4ZUUB

Crystal structure of equine mhc i(eqca-n*00602) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-cf9
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuuB00
1BD2D 2OCFD 2D03H 4YAQA 4NRXA 1KLGA 5FA3A 4NQEB 4KJWC 4W6XB 4JY6A 4YXLH 3DX7B 5LGJA 1UKTA 3O45B 4ZSOE 4Y4HA 1Q9OA 5IIEB 4NOBA 4I18A 1KN2H 4F15C 3UPCA 5C0GB 1MCJA 4XCEA 4P2QD 4QRSA 5HY9A 5EB9A 4ZUTA 4H8WC 1OAYH 5SWSA 4UINL 1T0NA 1N5YH 1KENL 3NCEB 4YHIB 1MHPH 4XH2B 5DJZB 1W0WB 4TULL 3TLRA 2VE6B 3QHFL 5ADPH 5CJOL 5BJTB 1F4XH 5F7EH 1I1FA 4PJCA 2DRUA 4OLEA 1GZPB 4FXGB 5GGUA 2HRLA 4Q9RL 3VJ6A 1HCFX 3QHZH 3K2UL 3K4DA 5CGTA 2P5WA 1KNOB 2IANB 1GGBH 3QFJD 1H3PH 4KQ4H 2WIIB 2ZSVA 3ARBB 4HS6B 1PLGL 1N6QL 4XPBH 1MHCA 4LSRH 1R5VB 3RVWC 3TN0B 5LJYH 3O3DA 2QADC 4OZHF 4C56A 3RGVA 4QRQA 5EU6B 5HYFA 4NBXB 4OIIL 1ZS8A 1NCWL 5CD5C 3I02B 4G3YL 4OF6A 4PJ8C 3O6LH 4XTRC 5CKGA 3U1SH 4YC2C 5D5ME 2X4RB 3D85B 1ND0B 3EYFA 4LQ1A 4N1CA 2BVOA 3C9NA 3NFNA 12E8H 5ABDE 4NRZB 2MOVA 3VFWB 4PD4J 5IB3B 2X9YA 2PYED 5JMOC 2H6PA 1I1AC 4W4OA 4ZXBA 1KGCE 1T20A 3ZDXF 1XH3B 1KCUL 3BDBA 4DTGH 3NBNA 2VDMH 4TUKH 4PRHA 4FXKA 4D8PB 3B8YA 1N3NB 4TTDC 4U2YA 2IEPA 2IQ9L 1BFOB 3J8F7 3EOAB 4BZ2L 1H3WM 2BK8A 1TFHA 4PJEA 3BGMB 2F15A 2LU4A 1EFXA 5EO1B 1CE6B 4JAMB 5ICXA 1JPTL 4L3EA 1FCCA 1A6ZB 2R1WB 3DBXA 2Y06H 3CVHB 3BP5B 1G7IA 2W38A 1WBZA 1SJXA 3WJJC 4AK1A 1I7RA 5TE7L 1WBXB 3ROLB 3LKRB 3PWVB 4R6UA 1CICC 3QUYC 3TO2A 4LPUA 2Q6WB 2J8OA 2F54E 1FL3B 4PV8A 4QCIB 4PJ5D 5E2WL 5B38A 4ZDHB 1N8ZA 5ILTL 4UNVA 3PABB 4QHMA 1GOGA 1WIUA 5FYKU 4Z7WB 1F90H 2V17H 4KJYB 4XRCB 1C16A 1ES0A 3WDIA 2GW5A 2D9QB 3G08A 5IB2B 4HDIA 2VIRA 5FUCE 1HYSD 1IL1B 2Y9RT 5EZLB 3H0TA 2IG2L 1OCWH 2EZ0D 4OKVA 4P99A 1YNLH 3HMWL 3PGDB 4HGWA 4YLQT 3ULVH 4RWYH 1MIML 5CFHA 1U92B 4FP8L 1JPGB 1H3UA 4PLNC 5J1TC 3O6KH 1S7XA 4NNYB 1VKXB 1TVHB 4QOKD 2UV3A 2PO6A 1FLRH 3CK0L 1UFUA 1AXIB 5GS3A 5KSAA 4ONFH 2ARJB 3ZO0A 2EYRA 5HPOA 1G1YA 1RMFH 4ZS7L 4JDVA 4Y16B 4AEHH 1AGBB 1J0JA 2PXYA 5GIRA 4TUJB 1X5FA 1JZ7A 2FJFB 3FO2B 2WWMC 4PJDA 5CILH 1E28B 1QBML 5FM5O 3KLAA 1MUJB 4P5TA 1AQDA 5IFJA 4TSAL 43CAA 3T65A 3G5YB 4ODXA 1E6OL 5KSBA 1MH5A 3TBWB 1ZHLB 4JFEA 4JY4A 5IKCB 3TNMB 3LKPB 1Q94A 2HH0H 4IOIA 1G6RL 1RZ8B 5D9SA 1QYGH 4X7SL 1XCTA 4KZEL 4G9FD 4PJXB 2APXA 1SHMA 3QIBD 2JELH 4XT1C 4AJ0A 4JFXB 1E4XH 1A1NA 3UTZB 1T2QL 1XF3B 3PQYD 3VWKB 5FO9A 1OGAE 3VXNB 4K7PX 1YYMH 1RUQH 2CXGA 4YGVA 5GHWH 1QVOB 2JJWA 3MLXL 4NUJA 4PY8I 5FB8A 4JM2F 4BFBD 4NQCA 4C58B 4FFYH 4ZPTA 5M94B 1TCRB 5IOPA 3EGSA 1T1WA 3ARDC 4ZYKA 2NXYD 3WKMH 3GSRA 1CLOH 4WFHE 1P2CA 2GSGB 2W9DH 2NZIA 4JJ5A 4LOUD 5D1ZB 3C87A 3K74B 2QLVB 3SDDB 3B9AA 1OD7A 3I9GH 4XZUB 5F1IA 1PX3A 3MCLL 2EDXA 4L29A 5AD0B 5HHOB 5IEKB 4PRAA 3GO1H 3MGAA 4OZGA 4YEEA 5SX4I 4P5MA 1UM6H 3IDYC 3V4VL 4AY0A 2J8HA 3HB3C 5CGMA 5HYQB 2JLLA 4JQXA 3VD5A 3U2SA 3MOBL 1MCOH 2HKFL 5F7UA 4Y19D 4WI6A 3NH7L 3IXAA 3HC0B 1INEH 3RBGA 2XTLA 3DTXB 4UIKH 3VXOA 3BFOA 1BAFL 3L5IA 2HN7B 4HJJL 4ODUA 5INCA 2JJSA 1RV6X 1YEEH 3PL6B 5T33L 2XIDA 5L2KD 4LLQA 4XPTL 5T1DH 4MS8C 1I3GH 1ZT7B 3PHOB 2YD4A 1FGNH 4RISH 1YUHB 1RUMH 4Z6AT 1OT1A 1QTYT 1UH2A 5MI0B 1P6FA 1Q0YL 3C5ZB 3LRGA 5FK9B 3ULVE 3ARFC 4YK4B 5IBTH 3OF6A 2ITDB 5DRXB 1U8JB 5J12C 4LHUB 4N8CH 2EYSA 3CSPA 4LCYB 3KWWA 1M71B 3D0LB 3X3GH 4MDJA 4J6RL 1GC1L 2XY2A 1S7VA 3QG7H 4E41B 1TQCC 2AKRB 4W6WB 4LLYA 3ESVF 1MRCL 3VXRE 4HCRH 4U6YB 4DWHA 5DQJA 1NCNA 3TVMC 5EDXA 3RUGB 3ZKMC 2O5YL 3H9YA 3IDUA 4WTXA 5M7QA 3VRLF 3KPSB 3UAJD 3DECA 1EXUA 2FGWL 1XCQB 5F7LB 4BUGA 2YSSB 1UYWH 3D0VA 4PD4K 4U1NA 5JOFB 1CL7H 4XNYL 3TH4T 3ILPB 4LMQE 1YEHH 2VAAB 3D87B 2J8UE 2CLRA 1KJ2H 4JM4H 4XMPH 4KDTC 3IU4L 3ZT7A 3HPLB 3MLVH 3MX0A 5TPWL 3MJ9L 1RIUL 4YIQB 2EECA 1I85C 2APWA 1NCAL 5E8OB 3MXVL 3AY4A 3AB0B 4HC1L 4YHNB 4QHNA 1TXKA 1RK1A 3RVTC 3S3PA 3VFTB 2XNAB 1DLFL 1S7UB 1VACA 5FUOL 3NCCB 4P4KC 4WWKB 4YDKL 3OKDB 4RAHA 4H20H 1PY4A 2ZCHH 3CMOL 1R3KA 3QUXB 1XGYH 1C5DA 4O2FB 4FZ8H 4YH6A 5DK0B 5D2LF 3D39E 3FO0L 1CE1L 3BEWB 5EZJA 4A2LA 1H0DB 4M6ML 4PFEA 2FIKB 4K8RH 3MRBB 2NW2A 4EDWL 2XQBH 5SV4A 4OCRH 2ITCB 4GAFB 2XN9E 3FB5A 1I8KA 5CZVL 4IRJC 5B3JE 1NDMB 3DVNB 1F8TH 4WUUD 4RMUA 5GZOC 4R3SA 4YBLB 4M02A 1V3KA 3PWLA 4JB9L 5D2NC 1S5HA 2CR3A 3WFHA 1FYTB 1UM4L 3WSQH 3DO7B 1W0VB 4OF8A 1QSEA 4Y7MA 2BSSB 5E56A 3C60B 5JIPA 2WZPD 1JRHL 1C5BH 4PY7A 4PJHF 4TPRL 1JNNH 4G9DB 2JKXA 1A7QL 1FNEA 1LMKA 3ECBB 1Z6JT 3EO0B 2AJXL 4V1DB 1WZ1H 1A6TB 1H3TA 2YC1B 3QJHB 2DB8A 2EDRA 2EE2A 3H9SB 2ATKA 2IH3A 3BP7A 5SWZD 2HT2C 2P47B 3BIBX 1E27A 2F53E 2XZQH 1AGFB 3VH8B 4Z7QE 5HDBE 3HAEH 5E8PB 1RIVL 2NXZD 5MEQA 3P0YL 4U3HA 5DMGC 3C8DA 3H9ZA 4DZBA 3L9RA 4K9EL 4MCZB 4NRYB 5BS0E 1HCVA 3RWJA 1ZHKA 3MV8B 1KLUA 4QXWA 5DFWH 2HFTA 3QO0B 2OK0L 3GKWL 4JFPA 1QFOA 2OMBA 3O0RH 5FM4A 3UBXB 4LF3A 4JKWA 2EIZB 3F7YB 4XCFH 1S7WA 3RNQA 4XMLL 3RWIA 3V5DB 3O8XD 1X5GA 4ZO6A 5E7FA 4TOYL 5T1LB 3P0VL 1GAFL 2L7JA 3H9HB 1DQQA 5E6IB 1QLRB 1R3HA 4Z77A 1FFNA 5F6IC 3STBA 3PWPD 1YDPB 3RZCA 1ZT1B 2FH6A 1CZ8L 5C0BA 2YHGA 4S0SD 3E6HA 3MBEC 3OXRB 4XAKE 2FNBA 5D1QD 2V5MA 3HZYB 2FB4L 1J10A 3OKKA 4NN6B 5D5MF 1UJ3B 4R2GD 2Y07H 2V2WB 3MRPB 4CUCA 1CXFA 4NZTL 1AE6H 5E6YA 2ADJB 1YEKL 1B6UA 1DQJB 3GHBL 1CDHA 4U7KA 2EDEA 5LXGL 1IM3A 1UADC 1G9EA 1BFVL 5EU7E 2ATPB 2V7HB 3GSNA 3WD5L 5CEZD 1G0YR 2GTWB 5HD8D 4P2OC 4YE4L 3MTRA 5GS1A 1MIEH 2D7TH 3RHWK 3QWOB 2Q8AL 3RRQA 2P8PA 3O2WL 4JFQB 4HKZB 2NY5L 1XIWA 2F5AH 3BJLA 1RJYA 3VW3L 3BQUC 3P11L 2J4WH 3D2UD 5IESH 4PG9A 4NCC1 1N2RB 5B8CB 4RZCA 5DQ9A 1UENA 1A0QH 1KJMB 1J1XL 3PIQB 4MZ3A 3VRIB 4PJBA 5C0AE 1RJLA 3H42L 3ZMRA 4G6AD 2P5EB 4EI6A 2J2ZA 3S36L 1P5UA 3B9KC 2V2XA 3LKNA 3QDJD 3V0VA 1ZHNB 2XZCL 4HIXH 1D9KA 3LMJL 3V6BR 1DCLA 4J1UB 3X14B 5B38G 2CUIA 5C09E 1OGTB 1U6AL 5DURB 2GQHA 5DRNB 3MRIA 3Q6FA 1EHXA 4YAQB 4FMKA 1EGJA 1EUUA 1IGML 2IALB 3BHBB 1IQDA 5LGJB 4PGBB 2GJ6D 3SE3A 3KXFB 5DEFA 2HJLA 2AEQH 2FO4B 1JNLL 1BOGA 2HVJB 3UC0H 4XCEB 5DD1H 4ZUTB 1BZ7B 4BZ1L 2OR7A 4NHUA 3WL9A 4IRSB 3QIWC 5IHUL 1TCMA 4HLJA 1KIPA 2QV2A 4KK9C 4ODHL 2BNRA 4PJGB 3PP4H 2A9NH 4MD0A 1LILA 1YPZB 2RBLA 4M00A 5AZ2L 3SDYL 3I50L 1EFQA 3HE6A 4RGNB 5GGUB 3MLWH 1CBVH 3T1WA 4NKQB 1JGLH 4OLYH 3B8SA 3CC5A 2VLLA 3MRRB 5CIPB 1VERA 3ZKXC 1PKQE 3ZHLA 2K3TA 4NO0A 1MJJA 3MOQA 2O61A 5K59E 1ZGLM 1JPSL 1JNJA 1EHAA 4C56B 4A6YB 1SEQL 1WV7T 1Q9KB 3RGVB 3RWEB 1HQ4B 4WY7L 1T7WA 1U8QA 4KVNL 4OFDA 1O7VA 3K7UA 3IGAB 1VGKB 3L3KA 2CDGA 1ZKAA 3BGFB 1JCKA 5IJVB 1OTSD 2CLVA 2NW3A 5FHBH 3HR6A 5KN5A 1AO7B 2BVOB 2H9GB 1WC7B 1NCBH 3C9NB 4Y2DC 1MFEL 4KROD 3DROA 4YDLB 4NQUA 3E6FB 1KCVL 1QNZH 3IAGC 2FD6H 3QFJE 4UQ3A 5GGRA 2VXTL 2R56L 1GL4B 1T20B 2VDPH 2DI9A 3UTTA 1LE9B 1RULH 4ZUUB 3GIVB 4FXKB 2JB5L 3FHAA 4KAQL 1GGIL 4QXUH 4JRXD 3ARGD 1OF2A 3TT1H 2NY0B 1V3LA 2X4OA 3IJYB 3P73A 2QSTA 4MAYA 3U4BH 4N0CC 5DRZA 5ICXB 5AG9A 1MVUA 1HINL 4U1GC 3UTPD 4Q9QL 4G80B 4PBXA 1FE8L 1L0YA 2V9QA 3T0WA 2D7PA 2BNQA 3N1QC 3P77B 5ESAA 4YR6B 2W07A 2Z31D 3CDGA 3WNKA 1G7IB 1LEIA 1FRGL 2SEBB 1WBZB 1XR8A 1ZLWH 5I2IB 4UV4L 4OI7A 2XTJD 1IGJA 5IW6A 4ODTL 4FG6C 2A77L 4K3JL 1UVQB 3MROB 1BP3B 3B5HA 4MLIA 2C7UB 4WHDA 1UCBH 4GRLD 4I3RL 5DHVB 4YHOL 5GS0D 3ULVF 4HWNA 4CAGA 4HCRA 5EN2A 3RGHA 2J3SA 3KPMB 3HLAA 3HI1B 1UXWA 1WJ3A 2OSLA 2I26N 4M7LT 3RNKB 3WS6A 5CS7A 2R9HC 3G08B 4MX7A 2VIRB 2P8LB 2DJUA 4O5LL 2GT9A 2DMCA 3H0TB 4J8RA 4GUPA 3QDMA 3WUWA 1A6AA 1Z5LA 1DUYA 2FJHA 4F37F 3CD4A 3D3VA 4D0CA 1BQLH 2PR4H 4U31A 2A83A 5GGTH 2PO6B 5KSAB 3EUUA 3QZWG 4ZS6C 3OBAA 2GUOB 4WI7A 5TE6L 4PJ5E 3C6LD 2A38A 2J8UF 4FQQA 1RZKL 5F1SA 4M5ZL 1JNHB 3QO1A 3K46A 1Q1JL 4DCQA 2VMFA 1F02I 3O2DA 3TPUA 1J88A 5H8DA 1M6OA 1OAXH 2A6DB 3W9EB 5DDHA 1I8MA 3O4LE 2UVEA 4BM7A 3KPRE 2FHCA 1W72H 4U6TA 3TV3L 1CFSB 3BVNA 5F9WB 4JQIH 4OCMC 4MB3A 4I3SL 3W81A 4OKDA 3NABH 1I1CA 2HLFD 3NA9L 2EYTA 1QR1B 1FO0H 4ORGA 5C08D 2QSCL 3FN0L 4NUJB 4PRIE 5C8JB 2GAZA 3JWOL 4NQCB 5DD5L 4QGYA 1QQDA 2AXJA 3GMOA 5B3JF 4TN9A 4PLKC 3UROR 5I1KH 1GGCL 2APVA 3UXFA 5I0ZA 3TJEH 3EGSB 2AJSL 4GLRI 5D7LD 1U9KA 4KK6D 2IJ0C 3SCMD 5FGCB 3MV9A 3S6CA 3QDHA 2C1PB 1T3FA 1S9YA 2VXUL 1JGDA 4PRNB 1D6VL 5IFHL 3H8NA 5F1IB 3HZVA 5DUPH 3HS0B 5I0DA 5JW5B 5F89A 4HXBL 1NQBA 3O9WC 4GW4B 1T83C 3PQYE 2MTPA 3GFUA 3NN8A 5C09A 4H0GA 3FTGA 4JG0H 5SX5K 1J86A 2A9MH 5J9PA 1IGCH 3NCJH 4PRPE 1CQYA 2H26B 4IEFB 2JTDA 2CD0A 5ACZA 4ODUB 3MNZA 4EDXA 3GSOA 4F2MA 4Q7DA 4WDIA 4ZSOB 2QHLA 4Z7QF 2X4PB 2HT3C 4LLQB 4OFYD 1GC1C 1NUFA 5E5MB 3DIFA 2DI7A 2ZJSL 2XRAH 1Z2KA 3M8OH 1EZVX 3A67L 2WBKA 4GQ9H 4X80L 1KPUB 1R3LB 1X9QA 1XGRA 2O5XL 3WS3B 2NTFA 4XMKL 4MJ5A 5DI8A 1KB5A 5CD5D 2BRRL 3ORJA 3LKQB 3TO4B 1YA5A 1ROWA 5F3HA 3WNLA 1OTUD 4PJ8D 1BD2A 1EBPA 3P2TA 5FYLD 5DD0H 4DOHE 4G7VL 5CBAB 3E8UH 5AWNL 3PE9A 5I15H 1HZHL 1IKNC 3QPQD 5L2KE 2CJUL 2VH5L 2WNGA 1N0XL 1V8HA 3MLTB 3S5LA 4P2QA 4X6CF 4TSBL 4KJPC 1RZJL 3MRQA 5EU3A 4JPIB 1FZMA 1Z3GL 5T3XH 4HUVB 4PREB 3EO1A 3ME0A 3UZQA 4TTDD 3R8QA 1IEBA 3BP6A 1MCRA 3U0WL 2EDYA 1CG9B 1OSPH 5DFTA 4Q2ZA 4DFIA 3ARFA 3L6FA 4K2UL 2DD8H 5CBEA 2OLDA 2DKUA 4X9GA 1IAIM 4K23H 4Y5VC 1OWWA 4P3WA 2WLYA 3CSBA 4L4TD 3HTLX 1MCEA 1A5FH 1MFBH 5F96L 1KEGL 1RK1B 3IFNL 4I0KA 4OQ1A 1QOKA 3TVMA 1AXTH 4GAYB 5MHSD 2F74A 5FEBA 3GHEH 5CHNA 1C5DB 2LVEA 1BIIB 5T3ZD 2AEWA 2DIJA 1AI1H 5EZJB 2JIXB 5CJBA 2NW2B 1BMGA 3E3QC 5E1AB 3IRPX 1CD1B 1HHIB 3LS4H 1DBJL 3FB5B 4ZFOB 3KPPA 4P3DB 5CMAB 1IKFH 1QD0A 4KTDH 5DLMH 2W9EL 1GIGL 4R3SB 3GJEB 2DTMH 2PYEA 3V6OE 2GYSA 3X12A 3BPNC 4UDUA 1MI5D 4GG8B 2F54B 1QSEB 3NTCL 3RZWA 3QUZD 1KSRA 2NYYD 5A2LH 2COQA 1F4WH 4X0KA 4GRWH 4M1DH 2D31B 2IGFL 1OM3L 5GGRY 3OR6B 3WN5C 4ZTOH 2DTSA 2M1KA 1E6JL 1WFTA 5I71C 2WWMD 4Y5XC 3H7BA 5I19H 5E4IA 1UWGL 4K9EC 1F6AA 3T2QA 4NBYB 1OTTC 1U8MA 5D8JH 1KXVC 1MCFA 1UA6L 2X09A 3NMEA 3FQNA 5L8LB 5HHNA 3PXHA 4X6FA 1HI6B 4NCDA 2XA8L 4U6VH 1EJOL 1LGVA 3FN3A 3KPLB 3LN4A 5IB5A 4ESKA 3NA4A 5MEQB 1EO7A 3DYOA 4PJ5A 5GRXG 2Y1VA 2C4FU 2WWKT 4UV7L 1CU4H 3BZFA 4DJMA 1UQSA 5BQ7B 1P4IH 1TTUA 1C8PA 3RWJB 1QSFA 4NZRL 2H8PA 2YRZA 5EIVA 3LEVL 3PWJA 1IVLA 4FFZL 5DFVC 1I9JL 4FNLH 3RWDB 3BWUC 3P9MA 5TDPA 5JW4Q 5DK2B 1EV2E 4LF3B 5DC4B 2CXKA 1IFHL 15C8L 4QOKA 5SWZE 5T3XE 3RNQB 3IETA 2VXSL 3CXDL 2UWEA 4MNQA 2AEPL 4Z7OE 5C2BL 3F5WB 4OF3A 5D1XB 4X98B 2E27L 3D18B 5IHBA 1OGAB 1TPXB 4JKKA 3JWNC 4Z77B 4XHQA 5MENA 1M05A 1IBGH 3GSWB 4K7PY 2P45B 4F9PC 3E6HB 4AG4H 4MGXA 2E9IA 2JJTC 3INUH 3CFEB 4IIQC 3CPLB 1A1MA 5H35B 1MCWW 3CVHL 1ETZB 1L7IH 4HW6A 4OTXL 1U3HD 1AJ7H 4ONGL 4WI3A 2NY5C 4MB4A 3W9DB 5JW3L 2JCCF 4P48A 3SKOA 4I9WE 3WIFA 2V5SA 2YD2A 3L3HA 3FO1A 4M6AA 4G9FA 4NGHL 3QIBA 1JIBA 1K5NA 4PB9H 2A1WH 1XF1A 2HTLD 2C9AA 3V95A 5GS1B 4IHOA 1B6DA 2P8PB 3ULSB 1YQVL 4HH8A 3KS0H 1QRNE 1MCPL 5HDLA 1XIWB 3HC3L 1FLTX 4ZFZA 2OYPA 4ONOA 1RJYB 5LBSH 4XP9L 5F1KC 1DQDH 4TVPL 2Y5TA 5MEOB 4OZ4A 4NC1E 2VYRE 1ADQH 5DJXA 4RZCB 1QO3A 5TDOB 4JVWA 4WNQA 4GRWE 1NLDH 4X6DF 4LASL 2VDRL 4X4MA 3S34L 1FFRA 1HDMA 1HOCB 4EI6B 3OQ3B 1YC7A 5CSZA 3TZVB 1T1YA 4UOJA 5EBMA 3LKNB 2OL3H 2CDEA 3V0VB 1FPTH 4LU5L 1D9KB 4KKNA 1AGCA 4Y19A 1Q9WB 3PP3K 2DIBA 1BM3L 2AJUH 1MEXH 4LARH 3VXRB 2XYCA 4MA8L 4HQQL 2DBJA 2H41A 3AREC 4X9IA 1R5WB 3MRIB 3Q6FB 1A7NL 3B2UD 1Q38A 4MJ6B 1U8NA 3SPVB 1IEHA 5FDWA 4KMLB 1IQDB 1NAKL 4YGAB 4KK5C 4OGAC 4P4KD 1RZFH 5DEFB 2HJLB 2AAVA 4RBPK 4HWZB 5FA4A 1MRDH 2HWZH 3FQUA 4U1HA 4MNHB 2J8UB 1GRWA 1LEGB 2FX8H 5EOTA 3GJFH 4JR9L 3VI3E 4XBEH 2ZUXA 5HI3D 1NDGB 1L4IA 2DQEL 1W72A 4M6OH 5ISZD 1A9EB 3L5XH 4K3HA 2OR9L 2WQ8A 1LDPH 1KN4L 2AK1H 4MD0B 3S36X 5FOBA 4G8IA 5HGHA 4BUHA 3HE6B 3QFDA 4UILL 3F12A 3QDGA 3LEYL 2I9TB 4H5SB 2BOCA 4AQ1B 5L7XL 2W1NA 5ID0B 3VXQA 2X42A 2DKSA 2PETA 2FHBA 3EYOB 3D39B 2VLLB 3SE4A 4ELMF 1OP3H 2EE6A 3G6JE 4WW1A 3MACL 4EI5B 4NO0B 2O61B 5KVFH 3EJZD 1B90A 4FQHB 3S37X 1JGEA 3RIAF 5J8OA 5JZ7D 1V7MH 1X7QB 5GJSH 1P7QD 1U8QB 2XN9B 5L8KB 1ZSDB 3VXUD 1U3ZA 1H8SA 3EFDL 3ZKNC 2CDGB 4CU6A 4G6FD 2HFGH 4OD3L 4Q6IA 3S4SA 3VFOB 2NW3B 2HJKA 1FH5H 1YN7B 5E2UH 5DUML 3LIZH 4QLRA 4LVOC 3DROB 3OV6A 3HPJA 5FYKD 5DTFA 1RHFA 4Z5RB 2IBZY 5GGRB 1A7RH 1SY6A 1AY1L 3GEWB 4HMCA 4UB0H 4D0DA 1AFVH 1G7JA 3BKMH 3MR9B 4NQED 1CTNA 1BOYA 1DVFD 2VDNH 3C5JA 1TETH 3MXWH 4R4BB 1I7UA 2HG5A 3HMXH 3AMKA 1OF2B 1FVCB 1PEZA 1A1OA 4ZQKB 3UO1L 8FABA 4O9HH 2V5TA 4JHAH 3P73B 3BIKA 3BPLB 2B2XH 4WUUA 5DRZB 4RX4D 4XWGH 4KK8C 2F53B 1UACH 3QSKB 3MMEB 4JRWA 2P1YA 2R4RH 3BAEH 1IGJB 1D5BA 5C6WH 5BS0B 3MODH 4DZ8A 4LPYA 4BFEA 4MLSA 4I13B 5CP7A 1DFBH 1YMMD 1NC2A 3EW3B 2ICWA 4Y1AA 5JDJA 4HK0A 5EN2B 4Z8FL 2J5LC 5GGVH 2X89D 5IHZA 3TA3A 3WJLC 3U36A 5L0QB 4H8WH 4PGDA 4EBQH 3O2VL 3RVVD 3SDAC 1T7XA 4J8RB 1GGYA 2FH8A 3DNKA 4POZD 3WUWB 1Z5LB 3UTPE 4F7TB 4FQIL 4OGZA 1DUYB 5E24E 3MCG1 5F21B 3GK8L 1JRHI 4JLRB 3S9DB 1KJ2B 3D3VB 1EO5A 1EAPB 1S9VB 2NY3B 4L8SC 5DT1H 2R4SH 2A83B 3LV3A 3HR5A 1S9KC 3RU8L 1JGUH 3ZE1E 3D85D 4JFDD 4HGKC 2XQYK 4PJEF 2AW2A 3WBDA 3BD5A 3PGCA 3TM6A 4R0LA 1II4E 3S5LG 3SKJL 3WKNA 2CO6B 1F3DH 4FQPA 5KVGH 1K4CA 1DEEA 2C1OA 4HPYL 3BQUD 1U8LA 4FMFA 4JZOB 3TPUB 5INDA 3BN9C 3UJJH 1IM9B 4AMKL 4KH2A 3HRPA 3SDCD 4APQD 2VXQH 5EU4A 1M6OB 3L7EA 1YEDA 2QHRL 4ZTPH 5CJ5A 4CW1B 3NPSB 2X1WL 5I75B 3HC4L 3KJ4B 5DJYB 1IZJA 5FYLH 3LS5H 3VFNB 3X13A 5F1NB 4MD5B 4PLJC 3QUMH 3PWPA 3B9KD 2ILLA 4LVNB 2EKSB 1I4FB 4U6XA 4TSCH 1J1PH 4JFZH 1YEGH 2G2RA 4JZNB 5FKAA 4YHYC 1MJUH 3WHE1 2EDKA 1QHOA 3CFBB 4OLXH 4M48L 4O02L 1XR9A 1TNMA 3DX8A 1A7OL 4KUZL 5LWYH 4KHTH 1QQDB 4RDQG 5E70A 1ONQA 3QA3A 2UUDH 2VN7A 3CLFL 1J8HE 5GJTL 5C0AB 4PJFE 3V6FA 2FX9H 4MJIE 1XF4A 1X5HA 3OZ9H 4PGCB 2YEZA 1HH9A 3MV9B 1T3FB 1CCZA 1DL7H 2WM0A 1S9YB 4LAQL 1TZGH 5ENWA 4YX2L 5J11B 3VCLB 5F6HJ 1U8HB 4LCWE 1R24A 2XY1A 1K4DA 5E0QA 4S1SH 4QKXB 5TF0A 4ZMAT 1CF8H 3QRGH 4NQXA 1MWAH 2C3VB 5C09B 1EHLL 1JTOA 4KK9D 1KJ3H 1RZGA 1G7LA 4QTHB 4LIQL 3HAEB 1C12A 5KSBF 3V7MA 5I9QC 4PTUB 2CKNA 5H2BB 4KMTH 3MNZB 3QXDA 4WDIB 1PSKL 25C8L 4JN1H 5I16A 2DQCH 5F1OB 1L7TH 2KPNA 1DE4B 1CT8B 1RZ7L 4GW5A 4U7SA 3QDJA 1ITBB 4FRWA 5ALBH 4DVRH 4NO3B 5JIHA 4JO1L 3VU2A 3S35H 5GRVK 5ITBH 1SJHA 1XGRB 5HI5C 1IAKA 4O51B 4Z7VE 3O9WA 5HYJE 4I2XA 3CFCL 1RZJC 3NIFF 3ZTJG 1BD2B 4EXPX 3U9UB 4HHAB 3RKDD 4G6MH 3DX6B 4HIIA 4I5BA 2OQJA 5IFAL 3QEQD 4IMKC 2ZOKA 2R2HA 4Y2DD 1MQKL 2GJ6A 3TCLB 1B4JL 5EFIA 4HK3J 1HHHA 2AJVL 4KXZI 4HS8L 2ORBL 2ID5A 1VENA 2LTQC 4P2QB 4NM8H 1PKQB 3MOAH 5HHQA 5D7SH 5GISH 3B9DA 4S1RH 4QHUB 3EO1B 5BV7C 4CMHC 5DMJB 4PB0H 4BSWA 5DC9B 2VKXA 5DHYA 1LP9A 3CFDA 2G9HA 2HVKA 1I7ZA 3LRSB 4Q2ZB 5DGRA 5JXEC 3A6OA 5CEYA 3R1GL 4L8BB 1P7KA 3IJSA 2A6JB 1S78C 2D0GA 2OTWB 5FYLE 3VD7A 4FQCL 1AR1C 5BO1L 5LGHL 4ETYA 4RGMB 1J8KA 1HH6B 4XP4L 1PYWA 3QFJB 5DEZA 2LAAA 3LY6A 1IAIL 2KQNA 3O3AB 1YN6B 1JZ5A 4FG6D 3UP1A 2DQFB 4Y4KB 3SGKC 1NAMH 4PP1C 2F74B 4DN4H 2Z93A 3EOBA 2KQMA 4N0UE 1AR2A 1V3JA 2VSCA 3DSNA 3G6DL 1A9BB 5J6GB 3K8LA 1NGXB 3QCVL 3PL6D 4N0YL 1OAQL 3HI5H 4UMGA 3QNXA 4EVNA 4U49A 2Y23A 3REVB 2R9HD 3KNBB 1D5ZB 1FG2A 1OAZH 4F3FA 4OSUL 1RD6A 3DXAD 3BPOC 3MRCA 4X7TB 4BH8B 2AJZA 1BVLA 2GK0A 1A47A 2M26A 4YHPA 5IROC 3U0TA 4Y5VA 5DJDA 4DGYL 4LHUD 1NMCC 3FOMA 4Q9CA 4UDUB 3EJYD 1NJ9B 2NMSA 4M1GL 1V5JA 4U0QB 2VXVL 5D72L 5MHSE 3GKZA 2VLMD 1TJIH 5KOMC 4H25B 5FKPA 4EUPG 4X0KB 3TT3H 4JRXA 1CD0A 1WUNT 3ARBC 3ARGA 3B6SA 2DS4A 3BKCL 4JFOA 4TRPH 4BQ9A 3DO3A 1BLNA 2MCPH 2J1KA 5EUKA 4LRNL 5H37G 1XGQB 5ANME 3WYRA 1WITA 2DM4A 1F6AB 3MRMA 3D9AH 4IDJL 3T3ME 4EN3C 4X4YA 2AQ3A 3UPRB 2X7LB 3JTTB 2Z31A 1H5BA 3UYPA 1YEJH 5FDYA 4X6FB 4WFGD 3FAWA 2IAMC 4CMMA 1OWRM 2K7QA 3T09A 1OHQA 4GRLA 5J7CC 4PJ5B 1O7SA 2B1AH 5IQ9B 3BZFB 3N1PC 1JF1A 4LKCA 3MLZH 5A16B 3PWJB 5HGBB 4S1QH 3E2HC 4MNGE 4R7DB 5HYSG 3C5SA 4RIRA 2VQUA 2R0LH 2D2OA 1HKFA 1UM5L 1HEZB 4L9LC 4ALAH 2V7NA 3QUXD 5F3BB 1NKOA 5TDPB 1WAAA 3OAYK 3V4UL 1HILA 2Y6SD 3BXNB 5CP3H 1WBYB 5HBBA 3KPRB 3WLBA 3VWJD 1I3RB 1U8PA 4QOKB 1KJVB 1MQ8A 5I1IH 1NMAL 4F7MA 2B1HH 1BQHA 5IQ7H 1UGNA 1YNTA 3C6LA 3QIUD 4WU5B 3C6SB 3G6JF 3RA7L 3GUTA 1OB1B 5KS9E 3BYYA 4PRIB 5CINH 4Z76A 4HIJA 3LDBB 1JWMB 2AXFB 4QXGL 1ZLVH 5MEPA 5E00B 5CGYD 5A2FA 1Q8MA 3N0PB 4N1EA 5EO0B 4P4RB 2BSRA 5C70A 4NKDB 4AEEA 4LVHB 1C08B 4D3CL 4QY8A 5D6CB 3SKOB 3PWNB 5GSRA 4EQ3A 3U7AA 4IOFC 4JANB 3L3HB 4UAOB 5A3ID 4G9FB 1FFQA 3Q6GH 1ZLSL 5DD3L 3PQYB 4OLUL 1UZ6F 4GXUN 1M7IA 2BVTA 4OBSA 4YBQC 1B2WH 4NSKA 3UYRH 1KXTB 5C08A 3OB8A 3NCMA 2OP4L 5LAXA 1XGUB 4P23C 4QHKJ 1CDJA 4D94A 2VUOA 3SN6N 4LP4A 5DC0A 1MPAH 1P4LA 3GMRB 5D7LA 1CFNB 2O5ZH 3RTQA 4J2XA 3VMNA 4B53A 1G1CA 1PQZA 3WXVL 5C0RL 2NXYB 1KBGL 3SCMA 3ZE2E 3T0BA 5EUOE 1A3LH 5IBUG 3BKJH 4OJFL 4CL7A 5DJ8A 2YWZA 1HDMB 3EFFB 2R1YA 4GG6E 4YHLH 4PJ9D 3P4NB 1QLEH 1ORSA 3UMTA 1T22B 3OB0H 3B9EA 3FB8B 1U0QA 4NZDA 1T1YB 4UT6H 3QEHB 5FHAL 2ZPKL 1I8IA 1A7PL 5FYKH 2RJMA 3BD3A 4YHKL 3VWKC 5I18H 5T1LD 3RDTD 4JHZA 4UUJA 4DOHB 2F8XC 3S96B 4ZFFA 4DKAA 2P24B 1MAML 5TQ0L 4MD4A 5BZWB 5MP6H 3T0XA 5L2KB 2VLJE 4OFYA 3MO1A 4MXQD 2XWTA 1V05A 4H26A 3BZ4B 3MRGA 5EC1A 1BWWA 3WNNA 5FDWB 3MUZ1 2L7UA 4NQDA 1E4WL 5FO8B 1DSFH 4XCCH 4J3SA 3FQUB 4U1HB 1FIGH 5D1ZC 1WGOA 3BZDA 3MRNA 5D4QA 4N8VB 2PNDA 3L1OL 4HJ0C 1VADB 3QXAA 3TWCH 2VUYA 3GNMH 1NL0H 3AROA 5I1LA 2MMXA 1WWAX 1KPVA 1IGIL 1W72B 1JZ3A 2ZZUT 3BDXA 4HUXB 4XP5L 4NKIH 5I8CA 4UQ2A 2QQKL 4PJBF 3ETBF 1F45A 2R69L 4IJ3C 4N8PA 2ERJB 3IDIB 3QEUA 2D7OA 4M6NH 3OPZH 3ZDYF 4ORZC 4XNZB 3IDXH 4LQFL 1C5CH 2I60L 1FO0B 4WU7A 4G42B 2GEEA 5F93C 1ED3A 4N0UA 4K71B 3QUKA 1X5XA 3UX9B 1OP5K 1MNUH 3DMMD 4XBPA 1JFQH 2FX7H 4HIEA 4JDTL 1DQML 1F6FB 3DLQR 4KFZC 5E94B 4HFWB 1JGEB 2P5ED 3C5ZC 5MI0C 1BREA 5KVMC 3ES6A 4R90L 3RX8A 5ISZE 1MRFL 1TDQA 4OM1H 5J3HC 5C0FB 1JI2A 2G60H 4L4TA 4Q6IB 3S4SB 3OKNA 1P6AB 4R4FL 3I2CH 1D5IH 2CPCA 1MWAA 3DARA 3L7FA 3MRJA 5HHME 5D2NE 1JF6A 3FZUC 3HPJB 4Y5YC 1CVSC 1JPST 4AL8L 3ZT5A 3FQRA 1CDGA 2R0ZL 5JO5A 2EICA 4KRPC 1A6VL 4KV5F 3GBNH 4OAWB 5DF0A 2NY7L 1TITA 4M7JH 5ANMA 5E4EB 4UU9B 1DQLL 1U8OB 4K3EL 1T4KA 4I77L 2YA1A 3KXFD 1A1OB 3GBML 3BIKB 3VXUE 4J4PD 2VZOA 2VLKA 5KANG 1S8DB 3G9AB 1KELL 3MV01 1A6UH 3KPOA 1BBDH 4U1SA 4IRSD 5B39B 2HTKD 1MI5A 3RPKA 2OJZL 3I6GA 3QUZA 5F6HI 4UINH 3BT2H 4M62H 1J0HA 4D9QE 5FYKE 3AB0C 3VFSB 1W8NA 1YYLH 4JRYE 2QSVA 2DQDL 2IPTL 3P30L 4QXTB 2XWJA 2VL5A 3DOSA 5EORL 2E3VA 4YUEL 3QHFH 2ICWB 3MFGB 1XZ0B 4MNGA 1KCSH 2G5RA 3IVKA 5L88H 4PPTA 1UWXK 5IHZB 2A2QT 5I17B 3JV5A 5CJ8A 4HLZH 2B20A 4Q9RH 3VG9B 1JBJA 4NWUL 3K2UH 1ZVYA 2NR6D 5DD6B 4U6HB 3H3PL 2XFXB 3VI4E 1A6WH 5SWZB 1MFDL 3HG1D 4WTZA 5DR5H 2R2BA 3T0VA 2NX5E 5EZIL 3WIIL 4B7IA 3WHE0 4JM2D 3NZ8B 1OPGL 1PLGH 1N6QH 1NFDA 4Z7UA 1RHHA 4KZDH 3F58H 3LV3B 4LSQL 4YBLC 1RFDL 3VXME 4S2SA 1E4KC 3ZZ1A 1CI5A 2W92A 2YD8A 1FFPA 2V5RA 4PS4L 1YMME 2EDLA 4OM0L 4E42B 2IPUK 3REWA 3LQZA 1CGSH 3M17B 4LLWA 4Z0BL 1RUPL 4IDLA 3M1BA 1HSAA 2GFBA 3LOWA 3N1FC 5INDB 4N90D 3TGXA 5IM7A 2FR4A 5IP4A 2EXYD 3O8XB 3L7EB 4HV8B 4RAVA 1KCUH 1EEZA 1LEKB 4I4WA 1DBML 5J13B 2Q76B 1KIRB 1LK2A 3QXUA 1P4BL 3QXVA 3N85H 4OGXL 4BZ2H 1RURH 3HUJE 3PJSA 4P46D 4DEPB 1UXSB 1QRNB 2J6EA 4D0BA 4NFDA 5D1QB 4JDZB 5F9OL 1IGTB 4RGOH 2CK2A 4R2GB 5DJAB 3GB7B 1CLZH 2BX5A 1U3HA 2DI8A 5TE7H 1A3QA 4JHWH 3ARED 4Y4FC 3VGGA 5I66B 3SY0A 3QA3B 4GRWB 4AM0A 3KYAA 3MV7D 3V5HB 1MHPL 4GG6A 4MMXC 2YEZB 3EDEA 3W82A 1WK0A 5EPMB 5GXBB 1F4XL 2RQ8A 1HIMH 4OD1L 2PN5A 2I07B 5AUMB 2NNAB 5CJXC 3BKYL 2IG2H 2VWEC 1ZVSA 5E6IC 4PP2A 1GGBL 1JZ6A 1R3JB 4KQ4L 1ZGLP 1MIMH 3D2UB 3VMPA 3H2WA 1RZGB 1G7LB 2DICA 1DBBL 4HEME 3DSFH 3MFFA 4LSRL 4DAGL 1VFAA 5ETUB 4NNPL 1UJ3C 1A4KA 4TNVK 5JLZA 3DV4A 3MJ6A 4PJAE 3QXDB 4WI5A 2DQUH 4HUUA 2BY3A 5EIIB 3BPCA 3U1SL 3O6LL 2G5BB 5HHPB 2YPLD 4GW5B 4GMSL 1PX4A 1QBMH 3GRWA 5HDOA 1PZ5B 4JKPL 4ZNEA 1NANH 1CGTA 3CGTA 4EEEA 3EIFA 3DETD 1OW0C 3T4YA 4I2XB 3MJ7A 2CRZA 5D7IA 3HNVH 4WHCA 2FBJH 4OZIA 1G6RH 1F4YH 5BVJA 4C4KT 4CNIA 4X7SH 4OFIA 4L5FL 3CFJB 2JK5A 4IOSD 2GJ6B 4RCAA 5IVXA 1T2QH 5B8CC 2GY5A 1CS6A 5EFIB 3OKMB 5E2VH 5GS2D 3G6JB 3MLXH 5HHQB 3MBXH 1I1YA 4GMTL 2Y06L 2YPKB 4RNRA 1AHWC 1OL0A 4GBXA 2DBLL 3V7AG 3T1FB 2AK4A 2VB5A 5C0JB 1H15B 4ZAKB 1BQHG 2XKNB 3IF1A 3ILQC 3F8UB 4GKSA 2FRGP 5DHYB 1Q72H 4BFGA 2G9HB 3DURB 3OKOA 1P7KB 3CZFB 2DMBA 2QR0A 2ZP0T 3IJSB 1U3YA 3G5VB 2KH2B 1J1OH 2V17L 3N9GH 3MCLH 2UZIL 4WI9A 5ACMA 4MXVF 1PYWB 3QEQE 4YQXL 3HCVA 4XX1E 3QEGH 3IDMA 3ARPA 4IMKA 4XNXH 1OCWL 1RUAH 4LKXA 2ZG2A 4IM8A 4QRPE 1MCHA 1YNLL 1OOAA 3V4VH 4RWYL 3SO3B 3GSQB 2Y4SA 3FQXB 5JR1H 3VFVB 4L3CB 2HKFH 4PJIE 4Y4HC 3ALWA 4I18C 1INDH 4OZFH 1P7QA 1F5WA 1FLRL 4ODWA 1BAFH 1FG9C 1QFWM 1FG2B 4F3FB 2MNUA 4O2EA 5AEAA 3NCFB 1RMFL 3SDAD 1CXLA 4HGMA 5ITFB 3TBYA 1S7SA 1BVLB 2OL3B 5EUOF 1VPOH 4M1CD 4KROB 5DMIL 5T1MB 4YHPB 3IS0X 3THMH 2VABB 5CILL 4P5KA 5CZXD 3G5XB 5E8EA 2Q7YA 3BEVA 4RGNC 4L9DA 1QHPA 2QBWA 4NQEA 4KKCD 2F5BL 1DVFA 5IF0B 3DX7A 4QHKI 6CGTA 1N4XH 5LCVH 4JRXB 4KI5F 3LHPH 4KVCH 1MSPA 4G8GE 3O45A 5GRYA 4NQVB 4U1LA 1JWUA 5C0GA 1MRCH 5DS8B 3EJJX 1E4XL 2G75B 5HGAB 3RGVC 2X1XR 3BN9D 1TQBB 3MRMB 5D96B 3I3BA 1KFAL 2O5YH 3DXAE 1YYML 1RUQL 2EDWA 3IJHA 3OL2A 2Z31B 2FGWH 4YHIA 3BGFC 3I6KB 4YDVB 3GJFB 4XNYH 2XTJB 4C57C 4JQVC 2HA1A 2VE6A 5BJTA 3DYPA 5DJ0B 4FFYL 3STZB 3O3EB 4PLJD 3ZDZE 1QSZA 4GRLB 4YDLC 1BEYL 3IU4H 2DIAA 2VLME 4RDQF 4FXGA 4DKFL 4W4OC 3CX5J 3PUCA 3WKML 4ZXBC 1CLOL 1JF1B 1KNOA 3MJ9H 2IANA 3O6ML 4LKCB 1Y0LA 2W9DL 2B4CL 2WIIA 2YXFA 1KGCD 1TJHH 1NCAH 2EIDA 3ARBA 3O81A 4HS6A 3I9GL 2PUQT 5I1JH 3AM8A 4AIZB 3C5SB 4NPYB 2IC2A 1R5VA 3TN0A 4P2RE 2ESVE 4Z18A 3EYUL 4NIKB 4NN7B 3MUGA 4YPGB 4WHYH 1UM6L 4NNXA 2V6HA 4P2YA 1RJCA 3WLBB 5CUSL 3TBSB 3I02A 4WFGE 3RAJH 5GSVB 2X4RA 3D85A 5T1KD 4XVJH 4UOW1 1INEL 4JFDA 4DW2H 1QFUH 1CE1H 1WIOA 2I9LA 1YNTB 3C6LB 4NRZA 4EDWH 1YEEL 3VFWA 4GFTB 5IB3A 3GUTB 3RHWF 1JHLH 4JPWH 1YNKL 3UZVB 4IS6B 1I3GL 2Y25A 4NO2B 1FGNL 5MEPB 2I27N 1RUML 2DYPB 1K8IB 1R0AL 2NY2B 5C3LD 3SDCA 4M4RA 1LO4H 1UEMA 1N3NA 3DRTB 1UM4H 4PJFB 1TNNA 1BFOA 1U8IB 3EOAA 3OAZH 4MJIB 2FWOB 2XQYG 5IBTL 3TP4A 5I1GL 4N8CL 2NY6D 4LGPB 4M3JA 4QY8B 1CE6A 4TPRH 5EO1A 1CDYA 3OGCA 1EEQA 1DP0A 3X3GL 4DN3H 4LCWB 4NC0B 2DL9A 4M7LL 4HCRL 3BP5A 2PO6C 2H3NA 5KSAC 3PF2A 1WBXA 3ROLA 3LKRA 5C08B 3PWVA 4QT5B 2Q6WA 3CMGA 1X5LA 4NZUL 3BH9A 4QCIA 3OWEA 1CL7L 1ZMYA 3BSZH 2GCYB 1P4LB 3QYCA 1YEHL 1RIVH 4XRCA 4KJYA 1KJ2L 3P0YH 1PQZB 4JM4L 4NKMB 4P5TC 5C07D 2X4QB 1F13A 3SCMB 5J1AB 2MQCA 1HYRC 5IB2A 1IL1A 4K9EH 4RFNB 3MLVL 5EZLA 5JDSB 4XI5D 3PGDA 3LQAL 4K7PL 4NP4L 4OCSH 2DJSA 5AZEH 1ORSB 2AP2A 3LB6C 1H3GA 3GKWH 4KKLC 5D70H 1JPGA 4ZG1A 1QBBA 4JCLA 4Z7VB 4I48A 5DUBB 3RVUC 3EHBC 4NNYA 1FZJB 1VKXA 4D9RD 4WO4D 1VGEL 3K80A 1T1XB 3O2DL 2L4OA 2ARJA 4BSVB 5J6HB 4J12A 4H20L 2ZCHL 1L9NA 4XMLH 5D1XD 1FAKT 1T04B 3IAQA 3KLHD 1OGAD 3HFMH 4FZ8L 4Y16A 3HE7D 3P0VH 4TUJA 2DQIL 2FJFA 1GAFH 1S7RB 3FO2A 2B8OT 1NBYA 2GJJA 2Z8SA 1MUJA 4K8RL 4KPHL 1K9TA 1MHHA 2XQBL 1PG7H 3G5YA 5D7JD 1CZ8H 4WTZG 4C54A 3TBWA 1ZHLA 1F8TL 4HWBA 5IKCA 4IRZL 3TNMA 2QADB 3MRNB 2YPVL 3CXHJ 4WFHD 4V2CB 3QXAB 5KTEH 3WSQL 4OIBA 3FAXA 4PJXA 2PW1B 4PJ8B 4YC2B 1MFAL 4UNTA 1NUDA 4JFXA 1C5BL 1XF3A 3VWKA 2HYMA 1MHEB 1SM3H 2XG5A 5I8CB 3QUMB 3Q5OA 4JQXC 4UQ2B 4WGWB 4KDVA 2EH8L 1BFVH 4OV5A 1WZ1L 4YHMH 3QQNA 5EA0H 3WLWD 4FTVE 2YD5A 4ENEC 4YE4H 5FYJD 3OKLA 2JJSC 4N0UB 2ADFH 4JGJA 3HUJF 2ZOLB 2NY5H 5IBLC 2IPKB 3VW3H 3IFOB 3MUHL 2H32H 3P11H 2XZQL 4HT1H 5D1ZA 1CWVA 3N06B 3SDDA 5E2JA 2AERT 4XZUA 1N5AB 5CLWA 2Y72A 5AD0A 4XP6L 3ES6B 3V52H 4EN3D 3E3QE 4K07A 4K94L 3TZVD 5KVDH 3ULVD 1IC4L 3QXWA 3U4EA 2N4IA 3S36H 3QNYB 2IAMD 2LVCA 3QUYB 1MWAB 2P7TB 2CKBH 1MLBB 3HC0A 4WTWA 3DTXA 3LMJH 3TYFA 2HN7A 3ALXA 3PL6A 2DDQH 2F8VA 1U6AH 1KB5L 1WZKA 1ZT7A 1IJ9A 5ANMB 1IGMH 3CX5K 4CVXB 4WW2A 1IAII 5IG7A 1SBSL 1U8JA 4LHUA 1JNLH 5TFSL 3LD8B 3GI8L 4U1SB 3BI9X 4HKJB 1MI5B 1R3IH 4BZ1H 4YXHH 1M71A 3D0LA 3QUZB 1YEIH 2Y07L 4E41A 4U0RC 1VA9A 5IHUH 1KPRB 2HT4D 4U6YA 2VL5B 3RUGA 3UTSD 5FFLA 4KC3B 4PG2A 1NCUA 4MNGB 3TIDA 2YSSA 4PTTB 3FONA 4Q0XL 1F11B 1IGYB 1MFNA 1WVZA 3ELAT 3ILPA 1MIEL 2D7TL 2VAAA 3W5MA 3EYQC 2FLRT 1VFOA 4W68A 3VXPA 3CFKB 5C0NC 4IOFD 2J4WL 5IESL 2XN9D 1RHHB 4YIQA 5HYEA 4HBCH 1FGVL 3IFLH 4G6JH 4S2SB 4WY7H 1OAUH 5KS9B 1ZANH 4YHNA 2C5DC 3VFTA 2XNAA 1JK8B 4F9LA 1S7UA 2IBGA 3KYNA 3WFDL 4WWKA 2EO1A 1G84A 1OARH 3FL7A 3QUXA 3OXSB 5FUCC 3M1BB 1NAMB 5KJRH 1F3RB 2GFBB 5HSFA 4L4VD 3O11B 3VWJA 2O93L 1FAIH 3RL1B 2VXTH 5CSGA 3BEWA 3HG1E 5E5UB 4L8DB 1H0DA 3MRBA 3NOIA 3T0DA 1ORQA 4I4WB 4KAQH 2H2PC 5J89A 1EEYB 3QIUA 2B39A 3DVNA 3SJVE 4PJ7E 3TIEB 4PJIF 4AIXA 3D5OF 4H1LH 2CK0L 4YWGL 3PJSB 5FV1L 4HJGA 2VR5A 3IDYB 4POUB 3DO7A 2BSSA 4Q9QH 2W91A 1FE8H 3C60A 2AEQL 4URTB 4PGEB 3TBVB 2HLAB 1IC7L 4FXLA 4OFKA 1FRGH 1MLCB 1RUKH 3NGBC 3ECBA 1U3HB 4HH9B 3MJ8B 5HVHC 4V1DA 1FNFA 4AM0B 4K3JH 1AD9A 3CDCA 1A6TA 1UC6A 3MSPA 3QQ3A 3PP4L 4I3RH 4GG6B 4ODVL 1X5IA 4YHOH 3QJHA 4ISVB 4M7ZB 3GMNB 1B4RA 3H9SA 3DPBA 3NZHL 1VFUA 5J1SC 2GJZB 3K8KA 3MLWL 3VH8A 4HPOL 1CBVL 2BMKB 2DAVA 1TPXC 5E8PA 1ZTXL 4OLYL 1VSCA 5AYUH 3U30B 2WBJD 5B4MC 3RZCC 4FFVD 3CXHK 1T7YA 3RY6A 1C7TA 4P9ML 4WEMB 2VITB 2VLJB 4XCNA 3MV8A 1N59A 1VFAB 4X6EA 3QO0A 3MV7E 4AEIH 4QRRE 4PJ9A 1F3JA 4JY5H 1X5KA 1IZKA 3BPCB 4R4NC 3C09C 2UYLB 3ZDZF 5DJCA 5K9QI 2UVFA 3UBXA 5FHBL 4M5ZH 4F8QA 5L9DL 1TVDA 3V5DA 3JTSB 5JPNB 1AGDB 4NJAL 3U6RB 2LU3A 1Y18B 1QNZL 5T1LA 3RDTA 2K9UA 1IC5L 3R06A 3VRLE 3H9HA 5GS1C 5JW4N 3MJ7B 1QLRA 3WDHA 3TNNA 4KRLB 1G9MH 4OZHA 4ZODA 1YDPA 1XIWC 1OSZB 4MVBC 4QXUL 3OXRA 4OCYH 1U36A 3HZYA 5I30H 4P4KB 1ZA6B 1CGYA 3U4BL 5KW9H 3LQMA 2V2WA 3MRPA 3QP3A 3AVEA 2YPLE 3HNSH 4E5XB 4KRPD 3FN0H 4RNRB 1PAMA 4DK6A 3PNWB 5F44A 4R96A 2X1QA 5JOEA 3WIHA 3IF1B 1GGCH 2ATPA 2V7HA 3NIDF 5ISZB 3PG2A 2AJSH 4ZD3H 2GTWA 1D9KC 4Y89A 4IRJB 1UCBL 4JFQA 1BBJB 4KKBC 4ZUWB 5D2LE 4HKZA 4KWUA 1D6VH 5D2NB 5IFHH 5JQ6H 5ADOH 4HEPG 5FGBA 2VLRE 3HCVB 4GS7C 3SGEI 1AP2B 1N2RA 5B8CA 3O3BB 2B5IB 2R23A 1WEJL 4F7CB 4KDWA 3PIQA 3VRIA 3SE3C 1B9ZA 2P5EA 2PR4L 2W65B 4M61B 3QBTB 4ODWB 3VXUB 1LO0H 5F9AC 4G6FB 1E4JA 2AV7B 1U58B 5AG8A 4PJHE 1T5WB 1ZHNA 3H3KA 3OSKA 4QWWC 1M7XA 1NLBL 4OUUB 2PCPB 1J11A 4J1UA 1QFWL 2ZJSH 4LSTH 3V4PH 2L0DA 3A67H 1OGTA 2BXYA 4OGYL 4G43B 4U4BA 4BSJA 3BEVB 5DRNA 3HE6C 4XMKH 2NY1C 1NBZB 1MFCH 2BRRH 1OAXL 2BXZA 1DVFB 5IVZB 2IALA 1LP9F 4MSWB 3BHBA 3WDJA 1CLYL 4PGBA 1OLLA 1W72L 3KXFA 4U1LB 2FO4A 4JQIL 1PJ9A 1JWUB 3LPWA 4J4PA 2HVJA 3L3DB 3QPXL 1BZ7A 2NX5B 2CJUH 2VH5H 1FHGA 2B4CC 2MPAL 4IRSA 1NMBL 4TSBH 3KPQB 3IJHB 1V3MA 2X44D 3JSSA 4PJGA 2MKWA 3IB4A 2FECL 3VXMB 3CX2A 1NGPL 4Y88A 3WFCL 1NEZB 1YPZA 3U0WH 5F6IB 5I1KL 1BX2B 5E2TH 1YMMB 1J05B 3OAYH 2UY6A 4K2UH 1NGQL 3SKMA 3ISWA 4RQQB 1Y0LB 3C8HA 1RIHH 3P4OB 1LE5A 4MA1B 5HGDB 4OI8A 2EEAA 3MRRA 5CIPA 5DUPL 4Y4KD 1LDSA 4WVRA 1KEGH 5BV7H 2Q8BH 4KUCD 4UT7H 1T1ZB 3IFNH 2BVUA 1BZ9B 4A6YA 2YD6A 1Q9KA 3RWEA 2H32A 3MUGB 3BPLC 1HQ4A 4MAYC 4NNXB 2Z35B 4JG0L 3IGAA 1VGKA 3FT3B 1SY6L 3V6ZB 4MWFB 5IJVA 5DRWB 4LNRB 4JFDB 4P2OB 4JQVA 5IK3B 1AO7A 2H9GA 1WC7A 4FQXD 2I9LB 5C0CE 1XGTA 3W0WD 3E6FA 1DBJH 1F4AA 3BQUB 1NH6A 2GY7B 4LLVA 4KQ3L 1XGPA 2P46B 2XRAL 1LE9A 4XNMB 3OMZA 3M8OL 4ZUUA 3GIVA 3SDCB 4APQB 4N5ED 5E9DE 4WGVB 4BYHA 3WS6C 1A64A 4LSVH 2E7LC 3MLSH 3IJYA 2IGFH 3PV7A 1CFQB 1U93A 3OGCB 5FM8A 2IPUG 5DD0L 3CVIH 3B9KB 1E6JH 3CCHB 4G80A 5ALCL 4P46A 2NY3C 4XPAL 5IV2A 4UDTA 4JPVL 3P77A 3E8UL 4YR6A 4EIZC 2SEBA 1KYOJ 5FYJH 2H3NB 5I2IA 3LQAC 4LDLB 1UA6H 2X4SB 5BRZD 4M9OA 1UVQA 3MROA 3EAKA 2C7UA 5D71H 1WAAF 3BH9B 5TH2A 3U7YH 5DHVA 2XA8H 5I1CL 1YY8B 5FOJA 2YUVA 3KPMA 3FB6B 4PJAB 3HI1A 5IMOB 4M43H 5FECA 3RNKA 4QTIH 5ESQB 1EMTL 1AC0A 4UV7H 2DD8L 2P8LA 4MQ7A 4NZRH 3LEVH 2HMIC 4LHUG 3F6IA 3QG6B 5I75C 3KJ4C 3O4LD 3VXTA 4K8RC 1A5FL 3QIWB 4I48B 3KPRD 2WWKO 4JFFD 1P7HL 3ILQD 2MQ0A 2BHYA 1AXTL 4JJHA 4X5LA 2DQHH 1IFHH 3GHEL 1F00I 2GUOA 3QNZB 1S7TB 2APFA 1JI1A 5LKNA 5F7HA 2AEPH 1UB6A 3MRDB 3SHSA 3V9FA 3W39B 3HKFA 5C07E 1JNHA 4PRID 4JCMA 5JNYB 4AENB 3B83A 4HZLB 1NBYB 5C0EB 3MLRL 1I9IL 3MCKA 1SJEB 1MHHB 5F9JB 3QXTA 1QBLL 1ZA3B 1SEBB 2R0WL 2X4NB 5M95B 2YS4A 2A6DA 4KTDL 5DLML 3W9EA 2DQTH 2DTML 3FMGH 1H3VA 1T03H 3P4MA 2YWYA 4D9RE 1U8KA 5J11C 3RWGB 1CFSA 5JHDE 4F33A 3CZJA 2XZAH 5SWSD 1GH7A 2E7MA 2E7HA 2Q86A 3GMMA 3OR7A 1F4WL 1QEWB 5JW3H 4M1DL 1IQWL 5IHLB 4ZTOL 3QEQB 1QR1A 4Y2DB 1IAOB 4ZNCD 2UZYB 4XP1H 4OV5B 4ZOCA 3OGOE 3WFEH 5CEZL 4FZEL 5C8JA 4QRPB 3CAFA 3ZL4H 2VTFA 4PRBA 1UH4A 4K94C 4PRPD 3OKLB 1UZ8B 5D8JL 3CU1A 3G6AB 1YQVH 4OT1H 2WUBH 4PJIB 4PJ7F 4N5UA 4CJ0A 2YA0A 2P5WD 2IBBA 1MCPH 1A2YA 3IKCB 3AFLA 3GMPB 4J3XA 4XP9H 3QCTH 4XHJC 1G9NH 2C1PA 1CXHA 2EXWC 2RCSL 4HF5H 4TQEH 4U6VL 1CD8A 4PRNA 3L5WB 4PJHA 3AS1A 4M4PA 3HS0A 5HI4C 5JW5A 1TZIB 4U1GB 2DWEB 4GW4A 1CU4L 1YEFH 1ZAGA 2VDRH 4MA7L 3DVIA 3S34H 3U4EB 7FABH 4UBDD 4O58H 4YJZL 1C1EL 5FYJE 2HJFA 5B22A 5EBWB 2H26A 1FC2D 2CIKB 2WANA 3TYFB 4LBEB 1T5XB 2F9BT 2D7MA 4ZSOA 2X4PA 5L8JB 2ENYA 4LLAA 3WO4C 4N9OB 4HQQH 5E5MA 3O6FD 1NGYB 2R0KH 2AI0H 5E08H 5EULV 1JHKL 3DXAB 1AIFB 3VH8G 4MYWB 5EU6E 1KPUA 1R3LA 2Z8WC 4CADB 2XG4A 4NUGL 4WW2B 3WS3A 1NC4B 2AXGB 4ETQB 5KSVA 4KI5C 5IG7B 5I1EH 1I3UA 3MA9L 3TO4A 3LKQA 2WINB 3INUL 4L3ED 3VDBA 4RGMC 1NCDL 4BQ8A 3FJTA 4HMDA 3T2OA 5CBAA 3F6LA 4FFWC 1L7IL 4QNPE 4OLVH 1G6RB 1AJ7L 1S9WB 2OR9H 3NAAH 2OZ4H 3UBXG 3MLTA 2BVQA 4FQ2H 3VDAA 3S8WA 4PB9L 2KBGA 1TJGH 2A1WL 3TIDB 4JPIA 4UILH 1LO2L 3FONB 4PREA 4HUVA 2ESVB 1BJ1J 2FATL 5C6PB 1CG9A 3C2AL 4FHBD 3RVXD 5D5MA 3VXPB 1KCKA 3T77A 1Z9SA 5LBSL 3KLSA 3MACH 1J5OH 4OF0A 3ARVA 3QB7C 3HRZA 1HWGB 3CH8A 3W5NA 2CSPA 1E4XI 3UTSE 4OD3H 1WWWX 4GAYA 1WIPA 3KYNB 5F8QC 4LCIH 5DUMH 4PYHA 1KYOK 2PXYD 4NYLB 4Z7WE 2BERA 2GSIA 3EDDA 1BIIA 2F19L 5EC2A 3BP4B 5JXAH 1HNGA 3VWJB 4P5TD 2MSPA 4LK4A 2JIXA 1SYSB 2C3XA 4OZFB 1K8DB 1XEDA 4FQLH 1ORQB 1PZUB 5E1AA 1G0DA 2CH8A 1CD1A 1HHIA 5EU5A 4ZFOA 3QIUB 4P3DA 5CMAA 3IDJB 1QKZL 5CCKH 3GJEA 3UO1H 3K4ZA 3RVUD 4HJGB 5IWLA 2KDGA 2IBZX 4KY1H 2VDLL 5D7KE 1MCSA 2F54A 4GG8A 4G5ZL 3WCYA 1RZFL 4PLOB 2QL1A 1MF2H 4OCXL 1MRDL 2E5EA 2D31A 4NCC2 3WEXB 4NN5B 3OR6A 1HYSC 4S10A 2PYFA 4L4VE 2EZ0C 2FX8L 4Z7UF 3V0WL 2W0FB 3BX7C 2OI9C 4NJ9H 1AD9B 3SGDH 3QQ3B 5CKAA 2LABA 3L5XL 2BVYA 2I5YL 1CGUA 2VZSA 3PDDA 5GS0L 2AK1L 1CVRA 4Z8FH 32C2A 3AU1B 2VISB 1DN0B 2YKLH 5T3XD 1HI6A 3O2VH 3MLYH 4OUOA 3KPLA 1ZEAH 1T21A 2VO5A 5DA0B 4MXWH 4NHCL 2WMPA 4R7NB 5BQ7A 1YY9D 2CGRL 3RI5K 2AVGA 4XCNB 3RU8H 1N59B 4X6EB 5KSUB 1XMWA 3BMWA 35C8H 3L3GB 3RWDA 3SE8H 4RFEA 4PJ9B 1A3RL 1F3JB 2HFGL 5DJCB 5DK2A 3WFBL 1FL5B 2P8MB 4HPYH 5E2UL 3LIZL 3QIBC 4WO4A 5A2JH 4I9WD 1CIDA 4X7CC 1QA9B 1WISA 1CL7I 1FORL 4AMKH 3RDTB 3F5WA 4WI8A 5D1XA 4X98A 3RWFA 1A7RL 3R06B 3D18A 4X6CE 1OGAA 3VGBA 2EDOA 3HE7A 1REIA 5CLTA 3TNNB 4OZHB 1CK0L 3IYLW 4G8FB 1RU9L 3GSWA 3PDOA 4FTVB 3BJ91 3MUJA 2H2SD 1QRND 2Q1EA 2ADGB 4L1HA 4FABH 2DM3A 3CFEA 5D7JA 5A43C 4O9HL 4JHAL 4PR5B 1IT9H 3CPLA 5H35A 3GMLB 1ETZA 4XWGL 5EO9B 4C55A 4LOUC 4MCYA 5JUEH 3AAZB 1XF5B 5JA9A 1UACL 3W9DA 4B5EA 5C0IA 3WXWH 1KIQB 1A7OH 4KUZH 2AGJL 4R96B 2D7NA 2R4RL 2R2EB 4BELD 3GGWB 3MGTB 3CLFH 4F58H 1QPPA 3OJVC 3CJJA 3LH2H 5GJTH 3MODL 1JUFA 1J0KA 4R97C 1MAJA 5ELIA 2FGZA 1NCCL 5IEHA 1DFBL 1G0XA 4QRUA 1VCAA 3ULSA 4S11A 1CXKA 4XNQA 2XXCB 2GHWB 3BPNB 4LAQH 3QRFM 3SDXE 3DJ9A 3VE0B 2LU7A 4WHTB 4UNUA 4JO3L 5MEOA 2VDOH 4K3DL 3IU3A 2VNCA 1F42A 5TDOA 3NFSL 3DMMB 2R23B 3WN5B 4BK4A 4NZJA 1HHKB 3EOTH 3GSVB 3KPSE 5I71B 4Q97A 4XAWH 3EO9H 2Y36L 2KZ1B 5DT1L 2R4SL 1HOCA 4YZFE 3VD4A 1MJ8H 5D7IF 1JGUL 1PVHA 3ESUF 2DLFH 3TZVA 2BJMH 4GAJH 1B3JA 25C8H 4PUBH 3TBTA 3ZHDA 3U0PB 3QQ4B 5IVXF 3CSGA 1RZ7H 1PG7W 1NFKA 3VRJB 2FEDD 3PWUA 5KVGL 1Q9WA 2VZTA 4XVSL 3UJJL 3VXRA 1R5WA 4XNZC 3S37L 5K9QG 2VXQL 2ICWJ 3AS2A 4MJ6A 4ZTPL 2X2YA 5TGBA 3SPVA 3ULUL 2P49B 1RPQA 3FFCE 1MJ7H 4K71C 5JTWA 4HUNB 5FYLL 3LS5L 2NLJA 3GI9H 4HWZA 3SE4C 1LO3H 5IFAH 3UEZA 5IVNA 3QUML 4MNHA 5LG1A 4CVUA 2J8UA 3EYVB 4E9LA 1MQKH 3HHRB 1B4JH 1LEGA 2I25N 5FUZH 4TSCL 3MPCA 4JFZL 1YEGL 1ZT4A 4HS8H 4LGSB 2ORBH 1MJUL 2FEEL 3F7QA 1NGWA 1NDGA 4ZAKD 3WE6A 1HHGB 1A9EA 4Q6IC 3L3OB 4XXCA 2ADIB 4OQTH 4KHTL 1INQB 4NM4L 2HAZA 4OD2A 3ROOB 2WAHA 3QCUH 1FYTE 4GRMB 1U2HA 2FX9L 1SVCP 2I9TA 4H5SA 3OZ9L 3R1GH 4PBVC 4UTBH 3SKMB 1RVFH 5ID0A 3NFPB 3EOYG 5LGHH 1LE5B 2CLZB 2YBRB 3EYOA 3D39A 4PBWD 4GJTB 1ZLWK 3X3FH 5E4EC 3HG1B 4EI5A 4U1JB 1IAIH 4KTEL 3Q1SH 4KKAD 4S1SL 4FQHA 1EHNA 1CF8L 3QRGL 3Q48A 1MWAL 4JM2B 2H32B 1X7QA 2XN9A 1KJ3L 1ZSDA 3SJVB 4PJ7B 3QCVH 4LCCA 1OAQH 3VFOA 2FJGB 5DO2C 2AJ3B 4X5WB 4X8XA 1YN7A 3QI9D 5T3ZL 5I1DB 3HZKA 1XGTB 5ERWB 5H94A 4RMVA 4XBGB 2JCCE 4JN1L 2DQCL 4Z5RA 3VGDA 2CKBB 4LLVB 4NKOA 3K1DA 1UWEL 2VZ3A 1TIUA 1R6VA 1XGPB 5ALBL 4DVRL 5C0BD 3MR9A 3S35L 5ITBL 3TA3C 4M1GH 3P0GB 1DR9A 4R4BA 2EDDA 5D72H 3QDAA 1HN1A 4WJ5A 1FVCA 4ZQKA 1JGVH 4L4JA 2BOBB 4LIQE 2Q20A 1U93B 4R4ND 3BKCH 2J7LA 4G6ML 3VFMB 1A4JA 2F53A 4CKVX 4P46B 5C6TL 2NXZC 5IV2B 3IDNB 4UDTB 4LPWA 1ZHBA 3MMEA 1QFPA 3W0WE 2HKHH 2VWEE 5GGSY 4X6DE 1S9XB 2MKLC 4QYOB 1FBIL 5BS0A 1FNAA 4NM8L 5D7SL 4R0LC 5GISL 5TH2B 3BE1L 4S1RL 5HJ3B 3AREB 1EPFA 1ZXQA 5FF6A 3MV7B 3KJ6L 3BZEB 4PB0L 5FECB 1TLKA 5I1HH 3ARWA 4KRNA 3T0ED 2E7LA 3GM8A 2DLGA 4MQ7B 4QNPF 1T66D 4F7TA 4HS3A 1B0GA 1FNLA 3DYMA 4JLRA 3VXTB 2PKDA 1KJ2A 4PRDB 1EAPA 1S9VA 4XB7A 5DK3A 4X99A 4R26H 1UM5H 2XI9A 5GZND 4BKLA 5A2IH 4I0PD 3UDWA 1CR9H 2A74A 2WBJA 5A1AA 5BXFB 4L8CA 5GRVL 3V4UH 5BRZE 1NAML 1NCTA 4DN4L 5DJ2B 5E8DL 2N7BA 3QJFB 1IE5A 4RWHA 5EZOH 3VGAC 1UB6B 3HI5L 4LDEB 2X70B 1TMCB 4IMLA 3JWDL 1YQ2A 4LPTA 3EYSL 4YBHA 1KB9K 3RBSA 4JZOA 5E99L 1Y6KR 2YPLB 2C3GA 3MCKB 2DYPD 1IM9A 2NY2D 1F6LL 1EEUA 3FQTB 1J8HD 3A6BL 4MJID 4CW1A 2J6EL 5HHVL 5TQ2L 4DQOL 3P4MB 3IRZA 5DJYA 2JJVA 3VFNA 1U8KB 2XT1B 4JFFE 5F1NA 4F33B 4MD5A 2AJYH 1Q0XH 3VG0H 4Z7WF 4D3CH 1TJIL 2C3WA 3GMMB 2Q86B 3OR7B 4LCWD 2EKSA 1I4FA 5D2LB 1NFIB 3TT3L 3U46B 4ELME 4JZNA 4POYA 2BNRD 4TRPL 1ZLSH 4H1LB 2VLRB 2MCPL 4WI2A 3CFBA 3Q3GB 5LQBL 2H1PL 3BDYH 4PRBB 9CGTA 1MY7A 3RPIB 2NY1D 3UJIL 4LAJH 3ARZA 1KTLA 5C0AA 1N64L 1A2YB 4KJWD 1YEJL 4PGCA 6FABH 3SE9L 3R0NA 2J88L 4NFBA 2ZCLL 4OLWH 5C0RH 3WXVH 1KBGH 4PJHB 5F7FA 5SWSE 3VCLA 2B1AL 1U8HA 3HI6H 4OJFH 1QPXA 3B2VL 3S3JA 1ZWIB 1YJDH 3MLZL 3MYZA 5HYJD 2C3VA 2FIRT 5DWUH 3HA0A 4QTHA 4S1QL 3HAEA 1SYVB 1JL8A 1T0PB 2HJFB 2R0LL 4PJCE 4PTUA 2NY4C 2ZPKH 4HAFA 1MCLA 5H2BA 4ALAL 4RGNE 1A7PH 3GRWL 3F62A 2P5WE 3R8BB 1DLHB 3FQWB 3WO3B 2D9CA 4PJXF 1M1SA 2J5LB 3UJTH 3S7GA 3RIFF 3W11C 5TQ0H 3UTTD 1DE4A 4YNYB 1CT8A 2B1HL 4NO3A 3SDAB 4CDGC 4C56E 3RVWD 2QADD 4O51A 5KSVB 4FQ1H 1ULVA 1E4WH 1JF5A 4L8SB 4OBRA 2R8SH 1RJZA 4NQSB 5C71A 4XTRD 3U9UA 2BNQD 4OB5H 4HHAA 2EKJA 4D2NA 5C7XL 1AKJB 3DX6A 5JW4R 4WIQA 2ZUQC 4FQJL 3NCBB 4LNVA 3TCLA 4XP5H 3ZE0E 4OV6F 4QO1A 1I1AD 4MAUL 1CN4A 2DLIA 2BVQB 2R69H 1PKQA 1Y6NR 4ERSH 2AV1A 4PRHE 1UJTA 1QFWI 1LO5B 4QHUA 4LQFH 2I60H 4U7MA 4O4YH 4PJEE 1LK3H 2DWDB 2KUTA 1OTSC 2FO1A 3LRSA 5D5MB 3QDMD 3X17A 3T77B 3CLEH 4L3EE 4L8BA 2A6JA 1J12A 1DQMH 2OTWA 4NT6B 3HRZB 3NIGF 4X5XB 5C0CB 5IMLB 2PF6A 5EIQA 4K55A 1HH6A 3QFJA 3I6LD 4O2CA 4P9HL 3TC9A 5EBGA 1DANU 1KTDB 2BSTB 3BMVA 2CDFB 2MHAA 3O3AA 4GAGH 1GXEA 1CICD 1YN6A 2A6KA 2QEJA 3QUYD 2QQLH 5DEGB 4DKEH 2DQFA 4Y4KA 4HKXB 4YHLL 3ZKQD 5E9DB 3ARGC 3DRQB 4GXVL 5IW3A 4P59L 2GSIB 2FECI 1A9BA 5J6GA 2WSKA 1NGXA 5J57B 5EC2B 4KRMB 4AL8H 5FYKL 1AGEA 2R0ZH 3SDXF 3REVA 2VQTA 1LWRA 3BWAB 3KNBA 2DOCA 5I18L 1D5ZA 1XAUA 5T1KB 1V7NH 1P1ZA 2NY7H 2Z31C 1BZQK 1H5BC 4X7TA 3AUVA 4FQXA 2HMID 5EU5B 3O41B 4BH8A 5ESVB 4LFHG 5J4MA 2YD9A 2VL4A 2YZ8A 4O00A 4BH7B 4XPHH 2XTJC 5GGSB 5MP6L 43C9B 2VR9A 3GBMH 5CJQH 1TTGA 4YZFF 4GRLC 2BHUA 5GS0C 1NJ9A 3MRHA 4EOWL 1KELH 5I9QB 2EE9A 4H25A 1AXSA 1JE6A 2OJZH 3UZEA 3ARXA 5DVKA 4PJDE 3CU7A 4P2CG 2PYFB 3TWCL 1G7MB 2NY6B 4WEUD 1NL0L 2XWBB 4HFUH 5E5RB 1SMOA 4TNVF 4NDMB 1S3KH 1XGQA 4NN7C 5KSBE 5I8OL 1EJ6A 4NKIL 3UPRA 2X7LA 3JTTA 1EH9A 4JFEE 5BOZG 5K9OB 32C2B 4M6NL 1U2CA 3OPZL 1WTLA 5ICYB 3IDXL 1C5CL 5BRZA 4GT7A 4ZOAA 4RFOL 4Y8AA 3C6LC 1J9CT 1T21B 5IQ9A 5E6ZA 1HK6A 5C07B 2FX7L 1DBKH 5EOCH 4LSQH 3I3EA 1F3DJ 1RFDH 5A16A 1HXYA 4NQCE 1M7DA 2AABL 5HGBA 3PGFH 4R7DA 2ICWI 5F7DB 2LTQB 4PS4H 1HEZA 4RFEB 3QWRD 3NIFE 3QH3B 5F3BA 4GOSA 2G60L 3O4LA 1G7PB 4OM0H 3BXNA 1F58H 2ZKHH 3ARDD 3I2CL 1WBYA 5BV7B 2CIIB 3KPRA 4YFLI 4FA8A 4CMHB 1I3RA 3ET9F 4XHJD 4Z0BH 1RUPH 2EC9U 4WO4B 2EH7H 2MFNA 5JHDB 1KJVA 4NO5B 1OP9A 1AH1A 2HLFC 4QHLA 4ZUSA 1DUZB 4WEBH 1HXMB 3BW9A 3T3PF 1OLZA 3RWFB 4OZGE 3OKYA 2A73A 4WU5A 3C6SA 3DUSA 1DBMH 3HE7B 4LDOB 3T8XB 1OB1A 4PRIA 3PDOB 4OGXH 4M7JL 1JWMA 2AXFA 3HB3D 3CFIC 4ZUVB 5E00A 4Q58C 5D7JB 3RTQC 4KK6C 2VQ1B 2X6MA 5EO0A 4P4RA 1TZHA 1WSST 3SCMC 4NKDA 1MCCA 5F9OH 5K9KB 1A6UL 4RFNC 4MCYB 4X9HA 1BBDL 2MQ3A 3JVGC 1C08A 5T5FL 5C0IB 5KVEL 5K93A 1OD9A 2DKMA 5D6CA 3PWNA 3FB7B 3P9WB 4JANA 4MS8D 3BT2L 4M62L 1WFOA 4D9LH 3CIQA 1ZVHA 3NCYS 1YYLL 3PQYA 3BPOB 1JUFB 1D5XB 3QAZC 5IEHB 1GPOH 4KUCF 4QRUB 1AQKL 4KI5D 3ARFD 5C3TA 4KGJA 1RZIB 1KCSL 4XNQB 1ERNA 1XGUA 1NMCB 2R1XA 4OD1H 3STLA 4PRPA 5L88L 2EEBA 1G7QB 3GDBA 2X1PA 3GJFK 3BKYH 4LLMB 3GMRA 1GYAA 1CFNA 4FFWD 3IU3B 1A6WL 1HHJA 5DR5L 2VLJD 5L6YH 4EKXA 3TVMD 2XA3A 1N7ML 1DBBH 3ZKMD 1K3IA 3EDKA 3LPGA 1K6QL 3FT2B 4KZDL 3EFFA 4M03A 4DAGH 3F58L 4PV9B 3P4NA 4NNPH 4LL9A 3QWQB 4EN3B 1T22A 3FB8A 4M8QA 4WRLA 4ONHB 3ULUC 3QEHA 5I73B 1OTUC 3TBTB 4GO6B 2IAMB 3VD3A 4M8VA 1FNGB 1YECL 4GMSH 2IMMA 3PWUB 1OP3K 5GGTA 3MRKB 3S96A 1CGSL 4JKPH 5KANI 4G6KL 4GKZA 2P24A 2OJEA 3MLUH 3QPQC 4GQPH 4HWBL 3OX8B 2ZCKH 3O4OC 5BZWA 5L2KA 5F7YC 5IB1B 3RVTD 3BZ4A 5TGBB 3KDMB 3O6FA 1Q9LB 5IT2L 1QBAA 3WUWG 3E2HB 4TNWK 4DVBA 3N85L 2NLJB 5FO8A 4L5FH 4L9LB 2OTUA 1KEML 3RWCA 1FVDB 1RURL 4N8VA 5TF1H 1VADA 3GSNH 5SX4H 2OXGA 5DGQA 1ZT4B 4U1MB 3DGGB 1NGWB 4IBLT 1CXEA 4C4KO 4ZFGL 4GMTH 3WE6B 4RGOL 4HUXA 1HWHB 1CLZL 1KOAA 1IGFH 1TVBB 2DBLH 5I74C 4JREB 4JHWL 4IRJD 3IDIA 3MNWB 3JUZA 4OD2B 5GZOD 4Z0XB 3ABZA 3UTSB 3HNTH 5HHMD 1P5VA 1QSEE 1FO0A 4G42A 4DFHA 1R5IB 1MCIA 3LZFH 3KYOB 4TYUA 4P57B 1HIML 2UZIH 1QSFD 2BY1A 5DJ6B 4YQXH 5T5NG 3MQIA 5FV2A 1I3VA 4OLZH 1MAKA 3LSOA 5GRUH 5E94A 4HFWA 1KF9B 3QT2A 5K9JH 5C0FA 3DSFL 4LCCB 5L2JB 3LD8C 3V6OA 1MREL 4MNQD 3D69B 2HT2D 3QUZC 4FN0A 4YPJA 2NYYC 3HZKB 5H94B 2DQUL 4LLDA 4X9BA 1KC5H 4P23B 4UIMB 4D9QD 5IGXH 1JPFA 4JHBA 5I1AA 1EGJH 5DMGD 4I0CC 4LLUB 4JRYD 2WUCH 2EDHA 4NKOB 5MEND 5DMIH 4MHHI 3O3UN 4LSPH 4L4VB 4OAWA 4XB8A 1UZ6E 1WT5A 4PJGF 2QKIA 2BVPB 4F57H 4UU9A 4UTAL 1U8OA 3C08H 4Z95H 5EOQH 4NQTA 4DGIH 3A6CL 2A6IA 1YPZF 4CN6A 4WJ5B 2F5BH 1QG3A 3S88H 4MDIB 4PJCF 3Q2CA 3W2DL 3KR3H 3HNVL 1FV1B 2FBJL 2WP3O 1S8DA 1F4YL 2PTTB 4HX1A 1A4JB 2NX5D 5BMFH 4ACPA 3HAEG 5B39A 5ECJE 1CFTB 1ZHBB 2N7AA 4RMRA 2FZ3A 1KFAH 1LNUB 3DHJA 4XGZB 3VXMD 2Q87A 3VFSA 4K3GA 5MERB 5E2VL 3MBXL 4AH2B 4YHZL 4QXTA 2RR3A 5C0BE 1QLFA 1A8JH 3MRLA 2K1MA 5FF6B 2F58H 4TTGA 3DUHA 1XZ0A 2FL5B 2Z9TA 1BFSA 4TUOA 3MBED 4I1NB 4J3OC 4OI9A 5FXCH 1BEYH 5I17A 2FCBA 1L9MA 1Q72L 4JGUA 5TJWK 4DKFH 2D7QA 5DD6A 4U6HA 4NC2B 3O6MH 2XFXA 2B4CH 3K4AA 1KG0B 5SWZA 1RZKC 5EWIH 4HS3B 3KAAA 3JWDC 1J1OL 2UZXB 2PW2A 3N9GL 1B0GB 3SGJA 1A14L 3NZ8A 3ZE0F 3S35X 3QEGL 4X99B 2UUDK 4BKLB 1G6VK 4X6CB 4XNXL 1RUAL 2A74B 2WBJB 2YK1L 4L8CB 1T0MA 3EYUH 4XNUH 3OHXB 4HIHB 4LEXH 3CNKA 1K3ZA 5JR1L 4P2OD 5CUSH 4IJ3B 3PV6A 1INDL 1BWMA 4Y8DC 4IMLB 3VFRB 4E42A 3C8KB 1ZGLB 1U3HC 3M17A 4HKBB 3T0EE 4MJ2A 1YNKH 5DZOA 2HRPL 3IFPA 1ZK9A 3CSYA 4PJBE 3O8XA 4HV8A 3T4AA 1VPOL 4M7ZC 1ZV5A 1BJMA 1R0AH 1LEKA 3THML 2HTLC 3ZDYE 2Q76A 3JWOC 1KIRA 5DSCB 2BFVH 5DQDH 4U1IB 1Z9LA 3LCYA 4NWTL 5I1GH 4WFED 1UXSA 1TTFA 1QRNA 3VFGH 1XF2B 1N4XL 5LCVL 3LHPL 3U30C 4KVCL 3SDXB 5D1QA 4JDZA 4DUVA 1IGTA 4YFEA 4M7LH 2KKQA 3LN5A 4Y5YB 5DJAA 3GB7A 3MGOA 3QZWA 3SQOL 1X5YA 3H6JA 1EO8H 1EERB 4JZJB 4KRPB 3JUYA 3QDGD 5I66A 5DVMA 3RJQB 4PGZA 4MA3B 5DMKA 1KTLB 3LKSA 4KHXL 2GK2A 4LSUH 1FJ1A 1UB5B 4NZUH 3V5HA 1KTKE 5EPMA 2E8YA 4YDIH 2R15A 5ACLA 1HKLH 3I3DA 2BCKB 2I07A 5AUMA 2Y7QA 3WMSA 1U95B 2NNAA 4PJDF 4KV5E 3TH2T 3U83A 2EEDA 2RIKA 1FNSH 2BNRE 1R3JA 3LQAH 3D1MC 1W8OA 3QIWD 4K7PH 4NP4H 5D93B 3T2NL 3B5GA 2DQGL 1TJHL 3D2UA 2Z91B 3B2UC 2Z4QA 5I1JL 3DVGB 2YMXH 1YZZA 2VDQL 1VGEH 5ETUA 2OXHA 3KPTA 3BIAX 3O2DH 2CMRH 3L3JB 1GGUA 1DBAH 2RHEA 4XPFL 3MREA 3SOBL 3FFCB 2DLEA 5EIIA 3Q5TA 3RAJL 1D5MB 2G5BA 5HHPA 2B0SL 3I75B 2DQIH 4XVJL 4DW2L 1QFUL 5I8EB 7CGTA 3D48R 4GBXC 4YDJB 4QEGA 4YO0A 1PZ5A 5HI3C 3BISA 1CTOA 4LRIA 4KPHH 2GITB 1JHLL 4JPWL 1B0RB 3QQ9C 1NUGA 3DI2B 5IJKA 1RJZB 4IRZH 2FHFA 2BRQA 5BW7A 4S1DC 2X4TB 2YPVH 2Y5EA 1LO4L 1KT2A 4XC3H 4CN4A 2YZ1A 5FAAA 1P84J 5DO2D 4WCYH 4XPGH 3OG6B 1I9RH 3CFJA 1MFAH 1JN6B 3WIHL 2B5IC 3KYMB 4ODSL 4QRPD 1MCWM 2EH8H 3UTTE 4DN3L 3OKMA 3VMOA 3EJZC 4OZGF 3G6JA 1NC2D 2AV1B 1N6UA 4Y1AD 5AAMA 2OX5A 5IMMA 3MA7A 2YPKA 2Z0BA 1B0WA 5JZ7C 4MJ4A 1FYHB 4P9HC 4XC1L 3T1FA 3TA3D 5C0JA 1H15A 4ZAKA 2EDNA 5AYQA 2XKNA 3LVEA 1RK0A 2W0PA 3FT4B 3KPNB 3DURA 4N0CD 3K3QA 4QF1B 3RX7A 3CZFA 3AXLA 3BSZL 2BNQE 3G5VA 5IW1A 2JCCB 1HNFA 2XXMB 3IDGB