4ZUQA

Crystal structure of acetylpolyamine amidohydrolase from mycoplana ramosa in complex with a hydroxamate inhibitor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
341
structure length
341
Chain Sequence
MRVIFSEDHKLRNAKTELYGGELVPPFEAPFRAEWILAAVKEAGFDDVVAPARHGLETVLKVHDAGYLNFLETAWDRWKAAGYKGEAIATSFPVRRTSPRIPTDIEGQIGYYCNAAETAISPGTWEAALSSMASAIDGADLIAAGHKAAFSLCRPPGHHAGIDMFGGYCFINNAAVAAQRLLDKGAKKIAILDVDFHHGNGTQDIFYERGDVFFASLHGDPAEAFPHFLGYAEETGKGAGAGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDTFEQDPISFFKLTSPDYITMGRTIAASGVPLLVVMEGGYGVPEIGLNVANVLKGVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylpolyamine aminohydrolase
publication title Design, Synthesis, and Evaluation of Polyamine Deacetylase Inhibitors, and High-Resolution Crystal Structures of Their Complexes with Acetylpolyamine Amidohydrolase.
pubmed doi rcsb
source organism Mycoplana ramosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 114
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 3.5.1.48: Acetylspermidine deacetylase.
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 4zuqA00
3MZ6A 3C0ZA 4RN0A 5EF7A 3C10A 5G17A 5FUEA 2VCGA 5THVA 5G12A 5EFHA 2V5XA 5G10A 5IWGA 5DC7A 5LI3A 5G0XA 4ZUOA 5G0YA 5G0JA 5THSA 5THTA 1T69A 4ZUQA 4BZ6A 4ZUPA 5THUA 3Q9EA 5DC8A 3Q9FA 3ZNRA 4BZ8A 1C3SA 5G3WA 5FCWA 3F0RA 3MZ7A 2VQOA 4LXZA 4QA3A 2V5WA 4QA1A 3ZNSA 4BZ5A 1C3RA 4ZUMA 4QA7A 1ZZ0A 3C0YA 5DC5A 5EFGA 4LY1A 4ZUNA 4BZ9A 5EFJD 5D1DA 1VKGA 3MZ4A 5G13A 5G1CA 5IX0A 3EZPA 5D1CA 2VQMA 4CBYA 4A69A 5EENA 2VQVA 3Q9BA 2VQJA 5D1BA 4QA0A 5G0IA 5EFNA 5EF8A 1ZZ1A 3F07A 4RN1A 5BWZA 4BZ7A 3Q9CA 5EFKB 3MENA 3EW8A 4BKXB 5G1BA 1T64A 3SFFA 5DC6A 4QA5A 3EZTA 5G11A 4ZURA 4QA4A 5EEMA 5JI5A 4QA6A 4QA2A 5G0GA 1ZZ3A 2VQQA 3EWFA 3F06A 5EEFA 3MZ3A 2GH6A 5G1AA 1C3PA 5EEIA 5G0HA 5A2SA 4CBTA 5ICNB 3RQDA 1W22A 4CQFA 3SFHA 3MAXA 1T67A 2VQWG 5EFBD 4RN2A 5EEKA
chains in the Genus database with same CATH superfamily
2CEVA 3MZ6A 4IE2A 4Q3RA 5RLAA 3C0ZA 4RN0A 3E6VA 5EF7A 3C10A 5G17A 5FUEA 3GN0A 2VCGA 4Q3PA 1P8MA 1HQFA 1ZPGA 4Q40A 3E8QA 5G12A 5THVA 5EFHA 3THJA 2PLLA 2V5XA 1TBLA 5G10A 5IWGA 4Q3TA 1RLAA 5DC7A 5LI3A 3SKKA 2EIVA 5G0XA 3LHLA 4RHLA 1T5GA 4ZUOA 5G0YA 3NIPA 4HWWA 5G0JA 5THSA 3TF3A 5THTA 1T69A 4ZUQA 4GWCA 4DZ4A 4IU5A 1T4TA 2PHAA 4Q3QA 4ZUPA 4BZ6A 5THUA 1P8RA 3SL1A 1WOGA 1WOIA 3E6KA 3Q9EA 3MMRA 4IXUA 5DC8A 4HZEA 3Q9FA 3DJ8A 3ZNRA 3CEVA 4BZ8A 1HQXA 2EF5A 1T4RA 1C3SA 1P8OA 3MFWA 3LP7A 1P8QA 1T5FA 1XFKA 4GSMA 3MFVA 5G3WA 4CEVA 4IXVA 4RHQA 4Q3VA 5HJ9A 1T4SA 5FCWA 3GMZA 4Q41A 4Q3SA 3F0RA 3MZ7A 2VQOA 4LXZA 4QA3A 3TH7A 1TA1A 2V5WA 4QA1A 4RLAA 1R1OA 1TBJA 3ZNSA 4BZ5A 4Q3UA 3SL0A 1C3RA 4ZUMA 4QA7A 2EF4A 1ZZ0A 3C0YA 5DC5A 5EFGA 4ITYA 4IU0A 4ZUNA 3PZLA 4BZ9A 3THHA 5EEKA 5EFJD 5D1DA 1VKGA 1P8PA 3MZ4A 1HQ5A 5G13A 5G1CA 3RLAA 5IX0A 2AEBA 3KV2A 3M1RA 3EZPA 4GSZA 5D1CA 2VQMA 4IU1A 4CBYA 4A69A 5EENA 4G3HA 4MXRA 2VQVA 4Q3RC 1GQ6A 3Q9BA 3SJTA 2VQJA 5D1BA 4QA0A 1GQ7A 2PHOA 5G0IA 5EFNA 4FCIA 1ZPEA 5EF8A 1ZZ1A 3F07A 3F80A 4RN1A 5BWZA 1P8SA 4BZ7A 2A0MA 3Q9CA 4MYFA 5EFKB 3E9BA 4GSVA 3MENA 3EW8A 4BKXB 5G1BA 4MYNA 1T64A 3SFFA 4Q42A 5DC6A 4MYLA 4QA5A 1HQHA 3EZTA 5G11A 4MYKA 4RHJA 4QA4A 5EEMA 4ZURA 5JI5A 4QA6A 4QA2A 1WOHA 2ZAVA 5G0GA 3NIOA 1ZZ3A 2VQQA 3EWFA 2RLAA 4IE3A 1PQ3A 1TBHA 4I06A 5CEVA 3MJLA 3F06A 5EEFA 3MZ3A 4IE1A 2GH6A 5G1AA 4RHIA 1C3PA 5EEIA 5G0HA 5A2SA 4IU4A 1WVBA 1CEVA 4CBTA 5ICNB 3RQDA 5HJAA 1P8NA 3NIQA 1W22A 4HXQA 1HQGA 4RHKA 4CQFA 4FCKA 4RHMA 3SFHA 3MAXA 3LP4A 1T67A 2VQWG 5EFBD 3E8ZA 4GWDA 1T4PA 4RN2A 1WVAA 4LY1A 3THEA 1D3VA
chains in the Genus database with same CATH topology
3MZ6A 3C0ZA 4RN0A 5EF7A 3C10A 5G17A 5FUEA 2VCGA 5THVA 5G12A 5EFHA 2V5XA 5G10A 5IWGA 5DC7A 5LI3A 5G0XA 4ZUOA 5G0YA 5G0JA 5THSA 5THTA 1T69A 4ZUQA 4BZ6A 4ZUPA 5THUA 3Q9EA 5DC8A 3Q9FA 3ZNRA 4BZ8A 1C3SA 5G3WA 5FCWA 3F0RA 3MZ7A 2VQOA 4LXZA 4QA3A 2V5WA 4QA1A 3ZNSA 4BZ5A 1C3RA 4ZUMA 4QA7A 1ZZ0A 3C0YA 5DC5A 5EFGA 4LY1A 4ZUNA 4BZ9A 5EFJD 5D1DA 1VKGA 3MZ4A 5G13A 5G1CA 5IX0A 3EZPA 5D1CA 2VQMA 4CBYA 4A69A 5EENA 2VQVA 3Q9BA 2VQJA 5D1BA 4QA0A 5G0IA 5EFNA 5EF8A 1ZZ1A 3F07A 4RN1A 5BWZA 4BZ7A 3Q9CA 5EFKB 3MENA 3EW8A 4BKXB 5G1BA 1T64A 3SFFA 5DC6A 4QA5A 3EZTA 5G11A 4ZURA 4QA4A 5EEMA 5JI5A 4QA6A 4QA2A 5G0GA 1ZZ3A 2VQQA 3EWFA 3F06A 5EEFA 3MZ3A 2GH6A 5G1AA 1C3PA 5EEIA 5G0HA 5A2SA 4CBTA 5ICNB 3RQDA 1W22A 4CQFA 3SFHA 3MAXA 1T67A 2VQWG 5EFBD 4RN2A 5EEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ6 A;  3C0Z A;  4RN0 A;  5EF7 A;  3C10 A;  5G17 A;  5FUE A;  2VCG A;  5THV A;  5G12 A;  5EFH A;  2V5X A;  5G10 A;  5IWG A;  5DC7 A;  5LI3 A;  5G0X A;  4ZUO A;  5G0Y A;  5G0J A;  5THS A;  5THT A;  1T69 A;  4ZUQ A;  4BZ6 A;  4ZUP A;  5THU A;  3Q9E A;  5DC8 A;  3Q9F A;  3ZNR A;  4BZ8 A;  1C3S A;  5G3W A;  5FCW A;  3F0R A;  3MZ7 A;  2VQO A;  4LXZ A;  4QA3 A;  2V5W A;  4QA1 A;  3ZNS A;  4BZ5 A;  1C3R A;  4ZUM A;  4QA7 A;  1ZZ0 A;  3C0Y A;  5DC5 A;  5EFG A;  4LY1 A;  4ZUN A;  4BZ9 A;  5EFJ D;  5D1D A;  1VKG A;  3MZ4 A;  5G13 A;  5G1C A;  5IX0 A;  3EZP A;  5D1C A;  2VQM A;  4CBY A;  4A69 A;  5EEN A;  2VQV A;  3Q9B A;  2VQJ A;  5D1B A;  4QA0 A;  5G0I A;  5EFN A;  5EF8 A;  1ZZ1 A;  3F07 A;  4RN1 A;  5BWZ A;  4BZ7 A;  3Q9C A;  5EFK B;  3MEN A;  3EW8 A;  4BKX B;  5G1B A;  1T64 A;  3SFF A;  5DC6 A;  4QA5 A;  3EZT A;  5G11 A;  4ZUR A;  4QA4 A;  5EEM A;  5JI5 A;  4QA6 A;  4QA2 A;  5G0G A;  1ZZ3 A;  2VQQ A;  3EWF A;  3F06 A;  5EEF A;  3MZ3 A;  2GH6 A;  5G1A A;  1C3P A;  5EEI A;  5G0H A;  5A2S A;  4CBT A;  5ICN B;  3RQD A;  1W22 A;  4CQF A;  3SFH A;  3MAX A;  1T67 A;  2VQW G;  5EFB D;  4RN2 A;  5EEK A; 
#chains in the Genus database with same CATH topology
 2CEV A;  3MZ6 A;  4IE2 A;  4Q3R A;  5RLA A;  3C0Z A;  4RN0 A;  3E6V A;  5EF7 A;  3C10 A;  5G17 A;  5FUE A;  3GN0 A;  2VCG A;  4Q3P A;  1P8M A;  1HQF A;  1ZPG A;  4Q40 A;  3E8Q A;  5G12 A;  5THV A;  5EFH A;  3THJ A;  2PLL A;  2V5X A;  1TBL A;  5G10 A;  5IWG A;  4Q3T A;  1RLA A;  5DC7 A;  5LI3 A;  3SKK A;  2EIV A;  5G0X A;  3LHL A;  4RHL A;  1T5G A;  4ZUO A;  5G0Y A;  3NIP A;  4HWW A;  5G0J A;  5THS A;  3TF3 A;  5THT A;  1T69 A;  4ZUQ A;  4GWC A;  4DZ4 A;  4IU5 A;  1T4T A;  2PHA A;  4Q3Q A;  4ZUP A;  4BZ6 A;  5THU A;  1P8R A;  3SL1 A;  1WOG A;  1WOI A;  3E6K A;  3Q9E A;  3MMR A;  4IXU A;  5DC8 A;  4HZE A;  3Q9F A;  3DJ8 A;  3ZNR A;  3CEV A;  4BZ8 A;  1HQX A;  2EF5 A;  1T4R A;  1C3S A;  1P8O A;  3MFW A;  3LP7 A;  1P8Q A;  1T5F A;  1XFK A;  4GSM A;  3MFV A;  5G3W A;  4CEV A;  4IXV A;  4RHQ A;  4Q3V A;  5HJ9 A;  1T4S A;  5FCW A;  3GMZ A;  4Q41 A;  4Q3S A;  3F0R A;  3MZ7 A;  2VQO A;  4LXZ A;  4QA3 A;  3TH7 A;  1TA1 A;  2V5W A;  4QA1 A;  4RLA A;  1R1O A;  1TBJ A;  3ZNS A;  4BZ5 A;  4Q3U A;  3SL0 A;  1C3R A;  4ZUM A;  4QA7 A;  2EF4 A;  1ZZ0 A;  3C0Y A;  5DC5 A;  5EFG A;  4ITY A;  4IU0 A;  4ZUN A;  3PZL A;  4BZ9 A;  3THH A;  5EEK A;  5EFJ D;  5D1D A;  1VKG A;  1P8P A;  3MZ4 A;  1HQ5 A;  5G13 A;  5G1C A;  3RLA A;  5IX0 A;  2AEB A;  3KV2 A;  3M1R A;  3EZP A;  4GSZ A;  5D1C A;  2VQM A;  4IU1 A;  4CBY A;  4A69 A;  5EEN A;  4G3H A;  4MXR A;  2VQV A;  4Q3R C;  1GQ6 A;  3Q9B A;  3SJT A;  2VQJ A;  5D1B A;  4QA0 A;  1GQ7 A;  2PHO A;  5G0I A;  5EFN A;  4FCI A;  1ZPE A;  5EF8 A;  1ZZ1 A;  3F07 A;  3F80 A;  4RN1 A;  5BWZ A;  1P8S A;  4BZ7 A;  2A0M A;  3Q9C A;  4MYF A;  5EFK B;  3E9B A;  4GSV A;  3MEN A;  3EW8 A;  4BKX B;  5G1B A;  4MYN A;  1T64 A;  3SFF A;  4Q42 A;  5DC6 A;  4MYL A;  4QA5 A;  1HQH A;  3EZT A;  5G11 A;  4MYK A;  4RHJ A;  4QA4 A;  5EEM A;  4ZUR A;  5JI5 A;  4QA6 A;  4QA2 A;  1WOH A;  2ZAV A;  5G0G A;  3NIO A;  1ZZ3 A;  2VQQ A;  3EWF A;  2RLA A;  4IE3 A;  1PQ3 A;  1TBH A;  4I06 A;  5CEV A;  3MJL A;  3F06 A;  5EEF A;  3MZ3 A;  4IE1 A;  2GH6 A;  5G1A A;  4RHI A;  1C3P A;  5EEI A;  5G0H A;  5A2S A;  4IU4 A;  1WVB A;  1CEV A;  4CBT A;  5ICN B;  3RQD A;  5HJA A;  1P8N A;  3NIQ A;  1W22 A;  4HXQ A;  1HQG A;  4RHK A;  4CQF A;  4FCK A;  4RHM A;  3SFH A;  3MAX A;  3LP4 A;  1T67 A;  2VQW G;  5EFB D;  3E8Z A;  4GWD A;  1T4P A;  4RN2 A;  1WVA A;  4LY1 A;  3THE A;  1D3V A; 
#chains in the Genus database with same CATH homology
 3MZ6 A;  3C0Z A;  4RN0 A;  5EF7 A;  3C10 A;  5G17 A;  5FUE A;  2VCG A;  5THV A;  5G12 A;  5EFH A;  2V5X A;  5G10 A;  5IWG A;  5DC7 A;  5LI3 A;  5G0X A;  4ZUO A;  5G0Y A;  5G0J A;  5THS A;  5THT A;  1T69 A;  4ZUQ A;  4BZ6 A;  4ZUP A;  5THU A;  3Q9E A;  5DC8 A;  3Q9F A;  3ZNR A;  4BZ8 A;  1C3S A;  5G3W A;  5FCW A;  3F0R A;  3MZ7 A;  2VQO A;  4LXZ A;  4QA3 A;  2V5W A;  4QA1 A;  3ZNS A;  4BZ5 A;  1C3R A;  4ZUM A;  4QA7 A;  1ZZ0 A;  3C0Y A;  5DC5 A;  5EFG A;  4LY1 A;  4ZUN A;  4BZ9 A;  5EFJ D;  5D1D A;  1VKG A;  3MZ4 A;  5G13 A;  5G1C A;  5IX0 A;  3EZP A;  5D1C A;  2VQM A;  4CBY A;  4A69 A;  5EEN A;  2VQV A;  3Q9B A;  2VQJ A;  5D1B A;  4QA0 A;  5G0I A;  5EFN A;  5EF8 A;  1ZZ1 A;  3F07 A;  4RN1 A;  5BWZ A;  4BZ7 A;  3Q9C A;  5EFK B;  3MEN A;  3EW8 A;  4BKX B;  5G1B A;  1T64 A;  3SFF A;  5DC6 A;  4QA5 A;  3EZT A;  5G11 A;  4ZUR A;  4QA4 A;  5EEM A;  5JI5 A;  4QA6 A;  4QA2 A;  5G0G A;  1ZZ3 A;  2VQQ A;  3EWF A;  3F06 A;  5EEF A;  3MZ3 A;  2GH6 A;  5G1A A;  1C3P A;  5EEI A;  5G0H A;  5A2S A;  4CBT A;  5ICN B;  3RQD A;  1W22 A;  4CQF A;  3SFH A;  3MAX A;  1T67 A;  2VQW G;  5EFB D;  4RN2 A;  5EEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...