7ZA 3E6BA 1YFXA 3SCFA 2PAEA 4IEWA 4YRDA 4A2UA 2QNKA 2PHLA 2MNGA 3FE5A 4MH0E 1CX4A 3D0JA 3DV8A 4WBBA 3CL1A 1CAXB 3RYKA 3G7DA 4KWJA 4MGZE 4UBGA 4RD7A 4AXOA 1DZTA 2D5FA 4IEOA 4HMZA 3S7EA 4D7SA 1UIJA 3OCPA 5BXXA 2Z2SB 1EPZA 1NYWA 2ET7A 3LZZA 4BHPA 4HN0A 1ZRFA 4OLLA 3BCWA 5D1IA 2GC0A 4IESA 4XF3A 2XGXA 3E97A 3OF1A 4QGNA 4ZU5A 1I6XA 2XL9A 4IEVA 4UBHA 2K9ZA 4BYYA 5FPZA
chains in the Genus database with same CATH superfamily
1OXCA 3SLIA 2EICA 4YM1A 3O14A 1GUIA 1ZRDA 1UYYA 4GULA 1OBNA 4QAWA 3WDXA 4AG4A 4CP2A 1DZRA 2WT2A 3ZIWA 1C8M1 4XYXA 1F4AA 2ZGKA 2ZTNA 4D7TA 1C5HA 1NXMA 2Y6GA 4LBQD 5C4WA 4BJ0A 2HWB2 4OHXA 4I02A 3VZJA 4MHUA 4BXSV 2JB8A 3FLTA 3AMHA 2PQQA 1OKQA 1YXWA 2VUJA 3POEA 1ODMA 4RHV2 5JPMB 3MW4A 3I59B 1RUF2 3VGIA 3DN7A 5K8SA 2AH2A 4Z1VA 2XJPA 3KWVA 2NLRA 2EXHA 3N3HA 5C9AB 2IWGB 4P9JA 3M2MA 5JMCA 3B02A 4W4ZA 1H1IA 1DQ1A 1STMA 1US2A 1FV2A 1RHI2 1YEWA 2ARBA 4NPMA 3MGUA 3NV4A 4WM7B 1LHVA 1OD3A 3HBZA 2Y38A 4W6WA 2KXLA 4J25A 2VECA 1NLRA 5FZBA 5FWJA 4BIFA 2W1SA 4PIYA 4E4HA 1E57A 4GXLA 4K1YA 2GC1A 4LORA 4EN7B 4B1LA 5JUVA 5FUIA 2V09A 3NNMA 4QM8A 1DGWX 4XFGA 2VW2A 3WCRA 4RHV1 1LGBA 2Y26A 5CZKA 2VW1A 5F37A 1ODNA 1AX2A 4QPGB 4BMBA 4Q1RA 4NMIA 2GAUA 5FXWA 2CDOA 4WVMB 4CCKA 3IMMA 4CZSA 3CF6E 4BCUA 4Q4X3 4QD2A 3OTFA 3ZYRA 1IQDC 4A7ZA 1UKGA 2ZHMA 3EHKA 1RHI1 5BNPC 1L3JA 2AYHA 3ABZA 1PNGA 1GWKA 5A7WA 1C8M3 1ENSA 4XCBA 1AXKA 3AX4A 3UJOA 4YGEA 4NRQA 1REEA 5AC92 4K21A 1AL0G 1O5LA 1QOTA 4NIIA 3WW4A 3HEIA 5CIRA 4N53A 3I3QA 5GZDA 4OMDA 1NUKA 3WINE 3CDZB 3GCXA 1LCLA 3GXUA 4BU2A 1N1VA 1JUHA 5IAVA 5JR2A 5EXOA 1K42A 4CCOA 4Y26A 1GWLA 4OULA 2WNVC 3TEWA 2GP5A 3VBFC 3UKNA 4CDUA 2NZ9A 1VMFA 2ES3A 2WNUB 3A4UA 4AEJA 1BCXA 2KA3A 3VBOC 1Q5OA 1A8MA 3JUUA 1RUH2 2ZX2A 3M3QA 1OOPB 2ZPXA 1IPJA 4LHSA 3ZN6B 5IVJA 2YUEA 5F3EA 1CD3G 1D4VB 2LALA 2WC2A 2WT0A 5JI7A 1EAH1 5AC91 4FP3A 4RS5B 3LA2A 4X6QB 1SLCA 1V9U2 5A33B 1GOHA 3WP4A 4ORFA 1N3OA 1RXGA 3BOPA 2OZ6A 4RHV3 4N43C 1LEMA 1RUF3 1LESA 3GBWA 3WNPA 3HVDA 1JYNA 4JCKA 4YVSB 1XYNA 2J1RA 3RZHA 3OY8A 2ADEA 3R4DB 1S1AA 4I30A 2H0BA 4JV4A 1U5IA 1RHI3 2ZEYA 1M06G 2JWPA 4YM2A 2BFUS 3S6PA 3WNMA 3RZLA 3JD71 2BGPA 4XACA 3T08A 1CAXA 4B7EA 3EXUA 2Q8EA 4AVCA 1JTZX 1PIV2 1IQAA 3LFIA 2W47A 4GH4C 4NOTA 4Q4Y1 5T54A 5C3PA 2EAKA 4OUMA 2XJTA 4S2HA 2YDEA 4XFHA 4QDRA 1V9U1 4NAMA 1DGLA 4PLMA 3KV6A 5LRRA 5BV6A 1Y9GA 2E7TA 1RVF1 1QOOA 5BNOC 1XYPA 4UI9L 4QPIC 3QCWA 3AYCA 3I3MA 3KV4A 3VBRB 3O7OA 3SNMA 1BK1A 5A3LA 5AFEA 4XUNA 1RIRA 3OGRA 5GJ6A 2Q8OA 1UCXA 5FP4A 2CWMA 3VHNA 1OLME 5FYIA 5I8SA 5ACA1 2R16A 2ZGNA 3PU3A 3WCSA 4HN1A 1OKOA 4PT6A 3SCGA 2QQPA 5AC93 2IXLA 3RMYA 5J7MA 5IVYA 1GZTA 4W65A 3ZKYA 3V0AB 3KCCA 3LKJA 4LO8A 3K4AA 2VQAA 2AR6A 3ELNA 2X5IB 1ZX5A 3ZYBA 5FZ7A 3WNXA 4QB2A 2J1UA 4LIUA 1W6PB 4AK3A 1H1AA 3O5SA 2PQSA 3H8XA 1NE4A 1OLQA 3I59A 3GZTB 1IPSA 3C3VA 4ITCA 1OUSA 3AYAA 2C24A 4C0BA 1US3A 5A3PA 1AYM2 5T52A 2QQOA 1UMZA 3UYJA 4BQWA 4CDWC 1AR92 2B5HA 5I93A 4FSJA 5C9AA 3FHQA 4WVVA 1RUH3 3N9PA 4K40A 1VLNA 3AC0A 1RUD2 4LOTA 1QJY1 2X8KA 3ZYHA 5LA0A 2VNRA 4WM7A 5FYBA 2DTWA 2K0GA 3D82A 3LD8A 2ZKLA 3NJYA 3PVNA 3ACHA 2HWC2 4XQDA 2FCVA 4Q4W2 1V9U3 4R9BA 5A7SA 3K48A 3APBA 5CFDC 4DXSA 4QKFA 5FZKA 1O59A 1OC1A 3HQUA 1JZ2A 3NV1A 1K5MB 3KT4A 4Z07A 5JXIA 1FI2A 2XOMA 1GOGA 1HQLA 4XJUA 4KQ7A 1G9FA 3BPZA 1WKYA 5FZDA 4AHWA 1W9WA 4QPGA 1CVNA 1Z0HA 2VMFA 4NHLA 2W68A 3KSCA 4QKDA 1YI9A 2GH8A 4WVMA 4YW3A 2Y0IA 1AR91 4QMAA 4CA9A 3J7MA 1QDCA 3AFGA 1ONAA 3GYDA 1PIV3 5JXGA 2VZTA 1DGRN 1KXGA 4HANA 1O7FA 1UD1A 2VQ0A 4Q4W1 5D21A 2JEMA 1UYZA 4OFGA 2D43A 4LE4A 4DNYA 5FBZA 1MZ6A 1UU4A 4CU8A 5I8TA 2VXJA 3DGTA 1ULPA 3HNBM 3U0ZA 3KLSA 2R0FA 2YY1A 2TEPA 4QXBA 1RUJ2 2DUOA 2VQUA 2BWCA 2R1BA 2R1DA 3D6EA 3N9OA 3PURA 4QB1A 1O3QA 4WZCA 4XF1A 4KL1A 3VZOA 4B8EA 3HOBA 3ZR6A 1GP6A 4XDOA 2JG8C 3A23A 1L7QA 2Z79A 3SH5A 2PMWB 4ISQA 1GMMA 2JG9C 2BNNA 1NLQA 2WNUA 4CP1A 1H4HA 3FUQA 3ROUA 4JKMA 5EIYB 1SQ4A 3PDQA 1UX7A 3IWZA 4KGQA 4AOCA 2P2KA 5JIUA 2DCTA 5FZ9A 1OOPA 3QACA 4HPKB 4CXXA 3ZN6A 1WBFA 1KDKA 2R072 4BQ2A 1R081 2GH2A 1OLRA 3MPBA 3WNOA 4RS5A 3EBRA 3THCA 4FPKA 1H1MA 2Y34A 2LW8A 5FIXA 3IIAA 5A33A 1VMHA 3U4SA 4WM8C 5L19A 2ORZA 4XMIA 4H55A 4B1MA 1UY2A 5LY1A 4NPLA 2C1FA 3THDA 3RS6A 1RUJ1 4I0AA 3WNKA 3KQRA 3VN4A 2TBVA 1AYM3 1LOEA 4XXAA 2FD8A 1AR93 3WNNA 4YVSA 2ET1A 2ZA9A 5JMOA 5C5UA 1H9WA 4Z92B 1RUD3 4NIGA 1UN1A 3C7GA 5FXZA 4AFMA 3KGLA 3CEWA 3I3BA 4QQOA 3HMYA 1X82A 4OMCA 4RR3B 2HWC3 4GMP1 4AVSA 4Q4W3 4JAAA 1MVQA 4ZHNA 3AKQA 4MGSA 5FP9A 1PNFA 1WD3A 1PK6B 2GZWA 2V4VA 3W59A 5SV8A 1BMV2 2ZBJA 4XF0A 4YW1A 1LOCA 2BEOA 3NMBA 2KR2A 1PZ9A 3WXPA 3RFRA 4DMIA 2ORXA 5T5OA 4MXWB 5C70A 3U14A 2RS51 4D8MA 2O1QA 3DPRC 3K46A 2XLGA 2TNFA 3VBRA 3ZXGA 2K2SA 2QKDA 3M70A 4DZGA 1ZZ8A 2VL4A 4XZPA 2JIGA 1LOFC 1YJLA 2OPWA 1MS3A 1POV3 2A70A 2NQYA 4DUXA 4NRPA 2BQPA 4ES9A 4E4SA 4GALA 1DYKA 1WMEA 2LROA 3HR9A 2WRAA 5HCBA 5GZFA 1QXPA 4C1XA 2QQMA 2FCUA 2FCTA 3D8CA 3PMEA 4DQAA 4IV1C 5FY9A 5A80A 1O3SA 3F95A 4K8FA 3V0AA 5FZIA 5FPUA 5C3QA 4IE7A 1BMV1 1NCRB 4Q29A 3PUAA 4LTAA 5JPNB 3WF3A 2X5IA 1RYYA 1JYTA 2EXKA 2A6YA 4V2WA 1RUJ3 1DG6A 1UMHA 2BFUL 1HN0A 2YROA 1S0JA 1W6PA 1RGSA 2RMU1 1JZ6A 2HWF1 2QTWB 2VMHA 3MW3A 1K45A 1UOFA 2YGMA 4JKKA 3AMQA 4A7YA 5C8CC 4CSWA 5IVVA 1KQRA 1RITA 2WYFA 4LKDA 1W2AX 1OHFA 1S0BA 4O7XA 4FQZA 4XF4A 5APAA 5FZHA 3VKLA 4AEDB 5JXJA 2V5DA 4DINB 2VOKA 1S0EA 3AP4A 4GMP3 1LGCA 4U36A 5F39A 4BOWA 5F3CA 4D6QA 5IVBA 2G4IA 1SBEA 2BV4A 3DUIA 4FPFA 4QX7A 3V65A 4CDQC 5FZCA 4MGYE 1NAEA 5D8AC 3KHCA 2D3SA 2YYOA 2VBPA 4MYEA 1J58A 1UY4A 1AYN2 2RS53 2YG0A 3ZFEC 5CFCC 2DVGA 4E2GA 3GDBA 2YMZA 1K5MA 5FLHA 2AC1A 3AVRA 4QPWA 3J9SA 1PZ8A 4ZKTB 4LOSA 3J8F2 4QHZA 4FTEA 5FCCA 1DCSA 1OVSA 2DVBA 4QGLA 1YFWA 5FUPA 2CDPA 1GNZA 2WT1A 4OHZA 1ND2C 1W6QB 2UWCA 5FOJB 4A6SA 1DQ0A 4LR4A 1OLMA 4TYSA 2JE9A 2XPJA 1VBE1 2FQPA 2QJVA 5JI9A 3DECA 3VBHB 4C1WA 3U10A 1COV2 1GBGA 3KVAA 3QOPA 3ZSKA 1C1FA 4FO9A 1LGNA 3VDDC 3WP6A 1TMF2 2ZGRA 4LLOA 5FZ6A 1W3VA 1AYN1 3H7JA 1WMXA 2E7QA 1FT9A 2ZKNA 3PUQA 4RQPB 2FDFA 5LB6A 3UT0A 4K3UA 2VXRA 2HWD2 3SXWA 4PHZA 4AVBA 5HCHA 2GMMA 1EUUA 2IXIA 1GICA 1Y43B 3HWJA 4HVOA 1W2TA 4JHZA 1YFYA 2JDHA 4KWLA 4L2NA 4PCRA 5J96B 3POBA 1KJRA 4QU1A 4CCJA 4MGKE 2VGDA 2WZR2 4LLFA 2P1BA 1H4GA 4L11A 1QHDA 3MLKA 2RVAA 3M4FA 3MIBA 4LK6A 4ZY9A 3HJRA 3JQWA 1W9FA 4I3GA 5C3OA 4Z82A 4HPKA 1COV1 4I09A 4I2OA 4E9KA 2RR12 3FMGA 3NAPC 2B8MA 4F7ZA 1LU2A 1C3HA 3LSDA 4FFHA 1OQEA 2PHXA 3U1XA 2PAEA 4IEWA 4BQ4A 4E27A 4D3WA 1W99A 4FPHA 1BVVA 2WUHA 5FKBA 2HWD1 3T3YA 4HONA 1SCRA 3T0BA 3WQ1A 4BDVB 3CZJA 2O0OA 1EV11 3PU8A 3D0JA 2D7FA 2RS12 3DV8A 2YHJA 5DAVA 3IAQA 5A32B 4CP9B 5DN2A 3RYKA 2JDNA 2RJ2A 4YZ5A 3G7DA 4KWJA 4FPEA 4UBGA 3RWKX 2JDUA 4AXOA 1VBC1 2CWSA 3C7HA 3OPZA 4OI1A 3C7FA 2OXBA 3D3AA 4HMZA 4RR3A 1W39A 3AVSA 3WG3A 1UIJA 2KD7A 2GSYA 2VMEA 2YC2A 3AP5A 1AYN3 4M3CB 1RJ8A 4BB3A 4ASMB 1PVC1 5BXXA 5LATA 2PHTA 2RR11 1PK6A 3W5MA 1QKQA 1HV1A 3LZZA 1NYWA 5C5TA 4RFRB 3PUIA 1UKRA 3THTA 4S2FA 1GKBA 3MF9A 2Y64A 4KWUA 3J8F3 3CKHA 4LBNA 4MXWA 4K1ZA 2YV8A 1QOSA 1URXA 2OT7A 2OX0A 2JIJA 4XPVA 3NNFA 3UL2A 4QGNA 2WKKA 1LNSA 3LEKA 3ZXAC 1ZBE2 2RJKA 3M1HA 4C90A 5FPZA 1W0PA 4COZA 1FNYA 3AYEA 3SKVA 1COV3 3VD3A 3VL9A 4EWDA 3I7DA 4YVWC 1TMF3 2O8QA 4YNIA 4LBKA 1G9BA 4YW7A 4R9DA 4JHTA 4AAXA 3E1F1 2QDNA 3SH4A 1BEV1 2GN3A 2O8OA 4P9LA 1NCRA 3NW4A 4CDUC 3MHZA 2HWD3 3AK0A 3RDIA 4IGQA 3DYPA 1ULOA 4MVTA 3SITA 3DYMA 3AXDA 4Q4V2 4RGAA 4AVVA 4Q0SA 2LS6A 3J4UH 2IZWA 3T30A 3EYPA 3RQ0A 4AEDA 5JOXA 2A75A 1LAJA 1DLLA 1VBC3 4ZU4A 5BNQA 2Y60A 2WZR3 4A45A 2AUYA 2BBAA 5GLVA 3POIA 1IPKA 4I01A 3FWEA 3CU7A 5HXVA 5IHRA 4FPJA 4XEZA 3VBUC 1W8FA 2RR13 1C28A 2A5ZA 2YXSA 4DEVA 1N1TA 4FBFA 1KD7A 5EJ1B 4BIOA 1OF4A 4L99A 2RDSA 1LRHA 3ZIXA 4MOAA 3BKZA 5IFPA 3WZ1A 2GNMA 3H8RA 1NQDA 1NA1B 3K4ZA 1FPN2 1Z7S1 3IPVB 4GIQA 2P3YA 4Q4V1 2V5YA 1S0GA 2VZRA 4NJ4A 5LK7B 3GHMA 4FTBA 3IBMA 1YC61 3ZMNA 1JYVA 5FYSA 1UMIA 2IFRA 1W6QA 4TLGA 2OZJA 4Y1YA 5I0TA 1ULFA 1X50A 3ZSMA 1H2MA 1HN1A 2YBKA 3IM0A 3ME2A 5L9RA 4FTSA 2P3KA 3B01A 3VV1A 3HNYM 3VBHA 3T0DA 2XVGA 1DLCA 3MBWA 4GWNA 1GQHA 4FCAA 4LA2A 3LPFA 4E2QA 1YRZA 5F5CA 2EALA 2DFCA 2Z5WA 4RQPA 3B00A 4GA9A 4MADA 1HRV2 1OD5A 1FPN1 1OF3A 1UYXA 1TME1 4YZ4A 4HKWA 4TLFA 1ZBE3 3KHBA 2J1SA 1QGLA 4R52A 4COYA 2AEYA 2V72A 4KBZA 5J98B 3OJBA 3KT1A 1XC6A 3B69A 2DCYA 3O1SA 2IXCA 5J3UA 3FN9A 4AQ6A 5FOBB 3B94A 2O14A 1VPHA 3MW2A 1HJGA 3SC7X 4MSVA 4AE2A 2CTVA 1AJKA 1R091 2YFUA 4QXHA 4HVQA 5EPAA 1N3PA 4A3ZA 1K12A 2EF6A 1PM4A 1ULCA 4J1XA 4PIXA 5H9RA 1E5HA 4CEWB 1UZZA 2A73B 2BGOA 4WV8A 1ULGA 4BE3A 1Z7S3 5EHDA 1HRI2 3VB9A 2ZX3A 1Q8QA 4Q4V3 4GMP0 2HBUA 1YQ6A 2JD9A 1HRV1 4XTMA 4WM7C 4B29A 3MEPA 3CBNA 3VKNA 1LB2A 5EJZB 4Y3OA 3PTRB 1XSRA 2WWUA 4CP9A 5A32A 5IK5A 3POYA 2RE9A 4CTEA 4UFMA 4WZFA 2W1WA 5GLTA 3N9LA 3QH7A 1ZVFA 3PJQA 4ZONA 3JXSA 3CJIC 1C5IA 3LOBA 5CKNA 1SCSA 4M3CA 4OI4A 3WQBA 4Y20B 2DCZA 4AHZA 1LJ7A 3FBMA 4QPGC 1DFQA 4DY3A 5T55A 3VHPA 5CG8A 1QY4A 1A8DA 1FPN3 3LCPA 2VUDA 4R4ZA 2UYAA 5EP9A 4UYBA 4Q4X1 3NWKA 5BNNB 3ZYFA 1UPIA 1D2SA 2GNTA 3KF5A 2BERA 2R6QA 3IIIA 3H3ZA 2W91A 2MHFA 2Y0OA 3SKJE 3T2QA 1Y7BA 4NIDA 3LDBA 3ZPYA 3L2YA 1WCDJ 4YW2A 1R093 3TRSB 3BB6A 2JICA 4W6YA 1NCQC 5EV7A 4XQWA 3C7OA 2NYYA 1ULDA 3BTAA 2XQRA 3ZFFC 3ZXFA 1AR61 2A6XA 3EQEA 4FFFA 2JJ6A 1TE1B 1VB4A 5ABJB 3S30A 4BWOA 1DU3D 4OI0A 2IXHA 1HRV3 2AZ5A 3ZN4A 2WNUC 3MIGA 3R4SA 4IXLA 3VD4A 3BODA 1CN1A 3WT3A 3DCQA 4OHVA 2UY9A 3BGAA 2ZMKA 1JYCA 2VUCA 1OOPC 1ULEA 3R6SA 1RUNA 2RV9A 2B4KA 1GWMA 3VBSC 4OQ8A 3NO8A 1JHJA 4LMFA 2ERFA 1N1YA 2P34A 1J83A 1DQ4A 2IXJA 3AKTA 3KS7A 1MS8A 2WNEA 2HWB1 4I0BA 2ZJCA 2EA7A 4QHOA 4AI8A 4LT5A 3ACLA 1J59A 1Q56A 2B45X 1JXNA 2CNAA 5A7NA 1RUF1 1F15A 1HB3A 2ZGTA 1HB1A 5JLVA 3SISA 4LEJA 2PN5A 4IE5A 4RSUA 4H7MA 4XBNA 4BH9A 3MICA 1CIWA 2VZUA 3ZYPA 5FYTA 2E26A 1HRI3 3PVOA 4YVSC 4COWA 2LTNA 3QLQA 1H8TC 4IEQA 5IAXA 3RZZA 3CLPA 4EYUA 4LBQB 3A0NA 2ZAAA 4DUVA 1NA1A 1G9CA 2QZ3A 4A6OA 2FDKA 3RJ2X 3NJVA 2YZ4A 3IPVA 5CAZA 1CX1A 3WHUA 2YB7A 2VR4A 4ZXKA 4D94A 2N7GA 3RI9A 4XUTA 4XJ9A 1HQWA 2Q4SA 2VMIA 2ZX1A 3OD4A 1UY0A 4KH9A 3A7QA 3U07A 3I4IA 4CPBD 4E8CA 4G3YC 1QXRA 1SBFA 3FFQA 4QX1A 5FFOC 3TB0A 1ZBA2 2OQ6A 2ARCA 1REDA 3QH6A 3R05A 1GSLA 1AR63 1GLHA 1H30A 2FMDA 1UF2C 4PDWB 4Z2AA 1G7YA 2P6CA 3VLBB 4CCLA 1E5IA 5I0SA 1QH6A 4Q0QA 3D5OA 5FO9B 4PBOA 3USSA 3OGGA 1RTVA 1Y9QA 2ZAHA 4LJHA 4A41A 3AP6A 1XU2A 5FZ4A 4DEQA 5L7OB 1R1ZA 5BY5A 1ZYBA 4JZRA 1JU3A 1NQJA 3FHAA 4XFAA 1VALA 2ZMLA 4OI2A 4CXWA 4GB32 1KEXA 1WA6X 5FMCA 4AVAA 4QU2A 1IG3A 5FYMA 1H2NA 1W9YA 3RG0A 4NHKA 5GLUA 1Q3EA 2VZVA 2YBPA 1QNYA 2JXAA 3I2JA 2HWB3 5KHGA 3ETQA 3GJBA 5FPVA 4AF9A 1EY2A 1X36A 1HXS2 4IDZA 3I2HA 3SQOA 2JE7A 4JRLA 5FXXA 3E6CC 1UZYA 3I3DA 1LENA 3VZMA 2CGOA 2LM3A 3IDCB 2IC1A 3PNAA 3HBKA 1BYHA 4UFKA 4CEWA 4CYDA 1U5YA 3AP7A 4NUBA 5F7UA 2V73A 5GZCA 1YIPA 1H0BA 1RUH1 1W03A 3KCYA 4KG8A 3U11A 5F3GA 4XURA 3T4VA 1O4ZA 1O8SA 4PLOA 5F9TA 5J36A 5IK7A 4IETA 1OURA 2A7AA 3IDAA 3MUZ1 5FP3A 1UXXX 2QQLA 1IOAA 1IKPA 1UW8A 3JQXA 1HXS1 5F8PA 4NRMA 1SLBA 4HK9A 3EB7A 3GZUC 3UK9A 2NMNA 3POGA 1K5MC 3WHTA 1XU1A 4H3WA 3LFMA 2Q8CA 5BNPB 3NKTA 4C91A 2JECA 2CGPA 1V6JA 4XUPA 1O3RA 5DG2A 2RHPA 1DYOA 5JOYA 4Y20A 2JDKA 4GJYA 2W39A 4GJZA 1XNKA 1W6OB 4AHXA 2D44A 5LBFA 3NV2A 1QJFA 4D7YA 1KGYA 5FY5A 3EO6A 4AI0A 2YU1A 3FC0A 1QNWA 4LKEA 3T4HB 5BNNA 2WFPA 4AQSA 4QX0A 1PIV1 3I8TA 4XHXA 4H2AA 2RS32 2W2IA 2XJQA 4P9IA 1DIWA 1WBLA 3W5NA 2K46A 5EQUA 2WNVB 2Q1ZB 1PMIA 4QPYA 2WO1A 2P17A 1ZBA3 3FUOA 4QWNA 5JR7B 3RYPA 3ZMOA 4BM8A 4NR1A 2B9VA 1ZRIA 1QH7A 3INAA 4Y1ZA 3KV9A 2X53S 2ZGSA 5E1RA 5FJKA 1JOJA 4UW6A 4OCTA 3U78A 4YFWA 1EYBA 2A6ZA 2LRPA 5GLWA 2WA4A 5A6XA 4AQ2A 3A21A 3POFA 5ABJA 2CV6A 4GB33 2NN8A 1UIKA 4QX2A 4UFHA 3Q8BA 2V4AA 1AHSA 3AZYA 4N43B 4I3PA 3X29B 1CZVA 1D0GA 3N36A 5LRSA 3IDEA 1GNHA 1LU1A 2XWJB 3QBQA 5DAQA 3MUY1 1HXS3 2GC3A 1V6KA 4IE6A 4RYDA 1OI6A 2QVSB 4ZS2A 4NE9A 3ZN5A 2VULA 4EROA 3TOJA 3R4UA 3N7KA 4KU8A 4XFIA 4FPOB 1LODA 4Q0UA 5FR3A 1ZZ9A 1HJFA 3FJSA 3ITQA 1JODA 2WR9A 4LUMA 1J1TA 4FAHA 3KV5A 1S4CA 4CRQA 3CMGA 4QM9A 5KXDA 2VO5A 3LQCA 1MS9A 1AYM1 5DAPA 4GH4B 5CB7A 4FOYA 2VOWA 4S2GA 2XJSA 4YGBA 4R9CA 1RUD1 3FL7A 4DO0A 1FOD2 2XWBB 4LBQA 5AVAA 3HT2A 1YQCA 5A1LA 3WR0A 3O1RA 1LTEA 4BLJA 1P8JA 1SHWB 2HWC1 3FBYA 4LO7A 4QPIB 2HLEA 2QQNA 5GZGA 4B4QA 4FXGB 5A70A 1MVEA 5FZAA 1W0NA 4INDA 5K7PA 1UYPA 4X6RB 2VPVA 2JE8A 3NJZA 2OVUA 4QB6A 1UQXA 2EXJA 3A0KA 5FZGA 4YGCA 5KHKA 1B35C 5FMDA 1CR7A 1UY3A 1QQP2 5EFUA 1I5ZA 2ARAA 1YCIA 4PDWA 1AJOA 5G04L 1SBDA 2G19A 1Q8PA 1W9TA 2VCCA 3I2DA 5IK4A 2WFF2 3MYXA 3ZXLA 5L7OA 4LXLA 4CE8A 1ZA7A 1WD4A 2Q30A 4META 1POV1 1AXYA 5C3SA 1FOD1 2W46A 3RI8A 1FXZA 3VZNA 2RS33 4HZFA 3AXEA 1JOPA 1XNDA 2VVDA 3IMNA 1TZOA 4K9SA 5HI0A 1W2OA 4M01A 4BK4A 2FDGA 2D40A 4Y1VA 4K8RB 1XBFA 5I91A 2HBTA 3ZSJA 2PHFA 5DAWA 3MDPA 5LASA 2XMLA 1OFSA 2BOJA 4A4AA 2VCBA 3Q8AA 2CAVA 1XOYA 2FMYA 4MHRA 4CDWB 4CCEA 4XQ4A 3ZFGB 1CQ9A 2WZ8A 3AZXA 2VQTA 2VMCA 3CIHA 2ZHNA 3G6JB 3H1MA 4PF5A 3V64A 1VBB2 3LEGA 4TXWA 4AYUA 2CU5A 3E6BA 3GM8A 1W8WA 4MO3M 1MS4A 5FJHA 3BN6A 3ZPOA 5A7QA 2WFF1 1SFPA 5IW0A 4XJ8A 4ZZ8A 5CFDB 2PHLA 2MNGA 1NZIA 5LCWL 4CCMA 3DEMA 3WP5A 2RDNA 2QQIA 3H3LA 3CL1A 5F3IA 1R64A 1ASJ2 1WCUA 1W05A 4DXTA 5LBEA 4LQRA 2YGLA 1U0AA 3N7LA 4P02B 2R062 5FY0A 2R071 4MGZE 1VBD2 2J22A 1KITA 1MZFA 2IVJA 2ZACA 4IEOA 1OA3A 1GP5A 4FPCA 4Q8KA 4D6SA 4BLIA 5D2AA 2WDBA 4D7SA 2HEYF 2Y6HA 4R9AA 3LF7A 1FX5A 1UAIA 4AEKA 5A3TA 2KM2A 1EPZA 4Q5OA 3RMXA 3UESA 2QBXA 3C7EA 4BHPA 4YZ1A 5FZEA 5BNPA 1N1SA 3DKQA 2ZOEB 2BP6A 3DXUA 3AMMA 4OLLA 1PX3A 4XXPA 3BCWA 2DUQA 4P14A 2GC0A 2UWBA 1AUYA 4IESA 1KFUL 4NWWA 1FOD3 4AI3A 3U75A 1X9PA 3K3OA 4CEYB 1W6OA 2W1UA 2GNBA 4ZU5A 3OYWB 1C1LA 4IEVA 2K9ZA 4UBHA 3JU9A 3MO4A 4Y22B 5DAXA 3THPA 4Y24A 3W20A 2ADDA 1QJEA 1LHWA 2WO7A 3AMNA 5ISLA 5A3OA 1OPOA 2YPJA 4XFFA 4GKYA 3T2PA 3VBHC 2A1XA 3E5UA 4ASLA 3BIWE 2VCMA 3BU7A 3OBTA 2ZGOA 2WNVA 4JGZC 3VBFA 1QQP3 3WG1A 3M3IA 1CZSA 1W06A 4MUVA 1QWRA 4SBVA 5JZGB 5E89A 1JI6A 2EIDA 2WZEA 5CKMA 5IJRA 3VDCA 4FP2A 2D97A 4CUCA 2E6VA 2WFF3 4Z2WA 2BYVE 4YSFA 4DUWA 1CGPA 2BVVA 3OEBA 4LNVA 3ZR5A 3TN92 3TEYA 4PF1A 3VZKA 1EP0A 5F32A 3J7LA 5KHIA 1PM7A 1N3QA 1W8HA 4WM8B 2R073 2ARXA 4N43A 1A78A 1NKGA 5GLZA 1VE0A 2IFWA 2OUJA 1H2LA 3OSDA 1Y9MA 5L9BA 5CEHA 2WN3A 3NNGA 4D0QA 1W2UA 2ZCWA 1W3XA 3D0SA 4HL0A 1DGRA 1HQNA 1SMVA 4BK5A 1OUXA 1TNRA 3FLRA 3WDYA 3GBFA 4Y4RA 4OVEA 5FP7A 4QGMA 4AGGA 3AJZA 5B4NA 3JB4C 4HLTA 4LKSA 4MG2A 5FO8B 1RC6A 1CONA 1UL9A 4JGYB 2JDYA 1J84A 5FAXA 3WF4A 2XVKA 2CSGA 4JRAA 3OUHA 4YW4A 4GH4A 1GNYA 1DQ2A 1CZTA 4A42A 4ATEA 2R042 2VTXA 2XQXA 4OZXA 1O5UA 1ASJ3 2XKPA 3LWCA 3D4KA 4DS0A 4YARA 2JX9A 4BQ5A 5BUVA 4FQ4A 4RA0A 5FQ0B 4M3CE 2J1TA 5LA9A 1WLWA 1O91A 3GALA 3DPRB 2XBO2 4QPIA 2E31A 2VNOA 3OBRA 4L97A 1V6NA 5BPXA 1XE8A 4LHLA 5A3WA 3VHOA 4Y33A 5FPAA 4XBQA 4EQVA 2DF7A 3RSJA 4ES8A 2E32A 3J8F1 2WNOA 1OFNA 5A3MA 2D5HA 1W6MB 4B7KA 3I49A 5L9VA 4LIVA 4MGTA 2C4XA 5C4WC 5A7PA 4LBOA 1OA2A 4EN6B 5C8WA 2D3RA 2VD7A 2VOXA 4HK8A 2FDJA 3KT7A 3E5QA 1G86A 4XIOA 5LBCA 3DL3A 4AVTA 1U5ZA 5C8CB 2W92A 1VBA2 2XBO1 1TMF1 5C7GA 3IDBB 5A7OA 2VZPA 1U5XA 4EE2A 4YM3A 4CDWA 1F9KA 3PHMA 2YPDA 3ES4A 1W04A 2YFZA 1IS5A 3ZFGA 1O3TA 4MXVA 3CO2A 1OQ1A 2G9FA 3AZWA 3TN93 3WQ0A 3ZXKA 4DOUA 4N7UA 5CISA 1I3HA 4CDQB 3ATGA 3E5XA 5KC6A 2ZX0A 4RN5A 1WW6A 3TEZA 1F5JA 3SMHA 5D8AB 5KXEA 5CFDA 5K0UB 1G6NA 3ZFEB 1AR82 1C57A 2JDPA 1DQ6A 1LHUA 1SLAA 4FVVA 3LAGA 2WZR1 4J1WA 5A1FA 1UXZA 3H1YA 1PGW2 1WCKA 3TWIA 4CCDA 2H6BA 4JDOA 5K9YA 4XFCA 1W8OA 2XG3A 5F1RA 1W8UA 3SCHA 1VBA1 2FZ1A 2DVFA 4L0PA 4RL7A 1SDDB 4N8MA 2X10A 3AFKA 5L73A 3BTZA 1YO8A 4NWVA 5M0TA 1ND2B 3IAPA 2JENA 2WO2A 5AFBA 3ACIA 2C9KA 3HD8B 2VU9A 3OBZA 5H9QA 5FYVA 1W8TA 5FV3A 3UNPA 2RS11 5DG1A 1KJLA 2AGSA 1YI7A 2R043 2VZQA 3P3NA 1TEIA 4O65A 4IEXA 3VDDB 5CNAA 4K20A 1XNAA 3S5QA 2C0ZA 4LA3A 4N53C 1UZVA 4CEYA 1AR81 1V70A 1T6BX 2ZGQA 4WVZA 2BVBA 4IEPA 1QJU2 1WLTA 4JTNA 3OYWA 2Y6KA 2DWRA 4Y22A 1BVP1 2XBO3 2QE3A 3B7MA 3WX5A 4XE9A 4RGKA 1AXZA 2VAUA 3WQ7A 5CG9A 1ND3B 5DPNA 2B7YA 2QDRA 5JSOA 2R32A 1QXJA 2BNMA 3AMPA 4QQ2A 1YQ2A 2RJLA 4LBLA 2D6NA 1W2NA 3ZOIA 5JZGA 5CBLA 1JOBA 3GCWA 3NL1A 4LPLA 2NM1A 5F5IA 3I2OA 5KHJA 1OH3A 3NV3A 1MEC2 3IN9A 3LA7A 3ETPA 4H14A 5F5AA 3VD5A 4RFT0 1ZBE1 1NG0A 2EIBA 3MIEA 4AW7A 1C4RA 3K51A 3NAPB 3HQXA 3N9QA 5FY4A 3WDUA 3ZX7A 3N35A 2R30A 4IL7A 3N4MA 1GZCA 4MGQA 2SLIA 3UV9A 4FT8A 4CU6A 1QJU1 4WM8A 3HT1A 2PTMA 1VBA3 4FI9A 2HEVF 4G9SB 3ZDSA 4BZ4A 5LEJA 5LK5A 1WLCA 3ON7A 1WGPA 3U37A 4A7KA 1ENXA 2GC2A 2J1VA 4JQRA 5IUQA 1GQGA 4CCCA 4LO4B 1IS6A 1KDMA 3FLPA 2VZOA 2D98A 4HSJA 2H0VA 5FPXA 3PLQA 3WF1A 4XVHA 5JVVA 4B3NA 3ASIA 3HN3A 2RS13 5FMBA 4DPNA 1AF9A 2ETEA 3DYOA 3J7HA 5A3UA 1TQ5A 3RGBA 2A3XA 1W90A 4CU7A 1MEC1 1VMJA 3B9CA 4JGYA 3VD7A 1OMIA 4AI2A 1AR83 4AAPA 3PJYA 2WJSA 1RL3A 3URFA 3OG2A 2I45A 3PVBB 1JYXA 3KZ4C 2DVAA 4I0WB 2VC9A 2UU8A 2W3JA 2ZEXA 1ZZ7A 1H6YA 2XH6A 4E4DX 2VBDA 5FDBA 2ZEZA 5FQ0A 1LHOA 1FAYA 4M4RA 5DUWA 4DRRA 2E51A 1T2XA 5IYYA 2RM22 3DPRA 4GWJA 1I1EA 5LZ6A 1PMJX 1W28A 1A6CA 5FBJA 2D6OX 3H0OA 4W8JA 5F2WA 2YU2A 1I5PA 2XB6C 1LOFA 1XNCA 3BU0A 5FZOB 1POV0 3KM5A 1SFNA 3WEZA 1AR72 4XUQA 1W6NB 2C6SA 2CL2A 4COUA 2OPKA 4LULA 2H6CA 3H1WA 2X05A 2FDIA 4YVWB 2PAKA 2BZDA 4P9XA 1W6MA 4JVAA 3BVCA 2GN7A 1Q8OA 4URAA 1PHMA 4K7JA 1QJU3 5CU1A 1D7PM 4R8HA 1ALYA 1Z78A 2VJXA 3WLUA 3O1OA 1UOJA 4UFJA 2OS2A 2PELA 1XQNA 4G4FA 3WW1A 3LEMA 1DP0A 3KB5A 4QX8A 4PJYA 3ZXEA 5C8CA 2RM21 3LOIA 4KNCA 2P3IA 3SH3A 2ZGPA 5GZEA 1SZBA 1SFYA 3VBFB 5I8YA 5ABJC 5C9AC 1FV3A 1YJKA 3H42B 4BPZA 1IS4A 1AR71 2VW0A 3JBG2 1MEC3 4V1PA 1MQTB 4AL9A 2X09A 4EV0A 1BZWA 2WAAA 3VBUB 5CA6A 4Y5TA 4XOGA 3AB0A 3CNAA 1DZQA 4B4RA 4CDQA 3NVCA 5JWPA 2HJIA 5LA2A 3HPNA 1F8VA 1ZZBA 2VE1A 3LGRA 3MLJA 5D8AA 5HXMA 1CIYA 1HW5A 2DBIA 5K0UA 5AVPA 4NIAA 3WNLA 3ZFEA 5CFCA 3RZMA 4CDXB 4HFSA 4CCNA 1L7LA 5FY7A 5DUXA 3MFAA 2WABA 3RPQA 4QKBA 3W9AA 2PA7A 3BTXA 2PLV2 1LOGA 1TNFA 4QXCA 3M8LA 3BPSA 1HB2A 4UF0B 2XDVA 3UGGA 1T6GC 1SLTA 1VR3A 3LDRA 1HRI1 1A34A 5KXBA 1ND2A 3FHIB 4EZHA 1G8WA 5GALA 4JDNA 2FBEA 4BQ1A 2CY6A 5FPBA 1MS1A 1GU3A 1OQDA 5DUUA 2W5FA 1YWKA 2Y8KA 2Y6JA 3MF6A 3N7MA 3Q8EA 3RVHA 4QX5A 4E4ZA 1XRUA 1IG0A 2Q0AA 4TTGA 2VBBA 3VDDA 2VM9A 2A3WA 2BDRA 5FWEA 5FYYA 4IV3B 2B9UA 3VDAA 2RG4A 1O8PA 1CWPA 1X8EA 5E8AA 2RM23 2DTYA 3B93A 1WW5A 4XDPA 2VZ3A 5JCTA 1FMD2 2VTFA 1QDOA 3H8UA 5JOWA 3O1TA 2ILMA 2PLV1 1S0IA 4Z8BA 4QDQA 1ND3A 1AR73 3OB8A 3W21A 4SLIA 5L7OC 5IK8A 4N7IA 4MX3A 3LIHA 1UU5A 3H7YA 5FYCA 1V00A 2OUHA 4BXFA 3O1MA 1JBCA 3MLLA 3BYWA 4AHYA 4AZZA 3PIJA 3P6BA 5FMOS 1NX9A 2UY8A 3JCIA 4KU7A 3OUIA 1UY1A 2D3PA 1NT0A 4XDQA 4YZ3A 2A71A 3RJRA 4YG6A 1YQ8A 1ZZ6A 4YG0A 5EWSA 3NAPA 4RS5C 1DBNA 1W0OA 1X9TA 4XTPA 5DQ0A 2DVDA 3RZKA 4JTOA 3EMRA 2F6BA 3TYJA 4FOQA 1FMD1 3JZVA 3MIDA 1K3IA 1LOAA 3K3NA 4QHBA 4XIKA 4HBNA 1XE0A 3LIGA 4Q26A 4KMQA 5EZWA 2WZPP 2EIGA 4L9BA 3JBG3 4UFIA 4EWAA 2DU1A 5DMYA 1YIFA 1Q8SA 2WIIB 3H9AA 4WVWA 3RNSA 2GNDA 4NHYA 1SLLA 3AL5A 3NNLA 3WOGA 3MPPG 1MZ5A 1Q8VA 4UT5A 3CJIB 3T2OA 1KRIA 2Q1FA 3I2KA 2IUWA 4E2SA 1J3QA 1Q43A 2BUKA 2D6KA 2DBNA 1X33A 3AL6A 5C3RA 1RUE2 1DF0A 3ZYIB 3PUSA 3KMHA 5FZ1A 3WY6A 2PLV3 2QFEA 4LUKA 4A44A 3VBRC 4ZXEA 3P1IA 3TNQA 5T50A 4DXRA 1PVXA 4YFZA 5JDBA 2AREA 1GP4A 1SPPB 2MPFA 3WP3A 4AQTA 1EAH2 2Z42A 4QX3A 3MV01 5FZOA 3H3UA 1W6NA 4MGIE 4PI0A 4C8DA 2BBVA 4K6BA 1OT5A 3HAGA 1NCQB 1J3PA 4GQ7A 5FTTC 3L2HA 4YVWA 5KBFA 2AENA 3ZFFB 4PIZA 1JZ4A 4OQ9A 2Z69A 1BQPA 1VJ2A 2X5IC 3POSA 4W50A 3UGHA 2OKXA 4N9HA 2VZ1A 3S5AA 2D6PA 1ZBA1 3KGZA 1FMD3 5A6QA 3M7AA 1ACCA 1RUE1 4IEZA 1TVGA 4AI9A 3JD72 4Q0VA 1QF3A 1XSQA 4S2DA 2XKOA 3C8XA 2ZABA 4XFBA 2YC0A 1F2NA 3SHRA 4BISA 2XL7A 3ZSLA 2FZ2A 1JZ7A 3AKRA 3VBSB 4Q4Y2 1LECA 4FOVA 4O61A 1WWYA 1YFXA 3TEXA 3SCFA 3U4XA 4GB31 4YRDA 4A2UA 5IVCA 2VMGA 2QNKA 3WG2A 1MQTA 4AR2A 1GQPA 4FOWA 4HT1T 3VBUA 1RVF2 2JDAA 4MH0E 4WBBA 2IVIB 3ZLIA 1UX6A 5FY8A 4DIQA 3CQOA 3GZEA 3H8OA 5C33A 5T5PA 1H8TB 2P5BA 4AEMA 3NJXA 1BXHA 4CDXA 4RD7A 1DZTA 2D5FA 3I3EA 2HH9A 2D6MA 1GZ9A 3K75B 4NPRA 5ACA2 2BU9A 3L9JT 2QQVA 5B4XA 2BW8A 2Q5TA 2W08A 5FY1A 1ZA4A 1Y4WA 4CU9A 2Z2SB 4KBBA 5HPOA 4LO6B 4UF0A 2JKXA 4HN0A 3AJYA 1ZRFA 3LPGA 5DUVA 2WQZC 1H8VA 2G9ZA 1AVBA 2Z4FA 3GHNA 4NAOA 4BA6A 2XGXA 1RUI2 3E97A 3OF1A 4X8NA 2WO3A 5FKCA 2JKBA 1I6XA 5FZ0A 3Q8FA 1I9RA 1RUE3 3VBOB 2YC4A 5FP8A 4IV3A 3ZYJB 1WW4A 1XJAA 5DDJ2 4F83A 3M3CA 3W58A 1QJY2 1IZ3A 2WL1A 1UZWA 1EAH3 1GANA 4JDMA 3N9MA 2J1AA 1WMFA 5LBBA 1KFXL 3POWA 1JZ3A 3AM2A 4IGPA 4M0HA 3BUCA 3AKSA 4DRVA 4XW3A 2GMEA 1WMDA 4NHMA 4B4PA 1HX6A 5KHHA 5JAXA 2FHRA 4ASKA 1YNAA 1YFUA 1RUI1 4LBJA 1ENQA 2RS31 4F8AA 3UJQA 3LDKA 3GNEA 3NQHA 4HVRA 1GV9A 1LKNA 2HEWF 1F4HA 4NROA 1FNZA 5HCAA 2ZMNA 2E53A 4M00A 2YBSA 4ZS3A 3JD73 4L92A 1CAWB 4IEUA 1UPSA 2BGCA 2PXJA 3USUB 2QQJA 5DDJ1 3ZFGC 5BYNA 5IATA 1H6XA 5FZ3A 5I0DA 5JXHA 5FPLA 3HNMA 3PVEA 3B9IA 2FDHA 5C71A 4Q4Y3 1SDWA 5EJ3A 2R7EB 1JH5A 4YG3A 1TG7A 2TUNA 4P9GA 3POJA 2ZZJA 1S2KA 1YHFA 1KS4A 4LBMA 4MV2A 4TZDA 3KQ4B 1DYPA 2B42B 2PFWA 2EIEA 4GZ9A 4RR3C 1RVF3 1N47A 5BNOB 2WLPA 3H50A 3HQRA 4KI5M 1NZCA 3CJIA 2CGNA 4JX0A 2AACA 3AYDA 1PK6C 5B2GB 4XMAA 4AI1A 1M4WA 3KF3A 1SG3A 4OUEA 1L7RA 2VG9A 5FZLA 5LY2A 5ACA3 1LULA 1HLCA 1ZZCA 5SV5A 2R49A 3K77A 4Y1UA 5T3NA 2E9QA 3AP9A 1YQ5A 3JB8A 4IQPA 5FMOL 2JD4A 1CESA 1X7NA 3ACGA 1YUDA 2QCSB 3MFCA 3AZVA 4TWTA 2BTVC 3BALA 2BJSA 1R082 5L36A 1SPPA 2Q1MA 2Y6FA 4CEYC 1JYWA 1RUI3 2SBAA 3AKPA 2B39A 4BMEA 4Y5Z0 1JMUB 2G9GA 3T09A 1NCQA 1JHNA 3CJXA 1OVPA 2P4EA 4NIHA 3K4DA 1GYKA 1QIQA 4JQTA 3ZFFA 4MLOA 3V0BB 3M3EA 5E88A 1AX0A 1NCRC 4PQ9A 5KR7A 1UOBA 2HKXA 2NMOA 5C6CA 4FFGA 5DDJ3 1BBT2 3VDBA 3N9NA 2DCKA 1QJY3 1QQP1 1S2BA 3AZZA 3OBAA 1OH4A 3T2TA 5JZGC 1HKDA 4DY5A 1XNBA 1CAUB 4EJRA 4QDSA 1WCQA 3HN1A 4F3JA 1BKZA 1W9SA 4AEDC 1S2EA 5FLIA 5JIAA 1XYOA 5DZFA 2EXIA 4AFDA 1QEXA 3OUJA 3VBSA 1GR3A 2WWSA 4ARYA 2WINB 1LHNA 2RDRA 5DXDA 4CPBA 1RUOA 1GOFA 2QQWA 5TSWA 4Q2FA 2RS52 5IT6A 1U12A 1HDKA 1QJX2 5ANNA 3ACFA 4Q0PA 4IEYA 3MZHA 2LUWA 1UU6A 2GU9A 4IGOA 4GKXA 1PZ7A 4IUGA 1BBT1 1DHKB 1H8TA 1APNA 2WS92 4J6GA 4JC1A 4UW4A 3WDVA 2ZHKA 1VBB1 4EWEA 2JB4A 3DF0A 1VRH2 4AGVA 1ZRCA 2I2SA 4XAEA 1EPWA 3ES1A 4JGYC 3VKMA 2XJRA 3IT8A 3PUHA 4CXYA 4PQQA 3VKFC 5J09A 3WF2A 1MZEA 3I54A 4TSVA 3WUCA 2ENRA 5KXCA 5J1XA 1B35B 1VIWB 1GZWB 1SLIA 1ASJ1 1JU4A 5FZFA 2WA3A 2R061 3I2IA 2RMU2 2ZZQA 4BQ3A 1VBD1 2HWF2 4UFLA 1QJX1 4P08A 4FPLA 2ZHLA 1HIXA 4HG6B 4XJZA 2P3JA 1CJDA 2JG8B 2OW4A 2JG9B 2DUPA 3PMSA 3O0XA 1BHGA 4LHNA 4RQPC 3VBOA 3Q9OA 2WYSA 1V6MA 2WS91 2Q8DA 2XLFA 2OIIA 1ST8A 3GGLA 1VRH1 4V2VA 1R083 1RMU2 5DZGA 4ZZ5A 2E63A 2J7MA 3O1UA 1CAVB 1ZREA 3GJAA 1XB9A 1RUG2 4XILA 4YLZA 1BJQA 5I0RA 3WDWA 1BK0A 2CHHA 3MI8A 3ZM8A 3O1VA 2BRTA 3KVBA 5KWRA 2W94A 3M3OA 3ZXJA 3I97A 3PL0A 2WAOA 4P9WA 1S55A 1WLDA 4EN9B 5J37A 1BBT3 4P9YA 4HSLA 4GAZA 2NP0A 4UAPA 3SEPA 1VBB3 3TNPB 3T0AA 1NLSA 2WWJA 4QT6A 4AFCA 1CAWA 1JUIA 3MIHA 4DFSA 3USUA 1IHMA 2VNVA 4YW6A 4C0HA 1WUVA 1VBE2 5EYYA 4EZ4A 4RGGA 3TBDA 5KC5A 4UW5A 1JZ8A 3R0RA 4ISRA 4IW3A 3TN91 3CZUA 2Y33A 1RMU1 3RWNA 3WUDA 2UURA 2VOTA 4UOJA 4IE0A 4R4XA 5FK7A 1RUG1 2PYTA 1VAMA 2R063 5K0UC 1VBD3 3O1PA 1UWWA 4AGRA 1QJX3 1YLLA 2HWE2 1RUC2 2XUEA 3ORJA 5F6LB 5BNOA 4Y4YA 1NE6A 5FZ8A 5DABA 4YW5A 1CJPA 4LKFA 4OHWA 1A3KA 2ZGLA 3FX3A 2WSVA 2L9LA 2D93A 4AFAA 2WS93 5HCFA 4IERA 4P5YA 1E5RA 1NY72 1XXNA 4LE3A 1VRH3 5A3NA 4U2AA 4DB5A 4XJWA 1R1A2 3WW3A 2XHNA 1PGSA 3ENRA 2VMDA 2ZGMA 4IV1B 2VOVA 2QUOA 2W1QA 1W8ZA 4H7LA 1VB2A 4XBLA 2R041 3IB3A 1PO22 1XPWA 3A22A 4JGZB 4O9GA 3V56A 4OHYA 3ZVXA 5JSPA 1NXD1 3WG4A 5IFTA 2RMU3 5CADA 2A6VA 2HWF3 4M0NA 4GWMA 5LA1A 2DYCA 2HWE1 1RUC1 3FZ3A 2OQ7A 5H9SA 5K4LA 4KWKA 2QQKA 1KS5A 1H2KA 1C8NA 4XJAA 5FLJA 1EV12 1QJZA 4YWAA 2OYZA 1IGOA 4HETA 3V0BA 4P00B 3NNJA 5I0UA 2PHWA 1ND3C 2W95A 3O0WA 3IZOA 1NY71 1UZ0A 1ZM1A 4MZUA 1ZNPA 3BOWA 3S0MA 2VH9A 1WCSA 4CP0A 1R1A1 1RMU3 1VBC2 2J1EA 2XHKA 3NRUA 3ZXDA 2XLAA 1CAUA 1BLZA 1F31A 1AL22 1W8NA 1X8MA 4LHKA 5FUNA 3ILFA 1AX1A 1RUG3 2VUAA 2J42A 4XF9A 5CFCB 2P6HA 4HXCA 4UWDA 4HKOA 1PVC2 1OA4A 4ZPIA 1V6LA 2W87A 5F5QA 1ZRRA 3E6DA 3MV11 1PO21 3QD6A 4XAAA 1DQ5A 3EJKA 2Y6LA 2ZS6B 1HV0A 4Y1XA 1G9AA 1MS5A 2XVLA 5IVEA 2BPA2 1D4M2 4IE4A 3O12A 4DXZA 1HB4A 2DCJA 2HYKA 5FYZA 3TAYA 4BQYA 2C9AA 3LE0A 4AWDA 2E33A 2EVXA 3OGVA 3WDTA 5CVRA 3ALQA 5FO7B 5A6YA 3VL8A 4XC9A 2PHUA 3LSEA 5JSRA 1NA1C 1VBE3 4LK7A 4URTA 1J3RA 1DDLA 5IWFA 4GD4A 2QQUA 1QU0A 3ZYGA 4ATFA 1AL21 5LEKA 1YYNA 3GBGA 3S57A 1IS3A 2R0HA 3BTYA 2MEV2 3NSTA 3KCXA 1BEV2 1MS0A 4Q8LA 2HWE3 1RUC3 2UYBA 4D6RA 1PGW1 2VVFA 1B35A 1GZWA 2WN2A 1IKQA 2VY0A 3OEAA 3ST7A 1ENRA 2F4LA 3ILRA 1D4M1 5G05L 1F35A 1VAVA 3S7IA 2XUMA 5E6HA 1V0AA 1XE7A 4XHBA 4FFIA 3P3PA 3T1LA 5HBAA 2CAUA 2JG8A 4BQXA 4YGDA 2JG9A 1R1A3 3RZJA 1B09A 5C4WB 3LEIA 3RRDA 1UNBA 5HV0A 3C2UA 3ZO0B 3GF6A 2DV9A 1DGWA 4M3CF 5FYUA 1RJ7A 4Q1PA 2W9XA 1JYIA 2EAAA 1RINA 1PO23 1EUTA 2D6LX 3VD9A 4YYOA 4EN0A 1CAVA 4LO5B 2MEV1 4L8QA 1MR5A 1PX4A 3BI3A 5H9PA 4ONUA 2DFBA 1MPXA 5T5JA 2ZEWA 1PO12 1EV13 3Q8CA 3OGJA 3OGSA 3LA3A 1Z7S2 3OD0A 4PI2A 1V6OA 4TN7A 1O4TA 2ZXQA 2F17A 2WSUA 2BNOA 3KD4A 3VZLA 4CUGA 1LEDA 5FK8A 5DZEA 1SEFA 1WA4A 2DURA 2WQ4A 4QXKA 3RYRA 4CEWC 2QZ2A 4XCAA 2VCAA 4P5HA 5CYYA 1PMHX 1AL23 1UOGA 5FYHA 1JW6A 4OUSA 2P37A 1MQTC 1PVC3 3ECQA 3OPWA 4NVPA 2WBKA 4QQHA 4YPJA 5FXVA 3SEEA 2GALA 5A1AA 4HKLA 2B46X 3DXTA 3J26N 4COVA 1AZDA 1POQA 3P5BA 4FAGA 1SACA 2CYFA 1D4M3 2I07B 2VZSA 4PLNA 1OSGA 2WLQA 4KGGA 3UKTA 4NO4A 4XABA 4CDXC 3PIGA 2G1MA 1XNTA 1PO11 5A7WB 3UETA 1TME2 1LR5A 1J1LA 2GMPA 3IKWA 4HOOA 4X8PA 5E16A 2XXZA 3O0VA 4M4PA 2PAMA 4OZOA 5F6KA 4ET7A 5J48A 4ARXA 3J7NA 2XONA 4N53B 3I2GA 3VHRA 2I74A 1RXFA 4N9IA 5JOZA 5BNNC 3OOXA 1JN2P 2DU0A 1O6UA 5GM0A 3VUOA 1RB8G 3ZSEA 3MIFA 3NKGA 5ERLA 2MEV3 1D0HA 4IV1A 4Q27A 5FRAA 1R092 1BEV3 4XETA 1VP6A 3HIFA 1QMJA 3ILNA 4UXAA 4CDUB 2OA2A 5FREA 4OYUA 3GZAA 4JGZA 4ZU7A 2XJUA 2JDZA 1OPMA 1REFA 3WVJA 5IVFA 4IV3C 3CHXA 3I2FA 3UKVA 2BOIA 2IXKA 1CPMA 1Y3TA 2A3YA 2F4PA 3VKOA 4N90A 5CKQA 5EYXA 3F2ZA 4QQPA 2PHDA 2ZGUA 1K5JA 1NOVA 2ATFA 3UGFA 3WF0A 3WW2A 3ZDVA 4E8DA 1UO9A 1VRBA 3K2OA 4NHXA 2GDFA 4YM0A 2VNGA 3LB9A 2UWAA 3N7JA 1FATA 3T1MA 5A6ZA 1E5SA 4LITA 2A6WA 2VTXJ 3OPTA 2DDUA 4O9EA 4A3XA 3DKWA 1VAKA 1JS9A 4D69A 3RZGA 4CVUA 2GP3A 4XZUG 4EN8B 3BIEA 2XR4A 2NPIA 3OY8B 3WD5A 1S0CA 5T5LA 2C26A 1PGL2 1PO13 1FYUA 3FE5A 3B5LB 1CX4A 1WW7A 4FPYA 5LW9A 4Q4X2 1CAXB 2WQ8A 5LWBA 4QKNA 2JDMA 1JZ5A 1V6IA 3ZKUA 1MACA 4CUAA 1G9DA 1GFF2 1C8M2 2AEZA 2BWAA 4W6XA 1D2QA 5F2SA 4JKLA 4GWIA 2E7AA 3S7EA 1S0FA 2VVEA 4YZ2A 5HV4A 3JBG1 3OCPA 1S0DA 5FZMA 2ID4A 1CPNA 4KG0A 4FXKB 2PHRA 2ET7A 2RDQA 2ZX4A 3WV6A 5ANQA 4PBPA 4QQLA 1F5FA 5GKAC 1H9PA 5D1IA 2X29A 3PTYA 1AR62 4XF3A 4Y5SA 4FPGA 1O4YA 2XJVA 4NN0A 4XUOA 2W0XA 1PGL1 3FFZA 3WSOA 2W52A 4AFBA 2XL9A 3B3QE 4PDWC 1TME3 4BYYA 1WZXA 4CUBA 2C5DA 4UW3A 1LOBA 2HYXA
chains in the Genus database with same CATH topology
3SLIA 4YM1A 3O14A 1ZRDA 4GULA 3WDXA 4AG4A 4CP2A 1DZRA 2WT2A 3ZIWA 1C8M1 4XYXA 2ZGKA 2ZTNA 4D7TA 1C5HA 1NXMA 4LBQD 5C4WA 2HWB2 4OHXA 4I02A 3VZJA 3FLTA 3AMHA 2PQQA 1OKQA 1YXWA 2VUJA 4RHV2 5JPMB 3MW4A 3I59B 1RUF2 3VGIA 3DN7A 5K8SA 2AH2A 4Z1VA 2XJPA 2NLRA 2EXHA 3N3HA 5C9AB 2IWGB 4P9JA 3M2MA 5JMCA 3B02A 1DQ1A 1H1IA 1FV2A 1RHI2 2ARBA 3MGUA 3NV4A 4WM7B 1LHVA 3HBZA 2Y38A 4W6WA 2KXLA 2VECA 1NLRA 4BIFA 4PIYA 1E57A 4GXLA 4K1YA 2GC1A 4EN7B 2V09A 4QM8A 1DGWX 4XFGA 2VW2A 3WCRA 4RHV1 1LGBA 2Y26A 2VW1A 1AX2A 4QPGB 4BMBA 4Q1RA 2GAUA 4WVMB 4CZSA 3CF6E 4BCUA 4Q4X3 4QD2A 3OTFA 3ZYRA 4A7ZA 1UKGA 2ZHMA 3EHKA 1RHI1 5BNPC 1L3JA 2AYHA 1PNGA 1C8M3 1ENSA 1AXKA 3AX4A 3UJOA 4YGEA 1REEA 5AC92 4K21A 1AL0G 1O5LA 1QOTA 3WW4A 5CIRA 4N53A 5GZDA 3WINE 1LCLA 1N1VA 1JUHA 5EXOA 4Y26A 4OULA 2WNVC 3VBFC 3UKNA 4CDUA 2NZ9A 2ES3A 2WNUB 3A4UA 4AEJA 1BCXA 2KA3A 3VBOC 1Q5OA 1A8MA 3JUUA 1RUH2 2ZX2A 3M3QA 1OOPB 2ZPXA 1IPJA 3ZN6B 2YUEA 1CD3G 1D4VB 2LALA 2WC2A 2WT0A 1EAH1 5AC91 4FP3A 4RS5B 3LA2A 4X6QB 1SLCA 1V9U2 5A33B 3WP4A 4ORFA 1N3OA 3BOPA 4RHV3 2OZ6A 4N43C 1LEMA 1RUF3 1LESA 3GBWA 4JCKA 4YVSB 1XYNA 3OY8A 3R4DB 1S1AA 4I30A 2H0BA 4JV4A 1U5IA 1RHI3 1M06G 4YM2A 2BFUS 3S6PA 3JD71 1CAXA 4B7EA 3EXUA 4AVCA 1JTZX 1PIV2 1IQAA 4GH4C 4NOTA 5T54A 4Q4Y1 2EAKA 4OUMA 2XJTA 4S2HA 2YDEA 4XFHA 1V9U1 1DGLA 4PLMA 5LRRA 5BV6A 2E7TA 1RVF1 1QOOA 5BNOC 1XYPA 4QPIC 3QCWA 3AYCA 3VBRB 3O7OA 3SNMA 1BK1A 5A3LA 5AFEA 1RIRA 5GJ6A 2Q8OA 1UCXA 2CWMA 3VHNA 5I8SA 5ACA1 2R16A 2ZGNA 3WCSA 4HN1A 3SCGA 2QQPA 5AC93 2IXLA 3RMYA 5J7MA 4W65A 3V0AB 3KCCA 3LKJA 4LO8A 2VQAA 2AR6A 3ELNA 2X5IB 1ZX5A 3WNXA 1W6PB 4AK3A 1H1AA 3O5SA 1NE4A 1OLQA 3I59A 3GZTB 3C3VA 4ITCA 3AYAA 4C0BA 1AYM2 5T52A 1UMZA 4CDWC 1AR92 2B5HA 5I93A 4FSJA 5C9AA 4WVVA 1RUH3 4K40A 1VLNA 1RUD2 1QJY1 2X8KA 2VNRA 4WM7A 2DTWA 2K0GA 3D82A 2ZKLA 3PVNA 2HWC2 4XQDA 4R9BA 4Q4W2 1V9U3 3K48A 3APBA 5CFDC 3NV1A 1K5MB 3KT4A 4Z07A 1FI2A 1HQLA 4XJUA 4KQ7A 1G9FA 3BPZA 4AHWA 4QPGA 1CVNA 1Z0HA 4NHLA 2W68A 3KSCA 1YI9A 2GH8A 4WVMA 4YW3A 2Y0IA 1AR91 4QMAA 1QDCA 3AFGA 1ONAA 3GYDA 1PIV3 1DGRN 1KXGA 4HANA 1O7FA 1UD1A 2VQ0A 4Q4W1 2JEMA 4OFGA 2D43A 4LE4A 4DNYA 5FBZA 1MZ6A 1UU4A 5I8TA 3DGTA 3U0ZA 3KLSA 2R0FA 2YY1A 2TEPA 1RUJ2 2DUOA 3D6EA 2BWCA 2R1BA 2R1DA 1O3QA 4WZCA 4XF1A 4KL1A 3VZOA 4B8EA 3SH5A 2JG8C 2Z79A 4ISQA 2JG9C 2BNNA 2WNUA 4CP1A 1H4HA 3FUQA 3ROUA 1SQ4A 3IWZA 5JIUA 4KGQA 2P2KA 2DCTA 1OOPA 3QACA 4HPKB 3ZN6A 2R072 1WBFA 1KDKA 1R081 2GH2A 1OLRA 3MPBA 4RS5A 3EBRA 4FPKA 1H1MA 5A33A 3IIAA 4WM8C 5L19A 4XMIA 4H55A 2C1FA 3RS6A 1RUJ1 4I0AA 3KQRA 3VN4A 2TBVA 1AYM3 1LOEA 4XXAA 1AR93 4YVSA 2ET1A 2ZA9A 1H9WA 4Z92B 1RUD3 1UN1A 4AFMA 3KGLA 3CEWA 4QQOA 3HMYA 1X82A 4RR3B 2HWC3 4GMP1 4AVSA 4Q4W3 4JAAA 1MVQA 3AKQA 1PNFA 1WD3A 1PK6B 2GZWA 3W59A 5SV8A 1BMV2 2ZBJA 4XF0A 4YW1A 1LOCA 2BEOA 1PZ9A 3WXPA 4DMIA 5T5OA 4MXWB 2RS51 2O1QA 3DPRC 2XLGA 2TNFA 3VBRA 3ZXGA 2K2SA 2QKDA 3M70A 4DZGA 1ZZ8A 4XZPA 1LOFC 1YJLA 1MS3A 1POV3 2A70A 2NQYA 2BQPA 4ES9A 4E4SA 4GALA 1DYKA 1WMEA 3HR9A 5HCBA 5GZFA 1QXPA 4C1XA 3PMEA 3D8CA 4DQAA 4IV1C 1O3SA 3V0AA 4K8FA 1BMV1 1NCRB 4Q29A 4LTAA 5JPNB 2X5IA 2EXKA 2A6YA 1RUJ3 1DG6A 2BFUL 2YROA 1S0JA 1W6PA 1RGSA 2RMU1 2HWF1 2VMHA 3MW3A 2YGMA 5C8CC 3AMQA 4A7YA 1KQRA 1RITA 4EROA 4AEDB 1OHFA 1S0BA 4FQZA 4XF4A 3VKLA 4DINB 2VOKA 1S0EA 3AP4A 4GMP3 1LGCA 4U36A 4BOWA 2G4IA 1SBEA 3DUIA 4FPFA 3V65A 4CDQC 4MGYE 5D8AC 2D3SA 2YYOA 4MYEA 1J58A 3ZFEC 1AYN2 2RS53 5CFCC 2DVGA 4E2GA 2YMZA 1K5MA 5FLHA 4ZKTB 3J9SA 1PZ8A 4FTEA 3J8F2 5FCCA 2DVBA 4QGLA 1YFWA 1GNZA 2WT1A 4OHZA 1ND2C 1W6QB 2UWCA 5FOJB 1DQ0A 4LR4A 4TYSA 2JE9A 2XPJA 1VBE1 2FQPA 2QJVA 5JI9A 3VBHB 4C1WA 3U10A 1COV2 1GBGA 3QOPA 3ZSKA 1C1FA 4FO9A 1LGNA 3VDDC 3WP6A 1TMF2 2ZGRA 4LLOA 1AYN1 3H7JA 2E7QA 1FT9A 2ZKNA 4RQPB 4K3UA 2VXRA 2HWD2 3SXWA 4AVBA 2GMMA 2IXIA 1GICA 1Y43B 3HWJA 4HVOA 1YFYA 4KWLA 4L2NA 4PCRA 5J96B 1KJRA 4MGKE 2VGDA 2WZR2 4LLFA 1H4GA 4L11A 1QHDA 3MLKA 3MIBA 3M4FA 3JQWA 4I3GA 4Z82A 4HPKA 1COV1 4I09A 4E9KA 2RR12 3FMGA 3NAPC 2B8MA 4F7ZA 1LU2A 1C3HA 3LSDA 1OQEA 2PHXA 2PAEA 4IEWA 4E27A 4D3WA 4FPHA 1BVVA 3WQ1A 2HWD1 1SCRA 2O0OA 1EV11 3D0JA 2D7FA 2RS12 3DV8A 2YHJA 5A32B 3RYKA 4YZ5A 3G7DA 4KWJA 4FPEA 4UBGA 4AXOA 1VBC1 2CWSA 3OPZA 4OI1A 4RR3A 4HMZA 1W39A 3WG3A 1UIJA 4M3CB 2GSYA 3AP5A 1AYN3 1RJ8A 4ASMB 1PVC1 5BXXA 2PHTA 2RR11 1PK6A 1QKQA 1HV1A 3LZZA 1NYWA 3THTA 1UKRA 4S2FA 1GKBA 3MF9A 3J8F3 4LBNA 4MXWA 4K1ZA 2YV8A 1QOSA 1URXA 4XPVA 3UL2A 4QGNA 2WKKA 3ZXAC 1ZBE2 2RJKA 3M1HA 4C90A 5FPZA 1W0PA 4COZA 1FNYA 3AYEA 1COV3 3VL9A 4EWDA 3I7DA 4YVWC 1TMF3 2O8QA 4YNIA 4LBKA 1G9BA 4R9DA 3SH4A 2QDNA 1BEV1 2GN3A 2O8OA 4P9LA 1NCRA 3NW4A 4CDUC 2HWD3 3AK0A 3RDIA 4MVTA 3SITA 4Q4V2 3AXDA 4RGAA 4AVVA 4Q0SA 3J4UH 2IZWA 3RQ0A 4AEDA 5JOXA 2A75A 1DLLA 1VBC3 4ZU4A 5BNQA 2WZR3 2AUYA 5GLVA 1IPKA 4I01A 3FWEA 3CU7A 5HXVA 4FPJA 4XEZA 3VBUC 2RR13 1C28A 2A5ZA 2YXSA 1N1TA 4FBFA 1KD7A 4BIOA 4L99A 1LRHA 3ZIXA 3WZ1A 2GNMA 1NQDA 1NA1B 1FPN2 1Z7S1 3IPVB 4GIQA 4Q4V1 2V5YA 1S0GA 4FTBA 5LK7B 3GHMA 3IBMA 3ZMNA 2IFRA 1W6QA 2OZJA 4Y1YA 5I0TA 1ULFA 1X50A 3ZSMA 1H2MA 3IM0A 3ME2A 4FTSA 2P3KA 3B01A 3VV1A 3VBHA 2XVGA 4GWNA 1GQHA 4FCAA 4LA2A 4E2QA 1YRZA 2EALA 2DFCA 2Z5WA 4RQPA 3B00A 4GA9A 1HRV2 1OD5A 1FPN1 4YZ4A 1TME1 4HKWA 4TLFA 1ZBE3 1QGLA 4R52A 4COYA 5J98B 3OJBA 3KT1A 3B69A 2DCYA 2IXCA 5J3UA 4AQ6A 5FOBB 3B94A 3MW2A 4AE2A 4MSVA 2CTVA 1AJKA 1R091 4HVQA 1N3PA 2EF6A 1ULCA 4J1XA 4PIXA 5H9RA 4CEWB 1UZZA 2A73B 4WV8A 4BE3A 1ULGA 1Z7S3 1HRI2 2ZX3A 1Q8QA 4Q4V3 4GMP0 1HRV1 4XTMA 4WM7C 4B29A 3MEPA 3VKNA 1LB2A 5A32A 5IK5A 3POYA 2RE9A 4CTEA 4WZFA 5GLTA 3QH7A 1ZVFA 3PJQA 3CJIC 1C5IA 3LOBA 1SCSA 4M3CA 4OI4A 4Y20B 2DCZA 4AHZA 1LJ7A 3FBMA 4QPGC 1DFQA 4DY3A 5T55A 3VHPA 5CG8A 1QY4A 1A8DA 1FPN3 3LCPA 4R4ZA 2UYAA 4Q4X1 3NWKA 5BNNB 1UPIA 1D2SA 2GNTA 2R6QA 3H3ZA 2MHFA 2Y0OA 1Y7BA 3ZPYA 3L2YA 1WCDJ 4YW2A 1R093 3TRSB 3BB6A 2JICA 4W6YA 1NCQC 5EV7A 4XQWA 2NYYA 1ULDA 3BTAA 3ZFFC 3ZXFA 1AR61 2A6XA 3EQEA 2JJ6A 1TE1B 1VB4A 5ABJB 3S30A 4BWOA 1DU3D 4OI0A 2IXHA 1HRV3 2AZ5A 3ZN4A 2WNUC 3MIGA 3R4SA 4IXLA 3BODA 1CN1A 3WT3A 4OHVA 2UY9A 2ZMKA 1JYCA 1OOPC 1ULEA 3R6SA 1RUNA 3VBSC 3NO8A 2ERFA 1N1YA 2P34A 1DQ4A 3AKTA 2IXJA 3KS7A 4WVZA 1MS8A 2WNEA 2HWB1 4I0BA 2ZJCA 2EA7A 4AI8A 4LT5A 3ACLA 1J59A 1Q56A 2B45X 1JXNA 2CNAA 1RUF1 2ZGTA 5JLVA 3SISA 4LEJA 2PN5A 4XBNA 4RSUA 4H7MA 4BH9A 3MICA 1CIWA 3ZYPA 1HRI3 3PVOA 4YVSC 4COWA 2LTNA 3QLQA 1H8TC 4IEQA 3RZZA 3CLPA 4LBQB 3A0NA 2ZAAA 1NA1A 1G9CA 2QZ3A 3RJ2X 2YZ4A 3IPVA 5CAZA 3WHUA 4ZXKA 4D94A 2N7GA 3RI9A 4XJ9A 1HQWA 2Q4SA 2VMIA 2ZX1A 3OD4A 4KH9A 3U07A 3I4IA 4G3YC 1QXRA 1SBFA 3FFQA 5FFOC 3TB0A 1ZBA2 5JI7A 3R05A 1REDA 3QH6A 4PDWB 1GSLA 1AR63 1GLHA 1H30A 1UF2C 2FMDA 1G7YA 5I0SA 3VLBB 1QH6A 4Q0QA 3D5OA 5FO9B 4PBOA 3USSA 3OGGA 1RTVA 1Y9QA 2ZAHA 5L7OB 3AP6A 1XU2A 1R1ZA 5BY5A 1ZYBA 1NQJA 4XFAA 1VALA 2ZMLA 4OI2A 4GB32 4AVAA 4QU2A 3RG0A 1H2NA 4NHKA 5GLUA 1Q3EA 1QNYA 2JXAA 2HWB3 5KHGA 3ETQA 4AF9A 1EY2A 1X36A 1HXS2 2JE7A 4JRLA 3E6CC 1UZYA 1LENA 3VZMA 2CGOA 2LM3A 3IDCB 2IC1A 3PNAA 1BYHA 4CEWA 4CYDA 1U5YA 3AP7A 5GZCA 2V73A 1YIPA 1H0BA 1RUH1 3KCYA 4KG8A 3U11A 1O4ZA 5F9TA 4PLOA 5J36A 5IK7A 4IETA 2A7AA 1IOAA 1IKPA 1UW8A 3JQXA 1HXS1 1SLBA 4HK9A 3GZUC 3UK9A 2NMNA 3WHTA 1K5MC 1XU1A 4H3WA 5BNPB 3NKTA 4C91A 2JECA 2CGPA 1V6JA 1O3RA 5DG2A 2RHPA 5JOYA 4Y20A 2W39A 1XNKA 1W6OB 4AHXA 2D44A 4D7YA 3NV2A 4AI0A 3EO6A 3FC0A 1QNWA 5BNNA 2WFPA 4AQSA 1PIV1 3I8TA 4XHXA 2RS32 2XJQA 4P9IA 1DIWA 1WBLA 2WNVB 2Q1ZB 1PMIA 4QPYA 3FUOA 2P17A 1ZBA3 5JR7B 3RYPA 3VBFB 3ZMOA 4BM8A 4NR1A 1QH7A 3INAA 4Y1ZA 5E1RA 2X53S 2ZGSA 1JOJA 4UW6A 4YFWA 1EYBA 2A6ZA 5GLWA 2WA4A 4AQ2A 5ABJA 2CV6A 4GB33 2NN8A 1UIKA 1AHSA 3AZYA 4N43B 4I3PA 3X29B 1D0GA 3N36A 5LRSA 3IDEA 1GNHA 1LU1A 2XWJB 3QBQA 1HXS3 2GC3A 1V6KA 3ZN5A 1OI6A 2QVSB 2VULA 3TOJA 3R4UA 3N7KA 4KU8A 4XFIA 4FPOB 1LODA 4Q0UA 1ZZ9A 3FJSA 4LUMA 1J1TA 4FAHA 4CRQA 4QM9A 5KXDA 1MS9A 1AYM1 4GH4B 5CB7A 4FOYA 2VOWA 4S2GA 2XJSA 4YGBA 4R9CA 1RUD1 1FOD2 2XWBB 4LBQA 5AVAA 3HT2A 3WR0A 1LTEA 4BLJA 3FBYA 2HWC1 4LO7A 4QPIB 5GZGA 4B4QA 4FXGB 1MVEA 4INDA 5K7PA 4X6RB 2VPVA 3NJZA 2OVUA 5KHKA 2EXJA 3A0KA 4YGCA 1B35C 1CR7A 1QQP2 5EFUA 1I5ZA 4PDWA 1YCIA 1AJOA 1SBDA 1Q8PA 3I2DA 5IK4A 2WFF2 3MYXA 3ZXLA 5L7OA 1WD4A 2Q30A 4META 1POV1 1AXYA 1FOD1 3RI8A 1FXZA 3VZNA 2RS33 4HZFA 3AXEA 1XNDA 2VVDA 3IMNA 4K9SA 5HI0A 4M01A 2D40A 4Y1VA 5I91A 3ZSJA 2PHFA 3MDPA 1OFSA 2CAVA 2FMYA 4CDWB 4XQ4A 3ZFGB 1CQ9A 3AZXA 3H1MA 4PF5A 3G6JB 3ZVXA 2ZHNA 3V64A 1VBB2 4AYUA 3E6BA 1MS4A 2WFF1 4XJ8A 5CFDB 2PHLA 2MNGA 3WP5A 3CL1A 1ASJ2 2YGLA 1U0AA 3N7LA 2R062 2R071 4MGZE 1VBD2 1KITA 1MZFA 2ZACA 4IEOA 1OA3A 4FPCA 4Q8KA 4BLIA 4D7SA 2HEYF 4R9AA 1FX5A 1UAIA 4AEKA 2KM2A 1EPZA 4BHPA 3RMXA 5BNPA 4YZ1A 1N1SA 2ZOEB 3AMMA 4OLLA 4XXPA 3BCWA 2DUQA 4P14A 2GC0A 2UWBA 1AUYA 4IESA 1KFUL 4NWWA 1FOD3 4AI3A 4CEYB 1W6OA 2GNBA 4ZU5A 3OYWB 1C1LA 4IEVA 2K9ZA 4UBHA 3JU9A 4Y22B 3THPA 4Y24A 1LHWA 3AMNA 1OPOA 2YPJA 4XFFA 4GKYA 3VBHC 4ASLA 3E5UA 3BIWE 3BU7A 3OBTA 2ZGOA 2WNVA 4JGZC 3VBFA 1QQP3 3WG1A 3M3IA 4MUVA 1QWRA 4SBVA 5JZGB 5E89A 4FP2A 2D97A 2E6VA 2WFF3 4Z2WA 2BYVE 4YSFA 1CGPA 2BVVA 4LNVA 3TN92 3VZKA 1EP0A 5KHIA 1PM7A 1N3QA 4WM8B 2R073 2ARXA 4N43A 1A78A 5GLZA 2IFWA 2OUJA 1H2LA 1W2UA 2ZCWA 3D0SA 4HL0A 1DGRA 1HQNA 1SMVA 1TNRA 3FLRA 3WDYA 3GBFA 4AGGA 4OVEA 4QGMA 3AJZA 3JB4C 4HLTA 5FO8B 1RC6A 1CONA 1UL9A 4JGYB 5FAXA 2XVKA 4JRAA 4YW4A 4GH4A 4ATEA 1DQ2A 2R042 4OZXA 1O5UA 1ASJ3 2XKPA 3LWCA 3D4KA 4DS0A 4YARA 2JX9A 5BUVA 4FQ4A 4RA0A 5FQ0B 4M3CE 1WLWA 1O91A 3GALA 3DPRB 2XBO2 4QPIA 4L97A 2VNOA 3OBRA 1V6NA 5BPXA 1XE8A 4LHLA 3VHOA 4XBQA 2DF7A 3RSJA 4ES8A 3J8F1 1OFNA 5A3MA 2D5HA 1W6MB 4B7KA 5C4WC 4LBOA 1OA2A 4EN6B 5C8WA 2D3RA 2VOXA 4HK8A 3KT7A 3E5QA 1G86A 4XIOA 3DL3A 4AVTA 1U5ZA 5C8CB 1VBA2 2XBO1 1TMF1 3IDBB 1U5XA 4YM3A 4CDWA 1F9KA 3PHMA 3ES4A 1IS5A 3ZFGA 1O3TA 4MXVA 3CO2A 1OQ1A 2G9FA 3AZWA 3TN93 3WQ0A 3ZXKA 4DOUA 4N7UA 1I3HA 4CDQB 3ATGA 3E5XA 5KC6A 2ZX0A 1WW6A 1F5JA 3SMHA 5D8AB 5KXEA 5CFDA 5K0UB 1G6NA 3ZFEB 1AR82 1C57A 1DQ6A 1LHUA 1SLAA 4FVVA 3LAGA 2WZR1 4J1WA 3H1YA 1PGW2 1WCKA 3TWIA 2H6BA 4JDOA 5K9YA 4XFCA 2XG3A 5F1RA 3SCHA 1VBA1 2FZ1A 2DVFA 4RL7A 3AFKA 5L73A 1YO8A 4NWVA 1ND2B