4ZUUB

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-cf9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
molecule keywords Classical MHC class I antigen
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuuB00
3F58H 4D3CL 1VADA 2I9LA 3JVGC 5IQ9B 4XVTL 2A0LC 2Z8VC 3EFDL 2BDNL 1MJUH 3VXPB 5BMFL 3I75A 1RZKH 1VCAA 4U0RC 2O93L 3EYFB 2BERA 4DZBA 1V7NL 5INCB 4IOFD 3SGDI 1I7UB 1I75A 5D2LE 1NCNA 4WTWA 3UBXA 1G9NC 5JW4R 4G8EB 3QAZC 4FG6C 3UJTL 4BQBA 4YHYB 2GYSA 4YHIA 2LVEA 3DYMA 4JQIL 3V0WH 2WNGA 4QHKI 5GSRB 1NMAH 5FDYA 5ADOL 4HH9B 2VLRB 4JRYE 5FKPB 5HYSB 3MV9E 1WBXA 2VXTH 4KK9C 3BAEL 5FYKE 3VXMB 3WJJC 4MXWL 1J7VR 4K8RD 2OBGA 1CGSL 1EXUA 5EORL 5CGYC 3L95B 1EERB 1DQLH 1WWWX 4Z7WA 2F5BL 5JNYA 3D39E 3NIGE 3T2NL 3UTPE 4ZUTB 3JWOL 2D0HA 3NCBB 4IRJB 3O2WL 2OJZL 3CU1A 4GS7C 5I1KL 1FLRH 1KYOK 4DTGL 4U1MB 4P9MH 4Y19E 3KLAB 5BVPH 4N0CD 3OJDB 4JFXA 4KROC 2V2WA 2VITA 3BIAX 1CN4A 1FCGA 4UQ2B 5D1ZA 3RY5A 1P5UA 2AW2A 5I1JH 1YN6A 4OV6F 1KPVA 4XRCA 1CQKA 2WANA 1NLBL 3FQNA 1YY8B 3HMWH 4JO2L 1UKSA 2ATKA 3DX9B 3OB0H 3GSQA 3G6JA 3VD3A 1AFVL 4QRRE 3WXVH 5BQ7B 3MR9A 2PW1A 1FORH 2JJWA 4R97C 2Q86A 5IBUB 2DN7A 4MA7L 1F02I 2FR4A 4A6YL 2G60L 5DMIL 2A6DA 1KEGH 4K3EL 1YA5A 3SDXE 2N7AA 4WFED 4Z7QF 4G9FB 1IEBB 2DQEH 3ARDD 4HPOH 4QRPE 3FFCB 5B3JE 3T1WA 3VFNB 3MRPB 4NZTL 4IDJH 4F33B 2YZ8A 4W6WB 3KPRA 4JZJC 3LHPL 4R97B 2VKXA 5C0AD 1VFAB 3OB0K 5TF0A 1KJ2L 5FYLE 1VKXA 4TRPH 3OKLB 1BFOA 3UX9B 3KYAA 1FYTE 3BGMA 5CIPH 4I3SL 4N0FA 5HVWA 1BQHA 1K85A 3EFFA 3SDXF 1YYMH 2YD8A 1GRWA 4JFFE 1A14H 4YX2H 3P77B 3AREA 2RR3A 1FNAA 4RSVA 1N5AB 3D0VA 4HBCH 3RL1B 3UEZA 1BX2A 1XGPA 3CSYA 1ZT4A 4X99A 3VWJD 1JK8B 3KPLA 4XWOD 3KAAA 5E6IA 2BC4A 4WFGD 4BK5A 3CLFL 4IHOA 4OKDA 3AXLB 3JV6B 3K74B 3EZJB 1MAKA 1ZKAA 3SQBA 3VXRD 5E2WL 3GJFA 3P0GB 5DD5L 2E6JA 1U3HD 1GGCL 3VFRB 3FCTB 1FAKT 1MOEA 3TJEH 1K4DB 4X6CF 1RJZA 2B0SH 2HRPL 4XPBL 3O11A 1MRCL 1MFCH 4GAFB 2X4TB 1B4JH 5HXMA 3MCKA 3HHRB 3FQUA 4UT6L 3TV3L 1Q38A 3RIFF 1NBQA 1JUFA 4F9LA 1F58L 1TZHA 4LLVA 4PP2B 3PABA 2EDFA 1A6TB 2Z31A 1URLA 1FDLH 5T33H 2Y25A 4WJ5B 4FFVC 4R2GB 3BW9B 5FF6A 3HUJF 1NAKL 5H94A 4JFDA 3U6RA 3CPLA 5DWUH 3QDME 4XAWL 1AR1D 2A9MH 4P4KD 5JOFB 4OLYH 1S3KL 3HG1E 1KJVB 4X6DB 4KV5F 2F8XC 2YK1L 2C4FT 3C8HA 3ZL4H 3BEWB 1F6AA 4Y16B 4DCQB 1G0XA 3U7AA 4I4WA 3D85B 3ROLB 1MIEH 3S96B 5E2UH 2MPAH 1PG7L 4Y4FD 3BWAA 5J9PA 2HH0L 2V7HB 5E5MB 4LSSL 2APWA 4HZAA 2BVEA 1QYGL 3HE7B 5DHYB 1XGTB 2VUOA 1BMGA 2DBJA 4Y16C 3QDHA 1N64H 3IF1A 5JR1L 4RMUA 3LKOB 3RHWF 5AD0A 1FNGA 4QXGL 1MSPA 2CRYA 4GG8A 3WUWG 3IRZA 4P2OC 3SGDH 3TC9A 1BBJB 2IGFL 3CU7A 5LGKA 4RGMB 3CUPA 2GY5A 1OY3B 4AIOA 3V79C 4HS6B 5T1MB 5BOPA 3MRFA 1MHEB 4TNWF 4CN6A 5EIIA 1U8IA 4NQVA 1KGCD 4M48H 4LCCC 1MFDH 3BKML 1FFOA 3O9WA 4N0YH 4QRPA 3S34L 1B0GA 4UTBL 5HYJA 1Z0MA 3NACL 4N90D 4WGWB 3GFUA 1JPGA 2VXVH 3L5WB 2BCKA 2EZ0D 2D7QA 3F6LA 2EO1A 4MNGB 4UBDC 2XOTA 4ZTPH 4YE4L 1TQBC 1NUDA 1X5XA 3SEPA 4OI7A 1NBVL 1MCCA 1T20B 1VENA 3PP4L 2XXCB 5DRZA 2J5LB 4S1SH 1BX2B 5T5FH 3OPZH 2ICCA 3QUMB 4F37K 3B6SA 3VFOA 3VI3F 3TM6A 1QNZL 2NY0D 4B7LA 4CUCA 1MIML 5DD6A 2D7OA 1YNKL 1ORQA 2QADB 2NZ9C 5DJ6B 1G1CA 5IT2H 5I9QC 4Z95H 3G5VB 1D9KC 5L2JA 3V5DA 1ES0B 4XCCL 3B83A 4G3YL 5FYJD 1N3NB 1EO8L 3KPRD 3U6RB 3HC0B 2CUIA 3SDYL 4ZUSA 3MRBA 5CEZE 3D2UD 1CD0A 2W0FA 5C07B 1ZSDB 1EZVY 1NC2B 2DMBA 5CGMA 4QHMB 4Q9CA 5E5UB 1J8HE 3CFJA 4WI7A 5IK3A 2H6PB 4PY8I 1S7RB 2Y72A 5D7LD 4KI5F 4F80A 4GMTH 2YMXH 5F7FA 3TBWA 3MRBB 1OTUD 1U8MB 1YPZB 2ZCHH 1T1XA 5FAAA 3EW3B 2BK8A 1EAPB 5L2JB 2XWBA 2FX8H 1FNFA 2IMNA 2FYYA 1A7NH 5HHQA 1JF1B 5DGQA 1Q9LB 1N4XL 3MJ9A 2EXWD 4JDZA 4X6BA 3PUCA 1QFUL 1ZANL 4JFPB 1EDQA 4EN3D 3H9HB 4FQXC 4MQTB 3SDCD 3S37H 1CI5A 5KAQG 2VITB 2CH8A 5JHDD 1OAQL 4NQDB 4NO3A 4D9RD 4XWGH 3GMMA 3TO4C 4PV9B 3ZTNL 5DDHA 1DUYB 1K5NB 4EDWL 4WHYH 2P42B 1TMCB 4OZIB 4PPTA 5FYLD 2FX9L 5BV7C 3SJVD 2BOCA 2GITB 5L7XH 3BPOB 4DGIL 1G84A 5DEGB 1GIGH 5D2LB 1SY6H 4LPYA 3BP6B 1I1CA 4M93C 3I50L 4NPYA 2NXZD 4MA3A 4O58L 4KTYA 5I1DB 5KW9H 4LCWE 5DUBA 4ALAH 2Z9TA 3CXDL 1MHEA 1RIHH 1KUMA 1C12B 2DLFH 5KVEL 3MBXL 3EOBA 2P5ED 2X4SB 5LVEA 5ABDE 2QADD 3OAUH 4NNXA 5HI5C 2CMRL 4RAUA 1I7UA 3I2CL 3P4MA 1XF5B 5L8LB 3LD8B 2ZG2A 1J86A 1C5CH 1MWAB 4YFDB 2AJZB 1M71A 5C0EA 43CAA 4JO1L 5E2TH 4PJGA 3HPJA 5DQ9B 1HYSC 3U0PA 4AL8L 3IFPB 1KLFA 5E2VH 4ONFH 3DGGA 1Z9OA 3LB6C 5I8OL 3RFZC 1VADB 3EOTL 1XR8A 2NZ9D 1T1YA 3NZ8B 3O6LH 2FX7H 3S96A 4Y19B 4RNRB 5MERA 3OJVC 2EDYA 4G43A 4LPCA 2HT4D 1XF2A 2NY0C 2XWTA 2XTJE 1YEJL 4JREB 2IJ0C 4PJDE 4WUKL 1L6XA 2A1WH 4M8QB 1AQKL 3PP3H 5IB4B 3BP5B 3U83A 1KB5H 1YEDB 4WFFE 2WWKO 3UTTB 1A3RL 1D5ZB 3P4OB 3FAWA 1AIFA 5T3ZL 1EO7A 3O6FD 3NAAH 4S0TD 1JFQL 4JN1H 3MOAH 5HDQH 1MF2H 1UYWH 1WT5C 3I84A 4EBQL 5L9DH 2WUCH 2VQ1A 1YC8A 5IROA 4XVTH 1K6QL 5FUOL 3WNPA 3WFBL 4PG9B 1J87A 4TUKH 1MJUL 3VFWA 3C6LA 5DRWA 1RZKL 1Q0XL 2ATPA 4O51B 3S35H 5I71C 3RKDC 4KKCD 3EDKA 1WWCA 4HJGB 1INQA 4NM4H 1S9YA 2D3VA 3V6FA 1X5HA 1QO3B 4WWKC 3QUZB 4S1QH 4PJEA 3MUGB 3MJGX 4OZFG 2NW3A 3FRPA 1RURL 4WTXA 1QLRA 5FYJH 3ARQA 2Z31D 3I6LE 4NN7B 3BN9C 4H0IA 1D5BA 2ARJA 4EI6B 3WCYA 1KCSH 1NCTA 4YAQB 1JI1A 1FPTH 2FHCA 3VRIA 1MCEA 3EUUA 5F9OL 4Y5VC 3KHQA 4Y16D 4W4NA 4GKZB 3QUZC 3MFGB 2F9BT 3MGAA 4QRUA 1N59B 3VGBA 4RMTA 5IB3A 1WCBA 5C1MB 3JWOH 3PWLA 5GGTA 2MQ3A 1FO0A 1KXTB 5ESAB 1QP1A 3RJQB 4J2XA 5CBEA 4GRMB 1HZHL 1IJ9A 1HSBA 3RVWD 1KCLA 1G7JA 2X4NB 5DYOB 3BD5A 2BOBB 1AXIB 5JOPD 4YHNA 4R7NB 3WIHL 3MSPA 3IFOB 2R2BB 1I3GL 2W38A 5IB1A 1S5HA 1I8KB 2Y07L 4F3FB 4F58L 2GAZA 3EDFA 4GJTB 1HOCB 4BFBD 4UB0L 3LIZL 4NKDA 4KJYB 5D2NC 2DQJH 1JL8A 3O2DA 3UP1A 2HVKB 3B3IA 1KEGL 3FQRB 1CXLA 4OKVB 1N26A 3X12A 2CKBB 1EAPA 1HXMB 5ELIA 4HPOL 1BWWA 2PW1B 1T0PB 3STZB 1IAOA 3LDBC 4FQQB 5KANI 1CDBA 3X14B 3ME0A 1KFAL 2YXFA 1Q94A 4F57H 1AC6A 4CADA 1U3HC 4LNVA 4KJPD 5I1IH 3GBML 3CFCH 3ARBB 5DJCB 5INDB 4MQXC 1FJ1B 1A8JH 2HJFA 1IC1A 4ORGA 4PP1D 2MCPH 4PJXE 4FZEL 3RWJB 3GSOB 2VMFA 3BSZL 3LN4B 4U1HB 3V4UH 2XZCH 4LLAA 4LNRA 3HC0A 4KH2A 4F3FA 4JVUA 3NVQA 5F6IC 4XCYA 3CLEH 1MFNA 4PY8J 4XBEH 2EIBA 5IB4A 3S5LA 3RI5F 5DSCA 5F6HI 3BRDA 4H0HB 4NZRL 3D25B 3HC4H 1CGYA 3L95A 2M1KA 1W0WA 2EDXA 1P53A 3U7WH 5IG7A 1XAUA 2A9NL 1L0YA 4DOHE 5TFSH 4UZGA 1N6UA 3GGWA 4KMTH 3KJ4B 2APFA 1EEZB 2YRPA 4O2FA 2WINA 1CL7I 2IANE 1OAKH 1R3HB 3QDMA 3MRJB 5CJ5A 4Y1AA 1QOKA 3IGAB 3OKNB 3LKPB 5DJ2B 2K7PA 3QFJB 1KIUA 3O8XD 2J8UF 5I1CH 1BQSA 4NC1E 3ILQD 4YC2C 4OLZL 2MNUA 1H8NA 4HW6A 4N68A 4I8DA 4KVCL 3C60C 3BZEB 4L8CB 4NC2B 1DBBL 2C3WA 4TVPD 4U3CA 3LEYH 4LF3A 2ZUUA 3CDGB 1CT8B 3U9UB 4LLUA 4HS6A 3U2SB 5DK2A 5C0NC 4AM0B 3BUTA 3EYVA 3INUL 2AI0H 5B3NA 1NFIB 5DEGA 4U3HA 3HR5B 4PTUA 3LKOA 3VFTA 4N0CC 4PP1C 4JR9H 4OZIA 2OR9L 2P8MB 3K7UA 1ZHBB 2Z35B 4FFWD 1S9VA 2WIIB 4X6CE 4YHKL 5F7KC 3O6ML 2Z93A 2O5YH 1F4XH 2HH0H 4ODUA 1IKNA 5JTWA 2QBWA 2VLLA 2R9HD 4BFGA 1FVDB 3TVMA 1HHHB 1PG7W 2VSDA 4NO2B 5FOJA 3RKPA 1KJVA 2FATL 5B38B 2WK2A 1A64A 4JZJA 4EQ2A 2A6JB 1J0JA 1OGAA 3IFPA 4JM4L 3UYOD 1TQCC 3QHTC 2IGFH 2WSKA 3UO1H 4HWZB 4TVPL 2AJZA 5C0EB 1C5DB 2CLRA 3Q1SH 4P2RE 3M17B 4F37F 1U3ZA 3AS3A 4QTIH 3O3UN 5C08D 1I85A 1YEKH 2GUOA 5DFVC 3CSPA 2CGRH 3MV8B 1IGMH 4PLJC 4TQEL 1P2CA 3STLB 3DIFB 5EULV 3QDJE 4JQVA 4J4PD 1CXIA 2VXVL 3MRIA 4H1LA 3M45A 1F6FB 1VPOL 4PJFE 3QFDB 4NPYB 1CLYL 3MUY1 3T77B 4Y5XC 3L3KB 3P9MB 5DQDL 1I8MB 1OQXA 3EJZD 4ISVB 1KPUA 3WFHB 4G6AD 4WV1C 5I6XB 5DD6B 1DP0A 4FNLL 1FGNL 3KYKL 1A22B 3DVGB 5GISL 5E8PB 3MMEA 3NBNA 1ZAGA 5CBEB 4QRRA 4X5WA 4PJIB 2QJDA 1ZLUK 3RDTC 4M61B 1X5YA 1J9CT 2BNQD 1SJXA 3MX0A 4ZXBC 3P30H 4P4RA 2VLJB 4Z77B 4HX1B 4MD5B 5E94B 5FECB 2DIJA 3F5WB 5ALBL 3FB6B 3NFNA 1BIIA 2OLDA 2DICA 3OKOB 4MNGE 1JRHL 4UILL 2UYLA 1GPOL 1DE4B 4OCMC 3NZHH 1HEZB 3ZDYF 5EU3A 4PRIA 1UKTA 1WTGT 3VFGH 3DO7B 2BY2A 5JOPE 1BJ8A 1HH6B 5J3HD 4H5SA 2B39A 3U79A 4YH6A 3IJYB 2E9BA 3ARXA 4OCWL 3VCLB 1AO7E 5IVXA 4XP1L 3TYGL 3IKCB 1ZS8B 1IEBA 1T2JA 3OV6A 5AG9A 1DVFB 3UTPD 3CSGA 5AD0B 5T1LB 3SE9H 2CLRB 2ICWB 4POZC 1D5IL 1P7KB 4NQCB 1XGTA 4X4YA 5C9JB 1S7SB 1YUHA 3ARGB 3S36H 1AIFB 4ZQKA 3DROB 3QUYD 1OAQH 1CXEA 3N0PB 5FO9A 1HYSD 25C8L 3PDOA 4FQJL 5JUEL 4P46B 3ZTNH 5DUPL 4KZDH 4YR6A 1TNMA 4DKFL 3F7RA 1ACZA 1DLHA 3KHOA 4HQQH 4M62L 5DGRA 4G43B 3TJHD 5MERB 2Q7YB 4HUVB 4YHLH 5ANMA 2X70A 3W9DA 5GGUB 3BH9A 4RFOL 2LTQB 4UNUA 3SBWA 4BQ6A 2GTWA 1GGYA 1CGUA 4JRYB 2GJZA 5LCVL 3VXUD 2WBJB 3MCG1 5C0CD 1IM9D 3HE6A 2AK4A 5HYEA 4WHCA 1QHOA 4NN6C 1FZOB 3MRGB 1G7MB 1GVIA 3BIKA 3EYVB 4YHOH 3MBXH 5GGTH 1P4LA 5HYSA 5C08B 4L4TA 1CT8A 3U9UA 5F1SA 3I2CH 1JWUA 1DUZB 5HDOA 4HIXH 3IETB 4OF0A 3KYOA 4YHIB 1DFBH 2AEWA 3TO4D 2BVQB 1LE9B 5I73B 5FA4A 1G7MA 4PV8A 1OP3K 2QHLA 5I8OH 3MRJA 3ELAT 2BRRH 5C09B 2FX7L 2ED9A 4ESKA 4NOBA 1QRKA 5K93A 3IS0X 3LVEA 3SDCB 3D9AL 2YPLD 1PDKA 4K23H 2ERJB 5C7XH 4HXAH 4LDLB 3G04B 2A1WL 3BQUA 1Y6MR 2DM3A 4EUPG 2JJUA 2VR9A 4L8SB 4JG1H 3MLSL 2R23A 1OPGL 3HLAA 3N85L 2QHRL 4N1HB 2FNBA 1DL7L 5IV2A 4Y4HA 1DLHB 3QA3B 4DCQA 3T4YB 5C0ND 3TJHC 1VGKB 2WUCL 3GEWB 3RPIB 4JDZB 1K6QH 1R3LB 1TZIB 4D0BA 2ERJC 3MLRL 1U8NA 3HZVA 2Y5EA 1UM4H 5KSVA 3FOLB 5CEZH 3C5ZA 1Y6KR 3MLWH 4NM4L 1RZ7L 1EZVX 4P5TD 3ZHDA 4XAKE 3STLA 5F44A 3VFNA 3PGDA 4FOMA 1PAMA 2Q6WB 1I8IB 4DK3A 5DJCA 1V7NH 1FIGH 4M43H 5I1AA 3SDXB 1OSPL 5LAXA 4AEHH 5I1GH 3L3JA 3WFZA 3MR9B 4FA8A 1RJZB 1T03L 4MD4B 4D9QD 5A2FA 4JZJB 2OTUB 4GXUN 3GSUB 3BOVA 4JVPA 5EBLA 4FHBD 4G8GA 2FO4B 2R1XA 2V2XA 5FFLA 3TT1H 5CSZB 1JJUA 4WW2C 3PDGA 4XRCB 4MXQD 4MXWH 4ZMAT 3F6IA 5GZNC 2ZUWA 3SDDB 5K33A 1HZHH 4CMHC 2VH5H 3EJJX 1E28B 2X1PA 3BPLB 3MRRB 5E70A 4K3DH 4KROD 4K71C 3O2WH 2Z8WC 4G42B 4DKAA 4F7CB 3R8BB 5I30L 4U1SA 4G8FA 4J3SA 4P9ML 5DYOA 1BQHB 4U1GC 5D1XD 1JGDA 3P73A 1BPVA 5BXFB 1MI5A 3WV0A 1UACH 1P7QA 3B4NA 3MXVH 4GG6E 1CFNA 1CFSB 2F53B 4OCRH 2BNRB 3L3DB 1YNTA 1UT9A 2BRQA 5ESQA 1B2WL 2LTQC 1CDJA 5EZLB 3TLRA 4TPRH 3BH8B 1DANU 4U1JB 3MTRA 1X3DA 2NXYB 4TULH 3V52H 4A6YH 2JB6A 3ZT7A 4FG6D 2FSEA 4AMKH 3GBMH 3LKNA 5KVDL 2NW3B 1JYXA 3FB7B 4DWHA 2WINB 4PJHB 4WWKA 5EO0A 4GAYA 2MCPL 2Z4QB 1MCOH 1GZQB 3WO4C 3AU1B 3OSKA 4X6EB 1NFDE 5HHME 1I8LA 5T1KB 2JCCE 1OQOA 2P5WA 1ZV5A 3DMMD 2Q8BH 3REWB 3L1OL 2GK0B 3QRGH 4ZNEE 3D85A 3ROLA 2I27N 4KMLB 4ZFFB 1EX0A 1S7XA 1WSST 1KTDB 1CLOL 3HNTH 4R2GD 5D2NA 3CFEB 1S7VB 3WIIL 4OZGB 2O61A 2VL5B 1VEPA 4FXKA 4QXWA 3HNSH 2HT3D 3IAPA 1I7RA 3HI6H 2IQAB 5JIPA 2GSIA 5EO1B 4OQTA 4XXDA 1LGVA 2O5ZH 1EPFA 3DI3B 5EZIL 5I0DA 4JREC 3K1DA 4JO4L 5D7LA 4X9FA 4RMRA 5J4MA 1E27A 3V0VB 1BREA 2Q8AH 5E95B 1A7RL 4IMKA 4LASL 3WLBB 4HFUH 1W72L 5AAWA 1VGEH 3PV6B 2NY6D 3QXTA 4YWGH 2IFFL 4ETQB 2GTZB 3CDCA 4ONHB 1S7UB 3FT2B 4H25B 3IJHB 4UU9A 1RIVL 3B3IB 4JJHA 5C0CE 4NJAH 4NN5C 3GNMH 2OSLB 1OF2A 4PJGF 5K59E 2UZYB 4CW1A 5C92A 1FIEA 4XP4H 2R2EB 5T33L 1CFNB 3E6HA 3QI9C 4KI5D 5I1DA 3C6SB 4KK5C 1Y6NR 4YK4B 5AEAA 4YDKL 3EO1A 1FFNA 3WEXA 1UH2A 4MNQE 3V5HB 1BZQK 4IRSC 2MKLC 1MHHA 3W9EA 5C0DB 5FM5M 1S3KH 3OKDA 2APTA 2ZSWB 3HMXL 2YC1B 1FE8L 3D48R 4LHJB 5AUMA 4Z7VE 3VJ6B 1MY7A 1R6VA 3EOYG 5T3XH 1WCBB 1F4YL 2QADC 4M6ML 4OFKA 4R4ND 1PG7H 1I7ZA 2BY0A 3BFOA 3OZ9L 4APQD 2ZNXA 12E8L 5E8NB 2R4RL 1KJMB 1C08A 1U93B 5SWQA 3UO1L 4LSQL 3S36X 5CCKL 3GSWB 5INDA 2HFEA 5EU6E 5TDNB 1N0XL 2ICEB 3VGDA 4QTIL 5F1NB 4XCEB 1JVKA 5I1LA 2PO6D 3MLPA 2LU7A 2I26N 4UAOC 5BVJB 2J4WH 5I1AB 1EFQA 5KS9E 4BSVA 1ZEAH 5TF1H 2QSCL 4M48L 2VLKD 2NXZB 1FO0L 5FO7B 5DRWB 1KTLA 2Q76B 5DQDH 3ARSA 3MXWL 1K9TA 1YZZA 2FJHA 3BRFA 3NACH 1GOGA 4P5MA 3VH8A 1MAML 2IQ9H 3GMPB 1GXEA 5I74B 2FD6L 2HLFD 1N3NA 4LPWA 5GISH 3RTQD 4KKAD 1KXVC 4PREB 4PJDA 1KIRB 4OCXH 4HS8L 4R7NA 3AS2A 4XCFL 1F42A 1QUNA 2ZSVB 4ZUTA 4QCIA 3UPCA 4D9QE 1MQ8A 3ARYA 3FFCE 3OPZL 2HG5A 3MV8E 5GRXG 4GUPA 5JHDB 2XZQL 3ARTA 5F97E 5F6IB 4PTTA 2ZCKL 4QHNA 4ZSOE 4WW1A 1QKZL 3IDYB 4G8IB 2HP4A 4P4KA 4HXBL 5EO9B 2IAND 2Z4QA 1ZA3B 5I75B 3EYSL 1XGRA 3BKCH 3NZHL 1OL0A 4LLYA 4GKZA 3C8KB 5E9DB 4PLNC 1JGVL 1P84K 1QQDB 3IVKB 3STBA 1BF8A 4P59H 3VA2C 1T1WB 1T66C 4QY8B 3VGEA 3KXFE 2E7BA 2AXGA 1WBZA 2NNAA 4MDJB 5C07D 4BZYA 1HHKA 4GMTL 3HS0A 3SKMA 1QFHA 3J8F7 4PJ9B 3ULVE 3O4LE 5KSAB 2VNCA 5BXFA 3SE8H 4OF5A 3CFBA 1DN0B 3F7YB 1VACB 3NA9H 3Q6GL 4FFZH 5JUEH 3K80A 3KNBB 4ZS6C 4IRZH 2ZCLH 3LSOA 5IHUH 4HGWA 3B9VA 2MOVA 4TOYL 1ZT7B 5IKCA 5JQ6H 1I9IH 1RZJC 1XH3B 3I02A 1TTUA 2HJLB 4XNQB 1Z9MA 1KJ2B 3CH1B 3RIFK 5B8CB 4QRQB 5GRWA 3OKEA 5EU6B 5DK0B 3BEWA 4HUWB 1RIUH 3D0LA 4C55A 3W5NA 3G6AB 4HK3J 2HT4C 2PW2B 2DBLH 2CDGB 2VOTA 3RNKA 2I9TA 3QB7C 5IW3A 5DJYB 3W39A 3O2DH 4OFPA 4G9DB 1BJ1H 4WIQA 2EXYD 3DETC 3JWDH 1E4XI 1U8LB 5GGTL 1B0RB 4O58H 1IKFL 5KS9A 3QCUH 5DMKA 1OP3H 4ALAL 3DURA 4OZGE 1WEJH 3U4EA 1U8KB 4M6NL 1BZ7B 1JUFB 2VQUA 3WS6C 1P4BH 1NBYA 2EDKA 5IMLA 3AC0A 2YR3A 3OAUL 2EYRA 2V17H 1X7QA 3K4ZA 2EO9A 5FEBA 2IAMC 3R4DA 1I3VA 4J8RB 1CD8A 4JO1H 5FM4A 3V5DB 5IVZB 5JO5B 2LU4A 4EUPB 2WBJD 1C5BH 5IJVB 1QG3A 1WIPA 5H37H 3X3FL 4I0PC 4JCLA 4GKNB 2IH3B 4F8TA 1VGKA 3NPZB 1CYGA 2AKRA 3CX5J 4UV4H 4X7CC 4NM8H 5D1QC 1X6NA 3B6SB 3VFOB 3HLAB 2D2OA 1DUYA 1K5NA 4FFVD 5BV7L 5HHMB 1DDHA 1EJOH 3WS3A 3VG9C 5IQ7H 1G7HA 5H8DA 3D0VB 4NO3B 5KS9B 4PJIA 2UY7A 3HCVB 2D31A 3MV9D 1LEKA 3GIZL 4JN1L 3MOAL 5F8RC 2HN7A 5F7HA 1RZ7H 4U2YA 4TSBL 3D39D 1KPRB 1LE9A 1D5MA 4CDHA 1UXWA 5E8DH 1Q0XH 1OOAA 3BX7C 2W0LA 3T2OA 1VFAA 1JNNL 1U8IB 3D1MC 5C0CA 3S4SB 1FIGL 1E6JL 2CKBL 1F6LL 2X1XR 3MRHB 5IBTL 4MA1B 4X9IA 1FRGH 2D03H 3T4AB 1BBJA 1BZ7A 3QDGE 1GCFA 5L88L 2GUOB 3RWIA 3QQ9C 3LDBB 4G9FA 1RURH 1FYHB 3AB0B 3L3OA 2VL4A 2ZPKL 3WNOA 2MSPA 3PNWB 4L5FH 1ZT1A 32C2A 2EKSA 1C5DA 1DN0A 3F7YA 3MYJA 3TT1L 5FYKU 4W6XB 2HFGH 1X4XA 4A6YA 2K9UA 5BQ7A 1BWMA 4ETYA 5FYLH 5K9OB 2VLJD 4HIHA 2VH5L 3TYFA 5T1DH 2XN9D 2JIXB 1U95A 2UWEF 3IDIB 4K3DL 1OCWH 3ULVF 1V3JA 3MGOA 4K9EL 4EXPX 1IC5L 4C83B 1QRNB 4GH7B 4YPGA 5I30H 1KJ2A 3CH1A 3GJFH 2J8UB 3DSFH 4YHPB 1HWGB 1CZ8L 3BESR 4PY7B 5DTFB 3CMOL 3BQUC 3QH3B 4XMPL 4HK0B 3CIQA 1LP9E 1BHGA 1KSRA 2D9CA 4PUBH 1QHPA 2CIKA 3VFPB 5LXGH 5CBAA 5EO9A 5C0AB 5DZOA 5TE6H 5BW7C 2YOCA 3QJFA 4PJAE 5IP4A 1OGAD 4UMGA 1J05A 1UZ6E 4PTTB 4PJ9A 4LBEB 4I0CC 3RTQA 3KWWA 4HMCA 3AM8C 4D9LH 2FH6A 4PRPE 1UC6A 1I1YB 3F62A 3CZFB 1HH6A 5HDLA 1IQWH 3O6FC 4P5KB 4BFIB 3MRQB 1ZXQA 2VDKH 4TSCL 4UV7H 4P9HC 3N1MC 5B4MC 1T83A 5JXED 1M4KA 2YD1A 1AHWB 2YRZA 2E7CA 2GJ6D 4XMKL 1X5KA 3ZKXC 3BSZH 1MCBA 2XZCL 3CSYB 1IFHL 4YZFE 4NCC2 4JFYB 3KXFD 4Y5YA 5BRZA 1OLLA 3G5ZB 3ILPB 3O0RL 3V7MA 2DMCA 1MHPH 1QVOA 4JHZA 3HI6L 2FEEL 4RMQA 5FK9A 4O9HL 4IRJD 4GW4B 2O5ZL 1FG9C 3BGMB 1EHLH 5GJSL 3T3PF 5B38G 2XKNA 4OAWA 1I1AD 1JI2A 3KPRE 4JFHD 5EC1A 2Q8AL 3PXJA 4I0KA 3VXNA 4HKJA 3CH8A 5EBMA 2ZUSA 3WNKA 3MRIB 4IOFC 1IL1B 1I7ZB 1OLZA 3UCRA 3AY4A 4KKAC 1WZLA 4ZUVB 4CN4A 3GI8L 3V6ZA 1R5WA 3HAEH 4HHAA 1JN6B 2FIKA 3D2UA 3M17A 1T3FB 4O5LL 4CBPA 5D1ZD 3MNZB 3GMNA 3QI9D 3DETD 4R8WL 2VR5A 3FONB 3UZVB 5J12B 4I77H 4PJIF 43C9A 2I25N 4L9DA 4OD3H 4QYOA 2DD8H 1K4DA 3MBEC 1JHLL 3PGFH 3TVMC 4WVRA 4BKLB 5JXEA 3L3GB 3CVHA 4ERSH 4YDKH 2XZAH 5J3HC 1KB9K 2NY3B 3PGCA 4HIJA 3H9SE 5MEPB 2J8OA 4NKDB 3UJJL 3MREA 1SMOA 4H1LG 4HUNB 1J8HB 3TA3D 5E8OB 3VWJC 4UNTA 3HMXH 1FE8H 2Y5TB 3LQMA 4M03A 5I1HH 4PRAA 5LG1A 3HKFA 5AZ2L 3ABZA 1PKQE 5I2IA 2R56H 4NUJA 1ZGLA 4FS0A 2O5YL 1OARH 3O2VH 4IMLB 3OZ9H 4JPWL 1OGAE 2F54E 12E8H 2OJEA 5DRXB 5ESAA 4D0DB 1BFOB 1PY4A 4OFIA 1HH9A 3RVTC 4EI5C 4JM2D 4R3SB 4V1DB 1IL1A 3DV6A 3O3EA 1Y0LA 3FRPG 4CKVX 1G7PA 1I3RB 4TVPH 2HWZH 1KLGA 4F9LC 1PLGL 2QQLL 3TBSA 5DJAB 3LKPA 4BZ1H 1AGEA 1X5IA 1S7XB 2WUBL 4U3XA 3WKMH 5F96L 3FT4B 5HY9B 5DT1L 1A9EA 1TDQA 5I1EH 3I75B 3AS1A 1JGUH 2NY2C 1R5VA 2GK0A 2AV1B 4XP6H 2CIIB 4AENA 2IQ9L 3PHQA 2X4OB 4L3AA 5FGBA 3W2DL 3AU1A 2EZ0C 2FB4L 3LKNB 4TSAH 3QDGD 1AD0A 2W60A 2DJUA 3FZUC 2IFGA 4ODWB 2YPVL 4U1MA 2YKLL 3KYKH 5D71H 1B88A 3FRUB 3F7VB 2BXZA 1ZHNB 1U91B 1S9WB 5CEXB 4FXKB 1E6OH 2Y23A 2YUWA 1S7VA 4XVSH 5EZLA 1QKZH 1RFDL 4P3CH 3T0EC 1HDMB 1AGBA 4PGZA 4ZAKB 3P30L 5CILL 2BNRA 4HZLA 3PV7A 3QQ3A 1IGJB 3SHSA 1BZ9B 5ACMA 3BVNB 2BNUA 4ODHH 1DEEB 1UGNA 1FVCA 3DVNB 2Z91B 3MGTB 5GGVL 5ALBH 2P5WB 8FABB 1UCBL 2W65B 1NCBH 4LHUD 1JRHH 4UILH 4P2QD 1ZGLB 4PJ7B 3C6LD 5F71A 3QO0B 2P5EA 4Y0GA 5D9SB 4P59L 5HPMB 2DJ4A 4OKVA 1T21B 2HA1A 1HHJB 1C1EL 2VZSA 2BHYA 4RRPA 4PS4L 3H0TB 2X4SA 2EYTA 3BP7B 2BY3A 4QGTA 1KT2B 1BFSA 4J3TA 3HRPA 1IC7H 2EICA 3L5HA 3QIWB 5ISZA 2V9TA 3NN8A 1RQ5A 1I3UA 3UTQA 3SE8L 1WGOA 3QR2A 1TZGH 3L3DA 2IAMA 2O5XL 3SE9L 1D5IH 4G8GB 4KK6D 1G9MH 3MLXH 4HV8A 4KMQA 4U6HA 2W59A 3L5XH 5K59F 1U8JA 5HGDA 1N6QH 4NN5B 4QYOB 4OF6A 4N0RA 3MOBH 4N5UA 5BZDB 5HGHB 1I9IL 2P4AB 2GITA 3KPSE 3DVFA 2C26A 4NQCE 4FQJH 5IW6B 4ELKA 4PJIE 5EU7E 3C5JB 2B1HL 5HHXH 2I07B 3RPKA 1W2KT 1W72A 2AABH 3VRLF 5DO2D 5J6HB 4YHLL 1A1OB 1HQ4B 5D8JH 3IDXH 1C16A 2DQFA 3VGHA 3GRWA 4J3WA 5LCVH 3TCLA 1R5IB 1RMFH 3VXNB 4ZOAA 5KSVB 3F12A 4OCSL 3H8NA 1K4CA 3NTCH 4N0UA 2CRIA 4PRDA 5IBLC 3VRIB 1D6EB 4MSWB 3SO3C 1JF1A 3ARVA 1NMBL 3OAZK 2VABA 1HYRC 3QUXB 1WEJL 5I8KL 1WWBX 2YA1A 4WTZA 4DZ8A 5J1AB 2D31B 1BQLL 4L4VE 1Z3GL 1S78C 2OQJB 4R0LA 5D6DA 4NNPH 2EE6A 3C6LC 4BH8B 4HKZA 1IGTB 4PFEA 3NFPA 4H8WH 1KENL 3OG4B 3R0MA 3LN5B 5CD3A 2V2TA 2F5AL 1MCIA 5KJRH 5F7DB 5DJ0B 4ZODA 3OAZH 3ZE2F 3X11A 1DBAL 2YD3A 1QSED 3FOLA 5KZCB 1LQSR 1SJHA 2BRRL 3P2TA 4K7PX 3RGHA 4LSVH 2RHEA 2NY1C 4OFDA 3D9AH 4UQ3B 4K23L 2H2PD 3WIFB 3QIUD 1NGWB 4LFHD 4NIKB 5IQ7L 1XF3A 3BP4B 5EWIL 1NCCL 1LEIB 2VXUH 3T65A 2Z8RA 4QOKB 4KZEL 2NY1B 1XFPA 1S7TA 2IF7A 2JB5L 5DRZB 1UWXH 1BOGB 3LQAC 1CF8L 1BQHG 2EDQA 2AJ3B 1S7WA 3OXSA 1FVEA 4PJGB 3HE6C 2ORBL 1HHGB 1XF4A 4QRPD 1U8QB 5E8DL 1FBIH 1IEAA 4UUJB 3MJ7B 4HG4J 5CEZL 1XF5A 4XNUH 4R7DB 2P7TA 3TBYB 3RWHB 3QDJD 2NX5D 4MLSA 3MO1A 1QR4A 3T8XB 4R90H 5C0AE 3EOBB 4HUWA 4JFZH 3BKYL 1LEIA 2XPGB 3E3QC 2ED7A 3MGOB 1MFAH 3PXHA 2ZPKH 4OZGF 4UQ3A 3ZSTA 1OSPH 5DJZB 4WFEE 4AEHL 1KELH 3D3VB 5FM8A 4EN3A 3MFFA 15C8H 4Q6IA 4A6YB 1SHMA 4X98A 5EPMA 3D87B 4GW5B 4PGEA 3U82B 2A6KA 1FZJB 3C87A 2HTLC 3S8WA 1KNOA 4RIRB 4IOIA 4XI5D 3DYPA 5E6ID 2NY0B 4HC1H 2AJSL 3GMLA 4PV9A 1JHKH 3D3VA 4LSTL 3ZDZE 4U05A 2E9IA 1I1RA 4M7KH 3QUKB 3CMOH 1BFVL 2NNAB 3LKQA 2DWDA 2NY5C 3D18A 1CU4H 4YR6B 4HIEA 5IF0B 2DKSA 4IEFB 5F89A 1J88A 4MJIA 5FA3B 2DDQL 1DE4A 4C56A 4RGNB 2UYLB 1CD1B 3BXNA 3PHOA 1J1OH 1H3WM 4LGPB 1KB5A 3MBED 1XF4B 1QR1A 3ARZA 4YBQC 1RZJL 4LLYB 5F7UA 5MEND 1TPXC 1ACYL 2R8SH 1SJEA 1MI5E 3E6FA 3RBSA 4NRYA 3JWOC 2H6PA 1BOYA 1G9MC 4OI9A 1TZHB 4MA8L 3JV4B 3IKCA 4TPRL 1JGLH 3T65B 1QLFA 4JFQA 5JHDA 1ZLSL 4B41A 4WHTA 3HB3C 1QFWL 1OWWA 3WL9A 1YN7A 2PYEB 1G7LB 2GKIA 4Y5VB 4XMKH 1MCOL 3GJFB 2NY4D 4ZO6A 1TJIH 4U6VH 1LO2L 2ICWJ 1OSZA 4O2EB 1R3IL 3V6BR 3T0AA 3O0RH 1JHTB 3BKJL 1MHPL 3QWRA 3D3VD 2W9EH 4PGDB 3DX8A 2YWZA 1WITA 4P4RB 4GS7B 1IT9H 3SKJL 2R1YB 3H0TA 5E03A 3LMJL 3HI1A 2Y06H 4Z8FL 1KC5L 2FZ3A 4Z7VA 4PJBE 3WIIH 4P9HL 4QTHA 1SJEB 3HNSL 4LRNH 2H1PH 1ZVYA 3QZWA 2CJUH 5ID1A 1NSNL 1LD9A 3G5YB 4DGVH 4KQ4H 5SX5K 3U0TB 4BSJA 1ETZB 1E4WH 2IG2L 8FABA 4JO4H 3BDBA 3BZFB 3QG6B 4QRPB 3SOBL 2OTWA 3QFDA 3QQ3B 4F9PC 1QBAA 2G9HB 1U42A 3BUYA 4HJ0C 4O5LH 4QRQA 1LK2A 4YWGL 4N8VG 1R0AH 4CVZB 2MFNA 2V9RA 1Z9LA 4OGAD 1WZ1H 1SBSH 3THML 4ODWA 1AJ7H 3VXTB 1JHLH 3PGFL 3FFDA 2X41A 1U3HB 2QQNH 4DQOH 4LLDB 4NJAL 4PGEB 4M5ZH 4KXZI 3OXRA 1IGFL 1MHHB 5BCAA 3MROB 2LQRA 3K8KA 3FHQA 3RZCC 3LRHA 4Q6IB 1ED3A 5F3HB 1FFNB 1TCMA 5C09E 2Z0BA 4X9HA 3E2HB 1I85C 2VRAA 2Y36L 4GBXD 4NQSA 2DQDH 1TVHA 4OGYH 4P2RD 1CK0L 4O2CA 2X05A 2FECL 3O4LB 5I76A 5AZ2H 4Z7VF 3ZTJG 1Q9WB 3B5TA 4LKCA 3VD4A 1KT2A 1YEFL 3NPSB 1A1MB 4ZPVB 4EQ3A 4U1KA 3P4NB 4JPWH 5KVGL 1PYWB 2X89A 1CTOA 1FQ9C 3FT3A 3PL6A 4P23A 1FGVL 3SE3C 2P49B 3WN5B 4S10A 5D2NE 2GCYB 2X4RA 3BW9A 5FF6B 5JHLL 1UKQA 3IJSA 1DTUA 3QUML 4RRPG 5TQ2H 5K9QG 3QULA 1CDUA 4KKLD 3VMNA 3PL6D 4P23D 4TUJB 3RVXD 1OAXH 4K9EC 4ZFGH 1KJ3H 3UAJD 3V4VL 3FFCD 5DA0B 4MQ7B 1G7IB 5FKPA 3BP4A 4JHAH 3IDUA 3FMGL 1CDHA 2EE3A 3RL2B 1AGBB 4BZ1L 3O11B 4O02L 1T22A 3QIBC 5D2LF 3OR6A 2G2RA 4P3DA 1S9WA 3RGVC 5I1EL 3PL6B 4P23B 1NAML 5I16A 4PLKC 3BWUC 1H15B 1QBLL 1S7QB 4ZFOL 3S88L 4LKCB 4AG4H 1DR9A 4U1HA 3LN4A 1CLZL 1WIOA 5KSAC 3I6GA 3GI9H 1NGXB 3CVHB 4X8JB 3L3GA 1N7ML 1XGPB 3L7EA 4MAUH 5T1KA 4LRIA 3Q5TA 3GJEB 4LQFL 1G6VK 2WZPD 4YO0B 5GRUL 4Z7QE 3OXRB 2YWYA 1AHWC 4HS8H 3F65A 4OCXL 3ES6B 2M2DA 5DC0A 4XCEA 2VERN 3OHXB 4LCYB 2E27L 4NN7C 5KSBA 1BD2D 3UJIL 5AZEH 1EEYA 2XQYG 3BHBA 4ODHL 1N5YL 1HINL 2YUXA 4M7ZC 4FZ8L 3SDAC 3NCYS 2DQHH 1CDCA 1NCBL 1A1OA 3IDNB 5ID0B 5IOPA 1P7QB 3GB7A 2UUDK 5JDJA 1M7IB 1G0YR 3EYUL 1F3DH 3SGKC 4MGXA 3TZVA 2V6HA 4Y2DB 4QRSB 4XPFL 2UWEB 4FQQA 2JELH 4RWYH 2GHWB 3D69B 5F9JB 4E42A 2FHBA 3LAFA 5IMMB 4XPGL 2ATKB 1F8TL 1KCRH 4Z7VB 3QXUA 3UTSD 1WTLA 4N90E 5IM7B 5E08H 3MV7B 4YLQT 5IB3B 5DRNA 4OT1L 1LO0L 2IAMB 1KPVB 4TVSa 4UIKH 2R9HC 4Y5XB 2DMKA 2WLZA 1AHWA 4HUKB 1EIBA 4R96B 4FXGA 4OBRA 4HT1L 4A2MA 1RJYB 1S7QA 5J89A 3MJ9H 3FZUD 1UA6L 1YJDH 1JBJA 5LWYL 2M8XA 2ZCLL 2VDOH 4WI3A 4UU9B 3RZCB 4LU5H 1F90H 2XA8L 4KKCC 5DJXA 1QBMH 1G7IA 3DXAD 3ULUE 2HT2D 4JPIA 1QLFB 2P8LB 1SYVA 5ICZB 3O3BA 5F7EH 4OCSH 2HTKD 1F4WH 1HQRB 3LEVL 5CEZD 2Q20A 5CBAB 4ZAKA 3VXUE 1F00I 4TUOA 4Y4HC 4JY4B 5IESL 3JWDL 3JSSA 5SWZB 3MJ8A 5ETUA 2N56A 3TBTB 1D5ZA 4GXVL 1IKFH 1V8HA 5C0RL 4MJIB 1MLBA 5GRJL 4XP9H 3LB6D 4IIQA 4M6NH 4XP5L 2X9XA 1UADC 5CFHA 4GXUM 4YO0A 2F5AH 4MNQD 1DVFC 1MEXH 2DLIA 3P11L 4JY5H 1A2YA 3ARFC 5LGHL 1MJJB 1XIWA 2ITDA 3A6CL 4NCC1 3VWKD 3N9GH 4X0KA 5HVHC 1JZ6A 4LSVL 1NQBA 1VFBA 2NY3D 1J0KA 3RGVB 2B2XH 1MUJA 2ITCA 3FB7A 1C5BL 3UTZB 4F7PB 3ZE0F 43CAB 4IIQB 2LV4A 1ZT1B 32C2B 5IMOB 4JDVA 4UDTA 1ZGLM 5GS0L 4Q9BA 4PV8B 1AQDA 1UQSA 2R0LL 3BPLC 4UINL 4KTDH 4I18B 4K71B 5KVFL 4LLQB 2BVOB 4QXTB 4Y8AA 1WAAE 5J13B 4LKXA 4UT9L 5CUSH 4P57A 4PRHE 5BV7H 2PXYC 4HK3N 2GJJA 1DBKL 3T09A 1LVEA 4NRXA 4YXHL 2R2HA 2P24A 1CFSA 2AJVL 4S1RH 3PWVB 2KQMA 4C4KT 2PUQT 1KPRA 4N8CL 3WNNA 3O41B 1FZMB 4JN2A 4XHJC 2RFXB 5C0BB 2F8VA 3RUGB 1RUAH 4QHUA 1JTTA 3QP3A 4TSBH 2CIKB 4MX7B 3OKYA 1FVEB 2VXQL 4ZYKA 5IFAL 4NDMA 1JNNH 1QSZA 1HNFA 4OTXL 5DLMH 1JWSA 3GDBA 4XAKD 2JKXA 1E6JH 3F7PC 4FFYH 1J8HA 5D1QD 3OR7A 3TESA 1Q9WA 3EIFA 5L88H 1VHPA 3MC0A 1A7QL 2R1WB 1UEMA 4PBWD 1I4FB 1OTUC 1IM9A 4LPTA 2V2XB 2X40A 4UT7L 3GSUA 5EBLB 3TYFB 4HIHB 1EV2E 1GSMA 2MKWA 5IMMA 1YEEL 4MCZB 5D7IA 2MMXA 4L4JA 6FABH 3MROA 3BIBX 2XTJD 1M05B 1JHKL 3GJFK 2EYRB 3VRLE 3SDXA 2BVUA 1JNLL 1OTSD 5T1LA 4LMQE 5FHAL 5HGAB 5ESVB 4NSKB 1A9BB 3FL7A 3QUYA 1Z0NA 3O8XA 4RA0C 1L9MA 5C07A 1RI8A 4LVEA 5GPRA 5B4MD 1T2XA 2A2QT 3IU3A 3ECBA 3PWJB 3C5ZB 5E99H 3PHOB 4G6FD 4FN0A 3H7BB 3E3QE 1IGYA 3G5VA 3UBXG 5KBNC 2FCBA 3KG5A 4NQXA 1D6EA 5CP7A 3QFJE 2IALB 1YMHA 4QXUH 1JGLL 3RWDB 1FLRL 1T7XA 1H3TA 1C16B 4HWEH 1B9ZA 1HCFX 2JK5A 3K3QA 4CNIB 4K7PH 2GIYA 2H41A 4QRRB 3G6JE 5IBLD 2DI7A 1NEUA 1ZSDA 3QHFH 4OLVL 3ZDYE 2XN9B 1CFVL 1MRFL 1LO2H 5F9AC 3LKSA 1H15A 1AP2B 3MFFB 3UC0L 2ESVA 3BKJH 3U48A 2ZKHL 1MQKH 5IVZA 4OD2A 4YDJB 3DARA 5L2KD 3BO8B 2H8PB 3LMJH 1G7LA 4PRPB 5EUKA 2OX5A 4K3EH 4H1LB 2XTJB 1DVFD 1EK3A 3RVVC 1EFXB 4P2QA 4LLMA 2A83B 4XPTL 2XICA 3T8XA 3NCCB 4PJCB 4UIMA 4O9HH 4PJEE 3H42L 4WU7A 5K9QI 4XVUD 3VW3H 1EHLL 3IS1X 5E9DA 2B7DT 5GJSH 1X5JA 2JJSA 1ZTXH 5C08E 4AH2B 1V7MH 1F3DJ 4TRPL 4XHQA 2WBJA 4PJ5B 5H37G 5J13C 1T5XA 2FIRT 2EH7L 3RUGA 2ZG1A 4ZPTA 5K9JL 3TZVD 2X70B 4KU1A 1A14L 2OR7A 4I0PA 3D0LB 1WZ1L 4MJ5B 3I3EA 4NO2A 4O2CB 2F54D 2HT2C 3ZZ1A 4I2XB 4U1NA 3PDOB 2IWGA 5LQBL 3BO8A 2NTFB 4HCRA 3PWPE 1X5GA 4R8WH 5CJXC 5J8OA 1KTKE 2H26A 5LKNA 5EN2B 3ARGA 3TPKA 4OD3L 2ZUVA 3KYNA 1VFOA 2CDFA 4HULB 3W11C 4I13B 2VAJA 4YDLB 2EKSB 2FJHB 5D1XC 2DQDL 3QXAB 4KRPD 2LU3A 3TJEL 1HKLL 5CLTA 3PABB 4J6RH 3IU4H 4KK8D 3NFPB 4WDIB 1ZS8A 4NP4L 1ORSA 3JVGA 3ULUF 4U49A 4OLUL 3NCYP 1FYTD 1YPZE 1YEFH 3MRLA 5C0FA 3C5SB 4HCRH 3SGEH 1FGVH 5I1HL 2EXWC 4X4ME 1WV7T 5DHVA 5JHLH 1RVFL 2VDLL 1REIA 3IVKA 1FDLL 5HI4C 1SBBA 3HUJE 3UROR 4HG4K 1RAMA 3RU8L 3TWCL 3CVHL 3GSWA 5TDNA 2BXYA 5TQ2L 1NL0H 4OFYD 1DSFH 3NFNB 1INEL 5EZOH 1E4XH 3BGAA 3V4VH 1NC4D 1S8DB 2O26U 2NY7L 2B1AL 2XWJA 4WI2A 1SVCP 5IGXH 1BJ1J 3FMGH 2BZDA 1RK1A 1KCVH 3RA7L 1MLCA 3ZL4L 1QSEA 4M61A 2KL6A 4HUXB 5SWZD 2ILLA 1NPUA 1LE5A 1RUQL 1P7QD 3VXSD 3TH2T 4TVPE 5E2UL 2OP4L 2HWZL 3CSBA 2H2PC 5JW3L 3EFFB 2QQLH 4EIGB 1IZJA 3A6OA 4LDEB 3S5LB 3EDDA 1AO7D 4ISVA 4WO4C 3T0BA 3TBVA 1DBJH 3GRWL 1NCDL 2ESVB 3DSNA 3GI9L 1QPPA 2IC2A 2VN4A 4XP6L 4J8RA 3IDMA 2DAVA 2J2ZA 4X7SH 5JW5A 4MAUL 4XTRC 4P5MB 1PSKL 3QEHA 5I17B 3W2DH 3B9EA 3TIDA 5GRUH 2WWMC 4IRSB 5GSVB 5CD3B 5JOEA 4JPVH 4JRXE 2XFXB 4F7EA 2AK4D 3TNNA 1JTPA 3RX7A 3ULUH 1UWGL 3RWEB 4JAMB 2VSCA 5GGSA 3RUGE 1KN2L 1MNUL 4EOWL 2YPVH 2YKLH 5D71L 5CKGA 3RAJH 3ALWA 4N0YL 4GRLC 2PYEE 1A7OH 1S5IH 3BGFC 3VFVA 1UXSB 3QEQD 4G9DA 1JZ7A 3V2AR 3WUWA 4XMLH 3WLBA 3QPQD 1HCVA 2XNAB 2PYFA 3A0OA 3CFIC 3MV9A 3WDHA 1NBVH 1WF5A 5GRVL 5FUZL 3QI9B 4FQXB 1CD9B 5D1ZB 1O7VA 4S1SL 2D7MA 5BS0B 3PWPD 5T5FL 5B8CA 2KZWA 1K8DB 1I8KA 2BY1A 1XR9B 1B4RA 4QWWC 1F11B 1GOHA 2CO7B 2KKQA 3KPQB 2D0FA 1IBGL 4L4TD 1F8TH 1KCRL 2OMNA 5E08L 1AD9A 3KR3L 2ADFL 4F7PA 3MNWB 2Q86B 3CFBB 3HG1B 3V6OA 2DIBA 4XCCH 1IC7L 4H8WC 2ADJA 5ILTL 4LP4A 5L8JB 2RCSL 1XCTB 3L7FB 4LIQE 2O5XH 4POUB 5LGJB 1A2YB 2ARJQ 5E7BA 5EA0H 2FECI 4QRUB 5LWYH 3HPLA 3RX5A 4LVOB 1UB5B 5CZXC 3FT4A 1D5XB 2VLKB 3GSNL 3ZKMD 4RFEB 4Z0XA 3GSRB 1MHCB 1MVUA 5JIHA 3CVIL 1ADQH 3WBDA 1EA9C 1SMAA 4NBZB 5F93C 3R06B 2YMXL 2DLTA 3E2HC 4UAOB 4XBPB 4CGTA 1NDGB 1T21A 3JTTA 3MUZ1 4C58B 1CLCA 5ACZB 3IGAA 3QIBA 1P1ZB 1T4KA 2VLJE 5EH1A 4OZ4A 1F4WL 4MX7A 5D93B 4JPKH 2FX8L 3S4SG 4C56E 4PJ7A 3LEVH 1QO3A 3ZDZF 4FQHA 4M1GL 2R0ZL 3RY6A 3VD7A 5HI3C 2XZZA 1DJSA 3B9AA 4NKMB 1QFUH 1ZANH 2B5IB 3O3BB 1RMFL 4Q0XH 4D0DA 4QOKA 5DA4A 3RZWA 5KAQF 2PO6C 3BVNA 4APQB 4DK6A 3WYRA 1EJ6A 3D3VE 4KKBD 5D93C 5CGYD 1L4IA 4LSUH 4XBGA 4OZ4B 4DVRL 1KIRA 1A6UL 1ZHNA 2OI9C 2QQKH 3NIDF 1A3LL 1KACB 4PGBB 4OM0H 1JPFB 1FNEB 1Z3GH 1EH9A 4NNPL 5GRYA 4YHZL 5L7XL 4DGIH 3GSRA 4GRLD 4QOKE 3MREB 3EYFA 5D4QA 1UFUA 1CE6B 5CWSA 1V05A 4XT1C 1KB9J 2V5MA 3I50H 3AAZB 5A43C 4DKEL 2FO4A 2R1XB 5DRNB 5KJRL 3MV7A 4WEBL 5E2JA 1XCTA 3L7FA 4LP5A 1MJJA 1XIWB 5HPOA 5K9OA 3UTSA 4DJMA 1MJ7L 3WJLA 1DBAH 3CFDB 2ZOLA 4OJFH 1HN1A 4PJHA 1HSAB 2OXHA 4WWKB 4PJBF 1RJLA 4W4OA 3IYLW 4X83A 4OGZA 3VXTA 4RAUB 1M7IA 5IFHH 2CD0A 2HFEB 4V2CB 5E2TL 4PJDF 4S1RL 1NBZB 2BSED 1H8SA 4AK1A 2FBOJ 3DVIA 4I5BA 4OLXL 1U93A 4ONFL 5HGBA 4JHBA 4X7FC 3TN0A 1BP3B 5FYKH 5EBMB 3H6JA 1FL6A 1IGIH 1YMME 4X4XA 2XACC 4AY0A 3U4AA 4YHNB 1G6RA 3EDEA 3LH2L 4OTXH 3T1FB 1CXHA 3MOQA 4ZFOA 1RJLB 1EO5A 1M7DB 1NEZB 3NAAL 5MENB 4KKNA 4Y5YB 4XNMA 5BRZB 1QZ1A 3BKYH 3CFDA 4C4KO 4DEPC 3DLQR 4QHLB 2VLME 1X44A 4OGAC 5EBWB 3NIGF 3GMMB 3SKNA 2Z8SA 4MAYB 2GEEA 5GGQH 4U2ZA 5DMJB 2BVTA 1U8HB 2GJ6A 4L3EE 1K8IB 5FGRA 3F58L 5JW5B 4MNQA 4HWBH 5KOMC 4KWUA 3EFDH 5SWSA 4F8QA 4NHCL 2BDNH 5FA4B 2ARJB 4NKOB 1JNLH 2BJML 2F19H 2VZ1A 4S1QL 4CN1A 1LO5A 1QLRB 2CRZA 4G8GE 2CUMA 3VXRE 7FABH 3TBWB 1RZIB 1X7QB 5F1OB 2C3VB 2ID5A 1P4LB 1A4JA 3EYQC 2CXGA 1JN6A 3WUZA 1IAIH 5JXAL 1CU4L 1A6VL 3NCEB 3TT3L 5D7KD 2DDQH 2FRGP 3PDDA 3NPSC 3VFPA 5GS0D 4K94L 5D7SH 1QEWA 4DAGH 3MRKB 2F54B 5EORH 3WN5C 4WV1B 4HKBA 3LV3B 2J8UA 2E6PA 5ANMB 4MAYD 4MZ2A 2EDBA 4RMWA 3SY0B 5IFJB 2NX5B 4ZS7H 4KI5E 2VLKA 4YEEA 3N1PC 3IB4A 2R39A 4MA8H 2OJZH 1UB5A 3AROA 3O45A 4Y4HB 4MZ3A 2J6EA 4PYHA 4PJBB 4U1LA 4IDLA 1QFWH 5BVPL 1XR8B 4L8SA 1AY1L 4YNYB 2QV2A 5EOQL 5F3HA 3RVVD 5K9KA 2EC9T 4RQQB 3KNBA 2ZKHH 2DQJL 5C0GB 1P7KA 1M71B 4XNXH 1TJIL 3RDTA 5EPMB 4NNXB 3ZT6A 1AFVH 3GSNB 3R8QA 3ETBF 2NLJB 4IS6B 3SBWC 4XX1G 3L5JA 4XPTH 4ZOCA 1I1FB 1B6UA 4RGOH 1JPST 4HAGA 4MA7H 5SX5H 2G60H 2BNRE 1VEMA 1JWUB 5DEFB 4ZSOA 1ZLWK 1RD6A 5I1IL 1YNTB 1H5BB 4FQXA 4V1DA 1X6LA 1PGRB 2R69L 1V7ML 1MCKA 1BF2A 4PB0H 3VG0H 4BQCA 5ALCH 3BZFA 3QG6A 1NSNH 3ZE2E 2PN5A 4PJ9C 4DGVL 5EU5A 3ZKSD 4ACPA 2HTLD 4LLWA 4G5ZL 1VERA 5K9JH 3C09B 2IG2H 3G5YA 1BIIB 2OL3L 2BOCB 3KS0J 4NCDA 4ZUUB 3CLEL 3JUYA 4AH2A 1S7WB 3OXSB 1TCRA 4G6MH 4JRXB 3CCHA 1NCWH 4KKBC 4JRYA 4HIIB 5DTFA 3B5GA 3MRRA 2DLEA 1YYML 4F7EB 4JZNA 2JTDA 1T5WB 2Q7YA 5D70L 2NZIA 3QEHB 3THMH 4WU5B 2NY2B 4G6AC 2VDPH 4KUCF 1KTRL 3ALXA 1OAYH 1NGQH 1KPUB 4JJ5A 3WFHA 3WE6A 1PW3A 3RI5K 1OTTC 4M5ZL 1NCAH 5F7MC 3SQOH 1WK0A 3PWUB 2QSTA 4PJDB 1AR2A 3TNMA 3SKOA 1JMXA 4L8DA 1WT5A 1DN2A 4Y5YC 4LVHC 4OLUH 1WZKA 4JFEE 5FGSA 2Y36H 5IMLB 3QQ9D 1A4KA 2GT9B 1LE5B 4H88L 4Z7UB 3FN9A 3V6ZB 1CK0H 1QSEB 2Q6WA 1RVFH 2VDLH 4GG6B 4BSVB 5DMKB 1RZFH 4EZMA 2XWJB 4YDIH 2X4TA 1NL0L 5F9WB 2HFTA 1INEH 3QCVH 5EZOL 1MJ8H 3TNMB 1P6AB 1OW0A 1D5MB 1J11A 3KXFA 3LY6A 5HGGS 5FHBL 4R6UA 1PKQA 1KCVL 35C8L 3RA7H 4P99A 4XC1L 3WD5L 1OAXL 4I48A 4RZCB 1KJ3L 1FVDA 3OKKA 1KGCE 4YHKH 2VLRE 2HVJA 1JZ5A 4JHAL 4WEUD 2FZ3B 4XC3H 1YEHL 2EC9U 3VRJA 1MAJA 5IJKA 5IVNA 1T20A 1DBJL 3GRWH 1NCDH 4TTDC 3AREB 4PRID 4NNYA 2VWEC 2ADGA 5D72L 1QBLH 5HYQB 3TFKC 4LLWB 1YY9C 3TN0D 3RRQA 5BS0D 1FAIH 4LSSH 1U3JA 4PR5B 3VDCA 5DK3A 4ONOA 5CJXA 1YNLH 2EDWA 4ELME 3QBTB 3U46A 1YEGL 4OM1H 1YN7B 3ULUL 1I4FA 4TNVF 4KKLC 2DIAA 4L4TB 4L8CA 2VQTA 4LQFH 3DWTA 3E8UH 2CGRL 3X17A 2Q3ZA 4Z7NF 3OR7B 4WGVB 4XTRD 1HE7A 1J05B 1Z9SA 4K55A 5CMAA 5IHLB 4OSUH 3FQTB 1T5XB 3UJIH 3MJ7A 4POZD 3ROOB 2EXYC 2AK4B 1MFDL 2AEQL 4H25A 1B0RA 1S7UA 3FT2A 4HLZH 4ZUUA 1NFKA 4OUUB 1HINH 2R0WH 5AWNH 4WUUD 3MQIA 5BW7A 2OM5A 1CD1A 5DURD 3SO3B 3QEQB 2HMIC 4YE4H 4GBXC 4U1LB 3RJDA 2Y7QA 3DPBA 1A6ZB 5I9QB 3VWJB 1T7YA 4CU6A 5HYFA 1MFBH 5EU6A 4LAJH 3GK8H 2NX5A 4HJJH 1U95B 2JLLA 4KPHH 3MRMA 3V4PL 4MDIB 2G5RA 3DMMA 3T3ME 2BVOA 4QXTA 4IS6A 2KUTA 4KV5E 2ENYA 5EIVA 4G6JH 1MIMH 4JFDB 4ODVL 1ZLVH 3CFEA 3H3BC 4GG6F 1SJVA 3IXTB 5IT2L 4AIZA 1J12A 2ITCB 2CRMA 1UZ6F 3WHE0 4OZIE 1AO7B 1EO8H 1QTYT 3G6DH 3SDYH 1FNSH 4GSDL 4HMEA 4M3JA 4I3GA 4YNYA 3P0VH 3DX6A 5IWLA 4F7TA 3V7AE 1T66D 5L8KB 4KVNL 2NX5E 5DD1L 1EGJA 3X14A 1LO4H 1G9EA 4OB5H 4LF3B 4XP1H 3FOMA 2EEDA 3KVQA 4OZFH 4LU5L 3QNYB 2YD9A 2C7UB 4JPKL 2E8ZA 5CIPA 5T1KD 3TBSB 3WLWC 5BO1H 1L0XA 3QNXB 1JZ8A 1MH5B 2HKHL 2ZCHL 3SCMC 4DN4L 3TCLB 5F7EL 2UWEE 3S36L 1WC7B 5GS2H 4X99B 3G08A 4NHUB 4LEOA 2NXYD 4Y2DD 4HSQA 4G8IA 4LSUL 5EBWA 5ACLA 4KZDL 1KULA 2CLVA 1LO3H 1H3GA 1ZWIA 3U0WL 5IESH 1U8OB 1AGDB 5GZOC 6CGTA 3FB8A 1ZGLP 5D96B 3BISA 2X4NA 5C0RH 2F53D 3W9EB 1QFWI 4QCIB 4U7SA 3A6BL 1R3JB 4XP5H 4Z78B 2BFVL 2BSTB 5D7IB 3RX8A 4EDWH 4YQXL 2PTTA 4PREA 4KUZL 4XVUC 5TQ0H 5HJ3B 1U2CA 5HHOE 2VDRL 3UZEA 4BFEA 4LNRB 3U30B 1YECH 1YYLL 2YUZA 4J3OC 3VH8G 3SDDA 1I9EA 2FEEI 1IEHA 2CUHA 3UTOA 2YA2A 5AYUL 3OTTA 1HIMH 5L2KA 4PJ7E 2YS4A 1FL3B 4BH8A 5J11B 5HHPB 3IJHA 2DLFL 1NEZA 1E4JA 2P5WE 1DFBL 1HSAA 4CJ0A 1M7DA 3FO9B 1EFXD 3B2UD 4YPJA 1AKJB 5DURB 5FKAA 5ICXB 1T3FA 5IMKB 3KS0H 3V8OA 4WI4A 1C5CL 3I3BA 4DW2L 5L2KB 3QYCA 4Z7OE 4GW1B 1WBYB 4N8CH 2P24B 4R4NC 3LH2H 1TPXB 1Z2KA 3TN0B 4Y4KD 1U0QA 4HH8A 1FL5B 5FV2A 2GSIB 1I9RH 3RQ3A 3WSQL 2QHRH 3LPGA 4X7TB 1S5HB 4QRTA 4DVBA 4L8BB 3LSOB 4JEGB 4IOSD 1MCWM 2YC1A 4GW4A 1KTDA 4ZOEA 1KB5L 1Q8MA 4JFEA 1A3RH 3VGAC 2CK0H 3NMEA 2HFFB 5HGHA 5BZDA 2CPCA 4PJFB 2PNDA 4YFLF 1ZE3C 3REWA 5I19L 4JCMA 3HAEG 4X6CA 4PJCF 2CLVB 2XG5A 3MLWL 4K7FA 1W0YT 1GL4B 3DBXA 3UYRL 2BJMH 2F19L 4QRRD 4YBLC 1JYNA 4GRLA 4OFYA 3S35L 3ESVF 4P2RB 5SWZE 1OHQA 1U8PA 5I1GL 3MRQA 3VG9B 1DQQA 1JE6A 5H35A 4P4KC 3WJLC 5C09D 3OJMB 3QDMB 5JORA 3QZWG 3DBXB 4NWTH 4F7MB 2NXZC 3TA3A 2FH8A 3WO4B 5DVLA 4OUOA 5D7SL 3DUUB 4CU7A 5E99L 1UM5H 4NKMA 1DEEA 1QFWM 4V1DE 2HG5B 1ZVSA 1JZ2A 4KDTC 5SX4H 4ODTH 1HDMA 4WNQA 1F4AA 4P49A 1UZ8A 5MI0B 4G42A 4MJ4A 1CS6A 4PRAB 5E00B 2XT1B 2DTSA 4DVBB 2GJZB 5F7LB 1AI1H 5C2BH 1NJ9A 4DGYL 4GQPH 4OCYH 1AY1H 1H0DB 4NFBA 2DI9A 4FFWC 5D2NB 4HUVA 2X4PB 5EOQH 3O4LA 3FO0L 4FQCH 1T7ZA 4L1HA 4JRXD 5C0IA 1DQDH 5E4EB 3QHFL 3VFUA 4YEFA 2Y07H 5FYKD 1KCKA 4YDVA 5E4IA 2J8HA 3DGGB 3D6GA 2J1KA 5IMKA 1YJDC 3QEGH 5EOTA 4OV5B 3HPJB 4ZO7A 3IFNL 3GMNB 1MCNA 4Y2DA 4UTAH 3I6KB 2YPKB 1L7IH 4PJXA 2D4FA 4AMKL 5B21A 2X2YA 4U0QB 5E1AA 3NCJL 4HWUA 1I8IA 2LAGB 2R69H 3JUZA 5IIEA 3DHMA 5GSVA 4PB0L 3VG0L 3IDGA 1TVBA 1A02N 1C08B 3DJ9A 1Y0LB 1FFQA 4G5ZH 3TH4T 1YMMD 1EVTC 2D7TH 5D5MF 3U46B 1H3XA 4RISL 1SEBA 4YGAB 4YK4C 2KZ1B 4PJFF 4DN3H 2VB5A 3VDBA 4F15B 2XKNB 4OAWB 3V4UL 4KHTH 5GS2D 2OJEB 4Y4KB 1MI5B 2AERT 3WUWB 3C9NA 4IMLA 4KJWC 1SM3H 1G7JB 4NNYB 4G80B 5DS8A 3SE4A 3TO4A 5I2IB 4JG0H 2OCFD 4JKMA 3HCVA 3ZYJA 3QUMA 1FO0B 3K46A 1MLCB 2UZIL 2VDPL 3RWEA 3RWGB 1PEWA 1VSCA 3QDJA 1ZLWH 3GIVB 1AKJD 4RGND 4PGDA 4U33A 1H8OA 5GJTL 3JV5A 4Q9RL 2GJ6E 1W72H 4YHYC 3GKWH 5EU6D 1T0NB 4X6BB 1VGEL 1P4IH 1PKQB 3T0EE 1PQZA 2FJGA 5CZVL 2SEBA 4KMTL 1B0GB 4EUPA 3H2WA 4WFGE 3L3KA 3P9MA 2XWBB 1LDSA 3RVXC 3IU4L 4KJPC 3L3JB 4LSPH 3UPAA 3WL9B 1I1YA 5I1CL 1E4KC 2VXSL 4OLZH 4HCRL 2OZ4H 3GNML 1S7RA 4NQTA 3H9SB 3BIKB 1DLFH 4Z7UA 1DBBH 4X4ZA 4ZTOL 3QCVL 1WVZA 2FGWH 4L29B 1YMMA 4O4YH 4PG9A 3IF1B 2AP2A 1S8DA 2K7QA 4Z6AT 4QNPE 35C8H 1ROWA 4ZDHB 1CCZA 1QRNE 1DSFL 4MB5A 3MRCA 1AXTH 2AI0L 4Z5RB 3HZVB 2A6JA 4Y7MA 3K2UH 4IMKC 2X42A 3BWAB 5J9PB 2IAMD 1A1MA 3CJJA 4HS3A 4JHWH 4YHPA 5IGXL 1SEQL 3MPCA 1GGIL 1UENA 3P9LA 1CFQB 3G6AA 3CMGA 1YEHH 4QF1B 4CRPA 3RZCD 4PYGA 4HLJA 4KRLB 3U1SL 4D2NA 1S9XB 5IV2B 3OJ2C 3ILPA 5T3XL 1FLTX 3QUKA 2OP4H 2DQGL 1PEZA 2DTML 5FO9B 1BAFL 1OTTD 5JOFA 2AEPL 4KJQD 2WIIA 3DXAE 2R4RH 1ORSB 4DOHB 3U0PB 1J0IA 4Q6IC 2Z92B 4LSQH 1JGEB 1MWAA 5HDBE 3ARPA 3HR5A 4PJ5E 4PTUB 2BCKB 1UWXK 3FAXA 1JZ4A 4JM4H 1PKOA 1QBBA 4MMXC 2H26B 3E8UL 3MBEA 3R1GL 2A83A 4P5KA 4HPYH 4E5XA 3FQUB 3IJYA 4X7EC 3UTTE 1RSFA 5TF1L 5T1MA 1KN2H 1MNUH 1X5LA 3RWFA 2H3NA 5CINH 2RQ8A 2R2CA 3KWWB 1I7TA 3MXWH 4XZUA 3LS5L 3KPPB 1IC4L 3DGCR 4L3ED 4ZS6D 2YD2A 4XMLL 4IHOB 4D0CA 3FB6A 4U1SB 1ONQB 2H9GB 1ZA3A 2PO6B 1A47A 2VLMD 5FUZH 1ZLVK 2NW2A 4KUCD 2GTWB 1S7TB 3RWGA 4PY7A 1E28A 3L6FA 5KTEH 1FGNH 3UAJC 3RNQB 1EEQA 3JXAA 4ZNEA 2XZQH 3PL6C 4P23C 2VIRA 3OB8A 1XGQA 5D5MA 3ZLQC 3P0YL 2ZSVA 5CP7B 4LIQL 1Q9LA 1X5AA 4FMKA 3IXAB 5AAMA 4HWNA 3FQXA 3BKCL 2C1OB 1OM3L 4Y5VA 1CIUA 1QEWB 1FNSL 3LKSB 4GSDH 2E7LA 1MCPH 3IU3B 3BPNB 3V5KB 2WAHA 3LKRB 3S37X 1JYVA 1G6RL 1NBYB 1GPOH 1T7VA 4GG6A 1M7XA 1V3MA 1GJIA 4OB5L 1DVFA 5C6TL 2CK2A 1U92A 1JPTL 4JKPH 2IPTL 4JGMA 3T4AA 5IVXB 2GT9A 1KCUL 3L3HA 4M1CD 4OGXL 2PXYB 5DZNA 2AJUH 1ADQL 5DD3L 1IAOB 2IPUG 3GMOA 4HUMB 2HKHH 4S2SB 4J7RA 2H2SC 5EZJB 1NUNB 5LBSH 2C1OA 5B38A 1MELA 3T04D 2R0ZH 2PW2A 1MCRA 4FFZL 5E9DE 3JV6A 5E7FA 5JIKA 5FUCC 1YN6B 4Q0XL 1T2QL 5FECA 1A7PH 1UVQA 2X4PA 4TOYH 5JQ6L 3BD4A 4HJ0D 1D6VL 3RDTD 4W4OC 3GIVA 5JXEC 4L3EB 2X4UA 4M1DL 2R4SL 4DKFH 3BEVA 3LQAL 3SDCA 4HQQL 4M62H 4XNMB 2APBA 4LFHG 4PLOB 2MCG1 4HDIA 4OZIF 4FMFA 3PQYD 3QCTH 3EO9H 1UH4A 2ADIA 1YECL 1YYLH 1UG9A 2UV3A 1I8MA 2A77H 1LWRA 2ZUXA 2V5YA 4LLUB 2AJYH 5GZOD 1JV5A 5J06A 4LSRH 4Z0BH 5IW1B 1FZKB 1OF2B 5HYJE 3UBXB 3LS4H 5J12C 2DYPD 3T2PA 2NY2D 1GGBH 5IMOA 2JJVA 2YPKA 1IEAB 2VE6B 5E8EB 4PJHF 4ONHA 2EIZA 2H32A 5EOTB 5TGBA 1BOGA 4OLXH 5FIEA 5KSBF 5ISZE 1FZMA 4JN2B 4K2UL 2OZ4A 2VZ3A 4QHNB 5FYKL 3QHZL 1WFUA 4RFNC 3MLTA 1S9XA 3V0VA 2HFFA 5FXCH 2EECA 3P4LA 4HXAL 2X5PA 5FYJE 5IVOA 1Q0YH 2E9WA 4JG1L 2P5EE 3RIAF 1XH3A 4QRTB 5IB5B 3FRUA 1JMZA 4Z7UF 4RFNB 5E00A 2IADB 3H9SD 3BP5A 1RUKL 3N1FC 4WFFD 4KHXL 1HI6B 4M8QA 4WJ5A 5EOCL 3CNKA 1KIPA 5B22A 2C3XA 5GGQL 3K1KC 5JNYB 1WBYA 3UYRH 1R24A 3HZYA 5DF0A 5KSAA 1UM4L 4PP2A 5C86A 2VYRE 2PYED 3X13B 2P8LA 1N6VA 2BX5A 3W0WD 2OQJA 4R0LB 1P7HL 5BVJA 3TA3B 3MA9L 1RZIA 1LP9F 5GSRA 1A9EB 4HLZG 3HTLX 5J1AA 4Z76A 3B2VL 4YXKL 2BSRB 2J7LA 3QIBB 5DVMA 1U6AH 3P4MB 3QWQB 3IAGC 4M43L 4FQ1L 3MJ8B 1D5XA 2C4XA 2AXFB 1A6VH 2BC4B 3TT3H 5IW1A 2HJKA 1XCQA 4I9WD 4MHHG 4MWFB 5HVHB 1QPXA 4KK6C 4JB9H 4ODTL 5GGRY 5ENWB 4FQ2H 4QHLA 5JQHC 4KGJA 1N5AA 4IIQC 3WXWL 1ZHKB 3B8YA 1IM3A 3VFSB 3P73B 4UOW0 2JJSC 3WHE1 1HSBB 1FYTB 1YDPB 3C9NB 2Q1EA 3LEXB 5T5NG 4XMPH 5CZXD 2DQUH 5I1JL 4M9OA 1INDL 1RUPL 3C2AL 2IBGA 3PG2A 1NLBH 3E6HB 1OVZA 4IRJC 4NQDA 4FXGB 3ZE1E 1XCQB 5ISZB 1AGFA 1JNHA 1CQYA 1EUTA 2N1KA 3QXDB 5IVXE 4PRIE 3VXMD 5IB2A 3IFNH 4KROB 5FO7A 1NUFA 3MXVL 4XNXL 3LRSB 3BPCA 5KOVC 1T80A 5KSBB 3QEUB 5CIPB 1VA9A 3MCLL 1BVZA 3H9ZA 2CLZB 3FTGB 5D6CB 1XZ0A 3STZA 2DOCA 3QEQE 2UUDH 4IDJL 4RGOL 4K8RC 3KPOA 1IILE 3PV6A 3TZVB 2LFGA 3DX6B 5F3BB 3FQNB 4X7DC 4NWUL 4JM2F 5F9WC 5ID0A 1A6WL 1MRDH 2DLHA 4OZHF 3CFJB 1VB9A 1Z5LA 1AGFB 4KGLA 3LPWA 1LK3H 2CQVA 2X1QA 2BMKB 2OL3H 1U58A 2Q8BL 1EEUA 1ES0A 4JG0L 4DKDC 5DD0L 2FHFA 2NMSA 4G6ML 1WIUA 3VXOB 1YEDA 4IRJA 1ORQB 2UZIH 5DJ6A 1LNUB 3OHXA 4LCYA 4WNQB 2ZSWA 3KDMA 1EHAA 5D7IE 3RNQA 3NZ8A 1TLKA 5FCUH 3CLFH 4OIAA 4ZD3H 4JO3H 1CXKA 3NABH 4L8SC 5DR5L 3BDYL 2XY2A 4LEOB 3U2SA 2CKNA 4EIZC 2AV1A 2VLRA 1GZQA 3ARWA 5DD5H 5GIRA 4R4BB 1IMHC 2JE8A 3VGAB 4ELMB 2HRPH 4LASH 4XPBH 1FV1B 4WW2F 3QPXL 1PYWA 4JM2C 1KN4L 5KSUA 4AEIL 1F13A 2IFFH 4UT6H 3TV3H 1SY6A 5T5NF 3OKNA 1F58H 2FEDC 3CXHJ 5ITBH 4IJ3C 2FGWL 3UXFA 1JP5A 3RKDD 1JF6A 3MRLB 1INQB 5T1LD 5D1QA 2XZAL 1BGXL 3NGBC 4X5XA 5DZLA 3UPRB 5D2LA 5F8QC 4M4RA 4JQVC 3JWNC 5HYQA 1E27B 1IZKA 2H45A 3HG1A 3K2UL 5HI4D 4OLYL 4NUJB 1JGEA 3BN3B 2DM7A 5M95B 3EYOB 3WD5H 1TNNA 2YD7A 4HGKC 1UCTA 2XA3A 3VRJB 3S6CA 1XR9A 1TVDA 1GGTA 2MPAL 3MYZA 3FQWA 1CBVL 3MRMB 3MLYL 2AEPH 2KH2B 4I4WB 4OIIL 5C9KA 4KK8C 5C0JB 2G5BB 4NC0B 2F74B 4JRYD 5KG9A 3MV9B 1BM3L 4YGVB 1FJ1A 5D96C 1F4YH 4M6MH 4HS3B 5HHQB 1OTSC 3CAFA 3ULUC 5ICXA 1P5VA 1OD7A 4LARL 3OX8B 1T6VN 5DQ9A 5C9JA 5EO0B 4LVOC 1BEYL 3R1GH 5ID1B 2XYCA 3S9DB 3C60A 1YEGH 3MNZA 2VE6A 4ZO8A 1NDMB 1NLDL 3ROOA 1N0XH 4OM1L 1F5WA 4JAMA 3GHEL 1FL3A 3TO2B 1A6TA 4HHAB 2EIDA 2YZ1A 4M1CC 5CMAB 4KDVA 5EC2B 4NT6A 5DFVD 3T0WA 3BKMH 3O9WD 4M93B 3IFLH 1JGUL 5DUMH 1AR1C 3AM8A 4NKQB 1FZKA 1NC2A 1EFXA 4P2QB 4RAVA 1F3RB 4OSUL 3S4SA 3ULUD 5GGVY 2QSCH 4ZTPL 1WFNA 1FO0H 5HTSA 1HEZA 4JFFA 3VA6A 3BP6A 1TXKA 3MV8D 5GGRA 4FTVD 3PP4H 4LCCB 1TZIA 4OZHE 4D0BB 1HK6A 4TSAL 1JGDB 3WLWD 1CE1H 1FYTA 4M02A 1Q72H 4NQEE 4OQ1A 3KJ6L 2VLJA 4JDTH 2QKIB 4Q74A 4Z77A 2VKWA 4CMMA 4KXZH 3H3KA 4NGHH 1JZ3A 1RFDH 4OD1L 3RWCB 2N7BA 1A6PA 1OWRM 2XKSA 3SDCC 3V4PH 1E4KA 4QGYA 4Z95L 4MB4A 1JHTA 5EDXA 1ONQA 1OM3H 5E8PA 5GGVH 4G3YH 5C09A 5B39G 3NFSH 2ZCKH 4ODVH 1UCBH 4N0FB 4GKNA 2W0PA 3U30C 1JPSH 5HYIA 1OP5H 5JLZA 1H3VA 4HXBH 3ARDA 1I8LC 4Z18A 4OZHB 2XRAH 5C6TH 3T77A 4DFIA 3G6DL 4NQVB 3FOMB 1C1EH 2P8PA 1OGTB 1EBPA 5MEOB 4WWID 2IPKA 3VWKC 2QL1A 5HBBA 5JPMA 2F15A 2NCMA 1I1FA 1P2CB 2L4OA 5CEYA 1UJ3A 4JFOA 2ATPB 1U92B 2VDNH 4O51A 1R24B 1U8KA 3HZYB 4N9OB 5LBSL 1NGYA 1KNOB 2BSSB 1TZGL 3DURB 2DB8A 4FABL 5BO1L 1N4XH 1RK0A 4HWZA 2Z92A 1MPAH 3L5XL 4NUGL 4DUXA 1T04A 2P44B 5EBGA 4DN4H 4HK0A 5DMGC 3MOBL 4FRWA 5DJYA 1V5JA 1U8NB 3W9DB 3IXAA 3TGXA 3NA9L 4XWGL 3Q6GH 4WW2A 4XXCC 2WBWB 4LSDA 4X6DF 4PJBA 1EGJL 1QLEH 4U1NB 4EEEA 1KIQA 4M1DH 5IHUL 1FG2B 3SDAA 3U0WH 5J6GB 3KPNA 2DWDB 1VFMA 4MJ5A 2Y7QB 1TJHL 1NC4A 2AABL 1CL7L 2FX9H 4JZNB 3FQWB 2XKUA 3HC3H 3DNKA 1S9VB 2LABA 2P7TB 3GMLB 3TBYA 4Z5RA 5L0QB 1BD2A 4JRXA 1GH7A 4RIRA 2EDDA 4OUUA 3WFEL 3NTCL 2XXMB 3QG7H 5E8EA 1FZJA 2A77L 3SCMD 1FFRA 4D0CB 1N8ZB 2ICWA 2VDRH 4TYUA 2CO6B 4QHUB 5CAYB 3BD3A 1NGYB 2DM4A 5I8KH 1JTOA 4WU7B 4Z0BL 3O2DL 4LOUC 1ZA6B 4PRNB 5CHNB 1RPQA 3HS0B 3SKMB 2YD6A 3MRHA 5AYUH 2RAMA 4GFTB 1SYSA 3QCUL 5TJWK 1PZUB 1JV5B 3RIAK 2Y9RT 1M1SA 1GGBL 3WIFA 5DUBB 4W81A 3ARED 3B43A 5FUCE 4BELD 4NBXB 1L7TL 1B6DA 2E8YA 1P4BL 2NLJA 1U8PB 2RBLA 4AL8H 1ZA6A 5KSUB 4X9BA 1N0LA 1RZ8A 2VLRD 5E2VL 3KPTA 2DQIL 3QFJA 4K2UH 3EOTH 4XNZB 3RDTB 4DW2H 4PJXF 4LHUG 5C0GA 4I2XE 4HDIB 1DQMH 1U8HA 2GJ6B 9CGTA 1EEZA 4O2FB 2AJ3A 1I1AB 1BD2B 4K7FB 5DDHB 3MV01 1NFDF 5EOCJ 1NANI 1T1ZA 3OGOE 5TDOA 2ZG3A 1IGCL 4QEGA 1GZPA 4H26A 1I9RL 5MI0C 3V0AC 1OAUL 1UVQB 2AK1L 3OKKB 5J6GA 1JFQH 5HDQL 3MNVA 1RUKH 5HHNA 1GC1L 4NQXB 1H9VA 5FUOH 4HF5L 4U6YB 3GIZH 3FHAA 4TN9A 2G75B 4HFWA 5I19H 1T1XB 3DO3A 4F2MB 4ZDHA 2X10A 4WUUA 4XNUL 4D3CH 1DQJB 3M07A 4LCWD 5FYJU 5A1AA 2DQFB 5JDSB 1NKOA 1Z5LB 1ZVHA 1QD0A 5BMFH 3RP1A 1YQ2A 2IEPA 3RWJA 1CR9H 5IK3B 1PX3A 1UJ3B 3TIEB 3DECA 1MFAL 1Q9KB 3PWPA 4XH2A 2YBRB 2CKBH 3RY4A 5FKAB 3B9KC 2FLBT 1KCSL 2EE9A 2X89D 4MCYB 2HKFH 3T0VA 4Z7WF 5D6CA 4NQDE 5HHPA 1AE6H 1BBDH 3G6JB 3SKOB 3X12B 5HGDB 3V0WL 3FCTA 3VFRA 1NMAL 3KPSB 4XB8A 2HVKA 3RNKB 2I9TB 2CDGA 4ORZC 3VGGA 4CDGC 3ESUF 4JB9L 1PVHA 2HTKC 5ECJE 2VXTL 1EHXA 4J3XA 2MWCA 3F12B 4FQ2L 4POYA 4R96A 5A40E 1MCFA 2VR4A 1T5WA 3DUHA 5C8JA 4Y2OA 5T1DL 5TH2A 2NPLX 3KLAA 2W92A 1T89C 2YD4A 3A67L 3BRGC 1W72B 1SQ2N 2IH1A 1BFVH 4G6FB 4PGBA 3IKKA 5ITFA 4LGSB 2QR0B 4CMMB 3WIHH 4K9EH 2EDEA 2KQNA 2XY1A 4IM8A 1RUPH 3P77A 5J0BA 4WRLA 4G80A 5C2BL 3DSFL 4OCYL 3S3SA 1CZ8H 1FP5A 1G7QA 1GOFA 1U8OA 4UB0H 3BT2H 5IEHB 3LIZH 3GB7B 4NYLB 1FVCB 3DVNA 2R8SL 5DK2B 5GS1C 1HHKB 5TE6L 3HMWL 2CXKA 2BVYA 4CW1B 3EHBD 4J1UB 3BZEA 4I5BB 1K3ZA 1TIUA 4KJQC 5H35B 2NQCA 1DQQB 1NH6A 2OSLA 4XBPA 2NR6D 4NT6B 1KFAH 4FQLH 4UTAL 5HI5D 4F57L 3GSVB 5DMIH 3PE9A 2A6DB