4ZUUB

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-cf9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
molecule keywords Classical MHC class I antigen
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuuB00
4HWZB 4ZYKB 2Y7QA 1EAJA 1BEYH 1KELH 1HH6B 3HI1B 2QQQA 4GW4A 1NLDL 5KOMC 4PJHF 1IM9D 3FO9B 4W68A 4PFEA 2CIIB 1EV2E 3CDYA 3JVGC 1NEZG 3X13B 4ZAKB 5DMKA 2XZCH 5HHNA 1ZA3A 4Z7WB 4WV1B 3IJSB 1EA9C 5T3XE 2IFGA 5ERWB 2Z0BA 2XWJB 1LNUA 3B3IA 2FO4B 2APBA 1NJ9B 2M8XA 4O51A 3VXSD 5DFVD 4I3RL 2R4SL 4LCYA 2IH3B 5C6PB 4Q9RH 2CLZB 2YMXH 4M4RA 3CU1A 3BQUA 2B1AH 2PO6D 4WGVB 4FQXB 1XIWA 4DKEH 4X4XA 3GSQB 5C7XL 3AMKA 1QFWI 2E9IA 2HT4D 3PG2A 3H0TB 4JFEE 2D4FA 3LN9A 2F9BT 1OARH 1F4YH 4BH8A 5CSGA 4M7JL 1MRDL 3SY0A 3CK0L 3DYMA 4P3DA 2BMKB 4LLMB 1VKXA 2F54D 4TRPH 5DWUH 3CLEL 1R3JA 3DI3B 3RDTA 2RHEA 4GSDH 2XWBA 2AV1A 3H9SE 2D31A 1J1XH 3CFIC 3FQNB 3CFCL 4HX1A 5CJOH 5JR1H 5I1KL 3VD5A 4JZJC 5C0RH 4LHUD 3E6HB 3G9AB 4NKDA 2NZIA 5F21B 3AM8C 3LEXA 1RMFL 2J4WH 5E8OB 3MOAH 1MWAH 4M7KL 5EOCH 2XXCB 2XICA 3F58H 2OXGA 1VADA 4N0UA 3QP3A 1TTFA 5I8OL 2K7PA 4HXBL 1LQSR 4WI9A 4HMDA 3U0PA 4U1MB 4QXWA 4GMTL 4N5ED 4FQXC 4PJ7F 5IIEA 4OB5L 4ISVB 3CFDA 4PJ9B 3DX6B 3MRLA 3TF7C 3RZCB 5KG9B 1K4DA 5E1AB 2CR3A 2BNRB 4HS6A 5CIPB 1PGRB 4OZGA 2GSGA 2X1PA 2V6HA 3AXLB 4RCAA 3VFGH 3OX8A 1F42A 5D2NE 4XHJC 3V4VL 4Y5XB 1LVEA 2NY4C 5CP7A 3ZLQC 4XCCH 3HPLB 4PJ8A 3KVQA 3WFBH 4NO0A 4JFPB 3MV9A 3VXMD 1TVBA 1KPVA 2WWMC 4H1LB 5JHDB 5EU6E 5F9OL 2CLRA 8CGTA 1D5MB 3DWTA 1BM3L 3GHBH 2MKLC 3MXVH 3GB7A 5LQBH 1W2KT 1JNLH 3HUJF 5FGCE 4ZFFA 3SHSA 5A40E 2CDEA 4RAUA 2P44B 4AY0A 4Y0GA 5A2KH 3R8QA 2YD5A 3KHOA 1RZ7H 3FHAA 1UM4H 4KJPC 5CJOL 3BKML 3VFPB 3QH3B 3V6FB 1EEQA 1KJ2A 4U49A 4NKDB 3RX8A 3VWKD 3F8UB 4IRJA 2Z93B 1KG0B 1D5BA 3MLSL 3EO1B 2Q1EA 4QXUL 3MJ8A 4Q2ZB 3MLVH 1S7SB 1KIUA 2A6JB 3V6OE 2DM7A 2YSSA 3E2HB 4RFEA 4JM2A 4L4VE 1Q9KB 1TJGH 3H9YA 3NACL 2OTWA 1LO0L 3QXUA 5I76A 2O5XH 4U6XB 2LU3A 5HY9B 4Y8AA 4OZGB 4R3SB 4JRYA 1Z0MA 3RA7H 3THML 4PJXF 1IC4L 3RWJB 1F4WL 4JFYA 3F62A 4QWWC 1XIWC 4PGCA 3BI9X 4QRPA 1JZ3A 2L0DA 4LCYB 3MNWB 1N2RA 4LCIL 2ZUTA 3AS3A 4YDLB 3PGFH 3G04B 2FNBA 4NO0B 3UTOA 15C8H 3O3DB 1JGLL 2BK8A 1AY1L 1M7IA 4NQED 4LBEA 5DA4A 1KIPA 5LGKA 3TCLB 3IETA 5HPOA 3EO0A 1YEHH 1WITA 4DN4H 2V7NA 4ESKA 4NUGH 5KSUB 4M4PA 4OLVL 1IEAB 5JDSA 3EJZC 5L9DH 1I7RB 3GMQA 3MNVA 4U1LB 1CICA 5J11B 4K7PH 2BOCB 4Y4FD 4TVPH 3MUY1 4I0PA 4J3UA 3IJHB 3HUJA 1BQSA 1I9IH 4YDVB 3NBNA 5J9PA 2JELL 3C60B 3VXPA 2X4OB 2DD8L 3LDBB 1M7XA 4PJ5E 5C0IA 4EBQH 4KMQA 4G8EA 4I13B 4UAOC 5FUOL 2H3NB 4P5KA 1WWAX 5IVZA 1A1OA 3VI4F 1LK3H 2YUVA 4NKIL 5IBTH 4LLWA 1LE5B 3AGVA 3RZCA 4UNUA 4WI5A 1IM3B 2E7LC 4LLYA 5TGBB 4PJ8C 1Z9LA 4NIKB 3WCYA 4I3RH 4QRQB 3HR5A 3IDUA 4YE4H 4UQ2A 2R23A 4MDJA 2H2SD 4L4TE 4KTEL 5T33L 3HZMB 5E4EC 1KCVL 3UX9B 1WT5A 2QR0A 2IPTL 3AROA 1DBJH 2OR8A 4HIXL 1UWEL 1A4KA 3E1F1 3F7PC 3MV11 5K9QG 4WHDA 3CNKA 4R0LB 4NPYA 3V52L 3WDHA 5E08L 3S5LA 2CK0L 3LEYL 5L7XL 5KS9A 5KSVA 4JRYE 1UXWB 4OGYL 1FVEB 3CMOL 5FYLL 3ROLB 1OAUH 2VABA 2DJSA 5BRZB 3VH8B 5C2UB 1VFAA 1ONQA 1QVOA 3VFUB 2MQCA 3L5JA 1I3GL 2GTWA 5I18L 1I8MA 3DO7A 5JR1L 1XGTA 1J87A 5GJTL 4NKMB 2Q8BL 1TTGA 5C07E 3VFNB 1A2YA 4H5SB 2JELH 4IOSD 1U8KA 2ADGB 2IFFH 4P9HH 3VGAB 2B2XH 3LPGA 1YY8B 2P7TB 3HI1A 3GSOB 1GHFL 3CJJA 1NAMH 5C0EA 3IFLL 5TE6L 1LEIB 3ES6A 1ZV5A 3R1GL 3ZYJA 5EU7C 4GLRI 1U92B 3QJFA 4J2XA 3GI9L 1S7RA 2F53B 5KANG 3SKMB 5IBTL 2OTWB 2FO4A 1HHHB 2HFFA 1JF5A 2DQEH 4B7LA 4ZQKB 2C7UA 2ZOLA 4XP4L 5D7JA 3WIHH 2YD8A 4XH2B 3VFOB 2HP4A 4HUUB 1C5BL 4R7DA 4UU9B 5CGYD 2IH3A 3N0PB 1YJDC 3UTSE 4HGWA 4LSSH 2QQNH 5EFIA 2EYSB 1PSKL 2R23B 2ZJSH 3O3AA 5DFWH 3FQRB 3MA9L 3L3OB 3U1SL 5T5NG 3QAZB 4HK3N 1M7DB 4ELMB 1QO3B 1WCBB 1A64A 2EDEA 1T03H 1NBYA 5GIRA 1FZMB 4JRXA 1NFDF 3ARGA 4Y2OA 3I75A 3SJVA 4JVPA 4CMHB 5CCKL 4MX7A 5I8CB 4GG8B 4XNUL 4PGEA 3U9PH 2IGFL 1WFNA 2YRZA 2V7NB 4J3XA 3OTTA 1GSMA 5B4MD 1KGCE 5AYQA 1CU4L 1U8HA 5JORA 3NA9L 3QDGB 1JF1B 1INEH 4Q97A 4Y19D 4G9DB 4RBPH 4ZS7L 4B0MM 1FYTB 1I7TA 3GHEH 1H0DB 1YMME 3WEXA 1S9XA 3I02A 3MO1B 4DAGH 3U4AA 1A9EB 1G0DA 3S34H 2X10A 4YIQB 4BELD 4QXTB 5HVGB 2AXGA 5ILTH 1YDPA 4PBVC 2Z31A 1X7QA 2QL1A 3RZCC 1F6AA 2BJML 2H1PH 3MV8B 5DQJB 1RVFL 1VESA 5KAQG 3PGDA 4FS0A 1NGQL 2Y07L 1DQLH 1JWUA 4K8RH 1N0XH 3Q5TA 1UKSA 3L95A 2J6EH 3KJ4B 5EDXA 4MJ6A 3VFOA 2NY4D 3RP1A 3MA7B 1ZTXH 1WT5C 3OV6A 1TITA 4JFDE 1LHZA 4UIKL 3UCRA 1HN1A 1MOEA 3LS5L 3JWOL 3O9WB 1XGYL 2FEDC 4YZFE 1FN4A 1FL5A 3BGMA 1LGVA 4JKPL 5DTFB 1XR8B 3QO1A 7FABH 1T1WB 3RRQA 4W81A 4NSKA 4FA8A 3MOBL 4YHLL 4M8QA 3BPOC 1T1YB 5D5ME 4PLKD 4G80B 3T0EA 1G7JA 4XWGH 3NCJL 4JGUA 4NQSB 5TDPA 3DHMA 4S1RL 4R2GD 3RWGA 4WY7H 4LNRB 3DX8B 4PTTB 5T5NF 1KCSL 1Q72H 2EXWD 1TVHB 3ULUD 1TFHA 4OD2A 5MI0B 1ONQB 1QVOB 1K4CB 3L3DA 4KDWA 2WANA 3D9AL 3EO1A 4NZDA 4D9LH 1VB9A 4PRNB 2YZ8A 1YZZA 4ERSH 5GS1B 1KIRA 1DEDA 4S1DC 1D9KB 4FXKB 1JPFA 1QBAA 4EI5C 1OQXA 1IGML 3BDYH 5F88A 4PRDA 4Z78B 5B8CC 4DGVL 5L0QB 2OI9C 1JNJA 1JF6A 1WV7T 2IMNA 3MBXL 4EDWH 2BFVL 2IADB 3QDGD 2NY1C 5L0QC 2Z35B 4BH7B 5IB5A 1I3RA 1GC1H 1OB1A 2NYYC 2HRPL 3FQWA 5C0DB 3MLUH 4PJBA 3UTQA 2GJ6D 4K9EC 3PHQB 1KBGL 2CO7B 4NWTH 4Y4KA 4ZD3L 3O2WH 4JG0L 3NA4A 4ZUSA 3I85A 1FFQA 1FG9C 5J6HB 4EVNA 5C6WH 4G8GB 4M7ZC 4ZFZA 5INCA 2WBJD 1KENL 35C8H 3LKPA 4ODBD 3BHBA 3D3VB 2R4RH 4P2OB 2R1WB 3M8OL 3EKCA 5FM4A 4ELMF 5L2KD 3WIFB 4IIQC 2YBRB 1U3ZA 4N0UB 4NO0D 2X89A 3HI5H 3RPIB 4ALAH 5HHMB 5F7HA 1P1ZB 1V3KA 4ZSOA 5EWIL 2I25N 3DROB 3T0EE 4JGMA 4JM4H 3BGFB 4AEIH 1U2CA 3KYNB 3SGDH 1DSFL 2ORBL 2G75A 2VDKL 3HI6L 5SX5H 3V9FA 2X41A 5E4IA 3KXFA 4J8RA 1IGTB 5I30L 3L3KA 5D1ZA 5E5MB 4ZS6C 1YEJH 1JPFB 4LSTL 1YPZA 4XNQA 3WXVL 1IM9B 5DMJB 1CGXA 3V79C 3SDDA 5EO0A 1WC7B 1GL4B 4AT6A 3LHPH 1N5AB 4UTAH 3A6OA 5DQDL 1SJHB 3CUPA 3R1GH 3VXUD 5F9AC 1XAUA 1FL6B 4HUKB 2B8OT 2F5BL 1J88A 3BAEL 1FDLH 3KPRD 2BNQD 2HWZH 4Y8DC 4LSPL 4HWEH 3IAQA 5GGSB 3STZB 2VLKE 5TDNB 3OF6A 1YC7A 1L7IH 4AJ0A 4M6ML 3QDJB 1AI1L 1NGPL 5DUBB 4RA3A 3FT4B 3GSQA 1MCDA 4PJDB 2Z8WC 1P7KB 2MQ0A 1FSKC 2BVQB 4J3TA 5C0CA 3W5MA 3O3EA 4GO6B 2H8PA 3GI8L 3MOAL 5DMGC 4MB4A 2CSPA 4YHKH 1Q0YL 2VN4A 3DSNA 4NPYB 3NFSL 2XN9A 2E5EA 4F33A 5BJTA 1S5IL 2Q86A 2NXYC 2YS4A 3RPIA 4IRZL 5TH2A 4KQ4H 2DKUA 1NC2D 4X4ME 4QRTA 5AZ2H 2X70B 3TBYB 1D3CA 1ZEAL 3QT2A 1T5WA 3KYNA 2P8LB 2VDKH 2QKIA 3BEVB 4U7MA 3GSNB 5KVEH 1A7QH 3K8LA 4MD5B 1NBZB 4WJ5A 4XVSL 2XA8H 2C9AA 4O02L 5IQ9A 4X7CC 5DURD 3SKJL 3TO2A 5ANME 3GHEL 4HS8L 1P5UA 1PKQA 3NMEA 4K3JH 5FDWB 2QSCL 1YN7B 1BBJA 4IJ3C 4PJFA 1KNOB 2OSLB 1TVDA 1R3HA 5HGBA 1X3DA 4I8DA 1FQ9C 3C87A 3KPOA 5ALCH 3UBXB 4F15B 2GJ6E 2N1KA 2OM5A 1WBZB 5I75C 5TPWH 1EEUA 1HXMB 3SE9L 4HUUA 1X5ZA 5EUOE 3OKMB 1DEEB 5D7LA 1BFSA 4UT6L 5IB5B 5B38A 3T0AA 2BVPA 2X4RB 3IETB 4XBEH 2FJFA 1E4WH 4MDIB 4JVUA 1S9VA 3KYKL 2JCCB 1IKFH 2XG5A 4V1DA 2EICA 3F12A 3E3QE 4XVJH 3MR9A 5C08E 4IIQA 3TT1H 4S2SA 2CQVA 4U33A 5E6IC 2QHRH 3DO3A 3ULVE 4P46D 4QYOA 3MLVL 1UZ6E 2FATL 4Z77B 3K74B 3F7YA 1PYWB 3N1PC 5IR1A 1UT9A 2JJVA 3NCJH 4NQCD 3KPQB 4TTGA 2ITCB 6FABL 3GMLB 2OQJA 2ZG1A 4G6FB 5FOJA 5KVMC 4JM2F 4Y5XC 4MAYB 3C60C 3BGFC 4Z95L 4MHHI 4PBWD 1CLYH 1MFBL 1NCTA 3D9AH 5DK2B 3P4OA 3REWA 1XF2A 3EDDA 4WV1A 2PW2B 4Z7VB 3ZE0E 2ZCHH 1HHKB 4KHXL 1DVFD 3MCLH 4G6ML 4K3DH 4OZIA 4GKSB 3HPJA 3WFHA 4LVNC 1JYXA 5ACLA 4YFEA 2DM3A 4U6HB 1R0AL 3WE6B 4IRSD 4XP6L 5EA0L 4NNXB 5ID0B 4KVCL 2FYYA 2XTJD 1ZHBA 5GSRB 4EN3C 1I8LA 5AZEH 3KAAA 1JBJA 1GAFL 4QEGA 1XF5B 1CD9B 3BRDA 1Z2KA 3PIQB 1IKFL 2VLKD 5F1OB 1JYNA 3KDMA 3HE7C 3EDEA 1OCWL 3B2VH 5KVFH 1L7TH 5C0BD 4ZFOB 5I1AB 1T6VN 5J56B 3QXAA 5HVFB 1IC7H 4HJJL 3MLPA 3QIWB 2XNAA 4YNYB 4ZPVB 4I48A 5LCVL 5SWSB 1KENH 1XGTB 5ENWB 2IAMA 4ODSH 5EBWB 3RHWK 3FKUS 3KLHD 1L6ZA 4I2XB 3AFLA 4PP2A 4C56E 2FCBA 4FFYL 5L2KB 5ETUB 1LEIA 1ZT4A 1FIGL 5K9JL 2VAJA 4X6FB 3EJZD 5E9DD 2X4TB 1EZVY 1MFBH 2BDNH 4P3CL 5I17A 5LAXA 5GZOC 4PJ5A 2WUBH 1F4AA 2I60L 4XAKD 1IAKB 2NX5D 2Y7QB 1CD0A 4LPCA 4F9LC 2BNRA 1A22B 2BHZA 3M17B 1P7QD 4G8EB 2PYEA 3QA3B 2EH7L 4JO2H 4N0CC 4OT1L 5D7IA 3S36X 4NQDB 2XRAH 3MSPA 2WBJB 5GS0H 1KTDB 1KNOA 2OSLA 3IXTA 3UROR 5I1EL 5K9OA 1YEFH 5IG7B 3TH4T 4M1GL 2OL3B 2W60B 3B2UC 4ELMA 1V3LA 3LIZH 4H25A 1JGUH 4OGYH 1MJ7L 1R5WB 3R4DA 2VR4A 3E3QC 3KPNB 4ELKB 2CH8A 3RWFB 4DCQA 1YJDL 2XKSA 3OKKA 4XHJD 1A6PA 2HVJA 1UKTA 4AL8H 5HHQB 3GMOB 3D0VB 3GBLA 4JZJA 1OF2A 4WDIA 4RAVA 4IIQB 4QHMA 2GK2A 1I1FA 3L5HA 1HZHL 3ZDZF 2IFFL 2YD4A 4RA0C 4HDIA 3ROOA 1T5XB 3H9SB 4OF3A 1FVEA 5EU3B 3N06B 3CFJA 3NTCH 1QFUL 4OCSL 1KG0A 1RZFL 2QEJA 3BE1L 2BSRA 3ET9F 3D6GA 3EYSL 5DVNA 3TBVA 3FCTB 2D31B 3AAZA 5D5MF 3GI9H 2VLRE 3FJTA 5HI3D 1KN4H 4KK9C 4LSVH 3WN5C 4KJPD 2GEEA 4KQ3H 5IFAH 4L5FL 1SHMA 3QIBA 2L7JA 1JYWA 3QDME 4MJIB 4NHUB 2I9LB 3TIEB 12E8H 3ZO0A 1ZMYA 5B3JE 4IMKA 1YPZB 4PLOB 4YDIL 2G5BB 3MA7A 3HC0B 3NFNA 3VFMA 4PJHB 2DL9A 3ISWA 5BVJA 3OB0K 5CGTA 5DJ0B 1FH5L 5IMOA 4F2MB 4PJIF 1S7TB 4JQVC 5L6YL 3FB8A 5EUKB 3K4AA 4QHKJ 4Q0XH 1U8IB 2ERJB 4KMTH 3CXHK 3RY5A 1WCQA 3L1OL 2IGFH 2ZSVA 1MCHA 4D0BB 4QWWD 5TDNA 3TYGH 2XFXA 4GRMB 5A2LH 1WWCA 4OCYH 5HYFA 2EIBA 2P5ED 2X44D 4TYUA 4Z6AT 1JZ6A 3P0YL 2AK1H 1CE1H 5F8RC 4BSJA 3ECBA 3CFBB 3MNVB 4U1LA 1FAIH 2GK0B 4JJHA 5GJSL 1NDMA 1CDYA 1MCBA 2PKDA 4P23B 1G6VK 1FFPA 3QUML 3MLXL 1NUDA 2EIDA 3KPLA 3S34L 3M1BB 1IE5A 4N0YL 2DLEA 4J7RA 1DQML 3HG1B 1KN4L 3QUZA 4FN0A 4BSWB 3MYJB 1WBXB 3C8HA 5FO7B 4Z76B 1ZSDB 4Y19B 3BD4A 2DD8H 4MD5A 1X6NA 5ANMB 3QXDB 4GXUM 5D1QA 4HWNA 4PJBF 4PJ5B 4LAQL 5IROA 3QWOA 5DHVB 5GRYA 2VL5A 5AD0B 1UCTA 3WS3B 1AXSA 2Z35A 3O4LA 1RZKH 1EBAA 4HJ0C 3HC0A 5DMIH 3WMSA 5LKNA 1F3JA 4X7TB 1F4XL 1C12B 2WIIB 4XNZC 1S9WB 6CGTA 3P73B 3IT8D 3L95B 4IRJD 5HDOA 2D7QA 2EIZA 4M62L 1KIQA 1LD9A 1LDSA 4KK6C 4MZ2A 3V4PH 9CGTA 4QCIB 4ZTOL 4FQ1H 5TQ2H 4APQD 4LLMA 4MAYD 4OCLC 1R3JB 2DAVA 3RDTB 5IVXA 1UFUA 2YPLE 3WHXB 2XV6B 4L4VD 5HHME 3INUL 1NCNA 4CDHA 5CKGA 4MXVF 3U7YL 1WZMA 1M7IB 3ZL4H 1YQ2A 1DN2A 1T7YA 4QHMB 5EZOL 4JRYD 4LARH 3SEPA 1HEZB 3HCVA 3MRKB 4MS8C 3MRHB 3F7YB 4OFPA 4DFIA 3UAJC 1QA9A 3WNNA 1QFHA 3IFPA 3QIBC 4IEFB 3KJ6H 4MXWH 2R2HB 3RIFF 4WFED 3VWKB 1K4CA 4JRWA 2HAZA 1T2QL 4UINH 3VXMB 43C9A 4ODWA 3OGOE 5DYOA 5FV2A 5EOCJ 3GSVB 1DLFL 1JV5A 1G7IA 4P3CH 4JB9H 1BZ9A 1GHFH 5C7XH 1O0VA 1E6JH 4WW1A 4RGND 1RURL 2A1WH 3LZFL 1BBDH 3JTSA 3V5KA 3SKOA 4QHLB 3NCYS 1ZVYA 3D5OF 5DC9B 3U0WH 3FMGL 5D7SH 1XF4A 1OTSD 1H15A 1T89C 2BHYA 4ETQA 1KSRA 3C9NA 2R8SH 3KPSB 2EYTA 1QKZH 2ATKA 4KUZL 4P5TC 1I9RL 5H94A 5CGYC 4RAUB 3PQYE 4JM4L 4AEIL 2FIRT 4FTVD 1KJ3H 4OM1L 1C1EL 1I7UA 1DANT 4ZFZB 3U7YH 1QBBA 4XCNB 4LEOA 4JFFE 1KEGH 2LE9A 2QKIB 5IBUB 5LGHH 3RGHA 5IVOA 5JXEA 3CSGA 4NQXA 1VFOA 5IOPB 1FZKB 3HNTL 5JW5B 5C0AA 2FHBA 5DQDH 1YECL 5D7IE 4RFOH 4XXCC 1FFRA 3I6GB 4RFEB 2H9GA 5DRWA 5ID1A 3QZWG 5DJCB 1DL7L 5I8OH 4L3CA 1XH3A 1M6OA 2QLVB 4HXBH 3WUWG 5KSBF 4S1SL 3UTZB 4N0CD 3L7FB 4PJXB 4PJCB 1BFOB 4LCWA 4H8WC 5IGXL 4JFED 1QLRB 2P8PB 1Q9OA 3UJTL 4KWUA 4R7NB 3ZTJH 5E24E 2NY7H 4RZCA 2IPKB 5C08D 2UZIL 4L4VB 2I07A 5IHUH 4JQIL 5D7SL 3G5VB 2F54A 5MEQB 3PE9A 4MD4B 4ZUWB 1BQUA 3GSRA 4UBDC 3WNMA 2CRMA 2B7DT 5LXGH 5GGSA 4LKCA 1OAZH 2VZOA 3TWCH 4QYOB 1SEQL 1VEPA 2D7MA 1NGYA 5E8PB 2DQJH 1PZUB 4JKWA 3MBEA 3OXSA 5E56A 3TIDB 4YUEL 5HHQA 4HKJB 3QNXA 1N3NA 5IW6A 2VYRE 4DGIH 2JJSA 2XA8L 1S7WA 1C5DA 1UCBH 1RZJC 1WZ1H 1FAIL 3GSWA 3HUJB 5IV2B 5DJZA 1EJOH 4X6BA 4YDJB 4NN7C 2OMNA 1TNMA 4PJGA 5C0IB 4OD1H 4OCWH 3JV5A 2BSSA 3HAEB 4F3FB 2B0SH 4LU5L 4TPRH 5IMLB 4O9HH 5FOBA 4KRNA 4TSBL 2EDLA 2YKLL 4Z7OE 3TM6A 4K55A 2XTLA 4LCIH 3HRZB 5FA3A 2ILLA 4MQXD 3ARGD 4OGXL 3MJ9H 5FM8A 2KH2B 1H8NA 3RGVA 4PJ8D 2R56H 4L4TA 4OJFH 3BZDA 4L3AA 1MJJB 1UXSB 4NO3B 1BBJB 3KYKH 3F7QA 5E8DL 2DQIH 3V0VB 2AJSL 5HYSG 5FGBA 1ZWIB 5FB8B 4PJ7B 1G9EA 2O61A 2EZ0D 1DQJB 2EH8L 4I0KA 1NC4A 4ZUVA 4ZFOA 4RWHA 1IC4H 3HZMA 4P5TA 1FZJA 2CIKB 3MACL 4M61A 3GRWL 1AGCB 4BQ8A 3MJ9A 2XOTA 1NGWA 1P2CB 4GRWE 3SCMC 4HMCA 4WFEE 4XI5C 5DD3H 3PWVB 1J7VR 1U8LA 4KKBD 1JPGA 3H8NA 4KDVA 2X4QB 3D25A 4XCNA 3QRGH 5E99L 4OZ4B 3I6KB 1KTKE 4GRWH 3AMLA 2NY5H 4X5XB 4PV9B 4DGYH 1A2YB 3RVUC 4WHYH 1WBYA 1LK3L 1P7HL 4U1IA 5K33A 3EW3B 2VDNH 1I8MB 4AMKH 4X9BA 4Z0XA 3RKDC 3U2SA 3VG0H 1YEGL 4G43A 5D96C 4YPGB 1X5KA 1DSFH 2ORBH 4RMTA 3VCLA 4LASL 4MNQA 2UWEA 5JOPE 3BN9C 4HBCL 4QOKA 2I5YL 4M7LT 4P23D 1EMTL 3OHXA 4N8VB 2WK2A 2GJ6B 5CILL 2YD3A 4K8RD 1DLFH 2X4UA 1ZLWK 4P9ML 3T0ED 2IPTH 5EORH 5CZKA 1MVUA 4P2RE 4PJ9C 3S96B 5E8DH 4FG6C 3DXAA 4YXKH 3STZA 4N9OB 1L7TL 1PQZA 1KLFA 4JJ5B 1RZJH 3NN8A 2ZUQC 3BIAX 3QEQA 2COQA 3TNNA 5FYLH 3A6CL 5HHMD 3D0VA 5D2NA 2P48B 1TVBB 4HT1H 4APQC 2CMRH 2R0ZH 1CFSA 4XP5H 1CN4A 1OOAA 4UV4L 3LRHA 5T33H 1TQBC 5H37H 4XNMA 4ZO8A 2Q8BH 2ICWI 4HIXH 2DBLL 3PWVA 4ZO6A 3SQBA 4PJAB 3L5XL 4TOYH 4XBGA 2V9RA 1U8HB 4YHNA 4WIQA 1KEGL 1TZIA 1QQDB 3S3PA 4IRZH 3ESUF 2VISA 1AE6H 4YHOL 2WW8A 3MJ8B 1D7FA 4Y4KD 4H8WH 2BSTA 1A7QL 3L7EA 2BP3A 1M05B 4YIQA 2MCPL 2X9WA 4Z7NE 1PG7W 4WWKA 4HUVA 1NMCC 4Z7UE 5IESL 2J7LA 3GMMB 3OAUL 4M5YL 5HBBA 5F3BB 1RSFA 2PYEB 1T83A 3IRPX 4LSUL 4ORZC 3RKPA 2MSPA 4JO4L 4WHCA 3JTSB 3V5KB 4EIZC 3F7VA 5B38B 2FEDD 1L0QA 3RNQB 2FR4B 1N2RB 4JANA 3UJIH 3U9PL 4HIJA 5C0GB 1DBAH 5TE4H 1HHJA 1PX3A 5CWSB 5LGJB 1N8ZB 4M8VA 3LSOA 3U83A 5I8KH 3MRRB 3T0EB 4Y19E 3UPRB 3OXRA 5C0RL 4G7VL 1T1YA 4P2RA 3U1SH 5F3HA 2HT3C 5ICZA 4KHTL 4HH9A 1CR9H 1KXQE 4ETYA 4C83A 4BZ2H 3MUJA 4WO4A 1ED3B 5AWNH 4PRIB 4ZOCA 4ONFH 4QY8A 5C0JB 4RFNC 2R1XB 2VIRB 4JKMA 2VO5A 5AAWA 1RVFH 2ESVD 3O2DL 3RVWD 4FQ2L 2Q8AH 1QPPA 4UQ3B 3C6SB 2HFEA 4P57B 4O00A 3I9GH 2HLAB 1INEL 1VGKB 2XZZA 4CU7A 4Y2DB 3FB5A 3UTSD 5KSBE 4U6VL 2DOCA 4OLXH 1NAKH 3WS6C 4X4YB 4KK9D 3EFDH 4PJ9A 3B8YA 3LY6A 4YO0B 3JWOH 3WO4B 1YUHA 1R5VB 1OSZB 3PWPB 1T20A 2HYMA 3HC3H 4QTIL 4BH7A 1U3JA 3X11A 4GMSH 1TTUA 3MREB 5IFJA 2AEIT 4HIEB 1FG2B 2J8UE 3AY4C 4HWBL 4MWFB 2I9TA 3QDHA 4BQ9A 3N1QC 3S8WA 4JHBA 1CTOA 3BPOB 5IB1A 1EX0A 1JGVH 1LEGA 5K9KB 2DRUA 1R24A 1HHJB 1BZ7B 1Q72L 3HS0B 1I75A 4YHYB 2A6KA 3RI5K 3K80A 1J1PL 4F8TA 4HBQA 1ETZB 2X4RA 5F3HB 3MRCB 5C08B 4HIHA 1F3RB 1GPOL 3Q3GA 2HA1A 3EDKA 4R96A 5DSCA 1G7LB 4Y4HC 4N1CA 3HLAA 1NDMB 3CX2A 4X83A 4ODWB 4M6AA 1JHTB 4JFEB 3KPRB 3TH3T 1LO3H 3PNWA 5JUEH 3QR2A 2B1HL 5I17B 2VISB 3VWKC 3BRGC 2ERJC 2PR4H 1QLEH 1S9YB 5L8KB 2F8OA 4IHOA 1BVZA 4XMLL 5GS0D 2NR6D 4KI5D 4NWTL 3TO4B 2F53D 3WKML 4LLAA 2FD6H 1CDHA 2R4SH 5GZOD 2XTJE 3VXSA 2W9DH 1QBML 4NRYB 1GGCL 1MIML 1RZGB 4JFXB 3QIWD 3DV4B 2VWEE 3MLTB 3QSKB 3RWFA 3ZKMD 2VXUL 5JPNB 5DUBA 1HDMA 1JZ4A 1JGVL 4GAJL 3DGGB 4UOW1 5F1SA 2FGZA 1X5FA 3IS0X 5C3TA 4TRPL 3PDGA 4NO5A 1P7KA 1BJ1H 4MCYB 4IRJC 3LSOB 2R0ZL 3O2WL 1WZKA 1DVFA 2DS4A 3HNVL 4K07A 4NQXB 4HH8A 3ARDB 4LLVA 5D6DA 3NCMA 4YHZL 1SYVB 5GS1C 1VEMA 3ZTNH 1QHPA 3BO8A 1RUAH 2HT2D 2HRLA 1DQQA 3LRSA 4HPOL 4LSRH 4PRIE 4I3SH 1BIHA 4EBQL 3RVUD 3V7MA 4XPAL 4MXVE 4R3SA 3DVNB 4OCSH 4UTAL 2V17L 1T0MB 5T5FL 4L3ED 1WBYB 5SWZD 3D0LB 1SJEB 4NHUA 3OR6A 1YQVL 4RIRB 4X4ZA 5ADOH 3ALWA 4QF1B 1A3LH 2J3SA 3GSXA 3CH1A 2A6JA 3FO0H 12E8L 1A1OB 2Z31B 1I85C 4R26L 3CSYB 2VLJA 2GJ6A 3REVA 1MRCH 3K3QA 5IESH 4MD4A 4ZUWA 3FO2B 4GFTB 3ALPA 1XFPA 4HMEA 1FSKB 4P2OC 2A9MH 1FH5H 4QRQA 4X80H 1S9VB 2ICCA 3RWDA 3TFKD 1CFVL 4Y16D 1CLOH 5EB9A 1DZBA 1SMOA 5D2LA 4KQ4L 1XF4B 5K9KA 2DDQL 1JNHB 4P46C 1BIIB 1ZANH 1ORQA 2ZUXA 2VLKB 4GG6E 2UVFA 2A77L 4E0RB 3OKDA 3D85A 2VITA 4X6BB 4CU6A 3WN5A 3G6DL 5GJSH 3J8F7 3VH8A 1SJVA 4AZ8A 3U7AA 4NQVB 3DHJA 3KPTA 2BOBB 3QUMH 4JN2B 1IM3A 2HFTA 4G6JL 2HMIC 5JOFA 1J11A 2C3XA 4UDUB 5DJDA 4OF6A 3MLWH 4PRID 4KXZI 2E7LA 2K9UA 3TLRA 2J1KA 2AJUH 3P77A 1WEJH 4KI5F 2ZSWA 1AD9B 4NJAL 4EUPG 5K9QI 1I4FA 5C6TL 1GCFA 4JQIH 2ID5A 1J1OL 1IT9L 1T6WA 3K46A 4EI5B 4NNXA 5EUOB 1HHHA 4PPTA 3G5ZB 1MCSA 1Q9OB 3HTLX 1YYMH 3BZEB 4U3HA 3PGFL 4L1DA 4FFWC 1WJ3A 5BMFH 1I9JH 2VLMD 3EO9L 4FFVC 4I4WB 3GRWA 5EZLA 4F7EB 3KG5A 3QPXL 2GT9A 4RZCB 2EC9U 2ZOKA 5BS0B 5DJ2B 4OZFA 2VLLB 4FTVE 4NRXA 3N50A 3VFNA 3ZSTA 1SVZA 1ZT1A 4OD3H 1FGVL 1E4WL 2JIXB 3PWLA 3KGRA 1A5FH 4MNHA 5CZVL 2FHFA 4PYGA 4MAYC 3U2SB 1KJMA 3NH7L 2AEPH 2IEPA 1J0YA 1AQDB 3ZL4L 1CICD 2QHRL 5DO2D 1RHFA 2YUZA 1DQQB 2AEQL 3KPPA 3WUWB 4UT9L 5ISZA 1KCRH 5DK0B 3P4NA 4HCRL 4YX2H 2O5ZL 4DWHA 2GUOA 4G9DA 1YEKL 2VL4A 1B6DA 2NLJA 1XGPB 4GAFB 4WNQB 1DBBH 1XGUA 1U8QA 4QHNA 5D7JC 3GIVA 3LKRA 1UWXH 1RAMA 4Z95H 3T4AB 1B90A 4XGZA 1F58L 4R4NC 1N7MH 1TZHA 2AKRA 2FIKB 1IT9H 2ENYA 3DBXB 4PREA 2VH5L 4YHMH 1KPRB 4RMWA 3CUPB 2ADIB 5JW4N 3CSYA 4YR6B 3RZCD 1CD1A 5IF0A 3H9SD 3ZKXB 5F7YC 3QQ3A 3FN9A 1FNFA 5MEPA 4KTEH 2X9YA 2YA2A 5CEYB 5JLZA 1WAAE 4RGNC 3MOBH 4YHLH 4LLUA 3T0VA 3SQOL 4XNMB 4MWFA 3TN0A 1MUJA 1TDQA 1YY9C 3PWPD 4JDZA 2XTJB 1P6AB 4ZXBA 1RPQA 2IH1A 2Q6WA 5A3ID 1JRHL 3UJJL 1ACYH 1DQDL 1TZIB 1W72A 2R69L 3CFJB 1T7XA 4XC1H 1GZQB 5DMGD 1I3GH 2E7MA 4ONHB 2W91A 3VXSE 4ONOA 4HBCH 4X5WA 5GGQL 1OGAA 5MENA 1IGCH 3ZTNL 5I66B 3OPZH 3GMNA 3SGEH 2AXFA 1MY5A 3AAZB 4JFOB 4HIIB 1G9MH 1U9KA 1U8JB 4XWOD 4L4JA 4R4BA 2A9NH 3QRFM 1JK8B 4QHUB 3RUGF 4MNQE 4KK5C 1HH6A 4D2NA 5C92A 1KC5H 3MNWA 2NR6C 3IFPB 4XNZB 3C5ZC 5EC1A 2GKIA 4O4YL 3UYRH 1KJ2L 5JPMA 5D93B 5D4QA 2ZNXA 1MQKH 4DW2H 3FRUA 2Y72A 5E94B 2DTML 4TUKL 5ERWA 3CGTA 3DRQB 4PBXA 5EUKA 1HI6B 1U3HB 1AXIB 1RI8A 1RIHL 1Q38A 3CFCH 3MA9H 4NQDD 4PRPE 1A6WH 1MJUH 2W0LA 1WSST 4HKXB 1QACA 4PJBB 5J13C 1MFDH 4H20H 3M8OH 4OUUA 5IHUL 4JY5L 2A73B 1A1MB 4PJAE 1ZA6A 3DUSA 3DYOA 3R0NA 5DRXA 5FM5O 2C4XA 5HPMB 3HI5L 3O9WA 4WO4B 3BH8A 1CFVH 3DVGB 3NOIA 1YN6A 4X6DB 4GMTH 1FO0A 4KZDH 3QQ9D 4L5FH 2EIEA 2VIRA 2CIIA 4AQOA 1RHHA 5E00A 4HUWA 1IILE 1D5XB 3O8XA 4JFFB 1VPOL 5IVZB 1WQVT 1C5CH 1UCBL 4UDTA 5DF0A 1OAXL 1WBXA 1G0XA 2NX5A 1XR9B 3VWJD 2FECI 1A6ZB 5E2VL 3DOSA 4M5YH 4PJEA 2AERT 1IGFL 4GQ9L 4LF3A 5EU6A 3ALXA 1RUKH 5MERB 4Z76A 2FH8A 5C0CE 3QUXA 3VH8G 3C60D 1R3LB 2BJMH 2H1PL 4RMSA 2EDTA 3L7EB 1VGEH 3LKRB 5C07B 3MRFA 3MJGX 3TESA 1EXUB 3D18B 3O4LB 3S35L 3L1OH 5EO9B 1F8TH 1BQHG 1NFIB 4OGXH 4M6OH 4GKNA 3QHZH 3JTTB 2XIDA 4OZHA 4XAWL 2YD2A 3WKNA 3MC0A 1VHPA 4U1JB 4YR6A 3KJ4C 5HD8D 3U46B 3QHTC 4JPIA 4OLWL 5FXCH 3P0YH 3D69B 4M3KB 4GG6A 3TFKC 4IS6B 5EZIL 4RWYL 4YQXH 4FFZL 2A73A 4XPGH 2EDJA 3MXWL 1X44A 1S5IH 5CD3A 3BN3B 2BNQB 2R2EB 5EN2A 4F58L 5K59F 2N4IA 2R0LH 3PJSB 5ESAA 1YN6B 4PP1D 5C70A 4KGLA 1ORQB 3QIWA 3IAPA 1XF3A 2IG2H 3GSNH 5BOPA 4OUOA 3FTGA 3LQZB 4RISH 1HYSD 4NC2B 3GUTA 2FBJH 1IQWL 4JPWL 3EGSA 5D72H 1KTLA 3IU3A 3ILQD 2AK1L 3C09B 5FA4B 4QRTB 2HT3D 5T1LA 3Q5OA 2HMID 5H2BB 4M03A 4YBQC 2P49B 1IGFH 4GQ9H 5ESQB 3TZVA 3BW9B 5INDA 3TBTB 3RJDA 5HGAB 2IANB 4DGVH 4R7DB 4UU9A 3L3IB 3L3JB 4M62H 3OKNA 5B8CB 4XP9L 5D2LE 4JFPA 4PG2A 4N8VG 4GW1B 3RVWC 2X1OA 5E8NA 2H6PA 3I3EA 5TQ2L 1I4FB 4Z7QE 3QIUA 2VH5H 4I18A 4XAWH 4JDVA 4OLVH 4QXGH 2UWEE 1MI5B 2DMKA 1ODAA 3CX5J 1U2HA 4OIBA 4LL9A 1QLFB 4JFDA 3X17A 1F2XK 1OWWA 3LN4B 5C9JB 1PDKA 5C2BH 4HWZA 4ZYKA 3SCMA 3GJEB 3MYZA 4F7EA 3T3PF 3QWRD 3MGAA 4HFWB 3FFCB 1U8OA 4WCYL 4YK4B 5EZOH 2J2ZA 5J57B 1G1YA 3ZE2E 4PJ7A 2EYTB 5MHSE 1FV1B 5I0DA 4F58H 1WFUA 5DVOA 3V4PL 2GTZB 2C4FU 4ZAKD 3RAJL 2E7HA 1CGYA 2MOVA 4ALAL 4OF7A 2UYLA 3O8XC 1RULL 5M94B 4NFDA 3PV6B 1QUNA 1PD6A 2J4WL 3WLBB 3ZHLA 1QSED 3GUTB 3SGJC 2UV3A 1UM6L 2ATPA 4HKZA 4NCC1 1BX2A 3KPPB 3VFVB 4CMMB 3NACH 3MV8A 3P0VL 2H32A 5IMMA 25C8H 3K0WA 4KVNH 3F5WA 1HXMA 4JRYB 3DURB 1P4BL 2OI9B 3RBSA 1EGJL 3I6GA 1G9ML 1QBMH 3EZJB 3STBA 2VXSH 4POUB 1DBJL 2I9LA 3TIEA 1FVCA 1H3XA 3T4AA 3JV0A 3C2SA 4OBRA 5EU5A 3UPAA 2B39A 4V1DB 2CGRH 1HH9B 3LEYH 3MLYH 1JGLH 3V4VH 4NFCA 4MLIA 1G6RA 1CZ8H 3PXJA 1MI5A 4OF8A 3RVXC 2DN7A 4TUKH 1AR1D 1KEML 3V6BR 5C2BL 1ES0A 4PB9L 1IFHL 1YEHL 3EYOB 1R3KA 2R2BA 3SCMB 3B4NA 2NY4B 3GZKA 5SWQA 3QG6B 4XCYA 3AS2A 4F7CA 2V7HB 4NBYB 1Q94A 1QBLL 3GNMH 4NQEE 2NZ9D 4OLYL 1FNSH 4RBPK 2Y4SA 3QIWC 1KCLA 3ZKMC 4KTDL 1NAML 4C83B 3U4BL 1CDCA 1DANU 2A6DB 2OJZH 4HWUA 3SDYL 1P53A 5C0JA 1MPAH 2H3NA 4KFZC 3STLA 4WVRA 4PR5A 2VZTA 3MLSH 1DUZB 4JAMA 3GSWB 3EOYG 4HG4K 3VMOA 4MGXA 2EDRA 3BO8B 1CS6A 4WFFD 1KTLB 3P9LA 4PD4K 2FRGP 2LV4A 2G60H 2OQJB 3LD8C 1X9QA 3VD7A 5JHDA 2FSEA 2VXTL 1SJXA 3GGWA 3HB3D 1JGEA 1RJZA 4XRCA 1JUFA 5FV1L 2YWYA 2AJ3A 2BRRL 4X80L 3QI9C 4W6XB 1JGDA 4KUCD 4U6VH 1CGUA 3MRMA 1DL7H 3QUMB 1DCLA 4CVZA 5KTEL 1G7QA 3BKJH 5J6HA 3RY6C 3Q5YA 3U30C 2JK5B 1SEQH 2JLLA 1H8OA 4FQLL 2ITDA 3QISA 1T66C 2X6MA 2ZNWA 3BHBB 3D3VA 4HHAB 4X98A 5T1MB 3GMMA 5ABDE 4QO1A 5HYEA 4YAQB 3G04A 1ZT7B 3BOVA 4ZTPH 4FTVA 1HKLH 2VQ1A 4UTBH 2NY1B 2A6KB 1QTYT 2EO1A 2OL3H 1MCNA 3VXRD 2OS7A 5DD1L 4XPGL 2C26A 2Z91B 3KDMB 2VLRA 5LAXB 3RVVD 4X4MA 1H8SA 4D9QD 1F3DH 2GTZA 5GHWL 3TNMA 1XCQA 1AKJA 3MLWL 4PY7B 3HZKA 3CC5B 1DBMH 2DQTH 4HPYL 4HQQH 4YNYA 4PRPA 3VGEA 3OKDB 4PR5B 1RUQL 2HH0H 3KLSA 1K8DA 1LO4L 3OJVC 5KBNC 5TE6H 1IZKA 3B8SA 43CAA 1TETL 3O2DA 3CFDB 1CTNA 2J12B 3DARA 2HJKA 1TCRB 1ZHNA 3IS1X 2EEBA 4PJDF 4WHTA 2UWEB 5CSBA 2XWTA 5DYOB 1J8HA 3VFRA 4U6YA 2EH8H 5DJXA 3MRQA 1BD2B 3WO3B 4XMLH 1JGDB 1AD9A 2GY7B 5B3JF 5JO5B 4XP6H 3ZE0F 4XWGL 3WKMH 3MRDA 3NFNB 3VFMB 3P40A 1CICB 2PETA 4WFFE 1UYWH 2CRYA 2W9DL 4NC0B 2QQLL 3HR6A 1KCVH 3ROOB 4L9LB 1BHGA 2IF7A 4N90D 5IW1A 4JJ5A 4PJCE 4MAUH 4YAQA 1CBVL 3LEVH 4O2FB 4P2QD 5T3XD 1MCWW 4E42A 3PWNA 1DVFB 2V7HA 1QNZL 3CMOH 4W4NA 1BAFL 1FORH 1T1WA 2AP2A 5JXAL 1G9MC 5DHXB 4NSKB 4RMQA 3HNVH 1M71B 3OB0H 4HQQL 1S7SA 1XF3B 4TQEL 1N59B 3DXAE 5FUCE 5J13B 3MRNB 1PLGH 4QHUA 1UZ6F 3C08L 4PTUB 1CDUA 5GGTL 2P4AB 1EHNA 1ZGLB 3HG1A 1RY7B 3EOBA 5I1LB 5BO1H 3ARYA 2HTLC 4YXKL 2OZ4A 3ZSSA 2PNDA 2OYPA 3T2NL 3SDAA 3BJLA 4EI6B 2WWKT 2XWTB 2Z92B 4OT1H 2MMXA 2NW2B 3ARUA 3C5ZB 2DQHL 1JGEB 5E6ZA 1ORSA 5D2LF 1P7QA 3U6RB 5C8JB 3S4SG 1TENA 3FFCE 4NFBA 3BWAB 3FB7B 4JE4B 4OCRH 4NZJA 3O6FD 5JW4Q 3SE3A 4HUXA 4L8SC 5DDHB 4LBEB 4L9DA 2JK5A 4ZUUA 3NGBC 3RWDB 5EFIB 2ITDB 4IJ3B 3CVHA 4BQ6A 1IJ9A 1CZ8L 5J11C 2NTFB 1D6EA 1M1SA 1HHGB 4RMRA 4M93B 4JFHE 5GZNC 1XGQA 5CFHA 5DR5L 3QZWA 4P2OD 3QCVL 2DQCH 3KS0J 32C2A 5T1KD 4MX7B 4XPBL 3O11A 5I8CA 5DEFB 5J1AB 3ORJA 1U92A 1YMMD 3QJFB 4OGAD 5ELIA 5A43C 3D39D 4CMHC 3P4OB 3REWB 3BE1H 5DZOA 3KR3L 2I24N 4LFHD 4GRWB 1HILA 2NY6C 5IROC 4M5ZL 3BPNC 5F96H 4OKVA 3WFHB 3UYRL 2YR3A 2H32B 5GGTH 3Q6GL 4JG1L 2A0LD 1E4KC 2OP4H 1L4IA 4Q6IC 3VFVA 1NGZB 5BO1L 3WE6A 1BBDL 4XP1L 1K8IB 3CPLB 4QRRE 4C55A 2GSIB 4XVUD 3ARED 4Y5VA 4NDMA 4BFEA 1D5ZB 1DQLL 4K8RL 4JDTL 4WFGE 1MJUL 2ZCLL 5HHPA 4OGZA 5IFJB 4W6YB 3H3BC 1W0VA 4YHKL 3RVTD 4XBPB 1HWHB 3ARGC 5L6YH 5I1GH 1FCGA 5I0ZA 4RX4A 5JDJA 1QFWL 2E8YA 1QRKA 1AR1C 3PGCB 1MEXH 4FNLH 3GM8A 2NTFA 4YJZL 3QNZA 5GRVK 3BD3A 4K2UH 3RWCA 3CAFA 3NPZB 2AV7A 2ESVB 1ZT1B 3KPSA 4PJHE 5HI4D 1IZJA 4HIHB 4ZFGL 3RTQD 5IVXB 2CJUH 4LEXH 5I1JH 4K3JL 2VLJD 4KY1L 3SCMD 1Y18B 2A6DA 1YECH 2OX5A 3BQUD 2PO6A 3I6KA 5JHDE 4U2YA 1FGNL 1DP0A 4ONGH 1FCCA 1T04B 2YD9A 1T2XA 3CMGA 5EG6C 4ONFL 2ADFH 1XEDA 1XGUB 1F8TL 1CD8A 3SDAC 4Z7UF 1EEZA 4HEME 3QHZL 4JY4A 4OFDA 1AP2B 4YEEA 4ETQB 1FYTD 5D1QD 2Q8AL 4OLWH 3BN9D 5B39G 3EYFA 1G7HA 1I1RA 1OM3L 3W39A 1T89A 1AXTH 1CD1B 2KL6A 4HGWB 4EXPX 4L8SA 1BZ9B 5C07D 4JPVH 4GOSA 2CR6A 4PJDA 1U95A 4OKDA 1JMZA 1RK0A 1T1XB 4PJBE 4BSVA 4OLXL 1OHQA 1I3RB 3T0XA 5KSUA 3PDOA 4R4ND 2HJLA 1R3HB 2W0KA 3W0WE 4AG4L 3V5HB 5IMKB 1BGXL 2DQGH 4I0PB 1L0XA 5TH2B 2XZAH 1ADQL 5BXFA 3X12A 3WIIH 4UBDD 3RDTC 3UTPD 1CLYL 1F6LL 4I4WA 3FQUB 3SPVB 1F6FB 1UG9A 3BEVA 4LPXA 1A7OL 2RBLA 1SYVA 2K3TA 2K1MA 1F2QA 3CFEB 4HK0B 1MCRA 5D96B 1U8MB 4JLRB 1G6RL 2EXYC 1AHWA 4LLDA 2QSVA 1BAFH 7CGTA 5E2JA 1XZ0B 5BV7C 2Q3ZA 1C5DB 4MXQC 2Q76B 4Y2DC 4PP1C 4PYHA 1R0AH 5F7MC 3E6HA 2VLJE 3IU3B 4R4BB 4KVCH 5D1XA 4JCMA 4DK3A 5KW9L 3VI3E 4L8BB 4FQXA 2VQUA 2YD6A 2ZKHL 1LO3L 2EYRA 1GAFH 1UJ3A 2HKFL 4WV1C 3V0AC 1BFVL 1OCWH 2A1WL 1OTTC 3B2VL 4O5LL 1UQSB 4BH8B 2RFXA 4Q6IB 2CKNA 1KC5L 1QEWB 3MUGB 3DX7B 4UT6H 1N6VA 3UP1A 1HHKA 2VZ3A 5LVEA 1KFAH 4MQXC 4HS3A 3F12B 3X3GH 3SO3B 4R90H 3RIAF 3OJ2C 4G42A 1PW3A 3OJDB 3C5ZD 2FD6L 5GRUL 5IM7A 2I26N 4HKXA 5E0QA 2CRIA 1RIHH 5E8EB 4JANB 2AABH 5HHVL 1MIMH 1OPGH 1IARB 3B9KB 3P30L 3WJJA 1RD6A 3PABB 5CUSH 1KUMA 4DEPC 4LIQH 3MJ7B 4UB0H 4Y5YA 3L3KB 1KJ3L 4WW2B 1ZAGA 1FO0B 1Q9WB 5C71A 2H2PD 3JZ7A 4Y1AA 3OB8A 1NFDE 4MQTB 1OAQH 1JFQH 4LKXB 1MFEL 3MLRL 3MCKA 1MCPL 4QKXB 2UUDH 3W82A 2AJVL 3QUKA 3MMEB 5F7WC 1ZEAH 5AG8A 4QRPD 4M6NH 1V8HA 4Z9KB 4KKBC 4GJTB 4H88H 1JPST 4D0DA 1J0JA 1ERNA 5JOFB 5EZJB 1UB6B 5T3XH 3GSNA 4R26H 4RFOL 2AGJH 2DIAA 1F3JB 1OGAB 2AJ3B 2HTLD 4WEMB 1Y6MR 4J4PD 2EEAA 5I16B 5JOEA 2FYYB 1KT2A 2E9JA 4RQQA 4ZNCD 4P2CG 1OB1B 1W0WA 2Y25A 4C4KO 1I1AD 3PIQA 4RGNB 5ITBL 3ZHDA 2EDOA 4I0PD 4I1NB 1U93A 1HZHH 2R1YA 5E2UH 1VFMA 1JNNL 5JDSB 3RGVB 3SN6N 5GRZA 4NNPH 4CVXB 1J8HD 1CT8A 1QSFA 5SV3A 1MWAA 2WAHA 2BERA 2HJFA 3U0TA 2P8LA 1HQ4A 1MIEH 2VDOH 1IEBA 2ARJB 4XNXL 3G6DH 4XX1E 2D03H 3VD9A 3B5GA 1PEZA 4MJ2A 2VDLL 3EDJA 5BXFB 4GAYA 4FFYH 5MP6L 4UOW0 3ARWA 4OUUB 3V4UH 1V05A 4Y16B 1YEDA 5E2TH 1CICC 3ULVF 4WUUD 5D70L 4M6NL 3TCXA 3QG7H 5JQ6L 1IKNC 2MQ3A 5H2BA 4OI9A 5J3HC 1CXEA 5D1XC 2DB8A 4M1CC 5C6TH 3STLB 4Y1AE 1ZLUK 1VFBA 2AJXL 5ICYA 3NIGF 5IT2L 3O81A 1HNGA 4OCNC 2GJZA 4AT6B 3MODH 1UJ3C 4KU1A 2IANA 3TA3D 5HYSA 4X6EA 4K7PY 3K8KA 4P2YA 4R97B 5D7KE 1IGYA 3ARZA 3OAZK 3EHBD 1EHXA 1JE6A 1CF8H 5CBAB 4XPHL 1OSPL 2Q7NA 3EYVA 3TO4D 1QSZA 5C09B 1FYHB 1RJYA 4LMQI 4CKVX 4LVNB 5CEYA 1IC5H 5JLZB 1LP9B 1N6QH 5E6IA 4U2ZA 1J1OH 5FCUH 1EHLL 2EC9T 2FEEL 4MA1B 1U91B 5JW4M 2AK4E 5DJ8B 5BVJB 1M4KA 1I8KA 3MRJA 2V2WB 4MHHG 3D2UD 1MFAL 4ZOEA 4MYWB 1A7BA 1ZT7A 3UPCA 3V95A 1NDGB 3QO0B 3OZ9H 4G3YL 3G6JE 4PRBB 2FZ3A 5ECJE 1LDPL 5SWSA 4LDLB 1NUNB 5BZWA 3JWDL 1NLDH 1JI2A 1LO5A 1LMKA 5JW3H 4LGPB 4P9HC 4ZNEA 1CK0L 3AS1A 4HCRA 4HUVB 3H3PL 5F88B 2ATPB 3EOAB 4RGMC 1K6QH 2PTTB 2Y06L 4OF0A 1X5AA 3EYUL 4IRSB 3RVVC 2AJXH 2BDNL 3RA7L 1ZT4B 4LP5A 3W0WB 4B53A 3RTQB 5I73C 1WFTA 1YNTA 3TH2T 1T04A 1EMTH 1OD7A 3RFZC 1Z9SA 3SDXA 3MV8E 3VWJB 3HC3L 4QTIH 4Z5RA 1YY8A 2YUXA 4F7MB 3O41A 3T08A 5D1QC 2XRAL 3QA3A 4C59B 5H8DA 2DI7A 1BMGA 4QOKE 3RQ3A 1OP3K 1BFVH 5FYLE 3LEVL 4U7SA 2GY5A 4AM0B 4EDWL 3T4YB 4LDOB 2HFFB 4RAHA 2NNAA 2A38A 5ACMA 4A6YH 1LP9A 3O6KL 3HFML 4OCYL 3CK0H 4OQTL 1G84A 4JFFD 1W72L 3EIFA 1I1YB 1KBGH 4HKJA 3AREA 3HNSH 4Z7WF 1CE1L 5BOZG 4L9LA 2W65B 1IFHH 5FAAA 4Q9QL 3WUZA 1AIFA 4YHYC 1MHEA 2BY0A 3RZWA 1CFQA 1S7XA 2X42A 3WIHA 1D6VL 5HYJA 4G3YH 5EBLA 3FQUA 3MLXH 3RUGB 4M7KH 1BIIA 5EOCL 3MRGB 4UIMA 3U36B 3HUJE 3T2QA 3GMRB 2AXGB 1NFKA 2DM4A 3U4BH 3VXTB 2FH6A 4X0KA 2V2TB 5I76B 3EYUH 2Q76A 1AXSB 1XGRB 2XQBH 1F4HA 1TJIH 3QDGA 3EAKA 1HOCA 4RGOL 4ELKA 3RTQA 1JP5A 5DJDB 3OPZL 4KTYA 3GSUA 4NRZB 2X9XA 4K23H 4OTXL 4TUJB 3VFGL 5IKCB 3MRFB 2NXYD 2D4DA 3SDCB 2FB4L 4XBPA 4TVPD 1NEZA 5TDOB 1YNKH 3G08A 1Q0XL 1YDPB 2VXUH 1NBYB 3TPKA 5C9KA 3VJ6A 3I75B 4KI5C 2FJGA 1P7QB 3B6SA 2DTSA 3TN0D 1NGWB 2BX5A 3X3FL 4JPIB 4OZHB 1UADC 4U1JA 3Q3GB 4CN6A 3IDYB 4YFDB 2OMBA 5KOVC 2IQ9L 1QP1A 1N64L 4GRMA 5DFVC 1EO8H 1T5WB 1EAPB 2YK1L 4CBPA 3S36L 3BKMH 4RSVA 1C5CL 4KPHL 5J1SC 1NBZA 1H15B 3IDMA 3GI8H 1CR9L 4MCYA 4Z0BL 4Y1AB 5E7BA 3GBNH 4WWID 4P2RD 4D8PB 2D0HA 1PKQB 3O11B 5MP6H 3VXTA 4ZUTA 4R8WL 1OW0C 5DT1H 4AIZA 1RQ5A 3UJTH 2W07A 4H26A 5IEKB 2VQTA 4HZAA 4LDEB 1VGEL 1TJIL 4F2MA 1S7QA 5IMOB 1JZ5A 2EC8A 3HE6A 1LO4H 4GBXD 5BS0E 4WI8A 1QSFE 3L6FB 4XVSH 4RGOH 3QQ4B 1TETH 3IB4A 4CNIA 3RWJA 3R8BB 1ZK9A 2ZSVB 1KLUB 4J4PC 2VDRH 5DD5H 1YEEH 2NCMA 4X4XB 3OKNB 5B8CA 4X9IA 4U1SA 3NN8B 4M7ZB 3IYLW 4YC2C 3L3IA 2WP3T 3OKLA 4MJID 1EFXD 5C0CD 4RWYH 1CGSH 5E8NB 3DJ9A 4EIGB 4R0LA 2HKHH 4JR9L 1CFSB 1C8PA 3VI3F 4PJXA 4JPKL 2RCSL 5TPWL 4FQXD 4LPWA 5I8EA 3LN4A 4GRLB 1ZHKB 3AREC 2XN9D 3CH8A 3BSZL 2XN9E 3PV7A 1LD9B 1YNLL 1PYWA 1UEYA 4WTXA 3ROLA 5IR1B 4OM1H 3TBWB 2X4SA 3LV3B 1RIUH 4M7LL 5HDBF 1PG7L 1CFBA 4U3CA 3LKSA 2HJFB 4M3JA 3CU7A 2DIJA 4ZUSB 4H0HB 1IGTA 4KKNA 1MFAH 1AHWB 4LLDB 3QEUB 3QUZC 2DLTA 2XY1A 3O8XD 2B0SL 2GITA 5ACZA 1YY9D 3VXUA 3ZE2F 5EBLB 1INQA 4OBSA 3MXWH 4KAQH 5EO0B 2O26U 4KKLD 4N1HB 2YXFA 3GMPA 1KJVA 1V3MA 3OKOA 3WLBA 5MI0C 4HZLA 2BC4B 2Z91A 3GBMH 2VKXA 3NCEB 1E27B 3HE7D 5CIPA 1LK2B 3ULUF 4WI3A 5E1AA 1LE5A 1AKJB 4PY7A 3IDGA 3SE8L 5D1ZC 4A2MA 4OLEA 4HG4J 3HZVB 3C08H 2VDPH 4YDKH 1N0LA 1T1ZB 2X40A 4NQCE 1NCDL 1BOGB 3FFCD 4NRZA 3EHBC 3V5DB 2O5XL 1MLCA 4YE4L 1FE8L 1MAMH 3IDNA 3GSXB 3TO4C 5J89A 1CGSL 2X1QA 2Y9RT 1KB9J 5AUMA 3WNKA 4HJGB 4I48B 5C09A 4YK4C 3REVB 1VDGA 1SEBB 4S1RH 1U95B 1JZ7A 5I1HH 1Y0LA 1II4E 4M7LH 3TT3H 1G6RH 4LQFL 3LKSB 1BFTA 1I1AA 4IRJB 5CZVH 1INDL 5IQ9B 2NPLX 2BVQA 5C0CB 4DN4L 3HMWL 1CGTA 5L2JA 2FZ3B 5KVDH 4P5MA 25C8L 2C1OB 4JHZA 5KN5A 3N1FC 1TIUA 5HGDB 1RUPL 4U1HB 1TZGL 3GMPB 3K4DA 1IGMH 3BDYL 2NY0C 5FF6B 2CDGB 2VUOA 5EORL 3BD5A 5D7LD 5CINL 3QQ9C 3VGAC 4KZEL 4X6CB 4FQPA 3SE4C 5FK9B 1RULH 3QXDA 3FN3A 1FL6A 5E5RB 5DO2C 4BFIA 1VFUA 1R5VA 4M5ZH 3QPQD 4NM8H 5ADOL 2ZUWA 2KZ1B 3HB3C 4ZQKA 4PGCB 3V6ZA 2DQEL 1KFAL 4DTGH 1AO7A 3IKCB 1E4XL 2XZQL 4UT7L 1T22B 3VWJC 3A6CH 3ILPB 4WUUA 5CEXA 1OT1A 4WNQA 3VRIA 1JI1A 4X7TA 4DKDC 2RIKA 3O45A 4GRLD 4GXVL 3B43A 4ZOBA 1KCKA 1EGJH 3BP4A 4MLSA 2MJWA 4HAFA 3AVEA 3WJLA 1WICA 4ORGB 4NQCA 5CEZD 5C0BA 5GS0L 3ZMRA 3OG4B 4LPYA 5DQ9A 1T66D 1YNKL 3T1FB 1FNSL 2BNUB 3T65A 3OKYA 3TA3A 4CUCA 2A83A 3W2DH 1FNEB 4U0QB 4KTDH 1ULVA 3UC0H 5GGRY 5GPRA 4MNGB 1RIVH 1CLOL 3ZTJG 3D69A 4Z18A 1RZKC 3AREB 1RK1B 5D9SB 2Y36H 4QRSB 1MCPH 5CJQH 4LQFH 2W92A 1MPAL 1AGEB 4LLUB 1BEYL 3KHQA 3KPRE 4HLJA 5F7FA 3TN0B 2FJFB 1N64H 1UB5B 1X4XA 2VLRB 4H8WL 5TJWK 2R9HD 1F00I 3JUYA 1SBSH 4X6CE 5KVDL 3VXUE 1IGCL 4BA8A 4Z7UA 3EUUA 1YEJL 4P4RB 4OLYH 2GAZA 2VKWA 3S6CA 4F57L 3ARQA 3SGKC 4KY1H 3WDJA 4CADB 4DAGL 4NO2A 2VLME 3KPSE 1IMHC 4LSUH 1EBPA 3QEHA 3NCBB 5I66A 2YPKA 1G7IB 4LOUC 5HXMA 4U0RC 5DMKB 2YMXL 4LSQH 3ILQC 2NY2D 4MMZC 4WHTB 4O9HL 5CBAA 1FDLL 1S5HA 1NGQH 5GGSY 1KYOK 3MZGB 1D5MA 5FKAB 4YBQD 3MJ9L 3BXNA 3LQAH 2LAAA 5E2WH 1RZJL 2F54E 3MTRA 3RUGE 4EQ3A 4UIKH 1GOHA 2AJSH 2C5DC 3BDBA 4LNVA 4F15C 2R29L 3VJ6B 3JV6A 1TZHB 2AKRB 2FIKA 3G08B 1OM3H 5EBWA 2DLFH 4L8CA 4AK1A 2WINA 3H0TA 2VXVH 3H9ZA 2AK4D 2XPGB 3UC0L 2FL5A 2XY2A 4NQSA 3O6FB 2AV1B 4XMPH 1ZHBB 3WFDL 4TSAH 3MGOB 3U48A 4FXLA 1FVDA 2MPAL 5KVGH 2CRZA 1B4RA 4FQ2H 4HJ0D 3QDGE 2Q7YA 1WIUA 4OZFG 1OAYH 1U8JA 5JMOC 1FNGA 4PG9B 2BNRE 3WIIL 1UM5L 5IWLA 4DZBB 5J0BA 5E99H 1DTUA 4I2XE 1JTTA 5C0EB 2NY5L 4Q74A 4F57H 4ERSL 4P4KB 5D7IB 2DMBA 3MRNA 3VRLF 2AEQH 3SE4A 1DUYA 4AMKL 3C5JA 3QI9B 3RU8L 3TVMA 4G8IB 2VOTA 1RUKL 3ARFC 4BKLB 2YPLD 4YXLL 3RGVC 3DTXB 5ISZD 4ELME 2P24B 4H25B 2HH0L 3KPNA 1KF9B 5B4MC 4Y2DD 3LCYA 3UTSB 1F58H 4R7NA 5E70A 5ILTL 4IM8A 3IDIB 1GC1L 2JIXD 3VGDA 1S3KL 3NIGE 3WJLC 1P2CA 2W9EH 4OQ1A 5ADPL 4XXDB 3G6JB 1Q9LB 2DYPA 2JF1A 3FQRA 2EKSA 4XVJL 3K7UA 4H1LA 1U8LB 5EO9A 5TE4L 3SO5A 3TBSB 1G7MA 4QTHA 3SKUD 4PS4L 3VDBA 4PRAB 4LCCB 5EO1B 5ICZB 4X7SH 3OKEA 2R0LL 1MCOL 1XGYH 5E6IB 4GG8A 3JWDH 5KS9E 5HD8C 1RK1A 4S11A 5D9SA 5L2KA 2MFNA 1A6ZA 4D94A 3H2WA 2JTDA 3QUZD 5DEFA 5J1AA 2AS5M 5IBLD 3ZDXF 4CU8A 1FYTA 3DUSB 3FQTA 3QEGL 5MERA 4M48H 3MMEA 4WY7L 3I6LD 2FBOJ 4KKLC 4PJGB 3FZUC 4KHXH 4ZO7A 5ACZB 3M17A 5C07A 3A6BH 1HOCB 1SM3L 4QGYA 5JXAH 3G6AA 4PJFB 4JQXA 2VNCA 1YYLH 5ESVB 2YN3A 5FA4A 2EE3A 2MCPH 2JCCE 5CP3H 5IUSA 1T7WA 5BZDB 3BZFA 4OCRL 3C6LC 3IVKB 2XACC 2P45B 3VD4A 4QHKI 2FSEB 3O6KH 4PJIB 2P8MB 1BOGA 5HDLA 1BVKA 4TSCH 3ZKXC 3RVTC 5D1XB 5BVPH 1XR8A 3I50H 3QO1B 2BNQA 2X4NA 4M6MH 3MROB 1QFPA 3BP5A 3BRFA 1IQDA 1IBGH 1R5IA 1MH5A 4J3VA 4XBGB 3O3DA 4EI5D 3E0GA 2OTPA 3DMMC 2G9HB 4H20L 4S1QL 1S7TA 4K7PL 4TULL 4YWGH 1X4YA 3A67L 1H5BA 3RWGB 1AGBA 5TFSL 4YH6A 3B9DA 1EFXA 1MJ8H 5C0FA 3K1KC 3KR3H 2NY1D 1JPGB 3EYQD 3GDBA 3OJDA 1R3IL 1HDMB 2W65A 4KZDL 1NMBL 1GGYA 4ZUTB 3PNWB 1PKOA 3SGEI 1IVLA 1C1EH 1N26A 2H9GB 2YA1A 4U1GC 5EN2B 2OP4L 2O5YH 1SBSL 4TUOA 3S3SA 4G7YH 4X8XA 5HGDA 4FQQB 2F74B 1OGAE 2GYSA 2NY0D 5CJXC 3VCLB 4GW4B 4MB5A 3E6FB 4IHOB 2CD0A 4HULB 4U1KA 4ZOAA 5JMRA 4R4FH 3MUHL 3QPQC 1P9MC 4XCFH 1JPTL 2B20A 1KPRA 1NCCL 4PJDE 3BYTA 1YEFL 3QUZB 2EIZB 4ENEC 3OKLB 3OR7A 1FZOB 4L4VA 4PLNC 2ZG3A 3IKKA 3V0WL 4Y19A 1J8HB 1UZ8A 1ZS8A 2ED7A 4LLYB 5TGBA 3S35H 4D0BA 4D3CL 2A2QT 1OP5K 2FJHA 3ILPA 5CEXB 4TTDC 3GB7B 2NXZD 2PTUA 4XP1H 5INCB 5L7XH 4MA3B 3PDOB 2E9WA 2VXQL 4NYLA 5IFHH 1I8IA 1IL1A 4OIAA 2GJJA 4BSVB 3T65B 3I2CH 3B9KC 1MAKA 2YBRA 5DQ9B 4QTHB 3PL6D 1I8KB 2V2WA 4DEPB 3B6SB 4E41B 4P2OA 4V1DD 1BWMA 2DLFL 4LGRB 4YWGL 3GBNL 5E7FA 1AC6A 1JVKA 5SX4H 3QFJE 2APTA 2I27N 3O4OB 3QFJD 1CLZH 1UWXK 3WEXB 1U58B 2NQCA 4C56B 1A6TA 3DECA 4W70A 4OFIA 2WUCL 4YHNB 3BMVA 3GSNL 2YSSB 1NEUA 1HCVA 2WV3A 3GSVA 4K2UL 2BC4A 1WEJL 2LVCA 1CXLA 1HHIA 2ADFL 3D39E 5J12B 3QFDB 1JNHA 3C09C 4JN1H 1IC1A 4JQXC 4H5SA 1IAII 4QF1A 4PRHB 2PW1A 2B1HH 3D3VE 4JFEA 5C0BE 2IBGA 2X09A 3TV3L 2KQMA 3HCVB 3MRKA 5D71H 2CKBB 1QSFD 1WGOA 5IHLB 1C12A 2WIIA 5T1LD 3UTTE 1E4JA 5EULV 2EYRB 4BM7A 2R2HA 3UTTB 5CEZH 4OM0L 4OZIF 3I84A 2RCSH 5EA0H 5BW7C 4O58L 3UDWA 3NABH 3LH2H 2ICWA 5KSAB 4DCQB 1RJZB 1BGXH 1G7JB 2C3HA 1BVKB 1OAKH 3ZDYF 2E6PA 3BEWA 4I0CC 1GJIA 4YBHA 4X6EB 3RKDD 5C09E 2VDMH 3O3EB 3GMOA 1NBQA 4L8CB 1KB5B 1AXTL 3HE7B 2MTPA 4HDIB 1A0QL 5A2IH 1H5BC 3UPRA 4E9LA 2FLBT 3RL1B 3BKYL 4UI2A 4ZFFB 1ACZA 2AJZA 3HNSL 2IAND 3EYOA 4AG4H 5KSBB 3CSBA 3QEQE 1QA9B 3RUGA 3QZWB 1DBML 2DQTL 2UUDK 2IAMD 3DETD 3VFPA 5I74B 3ARDA 4HSQA 4LSRL 4X9GA 1OGTA 1KB9K 2BSED 3DUHA 2Z93A 1HQRB 2AEWA 4Z8FH 4DGYL 3ARFD 2V17H 2J88H 2X7LA 3QUMA 4L29A 3RGVD 4XMKL 1WAAA 2VAAA 3VG0L 4XPTL 1P4BH 2P5WB 4F9PC 2WNGA 2BNRD 4OZFH 1X7QB 4ODHH 5F89A 4KH2A 3VA2C 3FT3B 5TF0A 3TNNB 1SY6L 2A0LC 1W0WB 3NABL 3K4ZA 3N1GC 5CILH 3MBED 4WU5B 3NAAH 1MCIA 1UYWL 4X8JA 2CDFA 2HTKD 1HINL 7FABL 1OAKL 4JZNB 2FDBP 4QHNB 3S3JA 4GS7C 3EO9H 5D1ZD 3WIFA 1ZS8B 5E9DE 4PRHD 3SOBL 4NRXB 1B0GB 5BVPL 4Y4KC 4C56D 5SX4I 5DJ6A 5ICXA 3V8CA 4NYLB 2BY2A 2XQYG 5IV2A 2O93L 1IBGL 1SQ2N 2H32H 5A16B 1KCSH 1JFQL 4F37K 3BKYH 4NGHL 1BJ8A 1KYOJ 2C4FT 3CLFH 1OL0A 3RWHA 1UH2A 1UVQB 4Z7UB 3TN0C 5KVFL 8FABB 2Y23A 3QXVA 3IFOB 4R96B 2NMSA 3KJ6L 3MFGB 4MXWL 4QGTA 4KZEH 1I3VA 5FYJU 4PTTA 4L4TD 4UINL 5SX5K 3WDIA 4QOKD 2P5EB 4Z7QF 2NLJB 2LABA 1OGTB 2J5LB 4TOYL 1K4DB 2R0KL 5B21A 3HN3A 5IEKA 4MD0A 4M1CD 2ARWA 4EDXB 3RTQC 5I73B 3ZHKA 1E6JL 3BPCA 4PY8I 5JO5A 1S9KC 4OV5B 1A9BA 3BVNA 3HZYB 1N7ML 1A1NB 1QYGL 1NC2A 4JEGB 4PTUA 5BW7A 1NAMB 2FGWL 4BFIB 1WLHA 4MA7H 1CFNA 5ID0A 1NSNL 4Z7NF 4EOWL 4GBXC 3IKCA 2DICA 4NNYA 3OAUH 1G9NC 1CL7I 4XNXH 4KRPB 1HKFA 4EUPH 1NBVL 3FAWA 1MH5B 5DC4B 1FO0H 1JGUL 4MJ5B 3QPXH 5KZCB 3HA0A 3JWOC 4X5XA 5E2TL 1HIMH 4M93C 5DGQA 4E5XB 1YNLH 1JF1A 5KS9B 4KK8C 1MF2L 4P23A 5IW1B 4X5WB 5JIPA 3QG7L 3TO2B 3VXRA 1MQ8A 2ED9A 3ZT5A 1O7SA 1X5GA 1A5FL 2WWKO 1JHLL 4ZNEE 5TE7H 3EOAA 5C0NC 2VE6B 2QTEA 1RUML 5DGRA 4OGAC 1KACB 1VADB 5FM5M 2GAZB 2P47B 4KJWD 1CIUA 2DWDA 5CHNB 4J4PA 4PJFE 3T09A 4XPHH 1KTDA 3P9MA 3V0VA 3O8XB 4HWEL 4LSPH 4MXQD 4LCWE 4MQ7A 5DA0B 3LB6C 5FHAH 1O5DT 5F9JA 3DX9A 5DHVH 1NC4B 3SE8H 3BP6B 1XR9A 1U6AL 2NY2B 1D6EB 3DX6A 4BQBA 5IVXF 3T77A 4NP4H 3ULUE 5CSZB 4ODXB 3C9NB 2Z8SA 3EFDL 3O2VH 1QEWA 3MUGA 2J8UB 3QCTL 4MA1C 3OX8B 1D5IH 1A1MA 4FNLL 5EO1A 5F1NB 2CKBH 2FJHB 5EIIA 5IEHA 4I9WD 1YPZE 2P42B 3MV7B 3OZ9L 2OR7A 2XA3A 3FOMB 3T8XA 1P4IL 1UM5H 4OZHE 4GKNB 4KMTL 4OV6F 1GIGL 5DK0A 5J1TC 4E5XA 1WTLA 4HUWB 4O2CB 4P2QA 4YHPA 1EJOL 4F7TB 3CVHB 1AIFB 2LAGB 4WWKD 5BRZD 1YPZF 3MOQA 1CFQB 1S7XB 5CZXD 2X70A 1U8QB 1CG9B 1INDH 2VERN 1OQOA 1QSEE 2YD1A 4JM2C 1JHLH 4QRRA 3RWEA 3WFCH 1FNGB 4MJIA 4BZ1L 2V2TA 5D5MB 1DE4A 5GSVA 3QIBB 2CLVB 3FFDA 1PLGL 3EOTL 5I9QB 4W4OA 2H2PC 2GITB 4PRHE 4JO3L 1LNUB 3BFOA 5B39A 4JB9L 1EXUA 3D18A 3IJSA 3F7RA 3M07A 4GRWF 2DLHA 2E27H 2X2YA 1XF5A 5H35B 3HZYA 4UZGA 1ZLSH 4HIJB 1JWMB 3F65A 4N0RA 4QRPE 1F90H 4PS4H 2HT2C 1WZLA 3T77B 5I1DA 3G5XB 3W0WD 1IQDB 1R5IB 3DLQR 4HLZG 3ULVL 5J6GB 4KI5E 1T83C 2BVPB 4Q9QH 1W72B 5F1NA 4HH9B 3U7WH 3S5LB 3NGBB 1JZ2A 1B2WH 2GFBB 2VZVA 1KPUB 3O6MH 1JJUA 3MR9B 1I1AC 5GS2D 4RFNB 3HE7A 1X5XA 4Z7OF 1FYTE 4I0PC 5DC0A 4R9HA 5DR5H 3HZKB 1NANI 3LEXB 4NN5B 5IVNA 3QCVH 4AH2B 1AFVH 2PO6C 5CJQL 4U6TA 2ZUSA 2PXYC 4XT1C 3MRBB 3P4MA 3GMLA 4P4RA 4J6RH 2DI9A 5KSBA 5CD5C 2VXSL 3QWQB 1O7VA 1ZSDA 4PY8J 4UUJB 4TVSa 5JZ7D 3ZDZE 3N9GL 5I71C 4IMKC 4XPFL 4K23L 4I3SL 1OAXH 2VE6A 3FRUB 1EFQA 4Y16C 4GKZB 1S7RB 2F53A 2PN5A 3V6OC 1MCKA 4POYA 1HQRA 2LFGA 2X1WL 1F45A 3L9RA 1QR1B 4XNYH 5EU6B 4XH2A 4U6HA 3P2TA 4CMMA 4NJ9H 3FT3A 4Y4FA 5DRNB 4QXGL 3WIHL 1NMCB 1R6VA 3ULVH 3KLDA 3P73A 3FO0L 4JREC 5GRVL 2C3GA 3TA3C 2IQ9H 3UAJD 2NY2C 4X6DA 3FB5B 3QIBD 4Q7DA 1C5BH 1FZMA 4JRXB 1NSNH 1FFNA 3A67H 5E2WL 2BVUA 1QO3A 3C6LD 5I1GL 1T0NB 5F7NC 1OTTD 5I8EB 5DUPH 3U82B 1T20B 3OGCA 1U8MA 1RMFH 1R3IH 1H3WM 4O2EB 4JO1L 3BUYA 3VXQA 2F8XC 3FMGH 3V7AE 4Z0BH 1LP9E 3HKFA 5DJ8A 2Q6WB 4H1LH 2BVOB 1J86A 5FO9B 4R8WH 3MLRH 2AAVA 4MZ3A 1OLLA 2R2BB 2DM2A 4FZEL 4DN3L 3KPMB 4HKBB 3DMMD 4V1DE 3SGKA 1PFCA 5T1DL 2HLAA 2I60H 1Q94B 4P4KA 1OTSC 4ODTH 5D72L 2UWEF 4FFVD 4Y4HA 4NN7B 2EH7H 3EYQC 4JO2L 3X13A 2WM0A 3HC4H 4PB0L 4LU5H 5DK3A 2P5EA 4YO0A 3V0WH 3MV9E 3LS4L 3FFDB 1GRWA 4XCCL 3BPCB 1A3RH 1L9NA 3BESR 4HW6A 5EU5B 1Z5LB 3UTTA 3LMJL 3CX5K 1NJ9A 2A74B 1JRHI 1J12A 4L4TB 3MLTA 4XNYL 2CGRL 2VJXA 4JO4H 1WC7A 3LIZL 2VXQH 5IFHL 4G5ZL 2QADB 4P3WA 5DDHA 1C16A 3GHBL 3MXVL 5LQBL 2AXJA 2VDQH 2D7OA 1N0XL 4GBXB 2JCCF 5DJ2A 1CXIA 3BMWA 1R5WA 2RGSA 4P5TB 3SGDI 4X9FA 1JUFB 3W9EB 1NC4D 2NY7L 5H37G 3BXNB 2BXZA 3ETBF 3ZYIA 4Z77A 3GNML 1BD2E 1OD9A 2UZIH 4HPYH 2N7BA 4LHUA 1J1XL 4L3EA 1TVHA 4QXUH 4YXHH 4RAVB 4PLJC 1NCAH 1K5NA 3JV6B 2BOCA 1MLBB 1WCBA 3RAJH 3CFKB 3QB7C 1DN0B 3BSZH 4PV9A 3MGTB 4YGAB 3PDDA 2VQ1B 3QWOB 5DHVA 2F58H 3FCTA 5JQ6H 5D6DC 5D71L 4DK6A 1QRND 5GS1A 3I9GL 1M05A 5C3LD 5C0ND 2NX5B 3PV6A 2IANE 1AQKL 4TNWK 4Y4HB 2P5WA 2H6PB 4JY6A 4WJ5B 3DBXA 4PREB 4PRDB 4Z78A 3VXOA 3MCKB 2PF6A 5GGRA 3QUXB 2ZCKH 4Y5VB 5AYUH 5HHNB 1JCKA 5CJ5A 1XGRA 1FL3A 1WK0A 3H7LA 3V6ZB 5DEZA 4KRPD 2P5EE 3VXNA 2ZKHH 5GSRA 2B4CL 3MV9D 2VDML 3BJ91 4G8IA 4G5ZH 3BKJL 4LPVA 5F7EL 4HC1L 3FONB 3PHSA 3H9HA 1F6AB 4IDJL 3VW3H 2QR0B 3CH1B 1HH9A 1NLBH 4P46B 1JTOA 1QNZH 4LIQE 3X3GL 1NCBH 2J8UA 1J05B 4JREB 2BY1A 2UYLB 4JHWL 3EYVB 4FABL 5B3NA 4CN4A 4XP5L 3I3BA 2JCCA 1F11B 1U93B 4PJXE 1R3KB 3QXTA 1HSAA 3MRDB 5I1CH 3BUYB 1ZHLA 1QBLH 5DTFA 1FC2D 4NWUL 5GRJH 3TBSA 3DVIA 5I1HL 4M8QB 1K8DB 3QDMD 1DN0A 1ZLUH 4P4KC 1EERB 1SBBA 5HDBE 5EWIH 2EZ0C 2EDQA 3CXHJ 2ARJA 4JM2D 4XXCA 3Q6FA 1KELL 4N9GB 4Y1AD 2HJKB 4IOFC 2BHUA 2ZPKH 1AQKH 5FYLD 1A9BB 3BVNB 5IMLA 4U4BA 4CADA 5DD0H 1NL0L 3S37L 3D85B 4B50A 5K93A 5MEOB 1SYSB 3MFFA 3RNKB 5HYQB 4XI5D 2ENSA 3BKCL 3WS3A 3W11C 3EYFB 5F3BA 2BVYA 3VGHA 1GGCH 3MPCA 3SOBH 3PQYA 1UXSA 4JFZL 1Y6NR 4ODUA 2V5MA 4Q6YA 2AVGA 4FQ1L 4NM8L 2C3VA 1T7ZA 4P9MH 5ISZE 2IQAB 3O0RL 4GUPB 2HVJB 1AGFA 4LK4A 3L3OA 5LBSL 1TPXC 3WXWH 4AM0A 1OARL 1ETZA 4HHAA 4X98B 3CSPA 1WFOA 1MRDH 1A02N 4FQCL 2XPGA 1NQBA 2OCFD 3I2CL 5CMAA 3T0EC 1MFDL 1I1YA 2D03L 5CKAA 3NFPA 5DD1H 4OSUH 4XAKE 5A2FA 3B9KD 4KGJA 4DVRH 4U1NA 3RWHB 1XGPA 3SKNA 2VB5A 2N56A 2Q7YB 3JWNC 4WO4D 2DBLH 5JXEC 1BQHA 1EUUA 3F58L 3L5WB 3DUUA 4NN6C 3QULA 2G5BA 4UQ3A 2H45A 3OHXB 4B7IA 3P9MB 3QHFH 4AENA 1PAMA 1XF1A 5BZWB 5HI5C 4PJHA 4O02H 3VG9C 5DVMA 1BP3B 3VU2A 3QI9A 3TVMB 1CQKA 1OTUC 3IGAA 4KRLB 4BYHA 4EI5A 1HNFA 2EKJA 4MSWA 2YN5A 4EN3B 3KXFB 3Q1SL 4J8RB 2R2CA 4U6XA 1OSZA 3PWPA 1E4KA 5T3ZH 1ZHNB 1CE6A 1JN6A 4J1UA 2BCKA 4K3EH 5I19L 4L1HA 4XX1G 4JFYB 4KKCD 3IXAA 3ULSA 5CJBA 5JPNA 5IM7B 2VXVL 3B9EA 2R8SL 3KNBB 1FO0L 3H9HB 2EKSB 3MV7A 3ZT7A 1I9RH 3RY4A 1Q9LA 1FFNB 3O41B 5HYJB 4LHQB 4NO5B 1N5YH 2VR9A 1MCQA 1S7WB 2V5YA 3BGMB 2CK0H 2W9LA 4LPUA 2IBZY 1TJHH 4BJLA 1FLTX 5TDPB 2DQCL 1JZ8A 1FGNH 3IFNH 1VACB 1Z6JT 2QQKH 1GPOH 3VXQB 3ESVF 4MVBC 4YQXL 3S37X 1ZHLB 5IBLC 1DDHB 1A14L 2YRLA 1MUJB 4DVRL 3ZDXE 1MRFH 1J8HE 4LEOB 2JJSC 4LPTA 4Z7VE 3KPRA 3HG1E 3FZUD 3ULUH 1BF8A 5DJXB 1CK0H 1DFBL 3GIVB 2IG2L 2NW3B 5FYJE 1NCWL 3CIQA 5J9PB 5AWNL 1XF2B 3KPMA 5FYJD 4KK8D 2PR4L 1CFTA 4NJAH 1N59A 5FO8A 1UA6H 5HTSA 3C5SB 5T3ZD 2OXHA 2XQYK 2ZCHL 5FK9A 3B83A 3Q1SH 4XRCB 2BNQE 4ZUVB 4N68A 3NIFF 4YZFF 5F89B 4ZAKC 2PTVA 5KG9A 4LLWB 4K3DL 2WIMA 1HK6A 1D5IL 4XPTH 5D7JB 4WTZA 2DQGL 5SWZB 4EI6A 4WU5A 4I77H 2HKHL 1C16B 3PWNB 2HFGL 1PSKH 1KN2L 3NZ8A 1B88A 3PHQA 4DUXA 4RMVA 5AZEL 1A6AA 1T03L 4FTVB 1I7ZA 2NTSP 1DBKH 2ICES 2IAMB 5KAQF 1RHHB 2ICWB 4WEBH 1DEEA 2XFXB 4NZTH 3NH7H 3OXSB 3TIDA 3WFCL 4FZ8H 3G6JF 4HEPG 3QUXD 4MJIE 4LHJB 4ZPTB 5TQ0H 1UGNA 2KUTA 5L9DL 2NYYD 4GQPH 3QEQD 2IJ0C 2GSGB 4O2CA 4P2QB 1GGBH 2R1XA 5HYJD 4Z7WE 4HX1B 3TVMD 2VC2H 1CQYA 2MHAB 2AJZB 4AQ1B 4ZMAT 1VGKA 1BQHB 2R9HC 3WL9B 2ARJQ 4XB8A 3C6SA 1QR1A 1H3UA 5EOTA 5SWZE 2UZXB 5E00B 5FO7A 1A3LL 4NHCH 3RPKA 4XNQB 5D5MA 4GW5A 4OLUH 4Y2DA 3IXTB 3QNYB 3O6LL 2DQIL 1BLNB 3LKOA 1EEYB 4FHBD 1BD2A 1JPSL 4EN3A 2PW2A 4Z7VA 1RK0B 5EIVA 3SDXE 3BIKA 3HHRB 5M95B 1A8JH 4DOHB 3P11H 4Y4HD 1B2WL 3CPLA