4ZUXV

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
89
structure length
89
Chain Sequence
TAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
total genus 34
structure length 89
sequence length 89
chains with identical sequence a, f, k
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 4zuxV00
4W4UB 3M99C 4FJCB 4C31B 3FWBC 3MHHB 3MHSB 4ZUXV 3FWCC 3KJLA 4FK5B 3KIKA 4DHXB 4WA6B 4MBEC 4FIPB
chains in the Genus database with same CATH superfamily
4HGKA 2OZBB 1KDXA 1O9XA 1UORA 1MUSA 2KBZA 2GUTA 2KWFA 4LUFA 5ID9A 1HK1A 5HOZA 2VUFA 1E7GA 4L9KA 2E0XA 2BXQA 4F5SA 4F5VA 2AJEA 3GQXA 1MA9A 4M70B 4PO0A 5GHKA 3SQJA 2XVVA 2Z8JA 1E7BA 5GIPA 2DG5A 4FK5B 4D7XA 1E7EA 5IIXA 5D7GA 2Z8KA 3BPJA 4Z9OA 1BJ5A 1HA2A 1GNIA 3NVKA 2VDBA 5BPKA 2BXNA 4GG2A 2QMCA 2NNWA 5GIOA 2BXLA 3UIVA 2AGHB 4N3ZA 4FIPB 4GDXA 2QHBA 3FWBC 4NAWB 4E99A 4J2VA 4BKEA 2BXBA 4IW2A 1J78A 2BXCA 2CKXA 2VUEA 4ZBQA 5GINA 2LXTA 1HK4A 4N0FD 1KW2A 3B9MA 3NVMA 3V09A 2DBWA 2DYMA 4EMXA 1LOTA 5FUOA 1LNSA 3KJLA 3KIKA 3W1SA 4GDKB 3ICXA 1E7AA 2XVWA 4I9OA 4ZC6A 3TDLA 4S1YA 3FNMA 4C31B 2BXEA 2QM6A 4TQ1A 3CX9A 4N0UD 3VQIA 2V36A 4F5UA 4K71A 4LA0A 3JQZA 3B9LA 2I2ZA 4L8UA 3WHQA 4LB2A 1H9ZA 4OT2A 4ZBKA 3FWCC 1NT2B 1VZSA 4HGMB 1HK2A 2XW1A 4BY9C 2BXFA 3GQUA 3LU8A 3V08A 1MM8A 3NVIA 2BXOA 4TQ0A 5B5TA 2NQOA 1AO6A 1E7IA 4LUHA 5DBYA 3SIUB 2EFHA 3LU7A 3WHSA 2LOQA 2OT3A 2LQHA 2BXIA 2I30A 1TXUA 3ECPA 3A73A 1MIWA 4MBEC 5IFOA 1BM0A 1KXPD 4ZBRA 5ID7A 2BXDA 1MIVA 3MHHB 5IJEA 2LQIA 5DQFA 4LB9A 1BKEA 3A75A 2XW0A 3GA9L 2BXKA 4OTUA 5IIHA 2LXSA 2XVUA 2EFCA 4G01A 3JRYA 2XVQA 2YDFA 3PLAA 3M99C 4G04A 2XMOA 2K0NA 2BXHA 4OTTA 2EFDA 2DBUA 1E7FA 3LU6A 2BXPA 2ROHA 4JK4A 1MUHA 3NMUA 1SB0A 4FJCB 2EFEA 5IIUA 4GDLB 1JNBA 2BXAA 4DHXB 2XSIA 2BXGA 1GNJA 1MIYA 2JUHA 4F5TA 3G9KD 3WHRA 3MHSB 4ZCGA 1VFIA 4L9QA 4ZUXV 1HK3A 1J7EA 3V03A 3SIVB 2BXMA 5IJ5A 4WA6B 3H3AA 4W4UB 4IW1A 2E0YA 1N5UA 1HK5A 3H37A 1IJGA 4DM0A 4G03A 1E7HA 1TF0A 1H5WA 1E78A 1E7CA 4K2CA 1FOUA 2DYOA 4OR0A 2BX8A 2Z8IA 4Z69A 5IJFA 2DBXA
chains in the Genus database with same CATH topology
4HGKA 2OZBB 1O9XA 1UORA 2KBZA 4LUFA 5ID9A 1HK1A 5HOZA 2VUFA 1E7GA 4L9KA 2E0XA 2BXQA 4F5SA 4F5VA 2AJEA 3GQXA 1MA9A 4M70B 4PO0A 5GHKA 3SQJA 2XVVA 2Z8JA 1E7BA 5GIPA 2DG5A 4FK5B 1E7EA 5IIXA 5D7GA 2Z8KA 4Z9OA 1BJ5A 1HA2A 1GNIA 3NVKA 2VDBA 5BPKA 2BXNA 4GG2A 2QMCA 2NNWA 5GIOA 2BXLA 3UIVA 4N3ZA 4FIPB 4GDXA 2QHBA 3FWBC 4NAWB 4E99A 4J2VA 4BKEA 2BXBA 4IW2A 1J78A 2BXCA 2CKXA 2VUEA 4ZBQA 5GINA 1HK4A 4N0FD 1KW2A 3B9MA 3NVMA 3V09A 2DBWA 2DYMA 4EMXA 1LOTA 5FUOA 1LNSA 3KJLA 3KIKA 3W1SA 4GDKB 3ICXA 1E7AA 2XVWA 4ZC6A 3TDLA 4S1YA 3FNMA 4C31B 2BXEA 2QM6A 4TQ1A 3CX9A 4N0UD 3VQIA 2V36A 4F5UA 4K71A 4LA0A 3JQZA 3B9LA 2I2ZA 4L8UA 3WHQA 4LB2A 1H9ZA 4OT2A 4ZBKA 3FWCC 1NT2B 1VZSA 4HGMB 1HK2A 2XW1A 4BY9C 2BXFA 3GQUA 3LU8A 3V08A 3NVIA 2BXOA 4TQ0A 5B5TA 2NQOA 1AO6A 1E7IA 4LUHA 5DBYA 3SIUB 2EFHA 3LU7A 3WHSA 2LOQA 2OT3A 2BXIA 2I30A 1TXUA 3A73A 1MIWA 4MBEC 5IFOA 1BM0A 1KXPD 4ZBRA 5ID7A 2BXDA 1MIVA 3MHHB 5IJEA 5DQFA 4LB9A 1BKEA 3A75A 2XW0A 3GA9L 2BXKA 4OTUA 5IIHA 2XVUA 2EFCA 4G01A 3JRYA 2XVQA 2YDFA 3PLAA 3M99C 4G04A 2XMOA 2BXHA 4OTTA 2EFDA 2DBUA 1E7FA 3LU6A 2BXPA 2ROHA 4JK4A 3NMUA 4FJCB 2EFEA 5IIUA 4GDLB 1JNBA 2BXAA 4DHXB 2XSIA 2BXGA 1GNJA 1MIYA 2JUHA 4F5TA 3G9KD 3WHRA 3MHSB 4ZCGA 1VFIA 4L9QA 4ZUXV 1HK3A 1J7EA 3V03A 3SIVB 2BXMA 5IJ5A 4WA6B 3H3AA 4W4UB 4IW1A 2E0YA 1N5UA 1HK5A 3H37A 1IJGA 4G03A 1E7HA 1TF0A 1H5WA 1E78A 1E7CA 4K2CA 1FOUA 2DYOA 4OR0A 2BX8A 2Z8IA 4Z69A 5IJFA 2DBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4U B;  3M99 C;  4FJC B;  4C31 B;  3FWB C;  3MHH B;  3MHS B;  4ZUX V;  3FWC C;  3KJL A;  4FK5 B;  3KIK A;  4DHX B;  4WA6 B;  4MBE C;  4FIP B; 
#chains in the Genus database with same CATH topology
 4HGK A;  2OZB B;  1KDX A;  1O9X A;  1UOR A;  1MUS A;  2KBZ A;  2GUT A;  2KWF A;  4LUF A;  5ID9 A;  1HK1 A;  5HOZ A;  2VUF A;  1E7G A;  4L9K A;  2E0X A;  2BXQ A;  4F5S A;  4F5V A;  2AJE A;  3GQX A;  1MA9 A;  4M70 B;  4PO0 A;  5GHK A;  3SQJ A;  2XVV A;  2Z8J A;  1E7B A;  5GIP A;  2DG5 A;  4FK5 B;  4D7X A;  1E7E A;  5IIX A;  5D7G A;  2Z8K A;  3BPJ A;  4Z9O A;  1BJ5 A;  1HA2 A;  1GNI A;  3NVK A;  2VDB A;  5BPK A;  2BXN A;  4GG2 A;  2QMC A;  2NNW A;  5GIO A;  2BXL A;  3UIV A;  2AGH B;  4N3Z A;  4FIP B;  4GDX A;  2QHB A;  3FWB C;  4NAW B;  4E99 A;  4J2V A;  4BKE A;  2BXB A;  4IW2 A;  1J78 A;  2BXC A;  2CKX A;  2VUE A;  4ZBQ A;  5GIN A;  2LXT A;  1HK4 A;  4N0F D;  1KW2 A;  3B9M A;  3NVM A;  3V09 A;  2DBW A;  2DYM A;  4EMX A;  1LOT A;  5FUO A;  1LNS A;  3KJL A;  3KIK A;  3W1S A;  4GDK B;  3ICX A;  1E7A A;  2XVW A;  4I9O A;  4ZC6 A;  3TDL A;  4S1Y A;  3FNM A;  4C31 B;  2BXE A;  2QM6 A;  4TQ1 A;  3CX9 A;  4N0U D;  3VQI A;  2V36 A;  4F5U A;  4K71 A;  4LA0 A;  3JQZ A;  3B9L A;  2I2Z A;  4L8U A;  3WHQ A;  4LB2 A;  1H9Z A;  4OT2 A;  4ZBK A;  3FWC C;  1NT2 B;  1VZS A;  4HGM B;  1HK2 A;  2XW1 A;  4BY9 C;  2BXF A;  3GQU A;  3LU8 A;  3V08 A;  1MM8 A;  3NVI A;  2BXO A;  4TQ0 A;  5B5T A;  2NQO A;  1AO6 A;  1E7I A;  4LUH A;  5DBY A;  3SIU B;  2EFH A;  3LU7 A;  3WHS A;  2LOQ A;  2OT3 A;  2LQH A;  2BXI A;  2I30 A;  1TXU A;  3ECP A;  3A73 A;  1MIW A;  4MBE C;  5IFO A;  1BM0 A;  1KXP D;  4ZBR A;  5ID7 A;  2BXD A;  1MIV A;  3MHH B;  5IJE A;  2LQI A;  5DQF A;  4LB9 A;  1BKE A;  3A75 A;  2XW0 A;  3GA9 L;  2BXK A;  4OTU A;  5IIH A;  2LXS A;  2XVU A;  2EFC A;  4G01 A;  3JRY A;  2XVQ A;  2YDF A;  3PLA A;  3M99 C;  4G04 A;  2XMO A;  2K0N A;  2BXH A;  4OTT A;  2EFD A;  2DBU A;  1E7F A;  3LU6 A;  2BXP A;  2ROH A;  4JK4 A;  1MUH A;  3NMU A;  1SB0 A;  4FJC B;  2EFE A;  5IIU A;  4GDL B;  1JNB A;  2BXA A;  4DHX B;  2XSI A;  2BXG A;  1GNJ A;  1MIY A;  2JUH A;  4F5T A;  3G9K D;  3WHR A;  3MHS B;  4ZCG A;  1VFI A;  4L9Q A;  4ZUX V;  1HK3 A;  1J7E A;  3V03 A;  3SIV B;  2BXM A;  5IJ5 A;  4WA6 B;  3H3A A;  4W4U B;  4IW1 A;  2E0Y A;  1N5U A;  1HK5 A;  3H37 A;  1IJG A;  4DM0 A;  4G03 A;  1E7H A;  1TF0 A;  1H5W A;  1E78 A;  1E7C A;  4K2C A;  1FOU A;  2DYO A;  4OR0 A;  2BX8 A;  2Z8I A;  4Z69 A;  5IJF A;  2DBX A; 
#chains in the Genus database with same CATH homology
 4HGK A;  2OZB B;  1O9X A;  1UOR A;  2KBZ A;  4LUF A;  5ID9 A;  1HK1 A;  5HOZ A;  2VUF A;  1E7G A;  4L9K A;  2E0X A;  2BXQ A;  4F5S A;  4F5V A;  2AJE A;  3GQX A;  1MA9 A;  4M70 B;  4PO0 A;  5GHK A;  3SQJ A;  2XVV A;  2Z8J A;  1E7B A;  5GIP A;  2DG5 A;  4FK5 B;  1E7E A;  5IIX A;  5D7G A;  2Z8K A;  4Z9O A;  1BJ5 A;  1HA2 A;  1GNI A;  3NVK A;  2VDB A;  5BPK A;  2BXN A;  4GG2 A;  2QMC A;  2NNW A;  5GIO A;  2BXL A;  3UIV A;  4N3Z A;  4FIP B;  4GDX A;  2QHB A;  3FWB C;  4NAW B;  4E99 A;  4J2V A;  4BKE A;  2BXB A;  4IW2 A;  1J78 A;  2BXC A;  2CKX A;  2VUE A;  4ZBQ A;  5GIN A;  1HK4 A;  4N0F D;  1KW2 A;  3B9M A;  3NVM A;  3V09 A;  2DBW A;  2DYM A;  4EMX A;  1LOT A;  5FUO A;  1LNS A;  3KJL A;  3KIK A;  3W1S A;  4GDK B;  3ICX A;  1E7A A;  2XVW A;  4ZC6 A;  3TDL A;  4S1Y A;  3FNM A;  4C31 B;  2BXE A;  2QM6 A;  4TQ1 A;  3CX9 A;  4N0U D;  3VQI A;  2V36 A;  4F5U A;  4K71 A;  4LA0 A;  3JQZ A;  3B9L A;  2I2Z A;  4L8U A;  3WHQ A;  4LB2 A;  1H9Z A;  4OT2 A;  4ZBK A;  3FWC C;  1NT2 B;  1VZS A;  4HGM B;  1HK2 A;  2XW1 A;  4BY9 C;  2BXF A;  3GQU A;  3LU8 A;  3V08 A;  3NVI A;  2BXO A;  4TQ0 A;  5B5T A;  2NQO A;  1AO6 A;  1E7I A;  4LUH A;  5DBY A;  3SIU B;  2EFH A;  3LU7 A;  3WHS A;  2LOQ A;  2OT3 A;  2BXI A;  2I30 A;  1TXU A;  3A73 A;  1MIW A;  4MBE C;  5IFO A;  1BM0 A;  1KXP D;  4ZBR A;  5ID7 A;  2BXD A;  1MIV A;  3MHH B;  5IJE A;  5DQF A;  4LB9 A;  1BKE A;  3A75 A;  2XW0 A;  3GA9 L;  2BXK A;  4OTU A;  5IIH A;  2XVU A;  2EFC A;  4G01 A;  3JRY A;  2XVQ A;  2YDF A;  3PLA A;  3M99 C;  4G04 A;  2XMO A;  2BXH A;  4OTT A;  2EFD A;  2DBU A;  1E7F A;  3LU6 A;  2BXP A;  2ROH A;  4JK4 A;  3NMU A;  4FJC B;  2EFE A;  5IIU A;  4GDL B;  1JNB A;  2BXA A;  4DHX B;  2XSI A;  2BXG A;  1GNJ A;  1MIY A;  2JUH A;  4F5T A;  3G9K D;  3WHR A;  3MHS B;  4ZCG A;  1VFI A;  4L9Q A;  4ZUX V;  1HK3 A;  1J7E A;  3V03 A;  3SIV B;  2BXM A;  5IJ5 A;  4WA6 B;  3H3A A;  4W4U B;  4IW1 A;  2E0Y A;  1N5U A;  1HK5 A;  3H37 A;  1IJG A;  4G03 A;  1E7H A;  1TF0 A;  1H5W A;  1E78 A;  1E7C A;  4K2C A;  1FOU A;  2DYO A;  4OR0 A;  2BX8 A;  2Z8I A;  4Z69 A;  5IJF A;  2DBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...