4ZUXB

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
total genus 25
structure length 83
sequence length 83
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxB00
4J8VD 1KU5A 3VH5W 3REHA 3MGQC 5GXQD 5AV5A 4XZQB 1AOIC 5DNMC 3X1VD 3AZLA 5F99A 3REKA 3O62A 3AZFA 4JJNC 4EO5B 5CPKA 5AY8B 3WAAC 1KX3C 1P3BC 1HQ3B 1KX4A 1P3FD 3AV2C 3AFAA 4R8PD 3AZIC 3X1TB 4HGAC 3W96C 4H9QB 5B1LB 3W97D 2NZDD 2LY8A 5BS7C 3X1SA 3RELB 4X23A 5JRGD 4XUJD 4XZQC 3UTAB 1P3AD 3C1BC 1ID3A 4Z66D 3B0CT 4J8UB 3REID 3REHD 1M1AB 2AROC 5AV9D 5AV5D 3MNNB 5AY8C 3KXBA 1P3MB 1HQ3C 5F99D 3AZFD 3O62D 5CPKD 1P3KB 4KGCC 4ZUXC 1WWSA 3X1TC 2HIOB 5AVBC 3KUYB 4G91B 5B31B 3LZ0B 1F1EA 3RELC 5AVCA 4KHAB 1P34D 5B32A 4J8WB 4Z5TB 3A6NA 3X1SD 3AZEA 1KX5A 4H9NB 3WA9B 5GSUD 4KUDB 1M1AC 2NQBB 1P3LB 1U35C 4UUZA 1P3MC 3AZNB 3MVDA 4H9RB 5B0ZA 5DNNA 3W99B 1P3KC 5KDMB 2HIOC 3KXBD 1EQZA 2F8NK 3KUYC 3NQJA 5B0YA 3LJAD 3AV1C 2CV5C 2PYOC 1BH8A 5B31C 3LZ0C 2YFVA 1S32A 3REJD 2RVQC 4H9OB 4YS3B 1BH9B 4J8WC 4Z5TC 4J8XC 3KWQB 2HUEB 5AV6B 5B1MB 3WKJA 5AVCD 4KUDC 2BYMB 2NQBC 4CAYB 1P3LC 3AZNC 3X1UB 3AN2A 3C1CB 4NFTA 4QLCC 3AZJB 2FJ7B 5CP6D 1TZYC 3X1TD 5B1LD 5B40A 1P3GA 1P3IB 5JA4B 4YS3C 2IO5B 5B2JA 5B0YD 3UTAD 5B1MC 5CPIB 3LZ1B 3AZGA 5GT3B 1P3OB 3AZMB 4J8UD 4WU9A 2CWEA 3MNND 1TAFA 3WKJD 1P3MD 3X1UC 1M19A 5CPJB 3C1CC 2FJ7C 4CSRB 5GXQA 4YM6B 1P3IC 1M18C 3X1VA 5GT0B 1HTAA 2IO5C 1AOIB 3AYWC 5CPIC 4LD9B 1P3GD 4G92C 3LELB 3AZMC 3WA9D 3UT9D 4WNNA 4DRBA 3REKB 3W97A 3AZGD 3WAAB 3W99D 3AV2B 4XUJA 1P3AA 4HGAB 4YM6C 1M19D 3AZKB 3W96B 4Z66A 5AV8A 1F66C 3REIA 5AV9A 3V9RB 3MGRA 3KWQD 3C1BB 2BYKB 4LD9C 3LELC 3TU4D 5AV6D 4Z2MH 2AROB 3AZLC 3REKC 1ZLAB 5B2IA 4KGCB 3R45B 3VH6W 4ZUXB 3AZJD 5FUGB 1P34A 1KX4C 3AZKC 5AVBB 1A7WA 3MGQA 3B6FB 5GSUA 5E5AB 1P3PD 5BNXA 4WU8B 4X23C 4JJNA 5AV8D 3MGSB 3AZHB 3LZ1D 3MGPB 5GT3D 1P3OD 1ID3C 3B6GD 3MGRD 1KX3A 1P3BA 3A6NB 1U35B 1ZLAC 3WTPD 3LJAA 3AZIA 5CPJD 3REJA 5B0ZB 2YFWB 1N1JB 5B2ID 2CV5B 3AV1B 2PYOB 4XZQA 3B6FC 4E44A 5E5AC 4WZSB 5B31G 5GT0D 4WU8C 4J8XB 3MGQD 1AOID 3MGSC 3AZHC 5AY8A 5B32C 3MGPC 5DNMD 1H3OB 3A6NC 1HQ3A 3AZEC 1KX5C 4H9SA 5CP6A 4JJND 1R4VA 3X1TA 4H9QA 5B1LA 3WAAD 3MVDC 5B0ZC 5DNNC 1KX3D 1P3BD 4WV4B 4QLCB 1TZYB 3AV2D 5B33B 3UTAA 3AZID 1EQZC 3W96D 5BNVB 4J8UA 1S32C 3W98B 1M1AA 3MNNA 4XZQD 1BFMA 3C1BD 1P3MA 3UTBB 2F8NB 4H9PA 1P3KA 3WTPE 2AROD 5B24B 2HIOA 5AY8D 1JFIB 4WU9B 3B0BA 1ULYA 1HQ3D 1TAFB 4KGCD 4ZUXD 5B33C 3AN2C 5BO0B 4KHAA 4ZBJB 5AVBD 4J8WA 4Z5TA 4J8VB 1M18B 3RELD 3WA9A 4H9NA 3W98C 5E5AD 3UT9A 5B40C 2NQBA 1P3LA 3AZNA 3AYWB 3UTBC 5B2JC 4H9RA 4NE3A 3W99A 4G92B 3MGPD 1M1AD 5KDMA 5B24C 1U35D 4WU9C 5BT1C 3NQUB 1P3FB 2JSSA 4R8PB 1P3KD 5G49B 4H9OA 3W97B 4NE6A 2HIOD 2NZDB 4ZBJC 4YS3A 3KUYD 4J8VC 3KWQA 3AV1D 2CV5D 2PYOD 5B31D 3LZ0D 5JRGB 3TU4A 5GXQC 5B1MA 5AV6A 2RVQD 1F66B 2BYMA 4CAYA 3X1VC 4NE5A 4J8WD 4Z5TD 4J8XD 3REHB 5AV9B 5AV5B 4KUDD 2NQBD 3C1CA 1P3LD 3AZJA 2FJ7A 3AZND 3AZLB 5F99B 3AZFB 3O62B 5CPKB 1P3FC 4R8PC 4M6BA 3W97C 2NZDC 1P3IA 4QLCD 4AWLC 1P3PA 1TZYD 2L5AA 1KX4B 3AFAB 5JRGC 4XUJC 1P3AC 3VH5T 5CPIA 3LZ1A 1P3OA 5GT3A 3AZMA 3B6GA 4YS3D 4Z66C 3X1SB 3REIC 3WTPA 4X23B 5GSUB 3REHC 5AV9C 5B1MD 5AV5C 5BNXB 5CPJA 1ID3B 2F8ND 4CSRA 5F99C 3AZFC 3O62C 5CPKC 3VH6T 5BT1D 3KXBB 4YM6A 3X1UD 3C1CD 2FJ7D 5GT0A 3AFAC 1P34C 1AOIA 4LD9A 5DNMA 1P3ID 3LELA 1M18D 3X1SC 5GSUC 5AVCB 3AYWD 5CPID 5B32B 3WAAA 3AZMD 5B32G 3AZEB 1KX5B 3AV2A 3KXBC 4UUZB 3W96A 3AZKA 5CP6B 3MVDB 5BS7A 5DNNB 3LJAC 3REJC 3V9RA 1EQZB 4YM6D 3C1BA 2BYKA 3NQJB 5B0YB 1BH8B 1F66D 2YFVB 3VH5A 1S32B 5AVCC 2AROA 1ZLAA 4LD9D 3B0CW 4EO5C 3LELD 1B67A 5CHLB 4KGCA 3WKJB 3R45A 4ZUXA 5FUGA 3AZLD 4H9PB 4H9SC 3REKD 5CP6C 5AVBA 3RELA 3VH6A 3B6FA 5B1LC 5E5AA 3AN2B 1KX4D 3AZKD 4WU8A 3AFAD 5B0YC 3UTAC 3MGSA 3AZHA 3MGPA 5B40B 1P3GB 1U35A 4J8UC 4E45A 4X23D 5B2JB 3MNNC 3UT9B 3WKJC 1ID3D 2F8NG 3AZGB 2YFWA 1ZLAD 1N1JA 3KUYA 2CV5A 3AV1A 2PYOA 5B31A 3LZ0A 3KSYA 5C3IB 1M19B 4G91C 4Z2MG 4J8XA 3B6FD 5GXQB 4DRAA 4KUDA 1P3GC 1H3OA 3TU4B 3X1VB 3WA9C 4WU8D 3UT9C 3MGSD 3AZHD 5B32D 3AZGC 3B0DB 3W99C 3A6ND 3AZED 1KX5D 4QLCA 1TZYA 5B33A 4WNNB 5C3IC 3MVDD 5B0ZD 5DNND 1M19C 5BNVA 4AWLB 1BH9A 3W98A 1EQZD 4XUJB 1P3AB 1P3PB 3UTBA 3KWQC 2HUEC 2F8NA 3TU4C 4Z66B 5AV6C 5AV8B 1S32D 3REIB 5B24A 1JFIA 3B6GB 3MGRB 3X1UA 3B0DC 3WTPB 5BO0A 3AZJC 5B2IB 4J8VA 1M18A 5JA4A 5B33D 1WWIA 3AN2D 1P34B 1P3PC 3AYWA 1Q9CA 3MGQB 5AV8C 3W98D 5B40D 3LZ1C 1P3OC 5GT3C 5DNMB 3B6GC 3MGRC 3UTBD 5B2JD 3NQUA 3WTPC 1P3FA 4JJNB 4R8PA 5G49A 5CPJC 5B24D 2NZDA 1KX3B 1P3BB 4WU9D 1B6WA 5B2IC 5JRGA 3LJAB 3AZIB 1F66A 3REJB 2F8NH 5GT0C
chains in the Genus database with same CATH superfamily
4J8VD 1KU5A 3VH5W 3REHA 3MGQC 5GXQD 5AV5A 4XZQB 1AOIC 5DNMC 3X1VD 3AZLA 5F99A 3REKA 3O62A 3AZFA 4JJNC 4EO5B 5CPKA 2UWXA 5AY8B 3WAAC 1KX3C 1P3BC 1HQ3B 1KX4A 1P3FD 3AV2C 3AFAA 4R8PD 3AZIC 3X1TB 4HGAC 3W96C 4H9QB 5B1LB 3W97D 2NZDD 2LY8A 5BS7C 3X1SA 2RIQA 3RELB 4X23A 5JRGD 4XUJD 4XZQC 3UTAB 1P3AD 3C1BC 1ID3A 4Z66D 3B0CT 4J8UB 3REID 3REHD 1M1AB 2AROC 2DF4C 5AV5D 5AV9D 3MNNB 5AY8C 3KXBA 1P3MB 2Y2PA 1HQ3C 5F99D 3AZFD 3O62D 5CPKD 1P3KB 4KGCC 4ZUXC 1WWSA 1Z2CB 2HIOB 3H0LC 3X1TC 5AVBC 3KUYB 4G91B 5B31B 3LZ0B 1F1EA 3RELC 2XD1A 5AVCA 4KHAB 1P34D 5B32A 4J8WB 4Z5TB 3A6NA 3X1SD 3AZEA 1KX5A 4H9NB 3WA9B 5GSUD 4KUDB 1M1AC 2NQBB 1P3LB 1U35C 4UUZA 1P3MC 2JE5A 3AZNB 3MVDA 4H9RB 5B0ZA 5DNNA 3W99B 2Y2HA 1P3KC 5KDMB 2HIOC 3KXBD 1EQZA 2F8NK 3KUYC 3NQJA 5B0YA 3LJAD 3AV1C 2CV5C 2PYOC 1BH8A 5B31C 3LZ0C 2YFVA 1S32A 3REJD 2RVQC 4H9OB 4YS3B 1BH9B 4J8WC 4Z5TC 4J8XC 3KWQB 2HUEB 5AV6B 5B1MB 3WKJA 5AVCD 4KUDC 2BYMB 2NQBC 2XD5A 4CAYB 1P3LC 3AZNC 3X1UB 3AN2A 3C1CB 4NFTA 4QLCC 3AZJB 2FJ7B 5CP6D 1TZYC 3X1TD 5B1LD 5B40A 1P3GA 1P3IB 5JA4B 4YS3C 2IO5B 5B2JA 5B0YD 3UTAD 5B1MC 5CPIB 3LZ1B 3AZGA 5GT3B 1P3OB 3AZMB 4J8UD 2FFFB 2ZY5A 4WU9A 2CWEA 3MNND 1TAFA 3WKJD 1P3MD 3X1UC 1M19A 2Y2GA 3C1CC 5CPJB 2FJ7C 4CSRB 2Y2NA 5GXQA 3H0RC 4YM6B 1P3IC 1M18C 3X1VA 5GT0B 1HTAA 2IO5C 1AOIB 3AYWC 5CPIC 4LD9B 1P3GD 4G92C 3LELB 3AZMC 3WA9D 2VQRA 3UT9D 4WNNA 4DRBA 3REKB 3W97A 3AZGD 3WAAB 3W99D 4WJ3C 3AV2B 4XUJA 1P3AA 4HGAB 4YM6C 1M19D 3AZKB 3W96B 2Y2LA 4Z66A 5AV8A 1F66C 3REIA 5AV9A 3V9RB 3MGRA 3KWQD 3C1BB 2BYKB 4LD9C 3LELC 3TU4D 5AV6D 4Z2MH 2AROB 3AZLC 3REKC 1ZLAB 5B2IA 4KGCB 3R45B 3VH6W 4ZUXB 3AZJD 5FUGB 1P34A 1KX4C 3AZKC 2G5HC 5AVBB 1A7WA 3MGQA 3B6FB 3IP4C 5GSUA 5E5AB 1P3PD 5BNXA 4WU8B 4X23C 4JJNA 5AV8D 3MGSB 3AZHB 3LZ1D 3MGPB 5GT3D 1P3OD 1ID3C 3B6GD 3MGRD 1KX3A 1P3BA 3A6NB 1U35B 1ZLAC 3WTPD 3LJAA 3AZIA 5CPJD 2Y2JA 3REJA 2F2AC 5B0ZB 2YFWB 1N1JB 5B2ID 2ZY3A 2CV5B 3AV1B 2PYOB 4XZQA 3B6FC 4E44A 5E5AC 4WZSB 5B31G 5GT0D 4WU8C 4J8XB 2ZM5A 3MGQD 1AOID 3MGSC 3AZHC 5AY8A 5B32C 3MGPC 5DNMD 1H3OB 3A6NC 1HQ3A 3AZEC 1KX5C 4H9SA 5CP6A 4JJND 1R4VA 3X1TA 4H9QA 5B1LA 3WAAD 3MVDC 5B0ZC 5DNNC 1KX3D 1P3BD 4WV4B 4QLCB 1TZYB 3AV2D 5B33B 3UTAA 3AZID 1EQZC 3W96D 5BNVB 4J8UA 1S32C 3W98B 1M1AA 3MNNA 4XZQD 1BFMA 3C1BD 1P3MA 3UTBB 2F8NB 4H9PA 1P3KA 3WTPE 2AROD 5B24B 2HIOA 5AY8D 1JFIB 2J8PA 4WU9B 3B0BA 1ULYA 1HQ3D 1TAFB 4KGCD 4ZUXD 5B33C 3AN2C 5BO0B 4KHAA 4ZBJB 5AVBD 4J8WA 4Z5TA 3FDDA 4J8VB 1M18B 3RELD 3WA9A 4H9NA 3W98C 5E5AD 3UT9A 5B40C 2NQBA 1P3LA 3AZNA 3AYWB 3UTBC 5B2JC 4H9RA 4NE3A 3W99A 4G92B 3EG5B 3MGPD 1M1AD 5KDMA 2Y2KA 5B24C 1U35D 4WU9C 5BT1C 3NQUB 1P3FB 2JSSA 4R8PB 1P3KD 5G49B 4H9OA 3W97B 4NE6A 2HIOD 2NZDB 4ZBJC 4YS3A 3KUYD 4J8VC 3KWQA 3AV1D 2CV5D 2Y2MA 2PYOD 5B31D 2Y2QA 5JRGB 3LZ0D 5GXQC 5B1MA 5AV6A 3TU4A 1PZRA 2RVQD 1F66B 2BYMA 4CAYA 3X1VC 4NE5A 4J8WD 4Z5TD 4J8XD 3AL0C 3REHB 5AV9B 5AV5B 4KUDD 2NQBD 3C1CA 1P3LD 3AZJA 2FJ7A 3AZND 3AZLB 5F99B 3AZFB 3O62B 5CPKB 1P3FC 4R8PC 4M6BA 3W97C 2NZDC 1P3IA 4QLCD 4AWLC 1P3PA 1TZYD 2L5AA 1KX4B 3AFAB 5JRGC 3P5JB 4XUJC 1P3AC 3VH5T 5CPIA 3LZ1A 1P3OA 5GT3A 3AZMA 3B6GA 4YS3D 4Z66C 3X1SB 3REIC 3WTPA 4X23B 5GSUB 3REHC 3EPKA 5AV9C 5B1MD 5AV5C 5BNXB 5CPJA 3A1KA 1ID3B 2F8ND 4CSRA 5F99C 3AZFC 3O62C 5CPKC 3VH6T 5BT1D 3KXBB 4YM6A 3X1UD 3C1CD 2FJ7D 5GT0A 3AFAC 1P34C 1AOIA 4LD9A 5DNMA 1P3ID 3LELA 1M18D 3X1SC 5GSUC 5AVCB 3AYWD 5CPID 5B32B 3WAAA 3AZMD 5B32G 3AZEB 1KX5B 3AV2A 3KXBC 4UUZB 3W96A 3AZKA 5CP6B 3MVDB 5BS7A 5DNNB 3LJAC 3REJC 3V9RA 1EQZB 4YM6D 2W8SA 3C1BA 2BYKA 3NQJB 5B0YB 1BH8B 1F66D 2YFVB 3VH5A 1S32B 5AVCC 2AROA 1ZLAA 4LD9D 3B0CW 4EO5C 3LELD 1B67A 5CHLB 4KGCA 3WKJB 3R45A 4ZUXA 3EPJA 3EPHA 5FUGA 3AZLD 4H9PB 4H9SC 3REKD 2Y2IA 5CP6C 5AVBA 3RELA 3VH6A 2DQNC 5B1LC 3B6FA 5E5AA 3AN2B 2BG1A 1KX4D 3AZKD 4WU8A 3AFAD 5B0YC 3UTAC 3MGSA 3AZHA 3MGPA 5B40B 1P3GB 1U35A 4J8UC 4E45A 4X23D 5B2JB 3MNNC 3UT9B 3WKJC 1ID3D 2F8NG 3AZGB 2YFWA 1ZLAD 1N1JA 3EPLA 3KUYA 2ZY4A 2CV5A 3AV1A 2PYOA 5B31A 3LZ0A 3KSYA 5C3IB 1M19B 4G91C 2ZY2A 4Z2MG 4J8XA 3F6TA 4UPKA 3B6FD 5GXQB 4DRAA 4KUDA 1P3GC 1H3OA 3TU4B 3X1VB 3WA9C 4WU8D 3UT9C 3MGSD 3AZHD 5B32D 3AZGC 3B0DB 3W99C 3A6ND 3AZED 1KX5D 4QLCA 1TZYA 5B33A 3H0MC 4WNNB 5C3IC 3MVDD 5B0ZD 5DNND 1M19C 5BNVA 4AWLB 1BH9A 3W98A 1EQZD 4XUJB 1P3AB 1P3PB 4DQYB 3UTBA 3KWQC 3KFUG 2HUEC 2F8NA 3TU4C 4Z66B 5AV6C 5AV8B 1S32D 3REIB 5B24A 1JFIA 3B6GB 3MGRB 3X1UA 3B0DC 3WTPB 1T3UA 3A1IA 5BO0A 3AZJC 5B2IB 4J8VA 1M18A 5JA4A 5B33D 1WWIA 3AN2D 1P34B 1P3PC 3AYWA 2Y2OA 1Q9CA 3MGQB 5AV8C 3W98D 5B40D 3LZ1C 1P3OC 5GT3C 5DNMB 3B6GC 1W2EA 3MGRC 3UTBD 5B2JD 3NQUA 3WTPC 1P3FA 4JJNB 2G5IC 4R8PA 5G49A 5CPJC 5B24D 2NZDA 1KX3B 1P3BB 4WU9D 1B6WA 5B2IC 5JRGA 3LJAB 2JCHA 3AZIB 1F66A 3REJB 2F8NH 5GT0C
chains in the Genus database with same CATH topology
4J8VD 1KU5A 3VH5W 3REHA 3MGQC 5GXQD 5AV5A 4XZQB 1AOIC 5DNMC 3X1VD 3AZLA 5F99A 3REKA 3O62A 3AZFA 4JJNC 4EO5B 5CPKA 2UWXA 5AY8B 3WAAC 1KX3C 1P3BC 1HQ3B 1KX4A 1P3FD 3AV2C 3AFAA 4R8PD 3AZIC 3X1TB 4HGAC 3W96C 4H9QB 5B1LB 3W97D 2NZDD 2LY8A 5BS7C 3X1SA 2RIQA 3RELB 4X23A 5JRGD 4XUJD 4XZQC 3UTAB 1P3AD 3C1BC 1ID3A 4Z66D 3B0CT 4J8UB 3REID 3REHD 1M1AB 2AROC 2DF4C 5AV5D 5AV9D 3MNNB 5AY8C 3KXBA 1P3MB 2Y2PA 1HQ3C 5F99D 3AZFD 3O62D 5CPKD 1P3KB 4KGCC 4ZUXC 1WWSA 1Z2CB 2HIOB 3H0LC 3X1TC 5AVBC 3KUYB 4G91B 5B31B 3LZ0B 1F1EA 3RELC 2XD1A 5AVCA 4KHAB 1P34D 5B32A 4J8WB 4Z5TB 3A6NA 3X1SD 3AZEA 1KX5A 4H9NB 3WA9B 5GSUD 4KUDB 1M1AC 2NQBB 1P3LB 1U35C 4UUZA 1P3MC 2JE5A 3AZNB 3MVDA 4H9RB 5B0ZA 5DNNA 3W99B 2Y2HA 1P3KC 5KDMB 2HIOC 3KXBD 1EQZA 2F8NK 3KUYC 3NQJA 5B0YA 3LJAD 3AV1C 2CV5C 2PYOC 1BH8A 5B31C 3LZ0C 2YFVA 1S32A 3REJD 2RVQC 4H9OB 4YS3B 1BH9B 4J8WC 4Z5TC 4J8XC 3KWQB 2HUEB 5AV6B 5B1MB 3WKJA 5AVCD 4KUDC 2BYMB 2NQBC 2XD5A 4CAYB 1P3LC 3AZNC 3X1UB 3AN2A 3C1CB 4NFTA 4QLCC 3AZJB 2FJ7B 5CP6D 1TZYC 3X1TD 5B1LD 5B40A 1P3GA 1P3IB 5JA4B 4YS3C 2IO5B 5B2JA 5B0YD 3UTAD 5B1MC 5CPIB 3LZ1B 3AZGA 5GT3B 1P3OB 3AZMB 4J8UD 2FFFB 2ZY5A 4WU9A 2CWEA 3MNND 1TAFA 3WKJD 1P3MD 3X1UC 1M19A 2Y2GA 3C1CC 5CPJB 2FJ7C 4CSRB 2Y2NA 5GXQA 3H0RC 4YM6B 1P3IC 1M18C 3X1VA 5GT0B 1HTAA 2IO5C 1AOIB 3AYWC 5CPIC 4LD9B 1P3GD 4G92C 3LELB 3AZMC 3WA9D 2VQRA 3UT9D 4WNNA 4DRBA 3REKB 3W97A 3AZGD 3WAAB 3W99D 4WJ3C 3AV2B 4XUJA 1P3AA 4HGAB 4YM6C 1M19D 3AZKB 3W96B 2Y2LA 4Z66A 5AV8A 1F66C 3REIA 5AV9A 3V9RB 3MGRA 3KWQD 3C1BB 2BYKB 4LD9C 3LELC 3TU4D 5AV6D 4Z2MH 2AROB 3AZLC 3REKC 1ZLAB 5B2IA 4KGCB 3R45B 3VH6W 4ZUXB 3AZJD 5FUGB 1P34A 1KX4C 3AZKC 2G5HC 5AVBB 1A7WA 3MGQA 3B6FB 3IP4C 5GSUA 5E5AB 1P3PD 5BNXA 4WU8B 4X23C 4JJNA 5AV8D 3MGSB 3AZHB 3LZ1D 3MGPB 5GT3D 1P3OD 1ID3C 3B6GD 3MGRD 1KX3A 1P3BA 3A6NB 1U35B 1ZLAC 3WTPD 3LJAA 3AZIA 5CPJD 2Y2JA 3REJA 2F2AC 5B0ZB 2YFWB 1N1JB 5B2ID 2ZY3A 2CV5B 3AV1B 2PYOB 4XZQA 3B6FC 4E44A 5E5AC 4WZSB 5B31G 5GT0D 4WU8C 4J8XB 2ZM5A 3MGQD 1AOID 3MGSC 3AZHC 5AY8A 5B32C 3MGPC 5DNMD 1H3OB 3A6NC 1HQ3A 3AZEC 1KX5C 4H9SA 5CP6A 4JJND 1R4VA 3X1TA 4H9QA 5B1LA 3WAAD 3MVDC 5B0ZC 5DNNC 1KX3D 1P3BD 4WV4B 4QLCB 1TZYB 3AV2D 5B33B 3UTAA 3AZID 1EQZC 3W96D 5BNVB 4J8UA 1S32C 3W98B 1M1AA 3MNNA 4XZQD 1BFMA 3C1BD 1P3MA 3UTBB 2F8NB 4H9PA 1P3KA 3WTPE 2AROD 5B24B 2HIOA 5AY8D 1JFIB 2J8PA 4WU9B 3B0BA 1ULYA 1HQ3D 1TAFB 4KGCD 4ZUXD 5B33C 3AN2C 5BO0B 4KHAA 4ZBJB 5AVBD 4J8WA 4Z5TA 3FDDA 4J8VB 1M18B 3RELD 3WA9A 4H9NA 3W98C 5E5AD 3UT9A 5B40C 2NQBA 1P3LA 3AZNA 3AYWB 3UTBC 5B2JC 4H9RA 4NE3A 3W99A 4G92B 3EG5B 3MGPD 1M1AD 5KDMA 2Y2KA 5B24C 1U35D 4WU9C 5BT1C 3NQUB 1P3FB 2JSSA 4R8PB 1P3KD 5G49B 4H9OA 3W97B 4NE6A 2HIOD 2NZDB 4ZBJC 4YS3A 3KUYD 4J8VC 3KWQA 3AV1D 2CV5D 2Y2MA 2PYOD 5B31D 2Y2QA 5JRGB 3LZ0D 5GXQC 5B1MA 5AV6A 3TU4A 1PZRA 2RVQD 1F66B 2BYMA 4CAYA 3X1VC 4NE5A 4J8WD 4Z5TD 4J8XD 3AL0C 3REHB 5AV9B 5AV5B 4KUDD 2NQBD 3C1CA 1P3LD 3AZJA 2FJ7A 3AZND 3AZLB 5F99B 3AZFB 3O62B 5CPKB 1P3FC 4R8PC 4M6BA 3W97C 2NZDC 1P3IA 4QLCD 4AWLC 1P3PA 1TZYD 2L5AA 1KX4B 3AFAB 5JRGC 3P5JB 4XUJC 1P3AC 3VH5T 5CPIA 3LZ1A 1P3OA 5GT3A 3AZMA 3B6GA 4YS3D 4Z66C 3X1SB 3REIC 3WTPA 4X23B 5GSUB 3REHC 3EPKA 5AV9C 5B1MD 5AV5C 5BNXB 5CPJA 3A1KA 1ID3B 2F8ND 4CSRA 5F99C 3AZFC 3O62C 5CPKC 3VH6T 5BT1D 3KXBB 4YM6A 3X1UD 3C1CD 2FJ7D 5GT0A 3AFAC 1P34C 1AOIA 4LD9A 5DNMA 1P3ID 3LELA 1M18D 3X1SC 5GSUC 5AVCB 3AYWD 5CPID 5B32B 3WAAA 3AZMD 5B32G 3AZEB 1KX5B 3AV2A 3KXBC 4UUZB 3W96A 3AZKA 5CP6B 3MVDB 5BS7A 5DNNB 3LJAC 3REJC 3V9RA 1EQZB 4YM6D 2W8SA 3C1BA 2BYKA 3NQJB 5B0YB 1BH8B 1F66D 2YFVB 3VH5A 1S32B 5AVCC 2AROA 1ZLAA 4LD9D 3B0CW 4EO5C 3LELD 1B67A 5CHLB 4KGCA 3WKJB 3R45A 4ZUXA 3EPJA 3EPHA 5FUGA 3AZLD 4H9PB 4H9SC 3REKD 2Y2IA 5CP6C 5AVBA 3RELA 3VH6A 2DQNC 5B1LC 3B6FA 5E5AA 3AN2B 2BG1A 1KX4D 3AZKD 4WU8A 3AFAD 5B0YC 3UTAC 3MGSA 3AZHA 3MGPA 5B40B 1P3GB 1U35A 4J8UC 4E45A 4X23D 5B2JB 3MNNC 3UT9B 3WKJC 1ID3D 2F8NG 3AZGB 2YFWA 1ZLAD 1N1JA 3EPLA 3KUYA 2ZY4A 2CV5A 3AV1A 2PYOA 5B31A 3LZ0A 3KSYA 5C3IB 1M19B 4G91C 2ZY2A 4Z2MG 4J8XA 3F6TA 4UPKA 3B6FD 5GXQB 4DRAA 4KUDA 1P3GC 1H3OA 3TU4B 3X1VB 3WA9C 4WU8D 3UT9C 3MGSD 3AZHD 5B32D 3AZGC 3B0DB 3W99C 3A6ND 3AZED 1KX5D 4QLCA 1TZYA 5B33A 3H0MC 4WNNB 5C3IC 3MVDD 5B0ZD 5DNND 1M19C 5BNVA 4AWLB 1BH9A 3W98A 1EQZD 4XUJB 1P3AB 1P3PB 4DQYB 3UTBA 3KWQC 3KFUG 2HUEC 2F8NA 3TU4C 4Z66B 5AV6C 5AV8B 1S32D 3REIB 5B24A 1JFIA 3B6GB 3MGRB 3X1UA 3B0DC 3WTPB 1T3UA 3A1IA 5BO0A 3AZJC 5B2IB 4J8VA 1M18A 5JA4A 5B33D 1WWIA 3AN2D 1P34B 1P3PC 3AYWA 2Y2OA 1Q9CA 3MGQB 5AV8C 3W98D 5B40D 3LZ1C 1P3OC 5GT3C 5DNMB 3B6GC 1W2EA 3MGRC 3UTBD 5B2JD 3NQUA 3WTPC 1P3FA 4JJNB 2G5IC 4R8PA 5G49A 5CPJC 5B24D 2NZDA 1KX3B 1P3BB 4WU9D 1B6WA 5B2IC 5JRGA 3LJAB 2JCHA 3AZIB 1F66A 3REJB 2F8NH 5GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V D;  1KU5 A;  3VH5 W;  3REH A;  3MGQ C;  5GXQ D;  5AV5 A;  4XZQ B;  1AOI C;  5DNM C;  3X1V D;  3AZL A;  5F99 A;  3REK A;  3O62 A;  3AZF A;  4JJN C;  4EO5 B;  5CPK A;  5AY8 B;  3WAA C;  1KX3 C;  1P3B C;  1HQ3 B;  1KX4 A;  1P3F D;  3AV2 C;  3AFA A;  4R8P D;  3AZI C;  3X1T B;  4HGA C;  3W96 C;  4H9Q B;  5B1L B;  3W97 D;  2NZD D;  2LY8 A;  5BS7 C;  3X1S A;  3REL B;  4X23 A;  5JRG D;  4XUJ D;  4XZQ C;  3UTA B;  1P3A D;  3C1B C;  1ID3 A;  4Z66 D;  3B0C T;  4J8U B;  3REI D;  3REH D;  1M1A B;  2ARO C;  5AV9 D;  5AV5 D;  3MNN B;  5AY8 C;  3KXB A;  1P3M B;  1HQ3 C;  5F99 D;  3AZF D;  3O62 D;  5CPK D;  1P3K B;  4KGC C;  4ZUX C;  1WWS A;  3X1T C;  2HIO B;  5AVB C;  3KUY B;  4G91 B;  5B31 B;  3LZ0 B;  1F1E A;  3REL C;  5AVC A;  4KHA B;  1P34 D;  5B32 A;  4J8W B;  4Z5T B;  3A6N A;  3X1S D;  3AZE A;  1KX5 A;  4H9N B;  3WA9 B;  5GSU D;  4KUD B;  1M1A C;  2NQB B;  1P3L B;  1U35 C;  4UUZ A;  1P3M C;  3AZN B;  3MVD A;  4H9R B;  5B0Z A;  5DNN A;  3W99 B;  1P3K C;  5KDM B;  2HIO C;  3KXB D;  1EQZ A;  2F8N K;  3KUY C;  3NQJ A;  5B0Y A;  3LJA D;  3AV1 C;  2CV5 C;  2PYO C;  1BH8 A;  5B31 C;  3LZ0 C;  2YFV A;  1S32 A;  3REJ D;  2RVQ C;  4H9O B;  4YS3 B;  1BH9 B;  4J8W C;  4Z5T C;  4J8X C;  3KWQ B;  2HUE B;  5AV6 B;  5B1M B;  3WKJ A;  5AVC D;  4KUD C;  2BYM B;  2NQB C;  4CAY B;  1P3L C;  3AZN C;  3X1U B;  3AN2 A;  3C1C B;  4NFT A;  4QLC C;  3AZJ B;  2FJ7 B;  5CP6 D;  1TZY C;  3X1T D;  5B1L D;  5B40 A;  1P3G A;  1P3I B;  5JA4 B;  4YS3 C;  2IO5 B;  5B2J A;  5B0Y D;  3UTA D;  5B1M C;  5CPI B;  3LZ1 B;  3AZG A;  5GT3 B;  1P3O B;  3AZM B;  4J8U D;  4WU9 A;  2CWE A;  3MNN D;  1TAF A;  3WKJ D;  1P3M D;  3X1U C;  1M19 A;  5CPJ B;  3C1C C;  2FJ7 C;  4CSR B;  5GXQ A;  4YM6 B;  1P3I C;  1M18 C;  3X1V A;  5GT0 B;  1HTA A;  2IO5 C;  1AOI B;  3AYW C;  5CPI C;  4LD9 B;  1P3G D;  4G92 C;  3LEL B;  3AZM C;  3WA9 D;  3UT9 D;  4WNN A;  4DRB A;  3REK B;  3W97 A;  3AZG D;  3WAA B;  3W99 D;  3AV2 B;  4XUJ A;  1P3A A;  4HGA B;  4YM6 C;  1M19 D;  3AZK B;  3W96 B;  4Z66 A;  5AV8 A;  1F66 C;  3REI A;  5AV9 A;  3V9R B;  3MGR A;  3KWQ D;  3C1B B;  2BYK B;  4LD9 C;  3LEL C;  3TU4 D;  5AV6 D;  4Z2M H;  2ARO B;  3AZL C;  3REK C;  1ZLA B;  5B2I A;  4KGC B;  3R45 B;  3VH6 W;  4ZUX B;  3AZJ D;  5FUG B;  1P34 A;  1KX4 C;  3AZK C;  5AVB B;  1A7W A;  3MGQ A;  3B6F B;  5GSU A;  5E5A B;  1P3P D;  5BNX A;  4WU8 B;  4X23 C;  4JJN A;  5AV8 D;  3MGS B;  3AZH B;  3LZ1 D;  3MGP B;  5GT3 D;  1P3O D;  1ID3 C;  3B6G D;  3MGR D;  1KX3 A;  1P3B A;  3A6N B;  1U35 B;  1ZLA C;  3WTP D;  3LJA A;  3AZI A;  5CPJ D;  3REJ A;  5B0Z B;  2YFW B;  1N1J B;  5B2I D;  2CV5 B;  3AV1 B;  2PYO B;  4XZQ A;  3B6F C;  4E44 A;  5E5A C;  4WZS B;  5B31 G;  5GT0 D;  4WU8 C;  4J8X B;  3MGQ D;  1AOI D;  3MGS C;  3AZH C;  5AY8 A;  5B32 C;  3MGP C;  5DNM D;  1H3O B;  3A6N C;  1HQ3 A;  3AZE C;  1KX5 C;  4H9S A;  5CP6 A;  4JJN D;  1R4V A;  3X1T A;  4H9Q A;  5B1L A;  3WAA D;  3MVD C;  5B0Z C;  5DNN C;  1KX3 D;  1P3B D;  4WV4 B;  4QLC B;  1TZY B;  3AV2 D;  5B33 B;  3UTA A;  3AZI D;  1EQZ C;  3W96 D;  5BNV B;  4J8U A;  1S32 C;  3W98 B;  1M1A A;  3MNN A;  4XZQ D;  1BFM A;  3C1B D;  1P3M A;  3UTB B;  2F8N B;  4H9P A;  1P3K A;  3WTP E;  2ARO D;  5B24 B;  2HIO A;  5AY8 D;  1JFI B;  4WU9 B;  3B0B A;  1ULY A;  1HQ3 D;  1TAF B;  4KGC D;  4ZUX D;  5B33 C;  3AN2 C;  5BO0 B;  4KHA A;  4ZBJ B;  5AVB D;  4J8W A;  4Z5T A;  4J8V B;  1M18 B;  3REL D;  3WA9 A;  4H9N A;  3W98 C;  5E5A D;  3UT9 A;  5B40 C;  2NQB A;  1P3L A;  3AZN A;  3AYW B;  3UTB C;  5B2J C;  4H9R A;  4NE3 A;  3W99 A;  4G92 B;  3MGP D;  1M1A D;  5KDM A;  5B24 C;  1U35 D;  4WU9 C;  5BT1 C;  3NQU B;  1P3F B;  2JSS A;  4R8P B;  1P3K D;  5G49 B;  4H9O A;  3W97 B;  4NE6 A;  2HIO D;  2NZD B;  4ZBJ C;  4YS3 A;  3KUY D;  4J8V C;  3KWQ A;  3AV1 D;  2CV5 D;  2PYO D;  5B31 D;  3LZ0 D;  5JRG B;  3TU4 A;  5GXQ C;  5B1M A;  5AV6 A;  2RVQ D;  1F66 B;  2BYM A;  4CAY A;  3X1V C;  4NE5 A;  4J8W D;  4Z5T D;  4J8X D;  3REH B;  5AV9 B;  5AV5 B;  4KUD D;  2NQB D;  3C1C A;  1P3L D;  3AZJ A;  2FJ7 A;  3AZN D;  3AZL B;  5F99 B;  3AZF B;  3O62 B;  5CPK B;  1P3F C;  4R8P C;  4M6B A;  3W97 C;  2NZD C;  1P3I A;  4QLC D;  4AWL C;  1P3P A;  1TZY D;  2L5A A;  1KX4 B;  3AFA B;  5JRG C;  4XUJ C;  1P3A C;  3VH5 T;  5CPI A;  3LZ1 A;  1P3O A;  5GT3 A;  3AZM A;  3B6G A;  4YS3 D;  4Z66 C;  3X1S B;  3REI C;  3WTP A;  4X23 B;  5GSU B;  3REH C;  5AV9 C;  5B1M D;  5AV5 C;  5BNX B;  5CPJ A;  1ID3 B;  2F8N D;  4CSR A;  5F99 C;  3AZF C;  3O62 C;  5CPK C;  3VH6 T;  5BT1 D;  3KXB B;  4YM6 A;  3X1U D;  3C1C D;  2FJ7 D;  5GT0 A;  3AFA C;  1P34 C;  1AOI A;  4LD9 A;  5DNM A;  1P3I D;  3LEL A;  1M18 D;  3X1S C;  5GSU C;  5AVC B;  3AYW D;  5CPI D;  5B32 B;  3WAA A;  3AZM D;  5B32 G;  3AZE B;  1KX5 B;  3AV2 A;  3KXB C;  4UUZ B;  3W96 A;  3AZK A;  5CP6 B;  3MVD B;  5BS7 A;  5DNN B;  3LJA C;  3REJ C;  3V9R A;  1EQZ B;  4YM6 D;  3C1B A;  2BYK A;  3NQJ B;  5B0Y B;  1BH8 B;  1F66 D;  2YFV B;  3VH5 A;  1S32 B;  5AVC C;  2ARO A;  1ZLA A;  4LD9 D;  3B0C W;  4EO5 C;  3LEL D;  1B67 A;  5CHL B;  4KGC A;  3WKJ B;  3R45 A;  4ZUX A;  5FUG A;  3AZL D;  4H9P B;  4H9S C;  3REK D;  5CP6 C;  5AVB A;  3REL A;  3VH6 A;  3B6F A;  5B1L C;  5E5A A;  3AN2 B;  1KX4 D;  3AZK D;  4WU8 A;  3AFA D;  5B0Y C;  3UTA C;  3MGS A;  3AZH A;  3MGP A;  5B40 B;  1P3G B;  1U35 A;  4J8U C;  4E45 A;  4X23 D;  5B2J B;  3MNN C;  3UT9 B;  3WKJ C;  1ID3 D;  2F8N G;  3AZG B;  2YFW A;  1ZLA D;  1N1J A;  3KUY A;  2CV5 A;  3AV1 A;  2PYO A;  5B31 A;  3LZ0 A;  3KSY A;  5C3I B;  1M19 B;  4G91 C;  4Z2M G;  4J8X A;  3B6F D;  5GXQ B;  4DRA A;  4KUD A;  1P3G C;  1H3O A;  3TU4 B;  3X1V B;  3WA9 C;  4WU8 D;  3UT9 C;  3MGS D;  3AZH D;  5B32 D;  3AZG C;  3B0D B;  3W99 C;  3A6N D;  3AZE D;  1KX5 D;  4QLC A;  1TZY A;  5B33 A;  4WNN B;  5C3I C;  3MVD D;  5B0Z D;  5DNN D;  1M19 C;  5BNV A;  4AWL B;  1BH9 A;  3W98 A;  1EQZ D;  4XUJ B;  1P3A B;  1P3P B;  3UTB A;  3KWQ C;  2HUE C;  2F8N A;  3TU4 C;  4Z66 B;  5AV6 C;  5AV8 B;  1S32 D;  3REI B;  5B24 A;  1JFI A;  3B6G B;  3MGR B;  3X1U A;  3B0D C;  3WTP B;  5BO0 A;  3AZJ C;  5B2I B;  4J8V A;  1M18 A;  5JA4 A;  5B33 D;  1WWI A;  3AN2 D;  1P34 B;  1P3P C;  3AYW A;  1Q9C A;  3MGQ B;  5AV8 C;  3W98 D;  5B40 D;  3LZ1 C;  1P3O C;  5GT3 C;  5DNM B;  3B6G C;  3MGR C;  3UTB D;  5B2J D;  3NQU A;  3WTP C;  1P3F A;  4JJN B;  4R8P A;  5G49 A;  5CPJ C;  5B24 D;  2NZD A;  1KX3 B;  1P3B B;  4WU9 D;  1B6W A;  5B2I C;  5JRG A;  3LJA B;  3AZI B;  1F66 A;  3REJ B;  2F8N H;  5GT0 C; 
#chains in the Genus database with same CATH topology
 4J8V D;  1KU5 A;  3VH5 W;  3REH A;  3MGQ C;  5GXQ D;  5AV5 A;  4XZQ B;  1AOI C;  5DNM C;  3X1V D;  3AZL A;  5F99 A;  3REK A;  3O62 A;  3AZF A;  4JJN C;  4EO5 B;  5CPK A;  2UWX A;  5AY8 B;  3WAA C;  1KX3 C;  1P3B C;  1HQ3 B;  1KX4 A;  1P3F D;  3AV2 C;  3AFA A;  4R8P D;  3AZI C;  3X1T B;  4HGA C;  3W96 C;  4H9Q B;  5B1L B;  3W97 D;  2NZD D;  2LY8 A;  5BS7 C;  3X1S A;  2RIQ A;  3REL B;  4X23 A;  5JRG D;  4XUJ D;  4XZQ C;  3UTA B;  1P3A D;  3C1B C;  1ID3 A;  4Z66 D;  3B0C T;  4J8U B;  3REI D;  3REH D;  1M1A B;  2ARO C;  2DF4 C;  5AV5 D;  5AV9 D;  3MNN B;  5AY8 C;  3KXB A;  1P3M B;  2Y2P A;  1HQ3 C;  5F99 D;  3AZF D;  3O62 D;  5CPK D;  1P3K B;  4KGC C;  4ZUX C;  1WWS A;  1Z2C B;  2HIO B;  3H0L C;  3X1T C;  5AVB C;  3KUY B;  4G91 B;  5B31 B;  3LZ0 B;  1F1E A;  3REL C;  2XD1 A;  5AVC A;  4KHA B;  1P34 D;  5B32 A;  4J8W B;  4Z5T B;  3A6N A;  3X1S D;  3AZE A;  1KX5 A;  4H9N B;  3WA9 B;  5GSU D;  4KUD B;  1M1A C;  2NQB B;  1P3L B;  1U35 C;  4UUZ A;  1P3M C;  2JE5 A;  3AZN B;  3MVD A;  4H9R B;  5B0Z A;  5DNN A;  3W99 B;  2Y2H A;  1P3K C;  5KDM B;  2HIO C;  3KXB D;  1EQZ A;  2F8N K;  3KUY C;  3NQJ A;  5B0Y A;  3LJA D;  3AV1 C;  2CV5 C;  2PYO C;  1BH8 A;  5B31 C;  3LZ0 C;  2YFV A;  1S32 A;  3REJ D;  2RVQ C;  4H9O B;  4YS3 B;  1BH9 B;  4J8W C;  4Z5T C;  4J8X C;  3KWQ B;  2HUE B;  5AV6 B;  5B1M B;  3WKJ A;  5AVC D;  4KUD C;  2BYM B;  2NQB C;  2XD5 A;  4CAY B;  1P3L C;  3AZN C;  3X1U B;  3AN2 A;  3C1C B;  4NFT A;  4QLC C;  3AZJ B;  2FJ7 B;  5CP6 D;  1TZY C;  3X1T D;  5B1L D;  5B40 A;  1P3G A;  1P3I B;  5JA4 B;  4YS3 C;  2IO5 B;  5B2J A;  5B0Y D;  3UTA D;  5B1M C;  5CPI B;  3LZ1 B;  3AZG A;  5GT3 B;  1P3O B;  3AZM B;  4J8U D;  2FFF B;  2ZY5 A;  4WU9 A;  2CWE A;  3MNN D;  1TAF A;  3WKJ D;  1P3M D;  3X1U C;  1M19 A;  2Y2G A;  3C1C C;  5CPJ B;  2FJ7 C;  4CSR B;  2Y2N A;  5GXQ A;  3H0R C;  4YM6 B;  1P3I C;  1M18 C;  3X1V A;  5GT0 B;  1HTA A;  2IO5 C;  1AOI B;  3AYW C;  5CPI C;  4LD9 B;  1P3G D;  4G92 C;  3LEL B;  3AZM C;  3WA9 D;  2VQR A;  3UT9 D;  4WNN A;  4DRB A;  3REK B;  3W97 A;  3AZG D;  3WAA B;  3W99 D;  4WJ3 C;  3AV2 B;  4XUJ A;  1P3A A;  4HGA B;  4YM6 C;  1M19 D;  3AZK B;  3W96 B;  2Y2L A;  4Z66 A;  5AV8 A;  1F66 C;  3REI A;  5AV9 A;  3V9R B;  3MGR A;  3KWQ D;  3C1B B;  2BYK B;  4LD9 C;  3LEL C;  3TU4 D;  5AV6 D;  4Z2M H;  2ARO B;  3AZL C;  3REK C;  1ZLA B;  5B2I A;  4KGC B;  3R45 B;  3VH6 W;  4ZUX B;  3AZJ D;  5FUG B;  1P34 A;  1KX4 C;  3AZK C;  2G5H C;  5AVB B;  1A7W A;  3MGQ A;  3B6F B;  3IP4 C;  5GSU A;  5E5A B;  1P3P D;  5BNX A;  4WU8 B;  4X23 C;  4JJN A;  5AV8 D;  3MGS B;  3AZH B;  3LZ1 D;  3MGP B;  5GT3 D;  1P3O D;  1ID3 C;  3B6G D;  3MGR D;  1KX3 A;  1P3B A;  3A6N B;  1U35 B;  1ZLA C;  3WTP D;  3LJA A;  3AZI A;  5CPJ D;  2Y2J A;  3REJ A;  2F2A C;  5B0Z B;  2YFW B;  1N1J B;  5B2I D;  2ZY3 A;  2CV5 B;  3AV1 B;  2PYO B;  4XZQ A;  3B6F C;  4E44 A;  5E5A C;  4WZS B;  5B31 G;  5GT0 D;  4WU8 C;  4J8X B;  2ZM5 A;  3MGQ D;  1AOI D;  3MGS C;  3AZH C;  5AY8 A;  5B32 C;  3MGP C;  5DNM D;  1H3O B;  3A6N C;  1HQ3 A;  3AZE C;  1KX5 C;  4H9S A;  5CP6 A;  4JJN D;  1R4V A;  3X1T A;  4H9Q A;  5B1L A;  3WAA D;  3MVD C;  5B0Z C;  5DNN C;  1KX3 D;  1P3B D;  4WV4 B;  4QLC B;  1TZY B;  3AV2 D;  5B33 B;  3UTA A;  3AZI D;  1EQZ C;  3W96 D;  5BNV B;  4J8U A;  1S32 C;  3W98 B;  1M1A A;  3MNN A;  4XZQ D;  1BFM A;  3C1B D;  1P3M A;  3UTB B;  2F8N B;  4H9P A;  1P3K A;  3WTP E;  2ARO D;  5B24 B;  2HIO A;  5AY8 D;  1JFI B;  2J8P A;  4WU9 B;  3B0B A;  1ULY A;  1HQ3 D;  1TAF B;  4KGC D;  4ZUX D;  5B33 C;  3AN2 C;  5BO0 B;  4KHA A;  4ZBJ B;  5AVB D;  4J8W A;  4Z5T A;  3FDD A;  4J8V B;  1M18 B;  3REL D;  3WA9 A;  4H9N A;  3W98 C;  5E5A D;  3UT9 A;  5B40 C;  2NQB A;  1P3L A;  3AZN A;  3AYW B;  3UTB C;  5B2J C;  4H9R A;  4NE3 A;  3W99 A;  4G92 B;  3EG5 B;  3MGP D;  1M1A D;  5KDM A;  2Y2K A;  5B24 C;  1U35 D;  4WU9 C;  5BT1 C;  3NQU B;  1P3F B;  2JSS A;  4R8P B;  1P3K D;  5G49 B;  4H9O A;  3W97 B;  4NE6 A;  2HIO D;  2NZD B;  4ZBJ C;  4YS3 A;  3KUY D;  4J8V C;  3KWQ A;  3AV1 D;  2CV5 D;  2Y2M A;  2PYO D;  5B31 D;  2Y2Q A;  5JRG B;  3LZ0 D;  5GXQ C;  5B1M A;  5AV6 A;  3TU4 A;  1PZR A;  2RVQ D;  1F66 B;  2BYM A;  4CAY A;  3X1V C;  4NE5 A;  4J8W D;  4Z5T D;  4J8X D;  3AL0 C;  3REH B;  5AV9 B;  5AV5 B;  4KUD D;  2NQB D;  3C1C A;  1P3L D;  3AZJ A;  2FJ7 A;  3AZN D;  3AZL B;  5F99 B;  3AZF B;  3O62 B;  5CPK B;  1P3F C;  4R8P C;  4M6B A;  3W97 C;  2NZD C;  1P3I A;  4QLC D;  4AWL C;  1P3P A;  1TZY D;  2L5A A;  1KX4 B;  3AFA B;  5JRG C;  3P5J B;  4XUJ C;  1P3A C;  3VH5 T;  5CPI A;  3LZ1 A;  1P3O A;  5GT3 A;  3AZM A;  3B6G A;  4YS3 D;  4Z66 C;  3X1S B;  3REI C;  3WTP A;  4X23 B;  5GSU B;  3REH C;  3EPK A;  5AV9 C;  5B1M D;  5AV5 C;  5BNX B;  5CPJ A;  3A1K A;  1ID3 B;  2F8N D;  4CSR A;  5F99 C;  3AZF C;  3O62 C;  5CPK C;  3VH6 T;  5BT1 D;  3KXB B;  4YM6 A;  3X1U D;  3C1C D;  2FJ7 D;  5GT0 A;  3AFA C;  1P34 C;  1AOI A;  4LD9 A;  5DNM A;  1P3I D;  3LEL A;  1M18 D;  3X1S C;  5GSU C;  5AVC B;  3AYW D;  5CPI D;  5B32 B;  3WAA A;  3AZM D;  5B32 G;  3AZE B;  1KX5 B;  3AV2 A;  3KXB C;  4UUZ B;  3W96 A;  3AZK A;  5CP6 B;  3MVD B;  5BS7 A;  5DNN B;  3LJA C;  3REJ C;  3V9R A;  1EQZ B;  4YM6 D;  2W8S A;  3C1B A;  2BYK A;  3NQJ B;  5B0Y B;  1BH8 B;  1F66 D;  2YFV B;  3VH5 A;  1S32 B;  5AVC C;  2ARO A;  1ZLA A;  4LD9 D;  3B0C W;  4EO5 C;  3LEL D;  1B67 A;  5CHL B;  4KGC A;  3WKJ B;  3R45 A;  4ZUX A;  3EPJ A;  3EPH A;  5FUG A;  3AZL D;  4H9P B;  4H9S C;  3REK D;  2Y2I A;  5CP6 C;  5AVB A;  3REL A;  3VH6 A;  2DQN C;  5B1L C;  3B6F A;  5E5A A;  3AN2 B;  2BG1 A;  1KX4 D;  3AZK D;  4WU8 A;  3AFA D;  5B0Y C;  3UTA C;  3MGS A;  3AZH A;  3MGP A;  5B40 B;  1P3G B;  1U35 A;  4J8U C;  4E45 A;  4X23 D;  5B2J B;  3MNN C;  3UT9 B;  3WKJ C;  1ID3 D;  2F8N G;  3AZG B;  2YFW A;  1ZLA D;  1N1J A;  3EPL A;  3KUY A;  2ZY4 A;  2CV5 A;  3AV1 A;  2PYO A;  5B31 A;  3LZ0 A;  3KSY A;  5C3I B;  1M19 B;  4G91 C;  2ZY2 A;  4Z2M G;  4J8X A;  3F6T A;  4UPK A;  3B6F D;  5GXQ B;  4DRA A;  4KUD A;  1P3G C;  1H3O A;  3TU4 B;  3X1V B;  3WA9 C;  4WU8 D;  3UT9 C;  3MGS D;  3AZH D;  5B32 D;  3AZG C;  3B0D B;  3W99 C;  3A6N D;  3AZE D;  1KX5 D;  4QLC A;  1TZY A;  5B33 A;  3H0M C;  4WNN B;  5C3I C;  3MVD D;  5B0Z D;  5DNN D;  1M19 C;  5BNV A;  4AWL B;  1BH9 A;  3W98 A;  1EQZ D;  4XUJ B;  1P3A B;  1P3P B;  4DQY B;  3UTB A;  3KWQ C;  3KFU G;  2HUE C;  2F8N A;  3TU4 C;  4Z66 B;  5AV6 C;  5AV8 B;  1S32 D;  3REI B;  5B24 A;  1JFI A;  3B6G B;  3MGR B;  3X1U A;  3B0D C;  3WTP B;  1T3U A;  3A1I A;  5BO0 A;  3AZJ C;  5B2I B;  4J8V A;  1M18 A;  5JA4 A;  5B33 D;  1WWI A;  3AN2 D;  1P34 B;  1P3P C;  3AYW A;  2Y2O A;  1Q9C A;  3MGQ B;  5AV8 C;  3W98 D;  5B40 D;  3LZ1 C;  1P3O C;  5GT3 C;  5DNM B;  3B6G C;  1W2E A;  3MGR C;  3UTB D;  5B2J D;  3NQU A;  3WTP C;  1P3F A;  4JJN B;  2G5I C;  4R8P A;  5G49 A;  5CPJ C;  5B24 D;  2NZD A;  1KX3 B;  1P3B B;  4WU9 D;  1B6W A;  5B2I C;  5JRG A;  3LJA B;  2JCH A;  3AZI B;  1F66 A;  3REJ B;  2F8N H;  5GT0 C; 
#chains in the Genus database with same CATH homology
 4J8V D;  1KU5 A;  3VH5 W;  3REH A;  3MGQ C;  5GXQ D;  5AV5 A;  4XZQ B;  1AOI C;  5DNM C;  3X1V D;  3AZL A;  5F99 A;  3REK A;  3O62 A;  3AZF A;  4JJN C;  4EO5 B;  5CPK A;  2UWX A;  5AY8 B;  3WAA C;  1KX3 C;  1P3B C;  1HQ3 B;  1KX4 A;  1P3F D;  3AV2 C;  3AFA A;  4R8P D;  3AZI C;  3X1T B;  4HGA C;  3W96 C;  4H9Q B;  5B1L B;  3W97 D;  2NZD D;  2LY8 A;  5BS7 C;  3X1S A;  2RIQ A;  3REL B;  4X23 A;  5JRG D;  4XUJ D;  4XZQ C;  3UTA B;  1P3A D;  3C1B C;  1ID3 A;  4Z66 D;  3B0C T;  4J8U B;  3REI D;  3REH D;  1M1A B;  2ARO C;  2DF4 C;  5AV5 D;  5AV9 D;  3MNN B;  5AY8 C;  3KXB A;  1P3M B;  2Y2P A;  1HQ3 C;  5F99 D;  3AZF D;  3O62 D;  5CPK D;  1P3K B;  4KGC C;  4ZUX C;  1WWS A;  1Z2C B;  2HIO B;  3H0L C;  3X1T C;  5AVB C;  3KUY B;  4G91 B;  5B31 B;  3LZ0 B;  1F1E A;  3REL C;  2XD1 A;  5AVC A;  4KHA B;  1P34 D;  5B32 A;  4J8W B;  4Z5T B;  3A6N A;  3X1S D;  3AZE A;  1KX5 A;  4H9N B;  3WA9 B;  5GSU D;  4KUD B;  1M1A C;  2NQB B;  1P3L B;  1U35 C;  4UUZ A;  1P3M C;  2JE5 A;  3AZN B;  3MVD A;  4H9R B;  5B0Z A;  5DNN A;  3W99 B;  2Y2H A;  1P3K C;  5KDM B;  2HIO C;  3KXB D;  1EQZ A;  2F8N K;  3KUY C;  3NQJ A;  5B0Y A;  3LJA D;  3AV1 C;  2CV5 C;  2PYO C;  1BH8 A;  5B31 C;  3LZ0 C;  2YFV A;  1S32 A;  3REJ D;  2RVQ C;  4H9O B;  4YS3 B;  1BH9 B;  4J8W C;  4Z5T C;  4J8X C;  3KWQ B;  2HUE B;  5AV6 B;  5B1M B;  3WKJ A;  5AVC D;  4KUD C;  2BYM B;  2NQB C;  2XD5 A;  4CAY B;  1P3L C;  3AZN C;  3X1U B;  3AN2 A;  3C1C B;  4NFT A;  4QLC C;  3AZJ B;  2FJ7 B;  5CP6 D;  1TZY C;  3X1T D;  5B1L D;  5B40 A;  1P3G A;  1P3I B;  5JA4 B;  4YS3 C;  2IO5 B;  5B2J A;  5B0Y D;  3UTA D;  5B1M C;  5CPI B;  3LZ1 B;  3AZG A;  5GT3 B;  1P3O B;  3AZM B;  4J8U D;  2FFF B;  2ZY5 A;  4WU9 A;  2CWE A;  3MNN D;  1TAF A;  3WKJ D;  1P3M D;  3X1U C;  1M19 A;  2Y2G A;  3C1C C;  5CPJ B;  2FJ7 C;  4CSR B;  2Y2N A;  5GXQ A;  3H0R C;  4YM6 B;  1P3I C;  1M18 C;  3X1V A;  5GT0 B;  1HTA A;  2IO5 C;  1AOI B;  3AYW C;  5CPI C;  4LD9 B;  1P3G D;  4G92 C;  3LEL B;  3AZM C;  3WA9 D;  2VQR A;  3UT9 D;  4WNN A;  4DRB A;  3REK B;  3W97 A;  3AZG D;  3WAA B;  3W99 D;  4WJ3 C;  3AV2 B;  4XUJ A;  1P3A A;  4HGA B;  4YM6 C;  1M19 D;  3AZK B;  3W96 B;  2Y2L A;  4Z66 A;  5AV8 A;  1F66 C;  3REI A;  5AV9 A;  3V9R B;  3MGR A;  3KWQ D;  3C1B B;  2BYK B;  4LD9 C;  3LEL C;  3TU4 D;  5AV6 D;  4Z2M H;  2ARO B;  3AZL C;  3REK C;  1ZLA B;  5B2I A;  4KGC B;  3R45 B;  3VH6 W;  4ZUX B;  3AZJ D;  5FUG B;  1P34 A;  1KX4 C;  3AZK C;  2G5H C;  5AVB B;  1A7W A;  3MGQ A;  3B6F B;  3IP4 C;  5GSU A;  5E5A B;  1P3P D;  5BNX A;  4WU8 B;  4X23 C;  4JJN A;  5AV8 D;  3MGS B;  3AZH B;  3LZ1 D;  3MGP B;  5GT3 D;  1P3O D;  1ID3 C;  3B6G D;  3MGR D;  1KX3 A;  1P3B A;  3A6N B;  1U35 B;  1ZLA C;  3WTP D;  3LJA A;  3AZI A;  5CPJ D;  2Y2J A;  3REJ A;  2F2A C;  5B0Z B;  2YFW B;  1N1J B;  5B2I D;  2ZY3 A;  2CV5 B;  3AV1 B;  2PYO B;  4XZQ A;  3B6F C;  4E44 A;  5E5A C;  4WZS B;  5B31 G;  5GT0 D;  4WU8 C;  4J8X B;  2ZM5 A;  3MGQ D;  1AOI D;  3MGS C;  3AZH C;  5AY8 A;  5B32 C;  3MGP C;  5DNM D;  1H3O B;  3A6N C;  1HQ3 A;  3AZE C;  1KX5 C;  4H9S A;  5CP6 A;  4JJN D;  1R4V A;  3X1T A;  4H9Q A;  5B1L A;  3WAA D;  3MVD C;  5B0Z C;  5DNN C;  1KX3 D;  1P3B D;  4WV4 B;  4QLC B;  1TZY B;  3AV2 D;  5B33 B;  3UTA A;  3AZI D;  1EQZ C;  3W96 D;  5BNV B;  4J8U A;  1S32 C;  3W98 B;  1M1A A;  3MNN A;  4XZQ D;  1BFM A;  3C1B D;  1P3M A;  3UTB B;  2F8N B;  4H9P A;  1P3K A;  3WTP E;  2ARO D;  5B24 B;  2HIO A;  5AY8 D;  1JFI B;  2J8P A;  4WU9 B;  3B0B A;  1ULY A;  1HQ3 D;  1TAF B;  4KGC D;  4ZUX D;  5B33 C;  3AN2 C;  5BO0 B;  4KHA A;  4ZBJ B;  5AVB D;  4J8W A;  4Z5T A;  3FDD A;  4J8V B;  1M18 B;  3REL D;  3WA9 A;  4H9N A;  3W98 C;  5E5A D;  3UT9 A;  5B40 C;  2NQB A;  1P3L A;  3AZN A;  3AYW B;  3UTB C;  5B2J C;  4H9R A;  4NE3 A;  3W99 A;  4G92 B;  3EG5 B;  3MGP D;  1M1A D;  5KDM A;  2Y2K A;  5B24 C;  1U35 D;  4WU9 C;  5BT1 C;  3NQU B;  1P3F B;  2JSS A;  4R8P B;  1P3K D;  5G49 B;  4H9O A;  3W97 B;  4NE6 A;  2HIO D;  2NZD B;  4ZBJ C;  4YS3 A;  3KUY D;  4J8V C;  3KWQ A;  3AV1 D;  2CV5 D;  2Y2M A;  2PYO D;  5B31 D;  2Y2Q A;  5JRG B;  3LZ0 D;  5GXQ C;  5B1M A;  5AV6 A;  3TU4 A;  1PZR A;  2RVQ D;  1F66 B;  2BYM A;  4CAY A;  3X1V C;  4NE5 A;  4J8W D;  4Z5T D;  4J8X D;  3AL0 C;  3REH B;  5AV9 B;  5AV5 B;  4KUD D;  2NQB D;  3C1C A;  1P3L D;  3AZJ A;  2FJ7 A;  3AZN D;  3AZL B;  5F99 B;  3AZF B;  3O62 B;  5CPK B;  1P3F C;  4R8P C;  4M6B A;  3W97 C;  2NZD C;  1P3I A;  4QLC D;  4AWL C;  1P3P A;  1TZY D;  2L5A A;  1KX4 B;  3AFA B;  5JRG C;  3P5J B;  4XUJ C;  1P3A C;  3VH5 T;  5CPI A;  3LZ1 A;  1P3O A;  5GT3 A;  3AZM A;  3B6G A;  4YS3 D;  4Z66 C;  3X1S B;  3REI C;  3WTP A;  4X23 B;  5GSU B;  3REH C;  3EPK A;  5AV9 C;  5B1M D;  5AV5 C;  5BNX B;  5CPJ A;  3A1K A;  1ID3 B;  2F8N D;  4CSR A;  5F99 C;  3AZF C;  3O62 C;  5CPK C;  3VH6 T;  5BT1 D;  3KXB B;  4YM6 A;  3X1U D;  3C1C D;  2FJ7 D;  5GT0 A;  3AFA C;  1P34 C;  1AOI A;  4LD9 A;  5DNM A;  1P3I D;  3LEL A;  1M18 D;  3X1S C;  5GSU C;  5AVC B;  3AYW D;  5CPI D;  5B32 B;  3WAA A;  3AZM D;  5B32 G;  3AZE B;  1KX5 B;  3AV2 A;  3KXB C;  4UUZ B;  3W96 A;  3AZK A;  5CP6 B;  3MVD B;  5BS7 A;  5DNN B;  3LJA C;  3REJ C;  3V9R A;  1EQZ B;  4YM6 D;  2W8S A;  3C1B A;  2BYK A;  3NQJ B;  5B0Y B;  1BH8 B;  1F66 D;  2YFV B;  3VH5 A;  1S32 B;  5AVC C;  2ARO A;  1ZLA A;  4LD9 D;  3B0C W;  4EO5 C;  3LEL D;  1B67 A;  5CHL B;  4KGC A;  3WKJ B;  3R45 A;  4ZUX A;  3EPJ A;  3EPH A;  5FUG A;  3AZL D;  4H9P B;  4H9S C;  3REK D;  2Y2I A;  5CP6 C;  5AVB A;  3REL A;  3VH6 A;  2DQN C;  5B1L C;  3B6F A;  5E5A A;  3AN2 B;  2BG1 A;  1KX4 D;  3AZK D;  4WU8 A;  3AFA D;  5B0Y C;  3UTA C;  3MGS A;  3AZH A;  3MGP A;  5B40 B;  1P3G B;  1U35 A;  4J8U C;  4E45 A;  4X23 D;  5B2J B;  3MNN C;  3UT9 B;  3WKJ C;  1ID3 D;  2F8N G;  3AZG B;  2YFW A;  1ZLA D;  1N1J A;  3EPL A;  3KUY A;  2ZY4 A;  2CV5 A;  3AV1 A;  2PYO A;  5B31 A;  3LZ0 A;  3KSY A;  5C3I B;  1M19 B;  4G91 C;  2ZY2 A;  4Z2M G;  4J8X A;  3F6T A;  4UPK A;  3B6F D;  5GXQ B;  4DRA A;  4KUD A;  1P3G C;  1H3O A;  3TU4 B;  3X1V B;  3WA9 C;  4WU8 D;  3UT9 C;  3MGS D;  3AZH D;  5B32 D;  3AZG C;  3B0D B;  3W99 C;  3A6N D;  3AZE D;  1KX5 D;  4QLC A;  1TZY A;  5B33 A;  3H0M C;  4WNN B;  5C3I C;  3MVD D;  5B0Z D;  5DNN D;  1M19 C;  5BNV A;  4AWL B;  1BH9 A;  3W98 A;  1EQZ D;  4XUJ B;  1P3A B;  1P3P B;  4DQY B;  3UTB A;  3KWQ C;  3KFU G;  2HUE C;  2F8N A;  3TU4 C;  4Z66 B;  5AV6 C;  5AV8 B;  1S32 D;  3REI B;  5B24 A;  1JFI A;  3B6G B;  3MGR B;  3X1U A;  3B0D C;  3WTP B;  1T3U A;  3A1I A;  5BO0 A;  3AZJ C;  5B2I B;  4J8V A;  1M18 A;  5JA4 A;  5B33 D;  1WWI A;  3AN2 D;  1P34 B;  1P3P C;  3AYW A;  2Y2O A;  1Q9C A;  3MGQ B;  5AV8 C;  3W98 D;  5B40 D;  3LZ1 C;  1P3O C;  5GT3 C;  5DNM B;  3B6G C;  1W2E A;  3MGR C;  3UTB D;  5B2J D;  3NQU A;  3WTP C;  1P3F A;  4JJN B;  2G5I C;  4R8P A;  5G49 A;  5CPJ C;  5B24 D;  2NZD A;  1KX3 B;  1P3B B;  4WU9 D;  1B6W A;  5B2I C;  5JRG A;  3LJA B;  2JCH A;  3AZI B;  1F66 A;  3REJ B;  2F8N H;  5GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...