4ZUPA

Crystal structure of acetylpolyamine amidohydrolase from mycoplana ramosa in complex with a hydroxamate inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
341
structure length
341
Chain Sequence
MRVIFSEDHKLRNAKTELYGGELVPPFEAPFRAEWILAAVKEAGFDDVVAPARHGLETVLKVHDAGYLNFLETAWDRWKAAGYKGEAIATSFPVRRTSPRIPTDIEGQIGYYCNAAETAISPGTWEAALSSMASAIDGADLIAAGHKAAFSLCRPPGHHAGIDMFGGYCFINNAAVAAQRLLDKGAKKIAILDVDFHHGNGTQDIFYERGDVFFASLHGDPAEAFPHFLGYAEETGKGAGAGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDTFEQDPISFFKLTSPDYITMGRTIAASGVPLLVVMEGGYGVPEIGLNVANVLKGVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylpolyamine aminohydrolase
publication title Design, Synthesis, and Evaluation of Polyamine Deacetylase Inhibitors, and High-Resolution Crystal Structures of Their Complexes with Acetylpolyamine Amidohydrolase.
pubmed doi rcsb
source organism Mycoplana ramosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 116
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 3.5.1.48: Acetylspermidine deacetylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 4zupA00
5EFBD 5EENA 5EFJD 1T67A 5G0XA 1ZZ1A 3MZ4A 5EEFA 5G0YA 5G0HA 1T64A 1W22A 5DC7A 5JI5A 3C0YA 5DC8A 1T69A 5G1BA 3SFFA 4QA1A 4QA3A 5EFKB 3C0ZA 2VCGA 4LY1A 5G10A 4BKXB 2VQMA 3MZ6A 3ZNRA 4CQFA 3F0RA 1C3RA 4CBYA 3Q9EA 5G1AA 5G17A 2V5XA 5THUA 4RN0A 2VQOA 4BZ7A 2VQJA 5EF8A 5EEMA 4ZUOA 5THSA 3C10A 5G12A 3MZ3A 5IX0A 5IWGA 4BZ6A 5G3WA 5A2SA 5EEKA 3EZTA 1C3SA 5FCWA 3MAXA 3MENA 4QA6A 4BZ8A 1VKGA 4BZ5A 4QA0A 1ZZ3A 4QA2A 5G0IA 5D1BA 3EW8A 3F07A 4QA4A 5EFNA 2VQQA 5EFHA 5FUEA 3Q9CA 3Q9FA 5THTA 3RQDA 4QA5A 5G0GA 4ZUMA 5THVA 4QA7A 3EWFA 4ZUNA 4A69A 4RN2A 5BWZA 3EZPA 2V5WA 5G11A 5D1CA 4RN1A 5EEIA 5ICNB 1C3PA 5EF7A 4ZURA 3F06A 5D1DA 5EFGA 5LI3A 2VQWG 3SFHA 3MZ7A 4CBTA 5G0JA 1ZZ0A 5G13A 3ZNSA 2VQVA 4ZUQA 5DC6A 4BZ9A 3Q9BA 5DC5A 4ZUPA 5G1CA 2GH6A 4LXZA
chains in the Genus database with same CATH superfamily
5EFBD 1P8OA 3NIPA 5EENA 5EFJD 1RLAA 3TH7A 1WOGA 4Q3VA 3RLAA 1T67A 1HQ5A 5G0XA 1ZZ1A 1TBHA 1P8QA 3MZ4A 3E6VA 5EEFA 5G0YA 1P8MA 5G0HA 1T64A 1P8PA 1W22A 3PZLA 1CEVA 1P8NA 5DC7A 3MJLA 5JI5A 1WOIA 3LP4A 3LP7A 3C0YA 4RHIA 2ZAVA 3NIOA 5DC8A 2EIVA 1T69A 4IXUA 5G1BA 1D3VA 3F80A 3NIQA 3SFFA 1ZPEA 4Q3PA 4QA1A 2RLAA 4QA3A 3C0ZA 2VCGA 4LY1A 5EFKB 5G10A 4BKXB 2VQMA 3MZ6A 3GN0A 4IE3A 3ZNRA 4CQFA 4RHQA 3F0RA 1C3RA 4CBYA 3Q9EA 5G1AA 5G17A 3THEA 2V5XA 1WOHA 2EF5A 4RN0A 5THUA 2VQOA 4MYNA 4BZ7A 3THJA 2VQJA 4FCIA 5EF8A 1TBLA 4IU1A 1ZPGA 3SKKA 4I06A 5EEMA 4ZUOA 4Q40A 5THSA 2A0MA 1GQ6A 1P8RA 3E8QA 2CEVA 4HZEA 1HQHA 1PQ3A 1HQXA 3C10A 4IU0A 5G12A 3MZ3A 3MFWA 5IX0A 4RHKA 4RHLA 4RLAA 5IWGA 4DZ4A 4BZ6A 2PHOA 4IU4A 4FCKA 4GWDA 4GWCA 5G3WA 1WVAA 3E6KA 5A2SA 5EEKA 4Q3RA 4Q3TA 3EZTA 1C3SA 5HJ9A 4Q3QA 5FCWA 3MAXA 3MENA 3DJ8A 4G3HA 4QA6A 3SJTA 4BZ8A 4Q42A 1VKGA 4HWWA 3E8ZA 4BZ5A 4QA0A 4CEVA 4Q3RC 2AEBA 1ZZ3A 1WVBA 1P8SA 4QA2A 5G0IA 5D1BA 3EW8A 3THHA 1T5GA 3F07A 3KV2A 4QA4A 4GSMA 5EFNA 4RHJA 1T4SA 2VQQA 4Q3UA 5EFHA 5FUEA 4RHMA 3Q9CA 4Q41A 3Q9FA 5THTA 4IE2A 3RQDA 1GQ7A 4QA5A 3E9BA 5G0GA 4ZUMA 5THVA 3TF3A 4QA7A 3EWFA 4ZUNA 4MXRA 4IU5A 4A69A 4MYKA 1T4RA 1TA1A 3CEVA 4Q3SA 4RN2A 5BWZA 3EZPA 2V5WA 5G11A 5D1CA 4RN1A 5EEIA 5ICNB 1C3PA 3MMRA 5EF7A 3M1RA 3MFVA 1XFKA 4ZURA 3SL1A 3F06A 5D1DA 4IE1A 4MYLA 5EFGA 5LI3A 2VQWG 3SFHA 2PLLA 1TBJA 4GSVA 1HQGA 3MZ7A 4ITYA 4CBTA 5HJAA 5G0JA 1HQFA 2PHAA 1ZZ0A 2EF4A 4GSZA 4HXQA 4MYFA 3LHLA 5G13A 5RLAA 3ZNSA 4IXVA 1R1OA 1T4PA 1T4TA 2VQVA 1T5FA 3GMZA 3SL0A 4ZUQA 5DC6A 4BZ9A 3Q9BA 5DC5A 4ZUPA 5G1CA 2GH6A 5CEVA 4LXZA
chains in the Genus database with same CATH topology
5EFBD 5EENA 5EFJD 1T67A 5G0XA 1ZZ1A 3MZ4A 5EEFA 5G0YA 5G0HA 1T64A 1W22A 5DC7A 5JI5A 3C0YA 5DC8A 1T69A 5G1BA 3SFFA 4QA1A 4QA3A 5EFKB 3C0ZA 2VCGA 4LY1A 5G10A 4BKXB 2VQMA 3MZ6A 3ZNRA 4CQFA 3F0RA 1C3RA 4CBYA 3Q9EA 5G1AA 5G17A 2V5XA 5THUA 4RN0A 2VQOA 4BZ7A 2VQJA 5EF8A 5EEMA 4ZUOA 5THSA 3C10A 5G12A 3MZ3A 5IX0A 5IWGA 4BZ6A 5G3WA 5A2SA 5EEKA 3EZTA 1C3SA 5FCWA 3MAXA 3MENA 4QA6A 4BZ8A 1VKGA 4BZ5A 4QA0A 1ZZ3A 4QA2A 5G0IA 5D1BA 3EW8A 3F07A 4QA4A 5EFNA 2VQQA 5EFHA 5FUEA 3Q9CA 3Q9FA 5THTA 3RQDA 4QA5A 5G0GA 4ZUMA 5THVA 4QA7A 3EWFA 4ZUNA 4A69A 4RN2A 5BWZA 3EZPA 2V5WA 5G11A 5D1CA 4RN1A 5EEIA 5ICNB 1C3PA 5EF7A 4ZURA 3F06A 5D1DA 5EFGA 5LI3A 2VQWG 3SFHA 3MZ7A 4CBTA 5G0JA 1ZZ0A 5G13A 3ZNSA 2VQVA 4ZUQA 5DC6A 4BZ9A 3Q9BA 5DC5A 4ZUPA 5G1CA 2GH6A 4LXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EFB D;  5EEN A;  5EFJ D;  1T67 A;  5G0X A;  1ZZ1 A;  3MZ4 A;  5EEF A;  5G0Y A;  5G0H A;  1T64 A;  1W22 A;  5DC7 A;  5JI5 A;  3C0Y A;  5DC8 A;  1T69 A;  5G1B A;  3SFF A;  4QA1 A;  4QA3 A;  5EFK B;  3C0Z A;  2VCG A;  4LY1 A;  5G10 A;  4BKX B;  2VQM A;  3MZ6 A;  3ZNR A;  4CQF A;  3F0R A;  1C3R A;  4CBY A;  3Q9E A;  5G1A A;  5G17 A;  2V5X A;  5THU A;  4RN0 A;  2VQO A;  4BZ7 A;  2VQJ A;  5EF8 A;  5EEM A;  4ZUO A;  5THS A;  3C10 A;  5G12 A;  3MZ3 A;  5IX0 A;  5IWG A;  4BZ6 A;  5G3W A;  5A2S A;  5EEK A;  3EZT A;  1C3S A;  5FCW A;  3MAX A;  3MEN A;  4QA6 A;  4BZ8 A;  1VKG A;  4BZ5 A;  4QA0 A;  1ZZ3 A;  4QA2 A;  5G0I A;  5D1B A;  3EW8 A;  3F07 A;  4QA4 A;  5EFN A;  2VQQ A;  5EFH A;  5FUE A;  3Q9C A;  3Q9F A;  5THT A;  3RQD A;  4QA5 A;  5G0G A;  4ZUM A;  5THV A;  4QA7 A;  3EWF A;  4ZUN A;  4A69 A;  4RN2 A;  5BWZ A;  3EZP A;  2V5W A;  5G11 A;  5D1C A;  4RN1 A;  5EEI A;  5ICN B;  1C3P A;  5EF7 A;  4ZUR A;  3F06 A;  5D1D A;  5EFG A;  5LI3 A;  2VQW G;  3SFH A;  3MZ7 A;  4CBT A;  5G0J A;  1ZZ0 A;  5G13 A;  3ZNS A;  2VQV A;  4ZUQ A;  5DC6 A;  4BZ9 A;  3Q9B A;  5DC5 A;  4ZUP A;  5G1C A;  2GH6 A;  4LXZ A; 
#chains in the Genus database with same CATH topology
 5EFB D;  1P8O A;  3NIP A;  5EEN A;  5EFJ D;  1RLA A;  3TH7 A;  1WOG A;  4Q3V A;  3RLA A;  1T67 A;  1HQ5 A;  5G0X A;  1ZZ1 A;  1TBH A;  1P8Q A;  3MZ4 A;  3E6V A;  5EEF A;  5G0Y A;  1P8M A;  5G0H A;  1T64 A;  1P8P A;  1W22 A;  3PZL A;  1CEV A;  1P8N A;  5DC7 A;  3MJL A;  5JI5 A;  1WOI A;  3LP4 A;  3LP7 A;  3C0Y A;  4RHI A;  2ZAV A;  3NIO A;  5DC8 A;  2EIV A;  1T69 A;  4IXU A;  5G1B A;  1D3V A;  3F80 A;  3NIQ A;  3SFF A;  1ZPE A;  4Q3P A;  4QA1 A;  2RLA A;  4QA3 A;  3C0Z A;  2VCG A;  4LY1 A;  5EFK B;  5G10 A;  4BKX B;  2VQM A;  3MZ6 A;  3GN0 A;  4IE3 A;  3ZNR A;  4CQF A;  4RHQ A;  3F0R A;  1C3R A;  4CBY A;  3Q9E A;  5G1A A;  5G17 A;  3THE A;  2V5X A;  1WOH A;  2EF5 A;  4RN0 A;  5THU A;  2VQO A;  4MYN A;  4BZ7 A;  3THJ A;  2VQJ A;  4FCI A;  5EF8 A;  1TBL A;  4IU1 A;  1ZPG A;  3SKK A;  4I06 A;  5EEM A;  4ZUO A;  4Q40 A;  5THS A;  2A0M A;  1GQ6 A;  1P8R A;  3E8Q A;  2CEV A;  4HZE A;  1HQH A;  1PQ3 A;  1HQX A;  3C10 A;  4IU0 A;  5G12 A;  3MZ3 A;  3MFW A;  5IX0 A;  4RHK A;  4RHL A;  4RLA A;  5IWG A;  4DZ4 A;  4BZ6 A;  2PHO A;  4IU4 A;  4FCK A;  4GWD A;  4GWC A;  5G3W A;  1WVA A;  3E6K A;  5A2S A;  5EEK A;  4Q3R A;  4Q3T A;  3EZT A;  1C3S A;  5HJ9 A;  4Q3Q A;  5FCW A;  3MAX A;  3MEN A;  3DJ8 A;  4G3H A;  4QA6 A;  3SJT A;  4BZ8 A;  4Q42 A;  1VKG A;  4HWW A;  3E8Z A;  4BZ5 A;  4QA0 A;  4CEV A;  4Q3R C;  2AEB A;  1ZZ3 A;  1WVB A;  1P8S A;  4QA2 A;  5G0I A;  5D1B A;  3EW8 A;  3THH A;  1T5G A;  3F07 A;  3KV2 A;  4QA4 A;  4GSM A;  5EFN A;  4RHJ A;  1T4S A;  2VQQ A;  4Q3U A;  5EFH A;  5FUE A;  4RHM A;  3Q9C A;  4Q41 A;  3Q9F A;  5THT A;  4IE2 A;  3RQD A;  1GQ7 A;  4QA5 A;  3E9B A;  5G0G A;  4ZUM A;  5THV A;  3TF3 A;  4QA7 A;  3EWF A;  4ZUN A;  4MXR A;  4IU5 A;  4A69 A;  4MYK A;  1T4R A;  1TA1 A;  3CEV A;  4Q3S A;  4RN2 A;  5BWZ A;  3EZP A;  2V5W A;  5G11 A;  5D1C A;  4RN1 A;  5EEI A;  5ICN B;  1C3P A;  3MMR A;  5EF7 A;  3M1R A;  3MFV A;  1XFK A;  4ZUR A;  3SL1 A;  3F06 A;  5D1D A;  4IE1 A;  4MYL A;  5EFG A;  5LI3 A;  2VQW G;  3SFH A;  2PLL A;  1TBJ A;  4GSV A;  1HQG A;  3MZ7 A;  4ITY A;  4CBT A;  5HJA A;  5G0J A;  1HQF A;  2PHA A;  1ZZ0 A;  2EF4 A;  4GSZ A;  4HXQ A;  4MYF A;  3LHL A;  5G13 A;  5RLA A;  3ZNS A;  4IXV A;  1R1O A;  1T4P A;  1T4T A;  2VQV A;  1T5F A;  3GMZ A;  3SL0 A;  4ZUQ A;  5DC6 A;  4BZ9 A;  3Q9B A;  5DC5 A;  4ZUP A;  5G1C A;  2GH6 A;  5CEV A;  4LXZ A; 
#chains in the Genus database with same CATH homology
 5EFB D;  5EEN A;  5EFJ D;  1T67 A;  5G0X A;  1ZZ1 A;  3MZ4 A;  5EEF A;  5G0Y A;  5G0H A;  1T64 A;  1W22 A;  5DC7 A;  5JI5 A;  3C0Y A;  5DC8 A;  1T69 A;  5G1B A;  3SFF A;  4QA1 A;  4QA3 A;  5EFK B;  3C0Z A;  2VCG A;  4LY1 A;  5G10 A;  4BKX B;  2VQM A;  3MZ6 A;  3ZNR A;  4CQF A;  3F0R A;  1C3R A;  4CBY A;  3Q9E A;  5G1A A;  5G17 A;  2V5X A;  5THU A;  4RN0 A;  2VQO A;  4BZ7 A;  2VQJ A;  5EF8 A;  5EEM A;  4ZUO A;  5THS A;  3C10 A;  5G12 A;  3MZ3 A;  5IX0 A;  5IWG A;  4BZ6 A;  5G3W A;  5A2S A;  5EEK A;  3EZT A;  1C3S A;  5FCW A;  3MAX A;  3MEN A;  4QA6 A;  4BZ8 A;  1VKG A;  4BZ5 A;  4QA0 A;  1ZZ3 A;  4QA2 A;  5G0I A;  5D1B A;  3EW8 A;  3F07 A;  4QA4 A;  5EFN A;  2VQQ A;  5EFH A;  5FUE A;  3Q9C A;  3Q9F A;  5THT A;  3RQD A;  4QA5 A;  5G0G A;  4ZUM A;  5THV A;  4QA7 A;  3EWF A;  4ZUN A;  4A69 A;  4RN2 A;  5BWZ A;  3EZP A;  2V5W A;  5G11 A;  5D1C A;  4RN1 A;  5EEI A;  5ICN B;  1C3P A;  5EF7 A;  4ZUR A;  3F06 A;  5D1D A;  5EFG A;  5LI3 A;  2VQW G;  3SFH A;  3MZ7 A;  4CBT A;  5G0J A;  1ZZ0 A;  5G13 A;  3ZNS A;  2VQV A;  4ZUQ A;  5DC6 A;  4BZ9 A;  3Q9B A;  5DC5 A;  4ZUP A;  5G1C A;  2GH6 A;  4LXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...