4ZUUB

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-cf9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuuB00
1YNKL 3KPSA 1L0QA 1OAUH 4HKXB 3OX8A 5I1JH 7FABH 2HA1A 1UQSA 3LQAH 2R2EB 5EB9A 3W9DB 4PJFA 1WBZB 4KK8C 4DZ8A 5I1EH 5C07A 1HXMB 3FFCE 4XPFL 2FHFA 5KOVC 4PJGA 4K3EL 1BAFH 3AREA 1MF2H 3RVVD 4FFZL 4FQPA 4X4XA 1YY8A 3QWRD 1SM3L 5EU6E 4OZIB 1YYMH 4PJ9D 2OMNA 1G7JA 1HHIB 4L5FL 2A83A 1H5BC 1TLKA 1WCQA 3CC5B 4HUMB 4WFHD 1CL7L 1VFAA 3FO0L 3S3JA 3HLAB 3O9WB 2FHBA 3HZKB 1DBML 5I1CH 4HUXA 3LKNB 1NGZB 3U46B 3CJJA 2FR4B 4PJ5B 2VDNL 4LSQH 3PWVA 1ZK9A 4GRMB 3BW9B 1U8OA 2R23A 3MJ6A 3E3QE 3IFNL 1RUQL 4RMRA 5HJ3B 3L5XL 4HBCH 2AK4A 1D6VL 4CW1B 1KB5A 1YEGH 4TSAH 1JVKA 3E3QC 5HVFB 1H9VA 1JWMB 1SM3H 5GGVL 3QRGL 1NGXA 3HAEB 1MJUL 3TH3T 4MJIE 4L5FH 2VL5A 3O8XB 2FYYB 3K46A 1UACL 3NCYS 5JOPD 1JFQL 2FX8H 4PJXF 3UO1L 2VDNH 3F7YA 3C2AH 5C3TA 4ZS7L 4Y4FB 1RPQA 1OTTC 2VQ1B 3T3MF 1AXSB 4JANA 2OCFD 4KJQC 2BC4B 4X0KB 1ZT7A 1A1NB 5IQ9B 2Y5TA 4YK4C 1H3UA 2X4QA 4TULL 5F72S 1K8DB 1SYSA 1WLHA 4WTXA 3L5XH 5EZIL 3U36B 1CDYA 1T20A 1NBYA 2IH1B 2AJXL 1SJEB 1D6VH 1RJZB 4FTVE 3OR7A 3TH4T 5BRZA 4BQ9A 4UT7L 5DUPH 2V6HA 5IG7B 4KJWC 5GGVH 5KANG 4NC2B 1B0RB 1KJ3L 2DQUL 4M7ZC 3RHWK 1UACH 4JG1H 4NRZA 2CRIA 4YNYB 3PV6A 1M71B 4NHUB 1OTUD 4ORGB 1DVFD 1D6EA 1JFQH 1INEL 4JFFD 4Y5YC 2MCG1 1NJ9A 3RJQB 2BNRB 4KKAD 3IFOB 2VDQH 2GUOA 3QFJA 4ZS7H 4IOFC 2H32B 1N2RB 4WNQB 3MNVB 1Q9KB 2AEQL 4HK0B 3EDFA 4GG6B 1MWAA 5I75B 2DOCA 1GGYA 4TULH 3TBYB 1FV1B 1ZT4A 2E6JA 1ZLUK 1NGWA 2LVCA 1FCCA 5AZEH 2AJXH 1DBKL 4QXTA 2VZ1A 3MRNA 4UT7H 4P5TB 1AD9A 4UT9L 3EOTL 2I24N 2J12B 1ZWIB 2XPGA 4ZXBD 3RA7L 1DQQA 4WV1A 3QXUA 1KACB 2EKSB 1J1PL 2IH3A 3TN0C 3VXOB 3ULVE 2Y72A 3BP5A 3J8F7 4FQQB 4WW2C 1KJ2B 4M4PA 2PW1A 4G6KL 5H8DA 5HDBE 3S97C 1TCRB 2ICEA 5A2LH 1NC4D 4OB5L 3JV0A 4N8VB 1JPGA 1YEEL 4F7EB 1MI5E 1A7QL 2ESVD 4MZ2A 3BPLC 3OHXB 5C0GB 1TJGL 2VDKL 1UWEH 3P9LA 4L29A 3B43A 5HI5C 2YWZA 1K3ZA 1QOKA 1QR1A 3KLSA 5CHNA 2IPTH 2EDLA 2JF1A 2YD5A 3IVKB 3QUMA 5IB4B 3U7WH 4HXAH 3RA7H 3ES6A 5GGSB 5CEZE 2SEBA 1HEZB 5DJDA 2LFGA 3HPJA 1FFOA 1N26A 2YSSA 4F33A 4YDLC 1FN4A 1A21A 3GMNA 4KWUA 4DN3L 3L5WA 3T0EE 3LPFA 1VFOA 3QA3B 4ELME 1MHCB 2DQJH 4IOIA 2CMRH 3HR5A 1KB9J 3FO9A 3GHEL 1B2WL 1H3PH 5E08H 3T0EC 4OLYL 3Q6GL 3PQYB 2A6KB 5CCKH 1VFUA 4WHCA 1PKQB 2VDKH 3RWEB 1OL0A 2XV6B 5CJXA 3VCLA 2C3GA 3WS6C 5I18H 4K8RL 4LSPL 3RWCA 5LVEA 1NCBH 1LNUA 4NC1E 2HT3D 1AD0A 4RRPA 2VZSA 4PB0L 4JY5H 3EYSH 5EU7C 3ARBB 1IM9A 4QXGL 3M8OL 4G3YL 1OSPL 4HH8A 4OD3L 4KJPC 1U93A 3NCYP 5B39A 1KCVH 3MV7A 4OZFH 4DN3H 3PHQA 3KGRA 3RL1A 1CFNA 1ZANL 3DIFB 5BJTA 1HHGB 4RMVA 4FXKB 4XBPB 5FA4B 1BFOB 1U8NB 2B20A 1YNTA 3FONA 1T0NA 3SDAC 1LWRA 4BQBA 2Q7YA 1L7TH 4LSPH 3BPCA 3DUSA 3QXTA 2ZG3A 4GJTB 5ADPH 4X6BB 5FKPA 1I3RA 4HMCA 4PB0H 2J6EH 4JZOB 4KV5E 1JGEB 1X4YA 3O6FB 4XNYL 3ULVF 4QXGH 3EJYD 4G3YH 1J05A 3FB7B 1UB5B 2HJKB 4X6FB 3H9YA 1F5WA 3W0WB 1OSPH 3VD5A 4AEEA 4I3SL 3CH1B 4WO4D 1EEUA 2AEWA 5GHWL 4HFWA 3DVNB 1ZHKB 4U6YB 1MAJA 3QEQA 5DVLA 3CVHB 3BQUD 1UCTA 3I6GA 2CKNA 1ZANH 5AD0B 1YN6A 3R1GH 3DHJA 4TVPE 3T0WA 4JB9L 1F4AA 2VLLB 3H9SD 4PJEA 4EQ2A 3EJZD 1JHKH 3F65A 3U7YH 3BDYL 2HLAB 3BXNB 3QXAA 1OHQA 1D5XB 1FG2B 3TWCL 2DQGH 1QVOB 2X4SB 2R2CA 1AI1H 2R1YA 3FCTB 4L4VD 2NY3B 1JWSA 8FABB 1U3HD 4HJ0D 3D85D 3OKMB 2CIKA 4BZ2L 1FG9C 3MV8A 5BQ7B 4XNUH 1U95B 3QQ4A 2EECA 4JFHD 1U8QA 3CLFL 4PGBA 3VI3E 1FH5L 4P2YA 4M48H 4LMQI 1IGFL 5DI8B 1A4KB 4U1JA 3O45A 1FIGH 3HZMA 2CDFB 3BDYH 3NA4A 5F9DC 1VEOA 1WISA 5EU3A 2VISB 3D39E 1OP9A 1TETL 3TWCH 2QQNH 3BN9C 4XWOD 4YDJB 1PEZA 1Q9WA 4KJYA 3HAEH 1BIIB 1CGWA 1WC7A 4OM0L 4ERSL 3HFML 2JJTC 4M1CD 4FG6D 1EGJA 4BZ2H 3CSYB 4I18A 4XVUD 4QEGA 5D7IA 1ZA6A 2FJHB 4MJ2A 3FQXA 4LSRL 3CLFH 4LCYB 3AS1A 3GZKA 2BERA 4AH2A 3OJ2C 2GITA 3VE0A 3GO1H 4LQFL 2JIXB 4B7LA 4NBYB 4F7PA 5BS0D 2NW2B 2WNGA 1RZ8B 4KV5F 4BKLB 4JKLA 2RAMA 3C5JB 4NM8L 3TA3A 1R3KB 2V7NB 4LLYA 5FGBA 4HHAB 3SKJH 4N0FB 2HJFB 4XMLL 3LKOB 2GI7A 5IB2B 1CDIA 4LCCC 2VZTA 4IMLA 1IEHA 5IWLC 1GYAA 1XR8B 1YEHL 2P45B 5BXFB 4OM0H 4EXPX 4ERSH 1UZ6E 2X44D 4U1NB 2X9YA 1UFUA 3MACH 4E0RA 4ODUA 4W4OC 1DFBH 4RBPK 3SPVB 1RHHB 3S8WA 3HCVA 4OKDA 3C5SB 4ZAKC 1XFPA 2CUHA 2H32H 4MNQA 4QYOA 5I66B 2ZOKB 4IOSD 1RU9L 4O51B 4HUVB 1N59B 4LQFH 2NY0D 4NKQB 3UJIH 1MCJA 3LKRB 1RK1A 5D6CB 1MSPA 1CBVL 1JNNL 1T5WB 3QQ3B 2MHAA 4XMLH 2YD1A 4R26H 3QEUA 1Q9LA 1P4IH 2ADFL 3S35L 5C3LD 4EI6A 1BFSA 3O0RL 1JPTL 1OW0A 3HI6L 5GRVL 3E2HB 5E9DB 3MBED 3TEUA 1SBSH 2BXZA 3T2PA 3P9MB 4HPOL 5DD1H 2G2RB 3EZJB 1BGXL 1BFVL 4P2OA 3UTTA 3VI3F 1H8OA 1QR4A 5BO1H 3ZTJH 3QI9A 1F11B 4BUHA 1EMTL 5DHVA 1KJ2H 1RJLB 5D7LD 1BIHA 1XCTA 1RU9H 5C0JB 2XKNA 1MCKA 1J86A 2XICA 3ARDB 4F15B 5FM8A 2FB4L 3BWAB 3Q48A 1LO2L 2LU7A 4QRQB 5I74C 1CBVH 2OJZH 4XP5H 1CFSA 1IEAA 3K8KA 4KY1L 5BW7A 4OF7A 5CMAB 4OCXH 4I2XB 3S35H 3TBWA 3TF7C 2UUDH 1Q8MA 3O0RH 4OCYL 2FX9L 2FLBT 4LP4A 1A6VL 3WMSA 5E2VH 4QHUB 1KJMA 3FN0L 4HJJL 4HWNA 5DRWA 1QLRA 3MLYL 1CFQA 1I7RB 4XB8A 3BD5A 1WQVT 2YKLL 4NNYA 4MNGB 5C0FA 2NLJB 1X6LA 1EMTH 1XAUA 4S2SB 2XZAL 4PJCE 4LCWA 3GMMB 2EDKA 4MD0A 2PXYC 3B2UC 4X7FC 1FE8L 3QJFA 3RL2B 2Q87A 2XTJB 3GGWA 3QUZB 1EO8H 3GFUA 3OQ3B 4M5ZL 2FB4H 4MJ4A 5JA8B 1AR1D 2YA1A 1ADQA 3RBSA 3TIEB 1E6JL 2FX9H 4OCYH 4RIRB 1A6VH 4N90E 1EO5A 1T5XB 2IAND 1NFIA 2DM2A 3JTSA 1IILE 3PP3K 4HJJH 4M93B 1TJHH 2MWCA 5ALBL 5KSBE 3CVIL 2YKLH 4WFFE 1ZLVH 2XZAH 3ARTA 3MR9A 3MX0A 4U1IA 4RGNB 3RWHA 5DR5H 3TZVC 2DM7A 2EDWA 4F8TA 2F74A 1MFDH 3DX8B 2R0ZH 4LLDB 1MRCL 4D94A 1NMAL 4L3EA 5F7NC 5A2KH 2WBWB 4Y16A 1CF8H 3IF1A 5HI4D 1I7UA 3W39A 3L9RA 4JFEB 1JF1A 4XP9L 15C8H 1P4LA 3L6FA 3GNML 4DKAA 1N8ZB 5HYJA 2P44B 2YXFA 1FSKC 3S3SA 1R5VB 3MV9A 3CVIH 3HS0B 3MLUL 4J1UB 3CVHH 1ZVSA 1RZIA 2MOVA 1K5NA 3R4DA 4ODXA 4CUCA 1LE9B 3EO1B 3MQIA 5C8JA 4LU5L 3KPPB 4YWGL 2DQHL 2BFVH 4AY0A 5L2JB 1OTTD 4KJQD 4M00A 1NMAH 5EOCJ 5IESL 3UYRL 1UXWA 4OUOA 1G7PB 2HYMA 4FQJL 5C6WH 4XP9H 4LSTH 2LU3A 3LY6A 5ECJE 5EIIA 3IJHA 4PJCF 1CU4L 3HRZA 2E6QA 4QCIA 2VC2H 1YC8A 2E27L 4W4NA 3GSOB 2H6PA 4U6XB 4ZFZB 4ODWA 4XXDB 1G7LB 1PLGH 3F62A 1JGVL 5DDHA 1X4XA 43C9B 3VFNB 3TNMA 1ZXQA 3V4VL 3C6SB 5F9AC 4YWGH 4OCRH 2DQHH 3MRQB 1QKZL 5DK0B 2NX5A 5E8OA 5FO8B 4OUUB 3UYRH 3FN9A 2KH2B 4U1MB 4D9RD 1CGVA 4UDUB 3MZTA 1YJDH 1M7DA 3FFDA 1S7SA 5GSRA 3BZ4B 1T1ZB 3T0XA 2GTWA 1OGTA 2HG5B 4LASL 4M61A 4PRHE 3D2UB 4PRPD 5B4MD 5HHXL 4L8DB 4DVBA 5DT1L 1AHWB 2P8LB 3I50H 2AV1A 4X80H 1YEIH 4HIJB 3QR2A 3TN0D 2VAAB 4FOMA 5CGYD 4ODVL 4ETQB 3P0VL 4DQOL 1T4KA 4ALAL 2VQTA 1DUZB 1QKZH 2XY2A 3SDCA 4ODBD 2C4FU 4GAYB 1TZHA 4IBLT 1JHTB 4QRPE 1IC7L 5EZLA 3UTPE 1X5IA 4LEXH 1T03L 2DLFH 4HK3J 2W0FA 3KG5A 2ZUQC 1INQA 3FO2A 1OM3H 5D7SL 2FD6H 3DX9A 1Z9OA 2AABH 2PO6D 4GMSL 4GSDH 3DPBA 1V3KA 1Z5LB 5HHXH 4WHTB 2VDRL 4NQCD 5DT1H 1X5LA 3CLEH 1KPRB 4LHUD 4CADB 3WSQL 3N9GL 5C0CB 3VXUE 4N9GB 4ODVH 2UY6A 2ORBL 5DJ0A 5IVXE 3EYVA 1AR2A 4Z7QE 4DQOH 2OTPA 5J6GB 4MA1C 4ALAH 2WK2A 5KJRL 1XH3B 1IAKB 1BZQK 1T03H 4L3AA 3ULVL 1QD0A 1T22B 4L8CB 1NFDF 1AIFA 4AIZA 1SYVA 3Q2CA 2EYRA 5D7SH 1OQOA 4PRID 4GMSH 3KS0J 1MEXL 5C0DA 3PV7A 2VDRH 4Y7MA 4M1DL 1S7RA 5JOFB 1IKNA 2Q3ZA 3AXLA 5CEYA 3GI9H 1RIVH 1MHHA 4FP8L 3LQMA 5L88L 2ORBH 4G9FE 5CS7A 2XWTA 1FRGL 2QHRL 2B7DT 4HMEA 5BOZG 4WW1B 4BH8B 2G9HB 3H9HB 4PRDA 5CEZL 1I8LA 4FQXB 1MPAL 1DEEB 5KJRH 1BF2A 5IMOA 4OLXL 2YUWA 5IB5A 3FAWA 5L8KB 4ZUSA 4UINH 4NZRL 4O2CB 3SKOB 5MENE 3BUYA 2NNAB 1DBJL 1A7PL 3HG1D 1P1ZB 1AO7E 2V2XB 5GSVB 1J8HD 4MDIA 4PJHE 2MKLC 4PJ7E 5ELIA 4M1DH 3MA9H 1U2CA 4Z7WA 3JTTB 1NMCB 1GGCL 4KRPB 3KDMA 3UPRB 2Q8AL 3SGKC 1JHLH 2C3HA 4N5UA 1CICC 1S7VA 5HPMA 5HYIA 2O5ZL 3U4BH 4APQB 5JORB 5D1QA 3G5ZA 4PG2A 5KG9B 3QUKA 4I0PA 4KUZL 4DGIL 2NZ9C 5F7EL 1Q72L 5F96L 4OLXH 5L9DL 1DCLA 5I1DA 1A6ZB 2VZVA 3BH8A 3BT2L 1OGAB 1I7ZB 4JG0H 4PJDA 3TO4B 1EDQA 3QHFL 1LE5B 3SBWC 2BNQA 2AJSL 1RUPH 5HVHC 4G43B 1WZLA 3MYJA 3DXAD 3BHBB 4EQ3A 5MEPA 4MQ7A 1FCGA 5LAXB 2PTTA 2ARJB 1CT8A 4N0UE 4JREB 1NCNA 3UBXG 2QR0A 1UXSA 5IVXF 2X05A 5F3BB 3KPRD 2OXGA 3Q0HA 1GGCH 4U7MA 4L8SA 4K23L 2HTKC 2X70A 4WFGE 4K7FB 3LZFH 5EU5B 1FNEA 3D25B 3RTQC 3FT4A 1Z3GH 5CSGA 3ARWA 4HKJA 4KUZH 5DC4B 4DGIH 1FL5A 1U8PB 3M17B 5INCB 1CDHA 4GKNA 5L9DH 2C3WA 3BP4B 4UOJA 4F57L 4OFVA 3WD5L 3U1SL 2EXWC 4R90L 3QHFH 4Z7VA 5IBLC 3KYAA 2PYFA 3MLPA 1IGML 2WLYA 1R5WB 3RI5K 1AQKL 4OZFA 3VI4E 3X12B 2AJZA 1FVDB 4U1GB 3BRDA 2BXYA 4H1LA 1E27B 2VXUH 4OTXL 5KSUA 4HIHA 3K4ZA 4GRLC 1BVLB 2GJ6A 3VXPB 4K23H 2W1NA 4H26A 4FQ1L 1UKTA 1INDH 1WITA 3VG0L 2X4NA 4JN2B 4NQED 1S7TB 4R0LC 4H25A 1Z9SA 4CNIA 3QQ9D 3SE9L 2DYPA 4J3WA 1EA9C 1NANH 4U31A 5E8DL 4F57H 1GZQA 3WD5H 4P2QE 1EEYB 2FGWL 3U1SH 5IHLB 4PJHF 4R90H 4JKKA 4PJ7F 2X1PA 3IFLL 1P9MC 3HE6B 4ISVA 1QYGL 4FS0A 4C58B 2J3SA 2HFFA 3IDMA 2I25N 5C0AD 4I0CC 1JBJA 2ZUTA 5DRZB 2B4CC 3D0VA 1U3JA 2CDEB 2DQCL 5ILTL 1C08B 5DJZA 2C26A 1ONQA 4MQTB 4O00A 3MJ9L 4XC3L 3OWEA 4HKXA 3VG0H 5F97E 3OZ9L 3TYGL 5I73B 1Q1JL 2R2EA 1K6QL 1WBZA 4ZAKD 1HXMA 3DSNA 3SE9H 1NFDB 5ID0B 4MD4B 2AXGB 2D7MA 1YNLL 3WFBH 5D2LB 2FGWH 1Q9OB 2DI8A 1FJ1A 3B6SA 3IFLH 3U2SA 1HHIA 3L1OH 1XGQB 3WUWB 3BOVA 1P7QD 5FYKH 1ZLSL 3VFUA 4KZEL 3O9WA 5DMKA 3GUTB 3HZKA 1IFHL 1DVFB 2WBJC 2NYYD 3LKNA 4ZUTB 5T1DH 2CH8A 3U46A 4JFFB 3OXSB 2BP3A 3NN8B 4WI3A 2RBLA 2DLHA 5CZXC 3O3BB 3VFRB 5FAAA 1T21B 4XC3H 3TP4A 4GRMA 4Y0GA 1IL1B 3ETBF 2V2TA 3OZ9H 4UIKH 4JRYE 1HQRB 5B8CA 1Q1JH 4M8QA 5C08D 1K6QH 5FA3B 1CTOA 4W6WB 4CW1A 3C60C 3SKMB 4C83B 4NO0D 4F2MB 3B5HA 3TBSB 1JWMA 1WAAA 5HHQB 3WDHA 3VI4F 3V8OA 3FTGA 3LKPB 3PG2A 4S0SD 3F8UB 1QRND 3O8XA 3P4MB 4N8CL 4OD1L 1GVIA 4ZXBB 2FYYA 4PLNC 1MIEH 3U30C 5J12B 1J0JA 5EBWB 2ZG1A 3QPQC 4JN1L 1I9RH 1RQ5A 5AZ2L 4PJBE 5TE7H 4Q9QL 2BOBA 3JVGA 1BZ9B 5IVNA 4KAQL 4Y4FA 4FNLL 1NC4B 2VQ1A 1AXSA 2R4SH 4X0KA 2BC4A 2JE8A 1A1NA 1F58H 5IQ9A 2ESVB 2WM0A 5IMLB 2YPLD 3CZFB 3GSRB 4G6JL 3U36A 1T89A 2IH1A 3B2UD 3QQNA 1HKLH 5AEAA 5GZOC 1Y18B 2GJJA 4GQ9L 2J8OA 3QULB 1B0RA 5J3HC 2EYSA 2QQLH 4YXHH 3ROOB 4HWBH 5EH1A 2IPUK 4M5YL 1M71A 4NHUA 2C1OB 4ORGA 5IEHB 2DLEA 3AY4C 2BNRA 5AZ2H 4EN3C 4Q9QH 3MLRH 3PWJA 5JZ7D 3A6BL 1MVFA 4C56D 2H32A 4WNQA 5C71A 1HYSD 4CU7A 3MNVA 1Q9KA 1GPOL 4HK0A 5KS9B 4GG6A 3DURB 3HPLA 3Q5YA 3RUGB 3TBYA 4L4TD 1FV1A 4LSUH 1AGCB 1PQZB 4XPHH 3QP3A 5ANME 3X17A 2ATPA 3O4OB 3ZTNL 1MAKA 3TZVD 3K80A 3ORJA 4P5TA 1JK8B 1CXLA 1G1YA 2ADIA 3QUYC 2X89D 1IQDB 3MGOB 4MA3B 2UZYB 4KK6C 1AGDA 4P5KA 1NL0H 1ZWIA 2EZ0C 2CLRB 4DKEL 3MMEB 4LLQB 3FQTB 1RZ7H 2EKSA 5A1AA 1A5FL 2PN5A 3VXOA 2UWEE 4FQQA 4G7YL 2HFEA 3F6IA 1KJ2A 2BRRL 3T2NL 2P5WD 2QHLA 3MOQA 3WJJA 4XP4H 5D9SB 3A6BH 2L0DA 1TCRA 2EC9U 1GPOH 4YDIL 4F7EA 2A77H 3R0NA 1F4XH 3OHXA 1KNOB 1Z9MA 1F6AB 4GXUM 4RDQG 1EHNA 2GTZB 4ZS6D 4Q6IA 4BQ8A 1E4KA 3P30L 1HXYA 2J8HA 3O6LL 1HCFX 3ZTNH 2PETA 3QDHA 1V3JA 3HNTH 1ZT1A 5IB4A 2DD8H 3A6OA 4BH7A 5ICXB 5GGSA 5HHPB 3U9UB 5EUOE 3U0PB 2GJZA 1A5FH 4ONFL 1OCWL 1A7RL 3DSFL 3E1F1 3GMPB 4CVXA 3VWKB 3BQUB 1H15B 3QA3A 1MHCA 2KZWA 4U1KB 5GJSL 4N0CC 4L3CA 1C1EH 4YDIH 3QEHA 3CCHB 3PABA 2ENYA 1GGBL 4JZNB 3PQYA 2A6KA 3H9SB 1PKQA 3GJEB 4QOKD 2YEZB 4XCEB 4PLKC 2YOCA 1TFHA 2CR6A 5FGRA 1J0ZA 2ED7A 4HGMA 4LNVA 1KN2H 3MNZA 1ZLWH 4BZYA 3ARBA 3LCYA 1QSED 5FCUL 1DLFL 4W68A 5GGVY 5GRZA 2L4OA 2CIIB 4GRWE 5J0BA 2JJSC 4L4VB 2VUOA 1X7QA 2VR5A 5CP7A 2APXA 1OCWH 1U3HB 3D85B 4D3CL 3DSFH 4ELKB 4EOWH 1MCLA 4L9LC 5F1NB 3HB3D 4FQCL 1FC2D 4UIMB 3DIFA 2BOCB 2VXTL 3AS0A 1CGYA 4OGXH 4HQQH 4HS3A 1HHGA 4XBPA 1UWXK 4U0RC 4Q0XH 4RGOL 3P4NB 3L3DB 2EH7H 2XA3A 4M7LT 3TESA 3S4SB 2VABB 3A67H 2OR7A 1RZFL 5E5UB 3D18A 3AB0C 5JHDE 2R69L 2E7LC 2L7UA 4JZJA 4X6BA 3ZYIA 2CJUL 4JZOA 1QLEL 1JGEA 1BQHB 4J4PD 3EDJA 2IF7A 2UWEF 1DLFH 3I75B 4WDIB 4R2GC 2P7TB 2MTPA 4N68A 2HJKA 1WFTA 2X1OA 4PJXA 4TTDC 4U7KA 5EULV 3W0WA 1NCWH 3CH1A 1CFBA 4ODTH 3DVNA 3MJ7A 1ZHKA 3G08B 4KTDL 5IOPB 1CD1A 3BAEL 5IV2B 3PL6C 3V6ZA 3VGEA 4FQCH 1G9EA 1JL8A 2Y06L 3NAAL 1N64L 5AD0A 5HYQB 5CZVH 4RMWA 2F53D 4OLWL 4NRXA 3I2CL 2DN7A 4RGOH 5GRJH 2IJ0C 4G42A 4G6AC 5F7KC 2ARWA 1N4XL 2EDTA 5BS0B 1RZFH 3MLVH 4ZODA 3WIHL 2OM5A 4NZDA 4KZDL 2HLAA 5EZOL 4YHYB 2Y7QA 1FL3B 1RI8A 4KC3B 2CLVB 4EJ1C 1D5XA 1FG2A 3AFLA 2NY5L 3WV0A 1PG7H 4FMKA 3G9VA 2FSEB 4JQIL 2OLDA 2X4SA 3FCTA 3VFPB 3CXHK 4MD5B 1CGUA 1Q0YL 1A6AB 2HFGL 4AJ0A 2EH8L 4YDKL 3OKMA 1A6WL 3IGAB 3IAPA 2AQ2A 3BAEH 5EOCL 5HGAB 4HIEB 2DMBA 4U1SB 4YZFF 3NAAH 5DD0L 2PYED 3VXRD 4X7CC 5FM5O 1BJ1J 3QXDB 1VGEL 4OLWH 5EU6A 1XF3B 3I2CH 1QSFA 4UDTB 1NUGA 4HUWA 4JM2F 1U8KB 3EFFB 3BGFC 3PE9A 3BYTA 2DLTA 2ED8A 2NY0B 1N4XH 5DI8A 3O11B 3O3DB 4I9WE 3S3PA 2J8UF 3DROB 3WIHH 3VXMD 3ZE2E 2CDFA 1NUDA 1OT1A 4GRWF 1BLNB 3MRHB 3DRQB 2XQYK 2VISA 3L7EA 1DQML 3EYOB 4EIGB 3RU8L 4QXUL 3MBEB 3S7GA 3NCJL 3VGAB 1BIIA 2ZKHL 4JQIH 4DAGL 1ZE3C 1P6AB 2HFGH 2GSIB 5GS3A 1A6WH 3CSYA 4P3CH 3T65B 2M2DA 2C1PB 2N4IA 1YMME 3U82B 2DIAA 4HX1A 5JDSB 4KMQA 1VGEH 4LCYA 3OR6A 2C7UB 1B6UA 5D7LB 4Z7UF 5DEGB 5D70L 1PVHA 3MLZL 4Y1AB 3SKNB 2VLKE 2JIXA 1FZOB 4QHNB 1YQVL 2NW2A 1URLA 4BQCA 1RZ8A 4BKLA 2H9GA 3C5JA 2DQFB 3ILPA 4XNQB 1G1CA 2HKFL 1R3KA 1OOAA 2V7NA 4HHAA 4QTIL 3DMMB 4N0FA 1F45A 1I1AD 4I3RL 1A7OL 1A9EA 1UEYA 4NKDA 5IB2A 5LG1A 4FZEH 2OP4L 4HKBA 1DQMH 2NZ9D 4QXUH 2AV7A 5A16B 4ZTPL 5CINL 5F7WC 1DE4B 1A1OB 5E0QA 3WFEL 4KPHH 3ARXA 1DL7L 4YEEA 3TVMC 4U1NA 3WJLA 4A2MA 1F3JB 2DDQH 3RVXC 1YQ2A 2E7HA 3SPVA 3GSWA 1N0LA 4WEUD 4P2RE 1L0YA 4GBXC 1KIRA 1U8MB 2ERJC 5I66A 2ZOKA 1LO3L 3IDYC 4QGYA 1N59A 5T5FH 3LKRA 2HTKD 1EHLH 4HV8B 1IZKA 3CFEB 1DJSA 3HNVL 4HS8H 3EAKA 4XGZA 1KPUA 4YDVB 3RGVA 4JFXB 3V0AC 4J3OC 5E9DA 1A02N 7CGTA 3P4OB 2D7PA 3GIVB 2R1WB 2IANB 3WFEH 1KSRA 2VLJE 1LP9B 3FFCB 3CZJA 1CIDA 5IBLD 1GC1L 4MZ3A 3LEYH 1IGIL 4Z76B 2FBJH 1R5IB 1H5BB 1I1FB 3E8UL 3LKQB 1U8IB 5JQ6L 4KVCL 4BK4A 3BEWB 1F11A 3ZE1E 3PWPD 2BSTB 3FZUC 1XF1A 1DZBA 5F7UA 1OAXL 1MAML 1YEJL 1LO3H 3LH2L 4LKXB 4YGAB 3D3VA 5C0JA 3ZE2F 5FECB 4PUBL 5DWUH 5DRNB 4MLSA 4XX1E 3QDMA 2HP4A 3BWAA 4QRQA 1MFCH 3HNVH 5CMAA 1CXIA 4YXLL 1U58B 4JM4L 4I2XA 5D96B 3V79C 4H20L 2CO7B 3OKEB 3GBNL 2R8SL 2HRPL 3QG6B 1F6FB 1TVDA 4CN4A 2HMIC 1IGIH 2DKSA 3QIBD 4PPTA 1U9KA 4RRPG 4LGPB 1RZKC 3L3IB 4NNPL 4JKMA 4MNGA 4PJFE 2NLJA 1MFBL 4DFIA 4S2SA 5C07E 3T0AA 1RMFL 4PJGE 2EICA 1T7YA 3DECA 2MMXA 4WGWB 2HH0L 2MKWA 3LH2H 4PUBH 3CSPA 3RL2A 3NCBB 4AG4L 3KS0H 4M7JH 4DTGL 3O4LD 3AREC 2JCCB 5AYQA 4X9FA 4YK4B 4IRJA 1TTUA 4JM4H 5HDOA 1DQLL 4RIRA 2R8SH 2HRPH 1FGVL 1T5XA 3LD8C 2ZNXA 3MZGB 3V95A 4JVUA 4ZG1A 4FTVB 5GS0L 4OZHF 2A74B 1Y6KR 3QZWB 4W6XB 4OFPA 4M7ZB 1MFBH 2HT2D 4QY8B 5DO2C 1RMFH 1TVHB 4Y5YB 2J8UB 3VFOA 1FZMA 3MJGX 1NLBL 2GFBA 2WUBL 1UVQB 1JN6B 4PG9B 3DX8A 4DTGH 4LLDA 4MNHB 5C6TH 5C2BL 3BYYA 2O61B 2C5DC 3NH7L 4J12A 4JFEA 4F3FB 3T1FA 5BVPL 3DRTB 5T3ZE 5IW1B 5FYJD 2VQUA 4K7PL 1CLYH 1MIMH 3ZE1F 1XR9B 4PRPB 1MFEH 5JDJA 1H0DB 2P49B 1R5VA 2C4XA 4Z7UB 1W0YT 4J1UA 5CJQL 1IAIM 3T3PE 4O5LL 3TN0B 3QPQD 1PY4A 1ITBB 1LE9A 4KUCD 4M6ML 5BRZE 1XT5A 5F7HA 1J5OL 1Y0LB 3KPPA 1T0MB 2Z93B 3KWWA 2WUBH 2EC8A 1HHHB 4I8DA 5L2JA 2IPKB 3U4EB 2QSVA 5GRXG 4D0BB 1NAMB 1P2CB 3BPLB 1G7PA 3BDBA 1J11A 1ZSDB 4UMGA 1MI5B 1SEBB 3EYUL 3QFJE 1EX0A 3LB6C 2IGFL 2BVOB 1I9JH 3L5HA 3IKCB 5GGSY 4NQCB 1CR9L 5J3HD 3GSOA 3QRFM 4Z95L 5FUOH 1VPOH 4RFNC 3S34L 4LHUB 4XXDA 4O5LH 1G7LA 43C9A 5IB1A 3VFNA 4YDLB 2OL3B 4Z7NE 1BOYA 1J5OH 1A2YB 2COQA 2X2YA 5FYLD 1BREA 4MAYA 2IPUG 5DK0A 3JWNC 3D69A 4YX2L 3KPLB 5FO8A 5JMOC 4OUUA 1J12A 4R7DB 3NCCB 4U1MA 4ELMB 3V5DB 1BBJB 4UDUA 4ODSH 2O93L 5ESQB 4DGVH 4PGZA 5HHMB 5D1ZA 4NM4H 1KCKA 1T1ZA 3QDJE 3EYUH 3ET9F 4PRIB 2PNDA 5ERWA 2IGFH 3MCG1 1AHWA 1IGCL 2P8LA 4Z95H 3S34H 5E6IA 3MJ9A 1JWUB 3ELAT 4WFED 1KEGL 1XIWD 4HIJA 4Q6YA 3GIZH 2VAAA 3NACH 5ESAB 1GGIH 2O5YL 5EOTB 5E8EB 4ETQA 2FBOJ 1P4BL 4YGVB 5TE4L 4PRNA 1FYTD 2ZJSL 4W70A 5B38A 3RAJH 4GAYA 3WS3A 5D2NB 1ZA3B 1JHTA 2HVJB 2QKIB 2ZSWB 3SDAB 3GSVB 4NHCL 2DIJA 4M9PA 5JW4Q 3ESUF 2JK5B 5CSBA 3RY6A 4I77L 4OCWL 3T3PF 5T1LB 1J8HB 1Z5LA 4WHTA 5IBTL 3R06B 5CBAA 3U0TB 1OVZA 1KPRA 5AUMA 3QIUC 2Q1EA 4CADA 1KEGH 2EE9A 2F54D 1ZVYA 5C0CA 4N9GA 5D6DA 4JLRA 1AH1A 4P9HC 4K3HA 1EO7A 1P4BH 1LK3L 1WWCA 3LN4A 3VA2C 3AU1A 2J4WH 1RZJL 3P77B 2BCKB 5C6PB 1T22A 4NHCH 4MQSB 4PLKD 4L8CA 5IEKB 3MV7E 4ZYKB 2BNUB 3RX7A 1HZHL 2D2OA 3P11L 4PV9B 4CU6A 5ISZD 4JFZL 4OCWH 1ULVA 3DXAB 3OPZL 1W0WA 3HHRB 5IBTH 4J8RA 3ULSB 1UYWL 4Z7NF 3DOSA 2H8PB 3B3IB 3DX6B 2CLZB 3LVEA 4R8WH 3KPRB 4PD4J 3NCEB 4UZGA 2GY5A 3RKPA 1TQCC 5LQBL 3JV6B 3BJLA 2AXJA 3H3PL 4LEOB 4NQSA 1LK3H 5I15L 3CFIC 1K2DB 4WW1A 4HMDA 4BH8A 2G9HA 3NABL 5KVEL 2CRMA 3LRHA 4FQXA 1DEEA 4GT7A 5ID1B 4HC1H 5C0NC 3RWJB 5JO5B 3V4PH 5DFWH 1RZJH 1S9WA 1AKJD 1SJVA 3QEQE 4NO2B 3RY5A 1S5HB 4O2CA 1HZHH 3OAYH 4AYFA 3P11H 1T6WA 3FRPG 5T1KD 3O3EB 4JFZH 4ZPTB 1O5DT 1P1ZA 1N5AB 4KTEH 5GSVA 2CPCA 4R4FL 1KV3A 5ALCH 3B9EA 4LL9A 3QNXB 1UYWH 2W60B 4UBDD 3JTTA 4PJEE 3RY4A 4KDTA 3V0VB 2AEPL 4BK5A 5TE6L 3BMWA 3H3PH 1X5JA 2W92A 3PDDA 5E4EC 4APQA 3W81A 3IU3B 5KG9A 4NQEB 2XN9E 4DUXA 3NABH 4P3DB 2J1KA 5KVEH 5BV7C 1T1XB 1WWWX 3GB7B 1A6ZA 3BIAX 4ONHB 4OZGB 5F3HA 4YJZL 4KXZH 4BSVB 3TO4A 1LE5A 4UOW1 4YFLI 2C3XA 1X5YA 4Y2DD 4OF3A 1IKFL 2OYPA 5DXWA 3BHBA 1ACYH 1NCUA 5LAXA 3TV3L 5GGRB 2ARJA 2NCMA 2GIYA 5JW3H 3H8NA 3K74B 1LEKB 2H1PH 3OKDB 5EA0L 3VGBA 2EIZB 2GY7B 4XCFL 4JR9H 5I1IL 3KXFD 4K7FA 4ENEC 4EDWL 1CLOL 1FHGA 3FMGL 2VZOA 5I6XC 3D25A 1JGUH 1BWWA 2R4RL 4QRRD 4ZAKB 3KLHD 4E41B 1NC2B 4ZFOB 1MCOL 1U8PA 2XY1A 3M17A 4MQXC 3BP6B 5INCA 3BP4A 1FPTL 2W9DL 2A6IB 3PNWB 1FC1A 4D9QE 1G0XA 1U8HA 3QWRA 4OQTH 3MC0A 4P57B 1C5DA 4PJ9A 3O3AB 5D7IE 1A7NH 3IJSB 4WEBL 1IKFH 2F9BT 1P7QB 1R5WA 4CVUA 5H2BB 3X12A 4TN9A 1FVDA 2YWYA 4E9LA 1MJ7L 1FVCB 4LK4A 1E27A 4B7IA 4HEME 3MLSL 4XCYB 4BFEA 1BVLA 3VXPA 2P48B 4F7MB 2XQYG 4G9DB 4S11A 4DFHA 3FMGH 4XHJD 4HWUA 4KH2A 1ED3B 5C08B 3QDGB 3TA3C 1G6RB 3WHXA 5TF1L 4YUEL 5FGBC 1A0QL 1MCOH 1NBVL 1IGTB 1U92A 1Z0MA 4NO0B 2Y6SC 3CSBA 1EEYA 2RJMA 1NAMH 5C7XH 4QKXB 3RZCC 2YRPA 5I74B 4QF1A 1NDMA 1QRNB 1WFUA 1JYNA 2GQHA 3SDXB 1ZLVK 1N3NB 4MNQE 4NKIL 3I3BA 4M6AA 4MXQD 1MJ7H 3EBAA 1A47A 1OARL 2YPVL 3P3YA 4HFUL 3W5MA 2VLME 5EO1B 2HLFD 1UCBH 4JDVB 4QRTB 5DVKA 3VH8G 4GUPA 2UYLB 1TTFA 3TGXA 2B5IC 4PJ5D 2W38A 4NWUH 2DLGA 1OD9A 3ARYA 2OL3H 5HYEA 4XXCA 2YPLB 4IJ3C 4YUEH 5F7LB 4F9LA 2PXYB 2C9AA 1CE6B 1NFDA 2WW8A 3NTCL 4MD4A 5B22A 2AXGA 5MP6L 3B2VH 3MBXL 1OW0C 1ODAA 3JV5A 1Q9OA 3UTTE 4GAGH 3T77B 3LSOB 1NEZB 3TO2B 3ZLQC 5MERA 1UG9A 3WUWA 5F1OB 3HE7C 5IT2L 4P2OC 2YZ8A 4POYA 2IALB 1JPFB 5D5MB 2PUQT 3GUTA 4NKIH 4Q9BA 3QI9C 4JFFA 2FO4B 3OXSA 4KHXH 1MUJB 2NXZD 1OARH 2HKHL 5SWZD 4FQ2L 2YPVH 1GIGL 4GG8B 4C56B 1C16B 3VFRA 1VB9A 1T21A 4RAVB 1VDGA 3CAFA 2NQCA 4X6CB 4HG4J 3OXRA 1A6PA 1HQRA 2ICCA 5IMMA 3WIHA 4L4TB 1OF2B 3LDBC 1EEZB 3WEXA 5BW7C 1IARB 2RR3A 3DLQR 2PCPB 4PBXA 4C83A 4F2MA 3TZVB 5MP6H 5GGQH 1DANT 5GZND 1GSMA 3BZEB 4ZUWA 4Y5XA 3UJTL 5A40E 1HIML 1G7QB 4U6VL 3P4MA 2I9TA 4MWFB 4ZXBA 4F37F 5IT2H 3OKKB 5GQBA 1QP1A 5EBWA 2P5ED 5I2IA 2ZUXA 2P5WB 4FQ2H 1GIGH 4MXWH 1FSKB 1NC4A 2X4OB 4NUJB 3KYNB 1EHXA 1BFTA 1XGRB 3EYFB 3MUGB 2ESVA 3KPSD 4LGSB 5IMLA 4OV5B 3CZFA 3GSRA 1H8NA 3JWDL 5KW9H 4K7PX 4M1GH 3NGBB 3WLBB 5KVFL 4MS8D 1I7TB 3AM8A 3W9EB 4F8QA 1BZ7A 4YO0B 3ARED 5J1SC 3UJTH 5I71B 1BJ1H 1HIMH 3MREB 4U6VH 3QULA 4P46C 5BZWA 3ZKMC 4OF8A 2YPKB 2DQEL 3MCLH 4HJGB 5EO9B 1BQLL 1NEUA 5FKAB 4ZO7A 1HINL 2R2BA 2C1OA 1SBBA 5IEHA 1XGYL 4LVHC 4G7VL 4L8BA 4D0CA 1M05B 1SEQL 3EHBC 5IUSA 1QFWI 1CS6A 3ARFA 4GW5B 3REVB 4GH7B 2CDGB 4L3EE 5DJ8B 5I0DA 3L3HB 5DQJB 4QOKB 2DTMH 1AGCA 1PQZA 5I8OH 5DC9B 3RBGA 4XP6L 5HYJE 1JK8A 4DEPC 2AK4D 4PY8J 2DB8A 5K9QG 1IQDA 3MV9E 4MA3A 1JV5B 1QSEB 5EFIB 2VDOL 2CLRA 3MMEA 2DQEH 3FQTA 1BQLH 5DJAB 3G04B 3GKWH 1HINH 4G7VH 5DUML 2X4PA 2GT9A 5D9SA 5INDA 4RMTA 3ZKNC 5HD8C 3NBNA 1DBAL 2OXHA 1CWVA 3VGFA 5GS1B 1YMHB 3OTTA 3G6JB 3MUJA 4O02H 4PRHB 1KNOA 4ZTOH 2I60L 3C09C 2BY2A 1F6AA 2GTZA 3C5ZD 2PF6A 2B8OT 3O2WL 4XH2B 4YHOL 3HUJE 4POZD 5GS2D 4TSCH 1I85A 1MJ8L 1OD7A 5FM5M 5EC1B 5D8JL 2OSLA 2XQBL 2X4TB 2W07A 5F1KC 1CXFA 4WJ5B 4HUKB 1M7IB 3ARQA 3N1MC 2D7TL 5ICXA 3RX5A 4GW4B 5HHPA 4XBEL 1RUAH 2VERN 4WO4A 3U0PA 2XT1B 4GLRI 2ZUQB 1U8LB 4K07A 2H3NB 4JO4H 4QRPB 3BE1L 3GMPA 3BQUA 4LNRA 1H15A 1FNFA 1FZJB 3MLXL 2NX5E 3U9PH 1FNLA 3LQAC 1F3RB 2F53B 3VWJC 3CCHA 4PB9L 1LILA 4OZFG 4ETYA 2WZPD 3RWGB 3H9SA 3DI3B 4DOHE 4XCEA 4JCLA 1S9YB 2GCYB 4H1LG 4JRWA 4M02A 3O2WH 4YHOH 3VRLE 2X4UB 1QNZH 2D0HA 1FP5A 1MJ8H 3HI5H 4MA1B 4QT5B 1E28B 2BHYA 3QNZA 2F8OA 2Q20A 5E6YA 2XQBH 3DO7B 1T2QH 4LSDA 4OI9A 4HZLB 2CIIA 1KIPB 4XBEH 1B4JL 3QB7C 4X98B 4L4VA 2YD8A 3O6FD 1U3HA 4PY8I 3D85A 3GHBH 3WO4C 4K3JL 1IT9L 4ELKA 3ZE0E 5IR1B 4G6FD 2WQ8A 3EO0B 3MLXH 3SDDC 4UIMA 2BOCA 3VXRB 4HWZA 4PREB 3C6LA 4YBLB 4PB9H 3L3DA 4N9OB 6FABL 1F4WL 4HKZA 1FO0L 2VABA 4JFOB 2UZIL 3SDCC 3Q5TA 3VXQB 4LGRB 2A0LC 2ZUVA 4WWKD 3JWOL 1FL6B 1G6RH 3VXMB 5JXAL 4JY4B 2FWOB 4PR5A 2Z0BA 1MWAL 4RQQB 1BQHA 3I75A 4G9FB 4WDIA 1CFVL 3EKCA 5E2UL 3JV4B 1U3YA 4NOFA 1B4JH 4X9BA 2XWJB 2KQNA 5DVOA 4E5XB 5IOPA 4BFBD 4K3JH 3SOBH 5IV2A 4LPVA 4YHIB 4V1DE 1W8OA 5DJCB 5HYQA 2WWMD 3CXDH 5KVDL 5LGKA 1HILB 5J1TC 3HUJF 3QIUD 2VLRD 1F4WH 4NNXB 2UZIH 5BS0A 2LTQC 3FHQA 1HWGB 3QXVA 1CICB 1A3LH 4KUCF 4GMTL 4DUVA 1X5GA 2DRUA 5H37G 1OWRM 1VHPA 5GRUL 5K9KA 5CIPB 3SEPA 3RDTD 4YBHA 1QLFB 5E5RB 2X09A 5EUKB 4EBQH 1AXIB 4KI5C 1CFVH 2VJXA 3DWTA 1VACB 3RNKA 3CPLB 2FSEA 1LDSA 3GMQB 1NDGB 1IM9D 3A0OA 4MD5A 4UOW0 3ZHLA 1IKNC 1A6AA 1EEQA 2VH5L 3OKNA 5IFHL 1J8KA 1P7HL 5DK2B 3IGAA 3L7FA 5HGAA 4HIEA 4P4KC 4PGCB 3BISA 2IEPA 4IIQA 4HW6A 4CMHB 2B39A 1OP3H 1XF3A 5KVDH 4M62L 4TNVF 3VRLF 2CD0A 1EERB 2EEAA 3GSUA 3EFFA 4UTAH 4DKDC 3DTXA 3NMEA 1YEKL 2EDEA 5E99H 2OS7A 1I8LC 3O3DA 1WBXB 3F5WB 4N0UB 3X3FL 3WDIA 1LO5A 2NXYC 4GMTH 3VGDA 5KSAC 3DROA 4NO3B 2Y36L 5F7FA 1KB9K 1AFVL 3TNNA 1BLNA 3BP7A 1DUYB 5JHLL 4HUNB 3EYOA 4Z7WE 3MBEA 3L3OA 1NCCL 4WI8A 4LAQL 3UTQB 3ZE0F 3K2UL 3VG9C 1CXEA 1KXTB 1JMZA 2GSIA 2VH5H 5FXCH 3T4YB 5IFHH 3EDEA 5JW5A 4LCIL 4YHKL 4DW2L 3T65A 5JDSA 3PWPB 5I76B 2C7UA 4OZ4B 2B0SL 5D7LA 5ADOL 5CD5C 1R24B 5D1QC 4PG2C 4LSSL 3UTZB 4LRNL 1FZOA 4GRLB 4PJDE 4P59L 3UJJL 1P5UA 1MCRA 3WFHB 3VFGH 4XNQA 3ARZA 2DQFA 4MB5A 3X3FH 1CFTB 2BNQE 5TJWK 3MUY1 1JNLH 4YIQB 4J3UA 4KROC 2X7LB 2W59A 5H35B 4Q2ZA 4NDMB 1NCCH 3HR6A 3V7AG 5A16A 2AI0L 2Z35B 1DE4A 1A1OA 4LAQH 3D9AL 2NY6C 3K2UH 1RJCA 4HXBL 4D0DB 3AAZB 5J11C 3QIBB 5GIRB 4BA8A 1S9XB 4LCIH 1TENA 3P0GB 4DW2H 2VKXA 4L8SC 1XGTB 3IB4A 5KZCD 5IP4A 1UT9A 1OQXA 1N6VA 4JGJA 3MV8D 4K3GA 1YDPB 2GK2A 4XPBL 4JFDD 1ETZB 3I3EA 4LRNH 3QH3B 1O7SA 2CGRH 4Z7VE 1IVLA 4WI6A 3NA9L 3IDNB 3O4LB 4HV8A 4ENED 3CFEA 5DJ6B 2QSQA 5HYSA 5TDPB 5IKCB 4X7DC 3ARDD 4YDVA 3CDFA 4JFXA 4PLOB 4XMKL 2YXMA 3V6FB 4E42B 4MQXD 4LPCA 5EU4A 4U2YA 2AI0H 1YYLL 3P4OA 3GIVA 3UTSD 2GJ6E 2R1WA 2IANA 4UAOC 4HXBH 2A9MH 1LP9A 2IG2L 5FOBB 4XAKD 3S96A 1BECA 4K94L 4LF3B 1R5IA 1H5BA 4HEPG 3BEWA 4YHZL 3OKYA 3GDBA 5EPMB 4N1EA 2WBJB 1KTRL 4UILL 4HH9B 4K8RC 4LKXA 1GXEA 4OGAC 1FAKT 2H41A 2CUMA 4RWYH 5D7KD 5FECA 1A3QA 2UZXB 1S78D 3NA9H 4Y19D 5IK3A 3OF6D 5CBEB 1JZ8A 4Y4KD 5AYUL 2FZ3B 1U58A 3IDXL 1G9NL 3QUZD 1B0GB 2Z31D 3OKEA 4JO1L 4XMKH 3C60B 3SO5A 1YYLH 1DQJB 1EZVX 4LPYA 4IS6B 2IG2H 3RZCD 2QBWA 3BPNB 2GK0A 4G8EB 4H0GA 3GSNB 3UXFA 4K94H 1JTOA 3L3IA 1JGLL 3L3KB 3HC4L 3EOAA 1FNSL 4YHZH 1QBLH 1S7WB 3U30B 5MHSE 5HGDA 4H8WL 1N6QL 3THML 1AJ7L 1EGJL 4Q9RL 1A22B 4P4RB 4KFZC 4WU5B 3IDGA 3S36L 3STZB 2JCCA 2JJUA 2D31B 5AYUH 1DLHB 5CWSB 4ZO9A 4UNUA 4X9HA 4JY6B 3PIQB 1MCQA 2YUVA 4OLVH 5I8KH 1VERA 3KLAB 4PJ5E 4NSKB 3O9WC 3NCMA 2KQMA 1J1OH 3MO1B 4ZSOB 3L3JB 2V5TA 3KHQA 2FH6A 4MDJB 5I1AB 2A74A 3HE7D 5SV3A 4QY8A 5ITBL 5L2KD 4MB3A 4MJ6B 2J8UA 5B8CC 2ZG2A 4H8WH 5F9OL 1WAAE 3THMH 4MJ5B 4FFVC 4Q9RH 1UVQA 1JN6A 4PG9A 1E4XI 3BEVB 2IBBA 3H0TA 4NZTH 4MNHA 5BCAA 1IBGL 5EBMB 3RVWD 4OQTA 3IS1X 3UC0H 2O61A 1LHZA 4F3FA 3TT1H 3O8XC 3DRTA 1UGNA 1RVFL 3FB8A 1BEYL 3BKML 2LAAA 2BY3A 1XR9A 4PRPA 1H0DA 5DQDH 4XVJL 2ZNWA 3I6LE 1RIHH 3QAZC 5B21A 3ZHDA 3JVGC 4GKZA 5J13C 4Z7UA 3GMOB 4Y4FC 1I3GH 2AGJH 5DRXB 1XIWB 5HHOD 3IXTB 2XFXA 3TN0A 3VDBA 5HGGS 4S0TD 1NGPL 1HNFA 3I9GH 2FIKB 3SY0B 4PY7B 4LCWD 1T0MA 1UWGL 1FYTB 1TZGH 2HWZL 3WL9B 2IPKA 4RFEA 3U4EA 3VXSD 1XGUB 4D0BA 4MB4A 1P2CA 2A6JB 4XCCH 1ZSDA 3F58L 1KELL 3HTLX 2BNRE 3BSZH 4BSWB 5CIPH 1SEBA 2EIDA 4Z78A 2PO6A 4GOSA 1ZEAL 1CD9B 2BVOA 1ACZA 4C54A 4FQHB 2Q76B 1WJ3A 5C09D 3IJYB 4NQCA 4P46D 5FYKD 2W9LA 4GG6E 4YHMH 1CDBA 3FQRA 3V7AE 4YHNB 5I0ZA 4LHUA 3MROB 3D2UD 4H5SA 4OZIF 1DQDL 1MRFH 5I75C 1EUUA 1XF2B 5BOPA 1QHOA 4RDQF 1BOGB 1U91B 5IFJA 2Z4QB 2HWZH 5I8CB 3O41B 3KPLA 4R4BB 1KPVB 2QQQA 4P5TC 2BVTA 4R7DA 1BBJA 3DO3A 4WY7H 3F58H 4XRCB 5SWSD 2R0WL 2Y07L 1MNUL 3CFBB 4U3XA 3N1QC 35C8L 5ISZB 4NT6A 4PRIA 1ZEAH 4OLZH 1MFAL 4UT6L 3S37X 2MNUA 1KTDA 1F4YL 2IQAB 3UYPA 5J8OA 3WJJC 2VKWA 1WAAF 4IRSC 3MRRB 4PJ8D 5EOTA 1EAPA 3T0VA 3VW3H 3TC9A 2HT4D 1BJ8A 3DGGA 3CUPB 2BVPB 4YGVA 4Q6IC 2G60H 4JPWL 2ZCKL 3Q3GB 5D2NA 1ZA3A 3BRFA 1ZGLB 4I5BB 1U3ZA 3V0WL 2A6DB 3IRZA 1M1SA 4X9GA 2ZSWA 4CDGC 4JKPL 1KOAA 2FCBA 2VO5A 5MEQB 5TDOB 3GSVA 5D71L 1MREL 5FUZH 2R0WH 2JK5A 1ZLUH 3AB0B 5T1KB 3VD7A 3HG1A 3VD3A 3H42H 1J8HA 1MFAH 4UT6H 1N5YL 3R06A 4K3DH 3U0TA 5FB8B 3PQYE 2ZPKL 2ZWLT 1PKQE 4XZUB 5IGXH 1FIEA 1CLZH 1IGYA 3D0LB 4HAFA 5FF6B 1IM3A 4JRXD 3KYKH 3F7VB 2B4CH 4OFYD 3WFDL 5KAQF 4Q58C 1QFWH 4UQ2B 1LEGB 1MFNA 4U1HB 2ZCKH 4YBQD 1YPZF 1MLCB 3VWJD 3V0WH 2BMKB 3CNKA 3U0WH 4JKPH 3P77A 1UM5L 2BCKA 3ARBC 4OT1L 3N1PC 4EVNB 3W11D 1MREH 4LFHG 5D93B 2BNUA 1TQBC 2B1HL 4OZHA 4WI9A 3PGDB 3PJSA 4Y2DB 3LHPL 1KBGH 1KFAL 3DXAA 5TQ0H 2AJYL 1N5YH 4ONGH 4FFYL 3ULSA 3AMKA 2RB8A 4LLVB 2H8PA 3B3IA 3DX6A 2CLZA 5K9OB 3DJ9A 3KPRA 4KMTL 2IMNA 3RKDC 3TBVB 4WUUD 4RMSA 3W2DL 1EH9A 4AEIL 5AAMA 3SGDI 3MLWL 4TTGA 4LEOA 2KUTA 3SDDD 1JNHA 3ABZA 2EDOA 4KRPD 2VAJA 3HC3H 4QRRB 1WZ1L 1JUFB 1OAUL 4JZJC 4PJXE 3HMXH 3W0WE 2B1AL 3C08H 1UJ3A 1JZ7A 3ULUD 3BGFB 1RSFA 3O2DH 1CG9A 1C5CH 5I1EL 2A0LD 1S5HA 3B9VA 1WGOA 4HSQA 1BAFL 1BM3H 4FN0A 3O3EA 1MF2L 4G8IA 1WTLA 4ZPTA 1T7VA 1CQYA 3LHPH 1S5IL 5HTSA 5BMFL 2NTSP 1KFAH 5FYJH 1OGAD 3KPOB 2DF3A 5ACZB 1YYML 2BSRB 4FFYH 2J88H 3QNXA 4KMLB 1QPXA 2W60A 5M94B 4X83A 3GSNH 1WSST 4KMTH 3MGTB 4GLRH 1KULA 5DYOB 3W2DH 3V0VA 4AEIH 5I1CL 2VL4A 3T2QA 2OJEB 3S5LG 5JXEC 2CQVA 3MYZA 3IU3A 1WT5C 4LSQL 1OSZA 4NQEA 5E5MB 4P3DA 4WI5A 1WZ1H 3BKYL 3RX8A 4RMUA 2B1AH 3GK8L 4K2UH 4K71C 2WV3A 1BPVA 3LV3B 4ONHA 4OZGA 5DJ2A 1TPXC 2F15A 4RX4D 4BSVA 1ZHBB 2I9LB 4HBCL 1AC0A 1YEGL 2NY2D 3L3GB 4TSAL 1S5IH 5BMFH 5IROA 5C0AA 4BYHA 2G5RA 5GGRA 1QSFE 5D7JD 4KI5D 5IWLA 2G75B 1NGYB 1CCZA 1T83C 5C0RH 4G8GD 1JYVA 3V5HB 4JHBA 2BSSB 5HI3C 2FX8L 4XNZC 4P4KD 1QSVA 4LSVH 4RAUB 3C2AL 1XMWA 1GOFA 2APBA 2IAMC 1FNAA 3BKYH 3JBG7 5EBGA 4GBXB 2YC1B 4OCMC 3DX7A 2ERJB 5FYLH 3STLA 2UVFA 3GK8H 3BP6A 3IDYB 1A6UH 1JP5A 2DIBA 3P73B 2A6IA 3DV6B 1LO0H 3FJTA 5C0EB 2NXYD 5KSAD 3O3AA 2FX7H 5DUPL 4PJAB 1P7QA 1EIBA 1DSFH 2Y1VA 5ITFA 5HHNB 3HE6D 1VADB 1FVCA 2NXZB 5SWZB 4XCYA 4JG1L 4F7MA 4G9DA 5C92A 5ICZB 3MRJB 2CK0L 4NP4L 5EO0A 4PP1C 5CD3A 2VDQL 3E6HA 4FMFA 1A6TB 5C08A 4CMMB 5CD5D 4JPIB 1EHAA 2W9EL 1IGTA 1KG0B 2V9RA 3PXHA 4NO0A 4P2CG 5GGUB 3ZYOA 1GHFL 4XI5D 2DJ4A 1NCDH 2PTVA 5EN2B 5AZEL 25C8L 4M8VA 5C2UB 1HSAB 5JIPA 5LBSL 3H3BC 1A64A 3WJLC 4HIXH 4KROD 1JZ4A 3DUHA 3MFGB 1LVEA 1IQWL 1T1YA 4NKMB 3HZYB 1D5IL 2P5EB 2QSTA 3V7MA 4HIIB 4BFIA 3RVUC 5EO1A 4NQDD 4QRTA 3I6KB 4JDVA 2CK0H 2UYLA 1YPZB 1FO0A 4NP4H 2AQ1A 3KPSB 4LVOC 3FT3A 1KLUA 2YPLA 4KQ4L 5E9DE 2J7LA 1CE6A 2W9EH 5FEBA 3MRIB 5E1HB 3RGVC 1YEDB 4AL8H 5LXGH 1GHFH 4PJGB 1UWEL 3AREB 3T77A 1NEZA 25C8H 3TO2A 5D4QA 3RVTD 3TH2T 2W0KA 1YY8B 5LBSH 1J0IA 5B38G 2IALA 2IPTL 5GRWA 1IQWH 5TGBB 1VFAB 3D3VE 3U7WL 4HXAL 3RIFF 4I3GA 5ENWA 1D5IH 3S36X 2FECL 1Q38A 4GG8A 4HUXB 3QDME 4C56A 4RAVA 1XF4A 3QJHB 4X6CA 3IU4H 3TLRA 4I2XE 3PWVB 3QDJA 2DQJL 2CMRL 4L4TA 4KQ4H 1OF2A 3ULVC 1H3PL 4RBPH 1EEZA 3UX9B 5E08L 4K8RD 2PCPA 1G7MA 4ZNEA 1BD2D 4OGAD 1JGDB 3TZVA 5JPNB 5CCKL 5A2FA 2VUYA 2AK4B 5I18L 1KB5B 2X89A 3BZEA 4BELD 1G7QA 4AM0B 1KXVC 1NCBL 4MNGE 4OF5A 2WBKA 4NQVA 3OKKA 4JY5L 4NGHH 3EYSL 1Y6NR 3EOYG 4PJIB 1X44A 4X7TA 4DK6A 3MRLB 1EXUB 2P5WA 2XTJE 2DBLH 1PX3A 3G5VB 4NUJA 1KCVL 3KYNA 3EYFA 1XGRA 3VFWA 1KCUL 2XTJC 4OV5A 4RFOH 4N0YH 1EFXD 3RWIB 1ZT7B 2DQIH 3C5ZB 3WNPA 3ZO0A 3VFTA 5JIIA 4DN4H 5AG9A 4IRJC 1I7TA 4KI1A 1SYSB 2PTUA 2EDYA 4HAGA 3W9EA 4ZO8A 5JW4R 1NBYB 3QFDB 4BFGA 4YO0A 3MOBH 3F7PC 3E6FB 1L7TL 2P43B 3QUXA 3UEZA 2I07B 2Q7NA 4AEHL 2E9JA 1QO3B 2YPKA 2XTLA 5ADPL 1G9MC 1RUML 5EO9A 2J6EL 4XPTL 5FKAA 1MCPH 1V5JA 2JJWA 4RGNE 1XZ0A 3AGVA 3DI2B 3KR3H 4NC1C 1M05A 4CVZB 1QPPA 3PV6B 2OTUA 4GW5A 3Q1SL 3REVA 1D6EB 5C1MB 1NJ9B 1DDHA 3TBTB 3L3HA 4HCRH 3O3UN 1KCUH 1V8HA 4JFEE 4Z0BL 4BJLA 2GKIA 3SJVD 4QOKA 5IB3B 1NLDH 1RIUH 3R1GL 2VE6B 1LO4H 2NW3B 4FFVD 1NGWB 4PRBA 1OT2A 3FOLA 4QXTB 1JV5A 3B9KC 1JHKL 3VMPA 3MRNB 3U7YL 2P8MB 4AEHH 1AD9B 4RZCA 1RUMH 1OPGL 5DJAA 4XPTH 1FZKA 1GRWA 4R4NC 3BUTA 2DQGL 3UYOD 2Z91A 4G6FB 1AI1L 3Q1SH 4UTBH 2IADB 1QA9B 5GS1A 3VWKD 3LIZH 4XNUL 4JO3L 4WHYG 1CE1L 2OQJB 4Z0BH 4IMKA 3FHAA 4X8JB 2VXSH 4WWKB 4LIQL 4M48L 1NANI 3MNWB 3DVIA 3QXWA 3PP4H 1W0VB 3SCMC 1EK3A 5EC1A 1E4XL 2X4TA 4J4PA 1M7IA 1Q0XH 1FIGL 1QR1B 2XKSA 4GW4A 5CHNB 1U8JB 1OPGH 3CH8A 2YHGA 4NUGL 1HNGA 1U8LA 2XN9A 4OF0A 5DJDB 2H3NA 2QQNL 4S1DC 5J57B 1FZJA 3HPJB 1PY9A 2WIIA 4LMQE 4J23A 3MLTA 2KKQA 3WFCH 3WN5C 2F53A 3K8LA 3ILQD 2BJML 4YXKH 1ZTXH 4R6UA 3MRCB 3HR5B 4MAYC 3QIUB 5E1AA 2VLRB 3FO9B 4FXGB 4JO3H 4BM7A 4FFWC 1PW3A 3RWGA 1CE1H 5EC2B 1S9YA 2GCYA 1OWWA 4LIQH 1QQDB 3X3GL 3OAYK 3QCVH 4JFQA 3GO1L 2ID5A 4QT5A 3V4UH 1ZGLP 2VR4A 5D1ZC 3RWCB 4OCNC 1E4XH 4X6EB 3RDTB 5FGCB 4Y4HD 3DO7A 1HQ4B 1V05A 1AD0B 2YMXL 1MH5B 4HZLA 4KDVA 3SKJL 1IM9B 4NUGH 1DN0B 3CX5J 5E6IC 3Q5OA 1ZMYA 5IR1A 3KVQA 3EO0A 1U93B 1TVBB 5DHXB 2PYEA 3VXRA 4PREA 4U2ZA 3PHQB 2BJMH 2ZCLH 2WSKA 1CVRA 3MACL 3RL1B 3T4AB 5BJTB 4IRSD 3DYPA 5KOMC 1DFBL 3EGSB 3VXQA 3BKJL 1JYXA 5FYKU 1YNTB 1FL6A 1T0NB 3VXMA 3VRIB 3X3GH 2WWKO 5EORH 4JY4A 2FWOA 2Q7YB 3BPCB 3UJIL 2Z92A 5F88A 3O6KL 3CGTA 5F8RC 4RQQA 3RY6C 4NPYB 5FKPB 2YMXH 5HPOA 1G7HB 2P8PB 3JV4A 4R26L 5I8EB 5FDYA 5C0CE 1P4IL 1KIQB 5FHAH 2XWJA 3HA0A 4E5XA 5TF0A 1U41A 1SBSL 2AQ3A 4LOUD 5DD1L 4YHIA 5D6DC 5DZLA 3QO1A 3QEQB 1KGCE 3I6GB 5EIQA 5F9JB 1F42A 5C0BD 1S3KL 3S88H 5BO1L 4NNXA 1LEIA 1MLBB 1RZKH 1JNJA 1KJ2L 1IC4H 3BKJH 4CVWA 3SGKA 4IDLA 3VXTA 1RAMA 1PDKA 3H7BA 3OJDB 3GMRA 1I1AA 4EIZC 5DFVC 2ED9A 3O6KH 1HYRC 5CIPA 4M3JA 1QLFA 5EUKA 3DVGB 2OJZL 3MRBA 4XP5L 4CU8A 4K55A 3GRWL 3GMQA 1NDGA 1IC1A 4O2FB 4OCXL 3KYMA 2X41A 1QSZA 4JPKH 3SBWA 4EKXA 5DK2A 4TUOA 3O81A 4PGCA 5E2VL 4MA8H 5GGRY 5KZCB 2CIKB 4ZUUB 2A2QT 5E8PA 3RQ3A 3MV8B 3I3DA 3QQ4B 1S3KH 4JFDB 3B4NA 1KYOJ 4HLZH 2ZCHL 1WBXA 1FAIL 3VFSA 2OR9L 3SO3C 1HI6B 4NO3A 4MHHG 4Y1AD 3MRDB 1V7NL 2PR4L 1J88A 1T1WA 3GJFK 1DUYA 4U1JB 2HVKA 4KKBC 5LJYH 1EO8L 3HZMB 4F7CA 4IEFB 3CDGB 1KB5H 3DMMD 4U6HB 3UTQA 3UTSB 3GRWH 3UAJD 4U1LA 3OKLB 5CKGA 4KJYB 2X1WL 3AS2A 5CGMA 2VSCA 1I1RA 4JHWL 4KDTC 5CJOH 2VMFA 1TJHL 1GCFA 3PWPA 4AENB 3OGOE 5I76A 1YZZA 3VJ6B 3S37H 1DBBL 1R24A 5T3ZH 1Q94B 3FQXB 2UVEA 4UQ3B 4KK9C 3UTZA 1CGXA 1VFBB 2W0LA 2MQ0A 4M3KB 2ZCHH 3T2OA 3WFHA 1FAIH 4AH2B 2OR9H 5JXED 4Y19B 5DR5L 1V7NH 2PR4H 4Y4KB 4YIQA 3TO4C 3TA3B 1MFDL 5GS2H 3PDGA 1HK6A 4LLYB 2R0ZL 5H35A 2Z31B 3VFMA 1CL7I 5ACLA 2Z35A 5F8QC 1CF8L 4IMLB 2Z8WC 1XF5A 4D0DA 4KK8D 4JREC 3ZKXC 3RZCB 1RHFA 1P9MA 3LQZB 3WYRA 2WAHA 15C8L 2DS4A 3QIBA 4ZDHB 5GIRA 3N1GC 4NBZB 1XGTA 4JHWH 1JPSL 3FFCD 2C3VB 4E0RB 4ODUB 1DBBH 1UM6L 2P42B 1ETZA 4RMQA 1FFPA 5EU6D 3CVHL 4MLIA 3OB8A 3LN9A 1D9KA 5HI3D 3SQOH 1B4RA 2AS5M 3SGDH 3RVVC 2B5IB 4ONOA 4WFHE 5TDPA 4GS7B 1OAQH 4PJ9C 3VFVA 2BFVL 2DICA 2IAMD 4IJ3B 4E42A 3V6FA 4I4WA 3QEUB 1CVSC 1QBMH 4EI6B 5JMRA 4U1GC 2VN4A 5FOBA 1CTNA 4LSTL 3HE7B 2JELH 1JPSH 3B9AA 5EPMA 5L2KB 2VC2L 4LPTA 4HH9A 1UM6H 1OAKL 2LAGB 5D72H 1MY5A 1PLGL 1E4WL 2NZIA 2DKUA 4NCC2 5JA9A 4MJID 3O2DA 4OCRL 2FZ3A 3SGEI 5FUCE 5K9JL 5JOPE 3QEGL 3LDBB 3L95B 1B0GA 1IC5H 2D9QB 3ULUF 2WUCH 1DQJA 1NPUA 3IFPB 5FUCC 4IS6A 2D4DA 2FJFA 1ZKAA 4KQ3H 1YJDL 3GSNA 5FO9A 2Y23A 4PRAB 3B8YA 1KJMB 2F5AL 3L3KA 4NJ9L 3HUJA 5DRWB 2AEIT 4PTTA 2QADC 3N0PB 1S7WA 5DD6B 2ZZUT 5JIKA 4KJWD 1NFDE 5HHOB 4FTVD 5I73C 5J6HB 4KKCC 5K9QI 1ORSA 3I50L 3QHZH 1JMXA 1OAKH 4LCWB 1UB6B 4MD0B 4X80L 1D5MB 4P4RA 4F9LC 1E4WH 1YEIL 4GAJH 3RPIB 3QYCA 4WU5A 5T33L 3QJFB 1A14H 2D31A 4JEGB 3VXSB 3ISWA 4P9HH 1DLHA 5DMJB 5CWSA 4IOFD 4XNXH 5K9JH 3LPGA 3QEGH 3PIQA 3AS3A 4JFFE 3NIGE 3F12B 3KLAA 4QRUA 3RGVD 1JI1A 5F6IC 4LEXL 2DLFL 3MO1A 4ZSOA 1O7VA 1SY6L 3LEVH 1OTSC 5C09B 2A73B 3KYOB 4KKAC 4MDJA 2D9CA 4P46B 1OM3L 4Z77B 1UENA 3WFZA 2F5AH 2FD6L 4P23C 3HNSH 4NJ9H 1AGFB 2AABL 5HGBA 3NPZB 4GSDL 3SGJA 2LU4A 4FQLH 4LVHB 3CLEL 2UV3A 1R0AH 4YPGA 3MR9B 4MJ5A 4PYGA 4PBWD 4U1IB 3BEVA 5T33H 1NUNB 5EBMA 2NY5C 2FLRT 3OG6B 4Y5XC 1S7UB 4R9HA 3ULVD 1FORL 5SWSB 4ZXBC 1I7UB 2WLZA 4AEFA 3UPAA 3LRSB 4YFEA 2K7QA 3ARSA 4RA0C 1SY6H 1MCIA 1K8IA 1MI5D 5HI5D 4CJ1A 2ITCB 2ESVE 5HYJB 1EJ6A 1XIWA 4PJ8B 3MUHL 4TRPH 2ILLA 4NCDA 4PY7A 2XZCL 1ZVSB 1RULH 4TSBL 4Z5RB 3GI9L 1FYTA 1RIVL 1B9ZA 3WL9A 1L6ZA 5CEZD 3AM8C 4UI2A 1XGUA 3NPSC 3C09B 1JZ6A 5EOQH 2O5XH 1PZ5B 4V1DA 1FORH 3UDWA 5A43C 3T0ED 2FIRT 2BX5A 5HVWA 2YD4A 3RWFB 4A6YB 5HHMD 5KS9E 3SE4C 4FQHA 4MCZB 3BVNA 4UINL 4HULB 2Q76A 3RUGE 1FNGB 4HPYH 1J1XH 3ZT5A 3ARFC 5D2LF 3HRZB 3MROA 4QCIB 4Y5VC 3QCTL 2F54A 2V17L 1PFCA 5IQ7L 1J9CT 3MA9L 4JRXB 4LPWA 2XZCH 4AQ1B 2AK1L 2X1QA 3T09A 4TSBH 3DETC 2QTEA 4KJPD 1U91A 3TNMB 2Z4QA 1W2KT 1JHLL 2E9WA 3O41A 4R4BA 3VWJB 3NIGF 1MCDA 2HT3C 3U4BL 2YRLA 4LDLB 5T3XH 1FLTX 1WZKA 2Q86B 2EIBA 1CXHA 2Z8VC 2ATKB 3KLDA 4WI2A 5ISZA 3ARRA 3SDAD 1F8TH 3FFDB 1S7SB 5GSRB 3RFZC 3B9KD 4JG0L 3VH8B 2GTWB 2IQAA 1G0YR 1UH4A 1TNMA 1RUPL 2I5YH 4GFTB 4U05A 4QNPE 5JPMB 5T1LD 4R4ND 3QCTH 3G5XA 4WUUB 4LLUB 2V17H 3EUUA 5IQ7H 1WWAX 3WO4B 1K3IA 2AK1H 1D5ZA 3V52L 4UU9A 3SDDB 3RZWA 4G80A 3IRPX 4X5XB 1J18A 5IHZB 1I85C 3LZFL 1T4KB 4I5BA 5CSZA 2WWKT 2A6DA 2Y5EA 5MEQA 3N85H 5TDOA 1Z3GL 1QFHA 1TZHB 1AKJA 3EJYC 1RURH 5L6YH 1GC1C 2E7LA 3EJJX 4WEMB 4WO4C 1QEWB 1FVEA 3SCMD 1INQB 4NQXB 5HGHB 4TVPD 2CR3A 5HYSG 3FQUA 3DX9B 1J0YA 4P9ML 3S9DB 3IDJB 5BZDA 5E00A 3H9SE 4XZUA 1NH6A 5I1HL 3IKKA 1KT2A 5F9WC 3D0LA 1KTLA 1W72B 4S1DD 3F7VA 2VXUL 4RNRA 3V52H 3EJZC 4UQ2A 5DJ0B 3MXWH 1MLCA 3OB0K 1WEJH 3JUZA 1INDL 2BMKA 2HJLB 4FFWD 4L4VE 4DZBA 4EVNA 5DC0A 5IIEB 5KS9F 4Z7OF 1F2QA 3RUGF 4Y8AA 2NY2B 4Y2DA 5D1ZD 3MODH 4JFHE 1AIFB 2V9QA 4HJ0C 1B3JA 5T1MB 1B90A 4P9MH 5D7JB 5FV2A 3BJ91 4C59B 1FLRL 2FL5A 2YZ1A 3GMLB 4HBQA 5C0DB 4LCUA 5I1HH 1TXKA 3C6LC 1S7RB 4G8GB 3TBVA 2N1KA 1UM4H 4XWGL 4OGYH 5E6ID 3KXFA 3BN9D 3CFKB 4P4KB 5CEYB 4F9PA 1MHHB 5E95B 3D39D 4QRRA 1F97A 4P0DA 1JUFA 4N8PA 4D2NA 1S9KC 3S35X 2GSGA 1HH9A 4NN7C 4PRDB 1BJMA 2YUXA 4JJHA 2NXYB 5KSAB 5HHVL 3V2AR 2DQTL 2J6EA 5IB5B 1WWBX 5GS0C 4PFEA 4ZUSB 4J3SA 5LGHH 4BZ1L 4QNPF 3WFBL 4AIXA 3KPOA 4M1CC 1J87A 4BUGA 5ACZA 4K9EL 2BSRA 4WHDA 4G8FB 4XVUC 1FLRH 3X14B 3G6DH 4S1SL 3L1OL 5BS0E 3TYFB 5FYKL 3OJMB 3NFNB 5KTEH 2ITDB 4XWGH 4DVRH 3ZDXE 4Z7WB 4QHKJ 5T1DL 2OJEA 3FAXA 4LARL 1I1YB 4JPVH 3QCUH 1NKRA 2DKMA 5HPMB 5MEOB 2VB5A 5E5MA 1ERNA 5D1QB 4UIKL 3QUKB 3FRUB 4YC2C 3W9DA 4E41D 2I9LA 1NC2D 4OJFH 3WKNA 5HHVH 2QEJA 1EJOL 1AE6H 1GL4B 2DQTH 2FRGP 3QDAA 2EIEA 4BZ1H 1WIPA 4NN5C 4OZIA 4KROB 4YEFA 4K9EH 4KGLA 2G75A 1NGYA 3N06B 3T0BA 4KKLC 3MYJB 1PGRB 4S1SH 4IIQC 3CC5A 4MQ7B 4TUKH 3IDIB 4RCAA 2PTTB 3HLAA 1MIEL 3V5HA 2QR0B 5J11B 2D7QA 4NQDB 2BSSA 1NGZA 2FR4A 1MCCA 1I9RL 4LARH 4PJ5A 4RAUA 5TE7L 1LMKA 1FQ9C 2YC1A 2R4SL 1FNEB 4GAFB 3BW9A 4M7KH 3FT4B 5H94B 1F58L 2R56H 3DV6A 2APVA 3QDGD 5HJ3A 3ZZ1A 1IE5A 3MBEC 4EUPG 5C0EA 1J0HA 1EJOH 43CAB 1HKLL 4PJAA 5FDWB 5E94B 1I4FB 4KKBD 5D7LE 3CFCL 3UROR 3HAEA 4LLWB 4A6YL 4TUJB 5DSCB 1REIA 2QQLL 4UAOB 4YXHL 5SX4I 4HWBL 2JTDA 4URTB 4X4YB 4GW1B 4H1LB 2NY7L 3MRJA 3K4DA 2VITB 4NO5B 4NN6C 3MLRL 1A6TA 3GI8L 4KK5C 4YPJA 3KNBB 4CMMA 4JPIA 4PD4K 2X4NB 1P69B 4LPXA 1BD2B 1KG0A 4QHKI 4MA7H 5GGUA 4OBRA 1E6OH 5DD5H 1V7MH 1K8DA 3QNYB 4LSUL 2PXYD 5DJXB 4XPHL 5EN2A 1SJEA 1RJZA 4H88H 3VD9A 1HSAA 4WUKH 5IG7A 1G7IB 4ISVB 3CFCH 1C12B 3ZDXF 1QRKA 1NL0L 1RUKH 4A6YH 1PYWB 5D1XC 3ZDYF 2P5EA 5DGQA 4HIIA 4JHAH 5HDQH 1RZ7L 3HC0B 5SX5K 4YNYA 2NY7H 1YPZA 4ZNCD 1CN4A 5DJZB 1ONQB 3IFOA 4XP4L 3QWOB 1EFXB 3GI8H 1N2RA 1AR1C 3HN3A 1RJYB 4N90D 3C9NB 2A77L 3MRIA 2IANE 3B5TA 4F37K 5I30H 1F4XL 1YEDA 1LP9E 5HBBA 3ULUL 2G5BB 2E9IA 2KDGA 4WFFD 2PKDA 4OF6A 5IF0B 1FJ1B 4HGWB 3B6SB 4P99A 3HNTL 3U2SB 3SDYH 1NBQA 5TGBA 2DD8L 3VFUB 5DMKB 3UMTA 4OKVB 2V5MA 4IRZL 2DWDB 4IDJL 1F02I 4NQTA 4XVSH 4ZPVB 3QJHA 3V5KB 1W72L 2HAZA 1YNKH 1AQDB 3IS0X 2IBZY 1I9EA 1LD9B 3SJVB 2V2TB 1RZJC 2DAVA 4X6DF 4YH6A 4ZQKB 1C1EL 1S8DB 4N8VA 5B8CB 1JGDA 4M8QB 5HI4C 5D96C 5JPNA 2VTFA 4XPFH 5C0GA 1QFUL 2E5EA 4K3EH 3ULUH 4FFZH 4AM0A 3GRWA 3LS5L 2JB6B 5TPWL 3AC0A 1L6XA 3BWUC 1KN2L 3FTGB 1RD6A 4PJIA 1MQ8A 3IVKA 1CL7H 3FO0H 3OSKA 2QL1A 3MRLA 1EXUA 2I26N 1HEZA 3CIQA 5J9PB 1DBMH 1OAZL 4IRZH 2JCCE 3ZSTA 3G5VA 1HDMB 4IDJH 3QAZB 2BOBB 5J13B 1L9MA 3BO8B 4EOWL 1HSBB 1W72H 4XHQA 2LABA 2QADD 1MCWM 3RWIA 4RWHA 3C5ZA 4OGXL 3ARUA 4HQQL 3MJ8B 4KKCD 2Q8BL 1MHEB 4Q0XL 3IFNH 1RUQH 1GH7A 2EH7L 2VR9A 4YZFE 3A67L 2P4AB 3QFDA 1QFUH 3RWEA 2FDBP 2M8XA 4KXZI 2Z8RA 3E6FA 1TZIB 2YD2A 2I07A 2CXKA 3LS5H 5TPWH 2E7CA 5AWNL 1QO3A 4DK3A 3KJ4B 3QRGH 5JUEL 2W65B 1MJUH 2RIKA 4CBPA 2EYSB 2J8UE 4JM2C 2IFGA 3WIFB 4CVZA 2MPAL 1NCWL 1OAZH 4ODTL 3UO1H 1OTSD 3TBTA 1JRHI 3HZVB 3P2TA 3PWJB 4D9RE 4P23D 1R3LB 2O26U 2WMPA 1LP9F 4XX1G 5IB3A 2ICWJ 4WCYL 5CZVL 3HPLB 4OCLC 2VE6A 5FA4A 4FXKA 2Q8BH 1BFOA 2NMSA 1X4ZA 1U8NA 3DNKA 4PRHD 2NW3A 5GRJL 4PRPE 5EZIH 2ATPB 1OLZA 3MLVL 4Y4HB 4Z7UE 2P8MA 2XKUA 5FHBL 1P5VA 1GZPB 2ADIB 3BZFB 5AWNH 5B4MC 3SGEH 5JUEH 1AGDB 4P5KB 5E24E 2I27N 3O6FA 1KJ3H 2DQUH 3S98A 1PG7L 3FB7A 4ZOAA 1UB5A 4X6FA 3K2MC 2MPAH 3W5NA 1HWHB 1INEH 5CGYC 2HFEB 1KUMA 2IADA 2X6MA 1QA9A 2Y4SA 4U6YA 4QRPD 4RA3A 2BVQB 3CVHA 4WVRA 3UTPD 4IRSB 2OQJA 5IVZB 2FGZA 2AEQH 4PBVC 4WCYH 4X8JA 4WWKA 3P4LA 2VLLA 4WIQA 3WNNA 3MNWA 4Q6IB 2BHUA 1HXYB 1W0VA 5T5NF 4HG4K 5A2JH 1DBKH 1CLCA 4NQCE 4XBGB 1NGQL 2PO6C 5FHBH 4UT9H 4OD2B 1U8JA 3BXNA 1ZT1B 2ZSVB 3EOTH 3VXUD 4BH7B 2JCCF 3BPOC 4YE4L 2GJZB 2EKJA 1QVOA 1J1PH 1NSNL 4CVXB 8FABA 3PHOB 4G6KH 4M6NL 4P3CL 3ARFD 5C0BB 3MRCA 3ESVF 5BQ7A 3QIUA 1U95A 2VLRA 4FXGA 2Z9TA 4L3CB 4OB5H 1NMBL 5HHME 1YEEH 2XRAL 3QEHB 1JCKA 3PABB 5EC2A 1A7QH 2NY1C 1QQDA 4PRIE 3HI1B 1TJGH 2CUIA 3DETD 5EU7E 2VXVL 3Q6FB 4X6EA 3RDTA 1HQ4A 1NGQH 1A4KA 2ICWI 5I1GL 3MNZB 1MH5A 2EDJA 1AC6A 2R9HC 5B3JE 1DN0A 4FZEL 2EDFA 1TQBB 4G9FD 4ZFGL 4YE4H 1B6DA 2Q3AA 4YDJA 1X7QB 2KL6A 5CP7B 4NFBA 5ABDE 4GXVL 1TVBA 4KPHL 4P5MB 1NSNH 2D3VA 5D2NE 3MFFB 4X6DB 2DDQL 4M6NH 1RZGB 3T4AA 1VENA 4H1LH 4YHPB 3GHEH 1B2WH 2FJHA 3EGSA 4HS3B 1NMBH 2XRAH 4I48B 5D2NC 4OLYH 5MEND 3K81A 3Q6GH 3CK0L 1HH6B 3HG1E 3VRIA 1AO7D 3OL2A 5T5FL 1J8HE 4K8RH 2VXVH 5F7MC 1EHLL 3D18B 1CICD 4WW2F 3KPNB 4NPYA 4JZJB 5I1GH 2VDLL 4LHQB 2YN5A 2AXFB 1G7HA 2P8PA 2J5LC 1GOHA 2HJFA 4HWEL 4HS8L 1SY6A 3LKOA 5I8EA 1KIQA 2NTFB 4YR6B 3M8OH 1AY1L 5DURD 4PJXB 1PEWA 4TNVK 4ZFGH 1XR8A 4OD3H 5HDBF 5I9QB 2LV4A 4EI5C 4UV7L 3MJ7B 4GXVH 5K59E 5BXFA 2DJSA 3CFDB 1NEZG 2EXYC 1CD1B 5F9JA 3LEYL 3V6ZB 2FBJL 2C4FT 3AROA 3ARGC 3RIAF 1MLBA 4NRXB 1U6AL 1RHHA 3PGFL 1C8PA 3C5SA 1UZ8B 3CK0H 4OZHE 5AAWA 4G42B 2ADJB 1F3DH 3OJDA 4O51A 3DXAE 4HUVA 5DWUL 5D6CA 1T5WA 3QQ3A 2VDLH 2Y7QB 1MFCL 3DVGA 4MXVE 4K71B 4ZUVB 3KPRE 5KVMC 4HWEH 5IJKA 3RTQD 4O2FA 4XNYH 1BWMA 1TPXB 5E70A 4WFGD 5BVJB 1AY1H 3WXVL 4I3SH 4ELMF 1JZ5A 3P9MA 5GHWH 4UV7H 4QGTA 1V3LA 5C9KA 2G2RA 4J3VA 5L8JB 4ZUUA 2EXWD 1CDJA 1EZVY 3JWDC 4TYUA 5I1LB 5CJ8A 3DVFA 4JFDA 2FH8A 5H37H 3C6LD 5EU6B 1U6AH 3PGFH 1L7IL 1QSFB 4JB9H 5FO7B 1RJLA 4HUWB 1UJ3C 1HI6A 4XNZB 5F89B 3NZ8B 4LLMB 3MRDA 2APWA 5KANI 5CGTA 4GRLD 5B3JF 3ARDA 5J1AB 2IAMB 4M7JL 1SMOA 3CDGA 3BFOA 4U6HA 3WE6B 3L7EB 3UTSA 1T7ZA 3OKLA 3WXVH 5GS0D 3LEXB 1E4JA 1HCVA 4NQEE 4QHUA 4AENA 2F19L 1I8MB 3QIWC 1I7RA 2OZ4L 3VJ6A 1P84J 1Q94A 4HX1B 4OZGE 4P2QD 3IETB 4UQ3A 2MFNA 2XXMB 3OR6B 1VFBA 1FH5H 1L7IH 3QQ9C 4RGMC 3GMMA 3WHE1 4MJIB 1MCEA 4Y19A 1IGFH 3OF6A 3FL7A 3FB6B 3OAUL 4RAHA 4Y4KA 5F44A 5C0AE 2H9GB 3ILPB 5B39G 3PWUB 3QUZA 2Z31A 4NKDB 1A9EB 4B50A 5C6TL 4R7NB 5IROC 4HKBB 2WIMA 5K59F 1TETH 2R15A 4MAUL 2AV7B 3TIEA 3B8SA 3E0GA 3RZCA 2JKXA 1IEBB 3LQZA 5DLML 4PGJA 4ZDHA 5C86A 4YQXL 1OLLA 1L0XA 2P1YA 1CLYL 3HFMH 1KTKE 1MIML 4TNWF 4E41E 1MFEL 2C3VA 2F19H 1VFMA 3EYQC 1F2XK 2OZ4H 4KKLD 4GKSB 3GSWB 4LSRH 1KIRB 2EO9A 1PX4A 1IAMA 4HT1L