4ZVOA

Caspase-7 variant 4 (v4) with reprogrammed substrate specificity due to y230v/w232y/s234v/q276d substitutions bound to veid inhibitor.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
139
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zvoA00
4QU5A 4EJFA 3NS7A 3V3KA 1NMSA 1I51A 3V4OA 1RWMA 4NOJA 3ITNA 1K86A 2XZDA 5H0IA 3DEHA 1PYOA 3IBFA 4DCJA 4JJEA 4EHHA 3H11A 4AWBA 2QL9A 4QUHA 5JFTA 4FDLA 2K7ZA 5IBRA 1RWVA 3KJFA 3K7EA 3GJQA 4FGUA 4ZVOA 3R6LA 5IAEA 1NMEA 3SIPA 2Y1LA 3GJSA 3H11B 4NOKA 4QU8A 3GJRA 3DEJA 4M9RA 4NBNA 1RWXA 1SC1A 4QUGA 1RWOA 5IBCA 3KJQA 2J33A 1JXQA 2H54A 3V55A 1F9EA 3QNWA 5I9TA 2CNOA 2P2CA 2DKOA 4EHDA 5IAGA 1RWWA 5LUAA 3NR2A 5I9BA 3H0EA 2QLBA 2CNLA 3DEIA 1SC3A 4JJ7A 4ZVPA 4QUAA 2XYGA 1ICEA 2C2ZA 3PD1A 3P4UA 2CJXA 4QTYA 5LU8A 4ZVUA 1RHMA 3D6HA 1RHRA 1GFWA 1SHJA 3GJTA 4D3XA 4N6OA 4N7JA 1RHUA 4QUDA 3SIRA 4QUIA 1PAUA 2WDPA 3R7NA 3H1PA 4ZVQA 4AW9A 2AR9A 2CDRA 1SC4A 3V6LA 1RWKA 2FP3A 3PCXA 3S70A 3V4LA 3R5KA 4IYRA 4QUBA 3DEKA 1BMQA 3EDQA 4EHAA 4PS1A 5IBPA 4EHNA 4N7MA 4D3YA 1RWNA 2XZTA 3R6GA 4FEAA 4JB8A 3R7SA 4D3ZA 5K20A 1M72A 4JR0A 2HBRA 1I4EB 4N6GA 4PRYA 2CJYA 4JQZA 4N5DA 4EHFA 5IASA 4EHLA 3R5JA 4ZVTA 5IABA 4NBKA 2QL5A 3R7BA 3EDRA 4NBLA 3D6FA 3E4CA 2C2OA 4PS0A 1F1JA 1RHKA 2CNKA 2QLFA 1QTNA 4EHKA 4HVAA 3OD5A 4ZVSA 2C1EA 2H65A 5IAJA 2H48A 5IAKA 1SHLA 1QDUA 1CP3A 1RE1A 2H5JA 4LSZA 1CVRA 2H51A 1KMCA 1RHJA 4QU0A 1I3OA 2QL7A 2XYPA 4ZVRA 3S8EA 4QULA 4FXOA 1NMQA 3IBCA 4N6NA 2HBYA 5IANA 3UOAB 1I4OA 4PRZA 2HBQA 3UO8B 2C2MA 2H5IA 2QLJA 4IEFB 4JR1A 4JR2A 4NOMA 2FUNB 4QTXA 3P45A 4I1RA 4AWAA 5LU9A 2C2KA 4HQRA 3H13A 3D6MA 3KJNA 5IARA 1IBCA 2J30A 1K88A 4NOLA 5LUBA 1QX3A 4DCOA 2Y0BA 4JJ8A 4QUEA 2HBZA 4QU9A 1RHQA 2H4WA 2J31A 2NN3C 2H4YA 3NKFA 4DCPA 4JQYA 2CNNA 4I1PA 3BIJA 4HQ0A 3RJMA 2XYHA 5IC6A 3PD0A 2FQQA 1RWPA 3V6MA 4QUJA 5IC4A 1NW9B 2J32A 1GQFA
chains in the Genus database with same CATH superfamily
5EQFA 3HP1A 1Q57A 5T4EA 3GWZA 2GFHA 2XTZA 3V8NA 5HRAA 5M29A 3GDHA 1VP3A 4Z4CA 3W6ZA 4NJMA 3ITNA 1FTNA 4UOZA 1ZISA 3F6YA 4HB3A 3NHUA 1L7VC 2PU5A 3VC7A 1TT7A 4WI1A 3VU3A 4MGYR 3L8HA 5AW7A 2CB0A 4DEXA 4DR1B 1QPZA 121PA 4PSDA 1H2AS 3AVQA 2R68A 5JRDS 4DPLA 3FWYA 3CEHA 3NJ8A 3RHTA 1KS9A 4G56A 2WHPB 1I0LA 2FQWA 3IERA 1O3YA 1QHHA 3O7WA 4LSMA 1T8SA 1SBCA 1TVKA 3EBLA 1NG9A 2BKEA 3KX2A 1P1BA 4BVJA 4YUVA 3ZWXA 4DLKA 2PUEA 4UUAA 4ZC8A 4X97A 1OYVA 2G28A 2SICE 1XN4A 1OBCA 2QUIA 3VOBA 3OPQA 5H9VA 5JXWA 2JC3A 2YIMA 1KK2A 2WJGA 3QVUA 5ABPA 1RPAA 3T5CA 5B7PA 3KSAC 1DIBA 4M9QA 1EFRA 4P81A 2E21A 1FP2A 1YK0A 3FFBA 1YQ9A 3G0CA 3KQQA 4OOFA 3E5RA 4RHFA 4EW2A 1E58A 3GB9A 3IPCA 3IT0A 3LY8A 1PDOA 2D1QA 3CJQA 3ANTA 3K0FB 3Q0TA 3TPCA 1K06A 2EJBA 3TSAA 1NAIA 1DO0A 1PSWA 1UBEA 1NQXA 1OR8A 2OCAA 2C4WA 4L74A 4RGQA 4RZ2A 3CKLA 1YDMA 3AR9A 1EQAA 1OQAA 3ITEA 4PZ0A 3D0OA 1J8YF 4KQEA 5CH3A 3U2QA 5ED4A 3IEMA 3MCVA 5E7IA 1QS0B 2DLDA 2IBSA 4MCIA 5EQTA 1U5BB 1AQJA 1G5RA 2R87A 4KV7A 1I4TD 3PNMA 3KEMA 4MINA 4L8FA 3C74A 4MVJI 1MC5A 4GPD1 1WCWA 4LAFA 2QAGA 4EKDA 2JLWA 2QKYA 4BO2A 1OAOC 2JFXA 1ZGHA 3O8OB 2X0KA 3KU4A 5JR3A 1GSHA 2AFIE 4K81B 5KOIA 5BT9A 4LY6A 1E6KA 1JLLA 2O2IA 1PW5A 1M8KA 2ZJFA 4YLYA 1MRSA 3CLTC 1EVKA 3O1JC 3OU7A 2P4UA 3FUUA 1E1CB 3OVMA 3C5CA 4DMFA 5BUCA 1W36D 3RU2A 4RD4A 3OPXA 1HT1E 3LYUA 1NBAA 4CKXA 2QW8A 3SYNA 1HYEA 1HDZA 3G9XA 1H22A 3JD3A 4EYKA 5CIQA 4KN9S 1J0XO 4JZYA 4S24A 1UC9A 3ND9A 5LBUA 4PX2A 4H4EA 1Z7YA 4DIFA 5HZMA 2IX3A 4B3MB 3T0GA 4UPVA 2VPTA 4N0PA 3RW9A 2SNIE 3O3OB 1AKNA 1VSTA 4PO8A 3OCXA 3WIVA 4JP3A 5IJ0B 4YJFA 2B5OA 2P1DA 4DNFA 3PR2B 3L0DA 3QLVA 4QXAA 5D3MA 4JA0A 4XX0A 2VJNA 3RVJA 3SG0A 5AKGA 4WN3A 3JQ9A 4JQYA 5GZ6A 2QUBA 1S96A 3BIJA 4I5DA 2AHRA 3Q2IA 3NKLA 3HA5A 3PVCA 5AUNB 1IY1A 3RANA 1V16B 2V7BA 3RNOA 1QR6A 1TJYA 5C8YF 1KEWA 1SOAA 1NYTA 1DC7A 3ASZA 5CEEA 1F3LA 2HK6A 3UGKA 2I6GA 2R6DA 5AVXA 1Z5UA 1P4JA 1A9TA 2J9XB 2YIDA 2VHYA 4UOEA 4IFEA 2A5JA 2PL5A 3UMBA 2NM0A 3Q2OA 4FFRA 5NLLA 5CB4B 3A04A 4FC7A 4WZBA 3AC0A 4BMVA 1QR2A 1BYUA 2QAJA 4Q1EA 5LA6B 3PXGA 1HM5A 3RIYA 3PX2A 2JK0A 2QEQA 1DRVA 3HU2A 3MPUA 2CMHA 3JQAD 1NASA 1Z4LA 1HLFA 2Q3JA 4GMGA 1VFNA 4BLVA 2OFWA 1GPBA 4WUVA 7MHTA 3EEFA 1YR2A 2XSZA 1TM4E 2BLNA 1OLXA 3MTDA 4RENA 5LVAA 4K40A 3CZ4A 3VDXA 3FYDA 4MA5A 2C57A 1ULZA 1VYHA 1WXGA 2IYQA 2Q5HA 3AFGA 3JRXA 4MPPA 2Z1DA 3I6MA 5A5DA 5LUAA 1FFEA 3VNBA 1P81A 4GWLA 3LPDA 3WL4A 3I72A 1COZA 3O94A 2DBRA 3ZE0B 1CTQA 2X13A 621PA 3V33A 1G5QA 5FXMA 2QAGC 5TQ0A 1SK9A 1YS4A 3LT5A 1TGYA 1ZVKA 2ATXA 5IJZA 5K3EA 1RVV1 4U2EA 1Z16A 3TLGB 1U8YA 2CCKA 3RRBA 1IJFA 3QE2A 2VDUE 5HJEA 5F2KA 2GBIA 2OM2A 1QIIA 5LN1A 1JG3A 3N2ZB 4PZEA 4WXEA 2QLTA 1E2FA 1QCCA 2VLBA 4W5JA 2M6LA 2OILA 2Q3BA 2XZTA 3R6GA 2C3YA 1TO6A 4YALA 4DWJA 5K20A 3KALA 3MB5A 4UNSA 5KYYA 3KQUA 4DILA 4O4LA 3GP8A 3LPCA 3LUDA 2F9MA 2O7QA 1ABEA 3VJLA 1MIHA 4MDYA 3GLHA 3UMFA 4Q9NA 5HKLA 3O4HA 4L5BA 4TXLA 3UJBA 2WSMA 4KI0A 1JSLA 4Z5XA 3N8KA 3W6UA 5K8IA 3KTDA 1FFWA 1IZZA 2P40A 4NYMQ 2PVCA 5DX1A 2BH2A 1M6VA 4UE6A 3PGMA 5JROA 3SHVA 4TYYA 2GEUA 1CETA 4YP9A 1LRLA 3QLVC 4OHZA 4KI7A 2QF7A 1SCIA 5IVDA 4CL8A 4F38A 2ZIEA 1Q7EA 1E4VA 2HEGA 3JQ9C 4H6PA 2BUCA 3GLGB 1Y7IA 1BMFD 4YS6A 4G26A 4DBLC 3HFGA 3MAGA 2R11A 1J7JA 2D3WA 4GH5A 2GDZA 3OZAA 5EPOA 4BNYA 1ZJJA 4F3TA 4DBVO 4LDQA 4MAAA 5AVKA 1GU1A 4TS4A 4B80A 3VZPA 3HVJA 3KHTA 3ZDZB 3SK0A 5HX7A 3QXGA 1Z0DA 2H2FA 1GUFA 1QCYA 1V11B 3T1TA 4MARA 4P9NA 1QG6A 5HE8A 4H1TA 4N3CA 4JV5B 1G5FA 2MINB 3I52A 1P75A 3IQHX 2XYHA 2GK7A 3LTEA 4LMAA 3PD0A 4RCZA 4YQEA 3HWRA 1SXQA 3MUFA 3ZBUA 5H9WA 4BFCA 2IUYA 5JEDA 1RQGA 3BWXA 3ZXYA 2PDAA 1RLIA 2QT0A 1AA9A 3E81A 2QV7A 3GGDA 4IXTA 4CKWA 3TGLA 4CMEA 3GFFA 1LXCA 3HHPA 2AC7A 4I4NA 4OQPA 1ARZA 4X7RA 2IYOA 2OO7A 1FYVA 1PNVA 2BE9A 1Z5OA 1TCUA 2HPVA 3S1LA 3HUDA 4V0KA 1Q83A 3ZH2A 4BNNA 1O94D 1FL9A 3IVMA 4MNTA 1U9ZA 2J3KA 3K6RA 1M1NB 5ALRA 1Q1AA 4LXIA 4YRQA 1O7JA 2P2YA 1Z9BA 1O97C 2C3PA 2YV3A 4TL8A 3ORQA 1DKUA 3ONNA 4IX9A 3AY0A 3WNQA 2RBEA 2PMFA 2I2WA 3ASVA 2G09A 2B9VA 2XUZA 2WLTA 3ZGNA 5CT4A 4HAYA 1M2VB 3EVCA 3FUCA 1SXPA 1U4NA 3NYRA 5IH3A 5LXTA 1ZM9A 2XYGA 4MRSA 5AKIA 1Q1GA 4OQMA 2A0KA 1I4DD 2QTLA 5DB4A 1NMZA 4EDFA 4H3KB 3ZCRA 1DT5A 4G5YA 4X54A 4O4HB 4F4UA 2NSJA 2R6R1 3U80A 4XD2A 4LHSA 1DUSA 5H82A 4GI7A 2OA0A 2HHLA 1DAIA 4KH1A 4UZEA 4GKBA 1YR6A 1UBOS 1RADA 2H17A 1KAGA 3CJTA 3OU6A 2KBFA 5G4KA 5JH7F 4DR2B 1TEXA 1DAHA 1SCAA 2CSXA 3E7PA 4HH0A 1E6MA 1KH2A 1XAJA 3E61A 3IH5A 2B2XA 5FCDA 1FUYB 1KKUA 2JI7A 5JIBA 2FMTA 1MGOA 4RH3A 1BMQA 1EVZA 4OI0A 1COWD 1ZJWA 5DCLA 3FLBA 4PGGA 2PJDA 3VRHA 4E14A 4YAKA 4HDRB 3E84A 2VFAA 3ZWBA 1N9ZA 5JTTA 1X3LA 2ZCUA 5G1PA 1O57A 3ICOA 3QEJA 1WEKA 4LYFA 5GJWC 2IOFK 3I23A 3K16A 2AG6A 5JLAA 4E33A 2A0XA 2WJJA 2A57A 2EYUA 2YDYA 4YT5A 5HDQA 3DM9B 4E15A 4BMZA 1FSZA 2H52A 3GG2A 4PTLA 1CYDA 2ERCA 1O6FA 4FMBB 1WXDA 3RUCA 5AM1A 3DE0X 4DLZA 3P5SA 2FW9A 3IUMA 3Q3VA 4KVAA 5TDHA 2GD0A 1WPGA 2R48A 2XYQA 1A69A 2C0CA 3SICE 4CR8A 5HVNA 2FP4B 3VH2A 1I80A 4X7PA 4EIWA 2GF0A 1MIOB 1D07A 1JYSA 3P9NA 4OXYA 4S1TA 3V80A 3QVSA 4PAWA 1XPUA 2HBQA 2ZS8A 3A1TA 2I4OA 1YT5A 1U1CA 3DOHA 3LC0A 4RSRA 2NADA 1WCIB 4DR7B 2R4TA 5EY5B 1ES9A 1JI3A 3SI7A 2J4CA 3SS7X 3W7AA 4CMEC 4BUZA 2BHSA 2XCOA 1ZOSA 1T5OA 1Y48E 1EQUA 3HUFA 1HBJA 1YXMA 3AR3A 3EXHA 1V4NA 2EEPA 4GQIA 3ZGVA 4JX8A 5DT2A 3A6EA 3IVCA 3C5HA 3WLTA 4ZOBA 3RROA 5D84A 3DUFB 2BM8A 3GMDA 3VNAA 1ND5A 4QL3A 4C06A 5G0VA 5JAUA 5JWRA 3AUFA 3HG7A 4DQDA 1T1EA 1GSOA 1QLJA 3RYHA 5EP1A 1S7GA 4HX9A 4MDEA 1W93A 5A0TA 1DXQA 1T36B 1I01A 4QXOA 3RODA 5C51B 1A8UA 1E6UA 1A1VA 4F4IA 1H6BA 4CTMA 2CHFA 4FFLA 3K35A 4IS2A 2RI1A 3EAFA 5AM0A 2C4TA 4QYIB 3TNYA 1W76A 1M33A 1SXIA 4H1VA 3RK1A 3ILVA 4AWBA 1CJMA 2FNAA 3AK4A 1R6XA 4IIYA 4ZD6A 5JI2E 2QW1A 1PJ8A 5GVRA 3U7RA 2NWQA 4K9NA 4IM7A 1CSEE 4OUDB 2KX7A 4DG9A 3VAYA 2BR3A 4X8LA 2IHVA 4LJ5A 5ECYA 1FYXA 3S2YA 4YMIA 4UFPA 3FKSA 4NBNA 2GJ8A 3LPAA 5F5XA 3QBEA 5C4GB 2VBFA 3AKCA 1JDUA 1R1DA 4KLNA 4PHCA 4ZK2A 1C1XA 4NENA 4XLLA 1DEXA 6PFKA 3ZGLA 2JCYA 1J2TA 2PPVA 3RYFB 4AMVA 4JC5A 2CNLA 2H3HA 3R3VA 4LGYA 2H7YA 3JQFA 2R8YA 1FRZA 2FPGB 1RD4A 1WOYA 1SBHA 2AOUB 2Z4SA 3GF4A 3VR6H 2VSFA 5GIOE 3HB9A 1JEEA 1TAQA 3L79A 4D92A 4D43A 2XHEA 2QMHA 1QDEA 3AEZA 3I3SR 2ZANA 4NULA 4QOEA 2EP5A 4M7RA 2PSSA 3T1HB 1R9NA 3HPRA 1Q14A 2AVDA 4JHXA 5I7FA 3PFIA 4FW8A 4R16A 1JKXA 3HPQA 1GD1O 2K2QB 3KKNA 4TWBA 4KXYA 2V4MA 1F3OA 1UADA 3FLEA 2XCSB 2WSLA 2VHTA 1QAMA 1R66A 2VH1A 2QYTA 3EFHA 4L57A 2DR3A 3RABA 3C70A 1FXUA 3HNOA 2A3NA 4GOND 4HR7A 3X1YA 1EAMA 1PVVA 4NK5A 1VJ5A 2WJPA 2OBLA 1L4BA 3CPHA 1CHNA 2PL9A 1NI4A 4ZVTA 4KQ6A 4ZAFA 3UXMA 2SKEA 1DCFA 2R7LA 1QAOA 1AKRA 3DF9A 4AP9A 2BFDA 1CR0A 2RGGA 1J33A 3D3NA 1G9XA 2H1SA 2LDXA 1LLQA 2I6TA 1Y5LA 1IXZA 4KMSA 5JCXA 1U11A 5CDGA 3VOSA 3CXUA 1YVRA 1ZGCA 1YOVB 3EXHC 4LTNA 3IIKA 2FWPA 3EWSA 3WG9A 4F1WA 5CM8B 4CETA 4LVCA 4D3SA 5C31A 1XD8A 1Y1QA 2HLPA 1M2NA 1YONA 2NU9A 3C8UA 3QV1A 2QM7A 4EVRA 1U7ZA 3FOBA 4FEYA 2ZSAA 3GVCA 4IDGA 4U5QA 2AUNA 5GONA 5H02A 1JB1A 3HB5X 3U26A 5AVTA 3WNBA 1SUCA 3H9QA 2YHUA 2CXNA 2WUVA 4HB2A 3E6AA 1YUMA 2GEFA 3T3HA 4OQFA 2GO1A 3UKDA 2OHOA 2JAPA 5HK8A 2VZ8A 1TEZA 3CONA 1V1MA 3ZE8A 2HHCA 5K0NA 3FPAA 5DF1A 1E63A 5KJCA 3GFPA 4DMLA 4GBMA 1DJMA 3DBLA 2W98A 1Y4UA 1EP2B 1ZL2A 3EUAA 1MPXA 2I4LA 4Q18A 2X8AA 5DN6A 2GQ0A 3VR1A 4OXIA 1M7BA 2O0HA 2ZIAA 5ARBA 3V5NA 2J0EA 1GL9B 2VH2A 4IIBA 1SBZA 4ND3A 1RI1A 3AW8A 2YXLA 3D0KA 5A4DA 2B5WA 2QMOA 3BGVA 2IOHA 3WKEA 3V4VB 4RZHA 1VL5A 3WNZA 3F5MA 1J2EA 3CB2A 1DB3A 1ZNZA 4GEKA 4ND8B 3JQFC 3RAJA 5TT1A 3A32A 1X92A 3C3BA 5EESA 3SXUA 3OIWA 3UCXA 1QQBA 1OF1A 3LH5A 3N86A 1VMIA 2BP7B 3A2LA 3NH9A 4JL6A 4TKVA 1L7BA 4UZFA 4YUXA 2XJ9A 5K8UA 5IWAB 5JJIA 3AM1A 2ZRMA 1RWXA 1UFKA 3FWNA 1QQ6A 5JZ9A 1OXUA 1R0RE 1T9ZA 3HJUA 3UWPA 5HHTA 2JLZA 3NNDA 4K0RA 4US0R 3MF4A 1KYYA 2HUPA 4RPJA 1PNTA 4OYYA 5L4NA 1DC3A 2VA8A 3EOZA 4BO3A 4QEZA 3BXFA 4JJ7A 3X1ZA 5BXQC 4Z4EA 4QE3A 1WDTA 4GE3A 4J4TA 1SU8A 4O2RA 3E7XA 1FJHA 4EJMA 1S02A 3LX4A 4LXQA 2DHRA 1NUTA 3WRWA 5LQRA 1R88A 2OT3B 2JBAA 2FOIA 3HXTA 3JU3A 4UAVA 1AQLA 1NN5A 1Z36A 2WDPA 1E62A 3SIRA 4DLRA 4FKMA 2PUFA 2IKQA 1CEXA 1Y8AA 1MQAA 3W5UA 4A91A 4A27A 1T2VA 3P9PA 3EJ6A 5I9IA 1ODTC 3HJBA 3ADCA 3A6PC 4WEQA 1MRZA 3NONA 1J8MF 4ZALA 3CEJA 4CL3A 5CDUA 1B93A 2J5KA 2CHVA 2VSYA 1U8UA 4HAVA 2NP7A 5F2EA 4BLQA 1ODFA 1WXHA 3H3FA 1VLVA 2XXBA 3S3TA 1FQJA 1P5HA 2XNCA 2IUTA 2F1HA 4L4RA 4ZWNA 5JATA 3EFOB 3NWPA 2XBUA 1JHXA 4GP7A 3U3RA 5DWVA 2QE6A 5DK4A 2H1VA 5CMLA 4ZQBA 1IPEA 1JIKA 3K8YA 1BQ3A 3G2PA 3V7UA 4R6WA 1VCHA 2IQIA 3H9UA 3GVHA 4OX9B 2VHJA 5DYIA 4BV3A 2UXCB 1NFRA 2CLKB 1YASA 4XQ9A 3OX3A 1XF1A 1J5EB 2ZRPA 3HXKA 4RMHA 5F64A 3W0LB 3OOWA 3C3DA 3P9ZA 3R7FA 4EJ2A 1IOLA 4R8SA 4YXFA 3VHXA 1LDBA 1OFVA 3C48A 3VPAA 4ECEA 2RGRA 4LJAA 5TY0A 2W37A 2CBXA 3ND5A 1HG0A 4MAMA 4RS3A 3F7NA 3LRTA 3M1AA 3NORA 4IDNA 3VR0A 3WLSA 2EKQA 1K4YA 5KJ6A 2EF0A 1NU6A 4H7IA 3M34A 1AGYA 5EIHA 1AZSC 1UT8A 1M7GA 3KSRA 1BCRB 3I1JA 4QXRA 3BRSA 1SULA 4WBSA 5K0ZA 1XMIA 5EJ4A 1Y7PA 4HRYA 1R4AA 3GT4A 5KBYA 2IOYA 1YHYA 3ILHA 3KXLA 5FYDA 5BOSA 3ZV3A 2ZE8A 2ZJ7A 3FIUA 3TYXA 4IIJF 4GGOA 2MSKA 4UD6A 1WHSB 3KE8A 5AKEA 5JS7A 1KXZA 1E0JA 1AC5A 3R5XA 3WR5A 4YCLA 5HIMA 5K6TA 3FHCB 1QOZA 3G2KA 3L5KA 3LL4A 3RJ5A 3EZXA 3HDQA 1E2JA 5CCBA 2O4CA 2QX8A 3I37X 5D6NA 5B30A 3K1AA 1XYYA 4L73A 3FHTA 2M32A 3CLRC 3QIAA 4QUHA 5JQGA 1YBVA 4GKKB 5JDIC 1LC3A 1SBNE 3WGMA 2QN9A 1RLOA 1Y8CA 4PLTA 4U3JA 4DFDA 2QR5A 3EQ8A 3IIMA 1DRWA 1T25A 1EG2A 1F2UB 4J03A 2PLWA 2QVZX 1CEYA 1VIAA 1RKXA 2WFLA 2YASA 3A31A 3MWYW 3RV4A 1QF6A 4BVBA 3UMJA 2MSDB 2L69A 5KSYA 3WGKA 2BFNA 3QE3A 2D8MA 2R7AA 5E6SA 4EJ6A 1MO4A 1RABA 3AJEA 1M1UA 5JNLA 3STXA 1F2TB 4PXYA 4CN8A 3GARA 1QTQA 3IXQA 3WB2A 4Z7JA 5B7NA 2DETA 1JEDA 4TQUS 2HRCA 5GPBA 4A16A 3U9LA 1XQVA 2BJWA 2H5LA 3CGWA 2BDUA 3TLXA 3GL9A 2E4ZA 4IX1A 1XV5A 5EA2A 2FCAA 5A1JA 1JPUA 5KUTA 1FTSA 1IEQA 1KGSA 1E1NA 1LPSA 2FMIA 2GN6A 2IXDA 3H1PA 3C3XA 1F8YA 2VCYA 3ELYA 4QEDA 3ZE1B 4WBNB 4G4IA 4YV0A 2VYVA 3GLKA 1PNOA 1NGSA 1OHHA 2RHWA 4QECA 4RJJA 2PKXA 3ADPA 2YWEA 3SJUA 4IDPA 4Y1RB 3PIIA 1SCNE 3D8SA 2PEZA 4QWMA 4DKXA 3U31A 2VQSA 4BVLA 4K88A 4D98A 4NE7A 3JQAB 3H8WA 2ISCA 2PZFA 1XEWY 3PHIA 3UB3A 3WKCA 3S2SA 1Q0LA 4L6AA 4HDAA 1NQ5A 1QGDA 2JLRA 4KO2S 4BU0A 4PLWA 5LQUA 1MBZA 4HP8A 4TZKA 1E1QD 3IALA 1OFGA 3QVOA 4BFUA 2JZOA 5E6UB 3T1OA 4LCBA 5EJGA 3HV2A 4MVJG 4N54A 3RREA 2X4LA 4QSHA 4EGJA 3RUEA 3QVLA 2XLCA 1EWYA 3DVRX 3MB8A 3QXSA 4YMTA 1UZMA 4M0CA 2AG8A 1WUYA 2PLNA 4DNQA 1FCJA 3JD0A 1KAOA 4L9SA 1ZVJA 3OFND 2DPGA 5K01A 2IS4A 4HZUA 2ODNA 3RB8A 2P27A 5M7EA 2QQ0A 3DMRA 4L2IB 1C7RA 2QU8A 3FPSA 4D9BA 2OD9A 3CNOA 3JD2A 5ED0A 3ELWA 2JNWA 1PGJA 3E1SA 1UJ6A 3EOBI 2HF2A 3IOCA 4NZOA 2IV7A 3Q0EA 4OQZA 3E9DA 5J4KA 1ECGA 2ORWA 5LU9A 1O1YA 2I2CA 2BI7A 3EEBA 3NP9A 1BFKA 2ZKIA 3GH3A 1NQVA 1BE0A 1Z7EA 3PI6A 4V2IA 5E4FA 5A2QA 1N2XA 1KJIA 1C29B 4PLGA 3AVTA 1HYQA 1L4YA 4LK3A 1FTWA 4XQEA 1FFHA 1WOMA 4MUKA 2H4WA 4HNVA 1ZR4A 4B3GA 3NHFA 3CWCA 4EPRA 2GLTA 5DHUA 4BMSA 2JH9A 3HU5A 2PQ6A 1N2CA 4B46A 1BD3A 1QG2A 1Z33A 1HT3A 1GSAA 1ZUNB 3GFBA 5AUPB 1H2FA 2C97A 4DWOA 4K7JA 1MDBA 1XJCA 4CTJA 3FNRA 3VAZA 3ZJVA 2NNWB 4BTLA 4MGEA 3S55A 4EY5A 2AQHA 1MPTA 1P0IA 2ANCA 4RTJA 3GHHA 3LO8A 3OQHA 1E6EA 3DEHA 3QU7A 3I76A 4IQ0A 2BVNA 3HY4A 1PUJA 4TTPA 1F5NA 4XJTA 2DLCX 1Y81A 3TEJA 1RRVA 1T5DX 1HSZA 2GZMA 3A4MA 5FUYA 1M9NA 2AMFA 2F64A 2FUCA 4UBNA 4XIJA 5T57A 3RJ9A 4AKTA 4E2ZA 2CEAA 4MVJH 1IAVA 5EGNA 3MT7A 4DDKA 3O74A 4EA9A 2BT4A 1X7WB 3PLNA 3BS4A 4B44A 4XVHA 4YRJA 1H2XA 2PIDA 3SP1A 1KJ8A 5EWLB 2I54A 3ZQJA 3DZFA 4E2WA 4E7OA 3HTXA 5ALJA 1E7WA 4KFSA 1PR4A 4AS2A 4Y3UA 5H59A 2WJHA 3KEOA 3LX5A 1YQEA 4WK0B 3BDVA 3TDKA 5KNCH 1G8JA 1VXOA 2QUHA 5FOSA 2HRBA 5JMOA 3RAFC 3W4KA 4YWHA 1P9WA 2H85A 5KTTA 3DDSA 3SCZA 1LFAA 3OWXA 5ESWA 1VKHA 3IDFA 4N6OA 4YEDA 1AUQA 3BERA 1AXEA 3JYQA 4WECA 4ESOA 3RSSA 5A5VA 4M8LA 1I24A 4IGEA 2Q5IA 4BX9A 3W5SA 1RRMA 1MO2A 2PBFA 4ND4A 5CCXA 3OJXA 1XZAA 2V6IA 1SVLA 1U2GA 1M6WA 2VZEA 3B9RA 3COZA 3GVIA 3INGA 3JASB 4LC1A 5D7BA 3T5TA 3Q0IA 3LDUA 1QHFA 2ZIUB 3ROFA 4NFHA 4W82A 1QWSA 2CXSA 1IQUA 1OLSA 1Z2NX 4WIAA 3DMTA 4CU5A 2B2CA 3TZCA 5T6MA 5LQSA 4AJNA 4KBGA 1PD1A 2A88A 3MAJA 3RADC 1P17A 1Z68A 1GRQA 2UYOA 2Z4TA 3DUWA 1VRWA 2FQXA 4L76A 4Z8YA 2DTDA 3BT7A 2NZJA 4GL4A 3ROTA 4IQ8A 3MBIA 1FVHA 4R8KA 2ZZMA 1E9VA 1U5CA 1QHSA 2HC9A 3IQDB 4MJXA 2JJQA 4Q4AB 2J3MA 5HYVA 1F1JA 1ODLA 3D02A 1T5HX 2DR2A 1XWWA 2CLFB 5JCZA 3OQPA 4JUAA 3ONEA 5E9WA 5L53A 2V54A 4TUYB 5H8WA 4J0QA 1RMTA 1CUJA 1NW7A 1JB9A 1RM5A 1UM9B 2YXBA 2F6RA 3ASUA 3MIIA 4ZVRA 4FWTA 4CG3A 3U7IA 3M6WA 4K2HA 3LW8A 4DT1B 3HYNA 5I7UA 1KZ1A 1MR3F 1S2LA 2YZMA 3R3WA 5BSGA 1A3CA 1GQSA 1Z73A 3PPXA 3EIOA 2NU8A 1IUNA 1IG3A 1C0IA 2XQIA 1YCFA 2ZIVB 2XWQA 4GYWA 4II3A 4BFSA 5LQNA 1U8CB 1FDRA 1QGOA 2OSVA 4RFLA 4E1VA 3FBTA 4GYKA 4R4JA 4D02A 4XSHA 1PJ3A 1YKSA 2AKYA 3MQ4A 2AOXA 2F3QA 5HZGA 3ZH9B 3LHIA 1MCZA 2JAWA 2C92A 1XMQB 2J09A 2QNIA 3VVCA 1OI2A 3E3NA 3RTEA 5G53C 4BV9A 4TPKA 3RRYA 1N9KA 2DG2A 1U1IA 2CLIB 1T5IA 2IOQA 4RNCA 4IDBA 2GUGA 3PVSA 4F96A 3ZD7A 4DSNA 2BZ0A 3PUZA 1HI9A 4RF2A 4RTPA 2BMJA 3JQ6A 3NWJA 4BE9A 3AGPA 2VHCA 2ZUCA 1A9YA 3EA0A 1GDDA 3EY4A 1FYDA 2HXYA 2P9TA 5FRDA 2XITA 2BMAA 3N76A 4AXBA 2B82A 5HNKA 1F8FA 1XZQA 2R4QA 1FRNA 2WNIA 1Z6XA 4DEYA 1UOPA 2C8LA 2P5YA 4B3FX 1DKPA 4MV4A 4Q7LA 2G3YA 4NJEB 4FI3F 1VSBA 1NG1A 4NC9A 1JDPA 3NIDB 4U2KA 3T4EA 3DV2A 3SFZA 5ICGA 4HDQB 4BJ1A 3OAAA 4CZ2A 4D4KA 2PX0A 1CG6A 2GRAA 4OA5A 2IUSA 1CJCA 2A14A 3G02A 4LXGA 3VR3A 3RVBA 5JQWA 2I9KA 2QLLA 1LBIA 3DLPX 1VCMA 4X6UA 3CIOA 4B75A 2PGAA 1EUYA 2QRVB 3WL7A 1HGXA 3NBUA 4WQMA 4BFWA 4EB0A 1NVWQ 1NVBA 3BTSA 1DX4A 4GUDA 4RMGA 3I6QA 3MUOA 1U2GC 4DC9A 4X1IB 2XDQB 2QLBA 3K9BA 2OBYA 3C3EA 4JI1B 4ENSA 3GELA 4RPLA 4QYWA 1K89A 5DGIA 3JWGA 4ZO6A 4MS1A 2BGWA 4FOTA 1Y4AE 2GXAA 2JFWA 1I6LA 2WT4A 5CJPA 2CLOB 3IS3A 5GIPE 4C88A 3LFUA 2R6CA 4YI5A 3UUWA 5AKYA 4GRDA 5KYXB 1XCJA 5CYGA 4LJ7A 4L02A 2QG6A 4MPRA 4REQA 1YVUA 1TAGA 3IKLA 1Q1QA 1RT9A 4Z9FA 4RTRA 4CN9A 4D9GA 1NXTA 2FZGA 2EKZA 2YNMC 2ZI4A 3HCNA 1U65A 5KDDA 2GCNA 4JL8A 1X15A 2WHXA 2IPNA 1NF8A 1OKKA 2O6HA 2ZFUA 5F52A 1NY5A 2CVHA 4M83A 4MDFA 7REQA 4N65A 5HE9A 4IGAA 3OBBA 1TLLA 3I9V1 1EUCB 1BCSB 1GQYA 3GMIA 3AKDA 4HT3B 1XRMA 1E2GA 3MELA 2IJGX 2EX4A 2WTMA 2VQFB 1PBTA 3K92A 1M0TA 1A7AA 4NBLA 1L5ZA 4JASB 1N7GA 1VPTA 4M87A 4JOSA 2Z0MA 3FPFA 3KZOA 1ZRSA 2GPAA 3FTPA 4ZI7B 5BW4A 3M70A 1O96A 1Q0ZA 2RGWA 2O6LA 1YQQA 1YNOA 1NT4A 4L0DA 4UBLA 4ARCA 3G13A 4G8JA 5LQCA 2NO9A 4I14A 5JXHA 1SCJA 3QFCA 1I3OA 2EKBA 3RT1A 4L5AA 1J9ZA 3P20A 5IANA 4H7JA 3B5EA 2XTMA 3IOYA 4TV8B 3FMPB 1XD2B 3PFHA 1R4MA 5K3FB 3T7DA 5EE9A 5LZ2A 3U7QA 1NNSA 1N3YA 2JGJA 2XIJA 4HF7A 4NZNA 5KTPA 4DAEA 1W0JD 1KETA 1T43A 2P6PA 2C9OA 3WBKA 1F9AA 4IF6A 4KWCA 3W5DA 3OUUA 1GDHA 4YONB 1YBMA 2AA3A 4GFDA 1KI3A 2VHXA 5CU7A 3S6JA 3EF3A 1RYMA 3N2KB 1EWRA 5EJ2A 3TXAA 4YMGA 1KARA 2CV0A 5AKZA 2Q1YA 3KJEA 2BR4A 4HUQB 3V2UA 1OFHA 4ZAWA 3WRVA 2DXIA 4MS4B 3ORHA 1OA0A 4BVKA 4RIEA 3TQRA 2ZPTX 3HJTA 3DD1A 2WJAA 1NVEA 3SVTA 4CTOA 2HEIA 1SB9A 4KAXA 4C03A 1UXKA 1QMGA 4DSZA 3LA6A 2VNSA 1GHTA 1P7YA 1S1MA 2VUTA 3DLIA 2XUQA 1Q77A 2DUNA 5L7YA 3MQ2A 3CPJB 5MFZA 1G55A 4W7IA 4G0PA 4BKPA 4J4BA 4E0BA 3R9WA 2P4QA 8OHMA 1N2EA 4MWSA 1S0UA 4KPUB 1BTOA 1E6CA 5K7SA 3SZ3A 4CR6A 1SG0A 2CE2X 2ONJA 4RV5A 1FB5A 4BNLA 5DW3A 5JZSA 3R9XB 1SG9A 3PUHA 3SZGA 3AEUA 1PBNA 2WB4A 4RACA 4K87A 5B3JA 2DP4E 5C8VA 3IPAA 4IDOA 2V7UA 5BYKA 5EI5A 1KY3A 1N2BA 4WESB 1JR3D 3GO4A 2ZTSA 4XCVA 3A0RB 4IUYA 4WOKA 1H2HA 2IYZA 4ZVPA 2C2YA 4L3OA 1NYRA 4QLOA 4XXHA 3UK7A 1MB3A 3LQYA 4BX0A 3PKJA 3TOCA 1SKYB 3PHBE 4RHEA 3IAM6 3TRDA 1ID8A 2A9FA 3DWFA 5TPWA 3BQNB 1A88A 4RDCA 3BAFA 5E3IA 1V6CA 3H2YA 1C9YA 3T99A 5BRAA 5M34A 2BGUA 1RYBA 1GNSA 1SOVA 1XDUA 3DBIA 1K5HA 1CFZA 1C1DA 2PFSA 2DBVO 4YRSA 1FSGA 3DXYA 4GHWA 3ZVRA 3ZJ4A 8GPBA 2GTPA 2W22A 3LGSA 1Q16A 3MMPA 1ZMBA 4WERA 1KDTA 1OFUA 2DOKA 3SJCA 2CMKA 4PANA 4EG7A 4ZHQF 1XNRB 4JUIA 3AUKA 2PT9A 3HU1A 4D45A 4ZZIA 4JU9A 2VF7A 1OXBB 5JC8A 3WVNA 4JB8A 1V71A 4IHAA 4BFVA 4ZEXA 3JR3A 2WY2D 4YHBA 4XQCA 1W0KA 4YR9A 3SQXA 4D25A 1MVOA 4JVSB 2C5LA 2WICA 4EY6A 4ZMBA 4PLHA 5FTLA 4BIIA 4L6IA 4MR8B 2DT8A 1N5RA 2P2NA 4GPIB 1XNHA 4GOJA 1HTTA 1IHPA 2GO7A 3BMQB 2Z6UA 3EAGA 4Q82A 2YVQA 4DL9A 1HDYA 2IC5A 1EWTA 1SA0A 4XLTA 1DJNA 1AOXA 2IEDA 5DP1A 1GDTA 1KOFA 2YS7A 4HXGA 1EVYA 2Z2XA 3WNVA 3ZHZA 4ESVA 1YF3A 3IPXA 1FLNA 3R0JA 3RUPA 5J23A 5HM8A 2NZXA 3MJ4A 3LKDA 1E2UA 2ZCVA 1OWMA 3GGGA 3KFLA 4RVFA 2ENUA 2QBYB 1EZ1A 4LPKA 1DVRA 4MR7A 2MYPA 2VXOA 3NTRA 4CGZA 2AD5A 2WR8A 4E6EA 4YJ2B 3IKMB 2FX3A 2ZSIA 4C0QC 2POQX 3EQ9A 1R6VA 3II6X 1AS3A 2I3DA 3H84A 3WY9A 3GAAA 4AYTA 4FOSA 1GNQA 1MH9A 1CVIA 3UA3A 1NJ8A 4I8XA 3GEPA 5ENVA 3KETA 1RYZA 5C7LO 1G8YA 2GHTA 1NBWB 5EVJA 1V45E 2AFHA 2ZE7A 3NIBA 1JU4A 2NXNA 4JAVC 4O5OA 4EQZA 3KJHA 4DC1A 2SKCA 1H1LA 2I91A 4R2KA 1SUAA 4EO4A 4FIZA 2IHJA 1TX4B 3H5LA 4X3CA 3CR3C 5I5EA 4RC9A 3KQKA 2JLUA 3X1KA 4D9KA 2WTAA 5J2TF 2I6FA 4MULA 5JPIA 3UJCA 2R8BA 4G1MB 2ZYAA 3PXAA 2BFPA 2Z58A 3TSCA 5B3JC 1DCKA 2AV6A 3OE4A 5L95A 3VYRB 3LBIA 2QVBA 5BURA 2P2ZA 3N7TA 4I9UA 4X6YA 3HNPA 1XDDA 4Q05A 1CW2B 1LVHA 5CNKA 1OGJA 3EZFA 4JJGA 1KMHA 3MINA 4MV3A 4O3FA 3M5PA 4LYYA 4NYJQ 3HUTA 2HSDA 5ALVA 3Q7EA 2L0XA 3EMDA 4F5EA 1EFPA 3TL6A 1A2OA 1N3LA 3UG6A 1G8PA 4WXYB 4DZZA 1IZ0A 4WNYA 1U2QA 1VBFA 1UDCA 4GM4A 4NABA 2Y2VA 1KYXA 2DQYA 2AVNA 3K0HA 1K8QA 4R40A 2Y9MB 1IMJA 2VEDA 1EFRD 5JCJD 1JR2A 4QBTA 3EEQA 4MW2A 1QOQB 1RLMA 2ZUWA 1VG0B 4R1NA 4UBOA 1E2LA 1XHFA 3GNQA 3SHTA 4MMYB 5EC8A 3NXSA 2G72A 5KYUB 4ITRC 4KAFA 4UM9D 1M74A 5DNCA 5A71A 1QYIA 2X0IA 3CN7A 3KT6A 2JFPA 3OA0A 1HFEL 1K8XB 3GGJA 3H5RA 3HY3A 3KLMX 3NBXX 16PKA 4HN2A 3RIHA 3ZXXA 1M5RA 2VSXA 3HBMA 3Q41A 3WRXC 1S2OA 1Z3CA 3PCTA 3ANMA 3M2PA 5DIFA 3EVDA 4XLZA 3KTAA 2WI8A 1V3VA 3QA3E 3CBGA 4UTXA 4UVDA 2PXXA 1SPBS 1PJRA 4QQFA 5IASA 2FFBA 2ZI9A 4HQKA 3VDQA 5BN3B 2GPBA 1WW3A 1YZVA 3EISA 3GAZA 1X1RA 2NQTA 5A7HA 4DR3B 2Z09A 2A9PA 3LHKA 4LYAA 5JWHA 4DIOA 1DKNA 3MFYA 3LPNA 1OYYA 1HYGA 1HEIA 2FG6C 3F7TA 4I9NA 2ZWPA 3JQ8B 3VR2D 1DXHA 4E5YA 3HKEB 4LSZA 1O5OA 4BEVA 1GR1A 1SHZA 4EKIA 3SM9A 2PX4A 1OMOA 1RHJA 1PZGA 2XQKA 1C7QA 3ZNNA 4UPEA 1L9KA 1PGPA 3L6DA 4N5LA 4UBIA 3S8EA 2IZOA 4X85A 4MUXA 5B1HA 1JQEA 2YV5A 2VUSA 3H2JA 1XQ9A 4M3NA 2ZI6A 3IURA 2ZSKA 3MVEA 4WLVA 3ZR4B 4IVNA 1E1DA 3A1UA 4BO6A 1C7JA 2DFVA 4NYIQ 5DDIP 3DKVA 4TOIA 2E5FA 4BWYA 4X20A 2EFEB 3VAAA 4V0RA 4Z4HA 1QCZA 1KC1A 3KSUA 1N77A 3V9AA 3VH1A 1TA4A 1T6BY 3NKFA 3TJRA 3D2LA 1PGNA 2Q50A 2XZPA 4QPPA 3DV9A 2WWTA 4PV7A 1OWOA 4TLDA 5F1PA 3U4QA 2XT6A 4HAIA 4WNAB 2E49A 2GSDA 5F9HA 5AI4A 1TF5A 3KYDB 2WZQA 3AESA 2GJSA 3IOBA 1H8ED 3PUXA 3RFXA 4BMCA 1M34E 2W2LD 2WIKA 1ZRMA 4DQ0A 1TRKA 4OAQA 4YH1A 3EMKA 2O8DB 3H4VA 4YQYA 4PSCA 1FA9A 2AR7A 1I94B 2P9YA 3USES 1RWMA 4JKIA 5MGBA 3NNNA 2PKEA 4EF6A 4DB2A 1UPBA 2FSUA 2J3IA 5GY7A 2JCBA 4EP1A 1G20A 1RYYA 2BCJQ 2K7ZA 2FA9A 1VPEA 2ONCA 4QATA 5ANRB 2Y05A 4IJQA 5AWFC 3T3IA 1LSUA 1Y8RA 3QVKA 2ZRNA 4KR3A 1T2DA 5A3VA 4IMJB 3UFBA 4F91B 4Z4FA 1GL6A 5F1KA 1N5KA 4F45A 4K0KB 5E1BA 2AOTB 5FV7A 2PUDA 1CY4A 4UM5A 4KZKA 4OQEA 4NXNB 3ZW7A 5DLYA 1PR5A 4QT0A 2XGJA 1LPAB 1DQRA 4QZVA 3UWSA 5AVSA 5CB0A 4F11A 4YCAA 4YT2A 2OCKA 4ICIA 3IQGX 5AHXA 1JWLA 3LG2A 4ZO8A 2JB9A 2G4VA 1NSFA 4CUZA 1M1XB 1ZOPA 4AIRA 4N41A 2VYNA 3NVKI 3ES9A 4DB4A 1XMOB 2HF9A 1OZAA 1QH8A 4UULA 4PYJA 4TLLB 4QGGA 2Q1SA 4WY2A 1UC4B 2VWGA 3BCUA 3ZDBA 3FMVA 3STVA 4B74A 1Q3TA 2DPLA 1US8A 1FW6A 2QPTA 4M55A 2JFOA 2PVSA 3ER8A 2ZT8A 3D4PA 1YRYE 5B37A 4AZ3B 1AN0A 4TYPA 4E09A 1A2KC 4DCUA 1KR5A 3FTNA 1JJVA 5CYPA 5HW0A 4PZZA 4CJXA 2H63A 4WOPA 1H42A 5COBA 3MWFA 2QTBA 3KZ1E 2PBRA 3I5MA 1FS4A 1Z7GA 1JHOA 1V5IA 2EL9A 4L7VA 2QP4A 2R84A 4I3GA 3I3OA 3IVXA 4LZNA 3IO5A 1DFGA 4JDUA 4PYRA 4Y0VA 4AQDA 5E6RB 3NLLA 3Q3GE 3ZYZA 2KSQA 1MQSA 3LQ4A 2VJQA 4QRHA 5BWBA 4PAGA 3QY0A 1ECBA 1KL7A 4TTVA 3D9QX 2HCTA 2H1FA 2UYGA 2O8BA 2EWWA 3JQQA 3V8QA 1SZJG 1POXA 1NWCA 2HF7A 5FUBA 5L51A 1D3AA 3F5QA 2P7HA 1GGVA 3I8XA 4HHEA 2WJIA 3I9MA 3K8QA 4BFLA 3ZHBA 5MHTA 1NXOA 1L4KA 3I5UA 5ITSA 4IIXA 3DONA 1ZW6A 1GPMA 3MWGA 1ZYUA 4C30A 4HNGA 3BSSA 1KPGA 3FBWA 4P53A 1VI5A 1HTWA 3R7LA 1U0JA 1I7QB 3AETA 4BPBA 1VB3A 2ABWA 2N9UA 3JAKA 4O2LA 3PVZA 3MLAA 4FYKA 2H9IA 3WWDA 2VJYA 4F3RA 2GD6A 3BGOS 3DP9A 4GI5A 3CW2A 1XL0A 3FVQA 3OCCA 2R8OA 4IOLA 1E6WA 4OHXA 4EEZA 4CLOA 4A8TA 3L4EA 3KWLA 4WRRA 3H2GA 4AAYA 5KTKA 2IYNA 3NGMA 3EVBA 1ZINA 2OBXA 1ZUIA 2QZ4A 4CM6A 5KO2A 5JDCA 3KZCA 3QX9A 2BTOA 3DQZA 1BGVA 2VKQA 4IP0A 1C80A 4BVFA 1X80B 2OSBA 4H17A 4R68A 3V7WA 2FSGA 2HJWA 3VKVA 4BO0A 5ELXA 2ZW9A 4DJAA 1GCUA 1RYEA 1KSGA 3O92A 4OI2A 1CPYA 2RGXA 1N57A 1PT9A 2E48A 2YWJA 3WMFA 4IUCS 1H4VB 3O1HB 1CUDA 3MCZA 5AW9A 5EZYB 1VZ3A 9LDTA 1CQIB 1EP3B 2WG2A 2ZAOA 2QTMA 2J67A 2ZRBA 1I1QB 3CFYA 3M6VA 2Q27A 3QU4A 5B1YA 2WWHA 3NT5A 4P5PA 5HP4A 4C7VA 4WN9B 2DHQA 3BMNB 2FRDA 3H1TA 4YIHA 3LFHA 4BQIA 1QRSA 4LTMA 1J0CA 1Q17A 1JEOA 1OE0A 1R64A 2CFCA 4OLFA 1T34A 3DDWA 3BK2A 3W3ZB 2TYSB 2D5IA 4INPA 3LQFA 2A8YA 2IYVA 4H9GA 4JMPA 2P78A 4OPMA 5GAJA 3WK6A 5KYNA 1T1RA 1YB2A 3JQDA 1OTHA 5E7QA 2YIJA 3D31A 2X8WA 4CIYA 4TZTA 1G42A 5LA6F 4AM8A 3SKYA 1GTSA 3HN7A 2XUIA 3NDJA 3RVQA 2A67A 3DPSA 4GX0A 1PLLA 3K9FC 1CQPA 4W1QA 2PANA 3EWIA 2V59A 4YDHB 5DCUA 3ROXA 4FYIA 4UMFA 1I2CA 2YFYA 3KPWA 3SY8A 1XIVA 3C6YA 3EH1A 4CIWA 2I1QA 1E9DA 2CYCA 1YUBA 5CT8A 5FPPA 4KUGA 4V0MA 2UAGA 4C4RA 5SZIA 5EJ7A 3KQSA 1T0PA 4OGGA 3HVKA 4MVYA 5LBTA 4CEHB 1DT3A 2JGDB 2PMDA 3FVTA 1FJGB 1QFYA 4AYXA 2PTGA 1UDBA 3HB1A 4DMKA 3HJNA 4O8ZA 2C96A 3U1BA 5CFLA 4PO1A 5SZJA 3TB6A 1IRIA 2C7VA 3DFFA 2DR0A 3PYXA 5EYPA 1TF2A 1UDXA 3GEBA 3GUVA 1S8NA 3Q72A 4W1PA 5FD8A 2DFLA 4G2TA 1GJRA 2B7CA 1SAYA 4KQKA 4I5GA 4I6GA 4ZA2A 2VT7A 2HFJA 4YRBA 3G9TA 3K5HA 5K0LA 1TECE 1PNRA 3SHWA 1G7RA 2OTCA 4P80A 4WCFB 4A92A 3IELA 4DMUB 4FOLA 3EGXB 1KP3A 5CLJA 2VQEB 2G9QA 1YA4A 1PLKA 3BWBA 4FFMA 4YIKA 3N9IA 3TZLA 4ZEMA 1D4ZA 1N7JA 2WHRA 3IUEA 5FPHA 3I45A 1BXKA 1U80A 4L6CA 3SLGA 4EUSA 4IRXA 2BFCA 5BO5A 1Q0UA 1E3JA 1C9KA 1E3WB 3DBRB 3OFJA 4DXAA 1A7KA 2FRXA 1GAQA 4JBXA 4EYEA 1MVNA 2R1ZA 5C18A 4HDMA 2D0PB 1MHTA 4F04A 3FVWA 2C4KA 2I7XA 4MI9A 4NMLA 3FOCA 3AMVA 4M53A 1D6SA 1U2TA 1ZBQA 3NIFB 4KHZA 5D3KA 3SQOA 1II0A 4DMHA 4DRYA 1FYWA 3GLSA 2OUIA 2FFHA 4G1CA 2KHZA 2NTNA 2R60A 4DQUA 5CVTA 1XTVA 4R1MA 4JLNA 4QTUB 4YAJA 4Q9AA 3W2TA 4OAOA 3R20A 5C46F 2F4VB 2AKEA 5JSZA 3E3OA 4Y2YA 5F7ZA 4XM0A 4I3HA 3TO5A 4RTNA 2HZBA 1O6GA 3O8LA 3QOYA 4JEHA 1OWPA 5DLQC 3ETNA 3ON5A 4M1OA 2ZIXA 1U0EA 1KU6A 3IO3A 1QYCA 3F7MA 3GT7A 3CVUA 3I2JA 2FTKE 1CV2A 2ZZNA 2R1UA 4ZQIA 5LYJA 2VP4A 5AW2A 2WJ6A 1QPBA 2ECPA 1Z34A 4YRNA 2E7ZA 3D59A 4R7GA 1U6KA 3GOQA 3DYBA 1V37A 4EG8A 2OYRA 2GT1A 1X74A 4FBLA 3VR5H 3MOIA 1FXWA 2TRSB 2G40A 3ZK7A 3UAGA 3QFFA 4G9BA 3HEAA 4O2BF 2HKIA 3CT4A 2YKGA 3JQCA 1DLJA 1P8AA 5KSWB 4OXKA 1VKNA 5EG5A 1QDLB 1CZRA 3DAGA 3IRVA 3ONFA 4ZOAA 3K1JA 1L5NA 2RIRA 1V8BA 2IXFA 4KK4A 5JS8A 3BZWA 2IYWA 3CEAA 1KRHA 1AGPA 3CLSD 4L8VA 4LHVA 5F21A 2A7XA 3KJZA 4QAJA 3FLAA 1SXJD 1EM8A 1J25A 2WAOA 4QUKA 3K70D 1XVVA 5FO1A 2EGGA 3IRUA 1A8HA 2Y77A 4JJAA 4LGCA 5BSVA 1JJIA 1X9IA 5AVOA 1P9LA 4EUKA 3ZKWA 1CJTC 1NKTA 2R1VA 3F46A 1J4AA 3Q7TA 2EQBA 3HCDA 3K9CA 1KPHA 4B85A 2DF8A 1QV6A 3H9BA 2Q3LA 4QD3A 1ZA1A 3PXEA 3QMWA 4A15A 3V4FA 3EGDB 4ZZ0A 4GL2A 1J8VA 2LV8A 2Y1WA 5TQ2B 2VO1A 3AVUA 1BROA 4MJ7A 3U5TA 2ODQA 1L4NA 2OAGA 1RCFA 3COSA 2HUNA 4R1LA 1D0SA 1P33A 4NU8X 1EJ0A 2QRUA 2ZBDA 3QK7A 4J0FA 4KL8S 4PQRA 4PRYA 3DAHA 5HS6A 2CFIA 4PNZA 5H3LA 3V46A 1JDSA 3X43A 5LQDA 2JK1A 2JI9A 4BVEA 3FFXA 5LM3A 3DE5X 1DG9A 2R1TB 4KWIA 4RD6A 2A9KA 2WFAA 3M82A 5HCUA 5CDHA 2YZGA 3O03A 4F5DA 2ACWA 4RE6A 2WT9A 3ZWWA 3HDTA 1VM6A 1W88B 1DBQA 2JZNA 2W6IA 1U1FA 3A9UA 4N7RA 2CXTA 3KQMA 1ADYA 5BWNA 1PVOA 4DMMA 1BEEA 3SBDA 3ZWQA 2BKUA 3HBFA 4X92A 1U9CA 1N3IA 3RPEA 3N1UA 2C7RA 1ACLA 1OTYA 1ZNQO 3OLWA 1XZNA 2QL7A 4MVJM 4EENA 3VBCA 3KUXA 1NR1A 4XW2A 3JVIA 5AI8A 2YY6A 1RIFA 4TWZA 1BFUA 2V3VA 3DO5A 4URYR 1FX0B 4WSOA 3H4TA 1YBFA 3ZD8A 4PX3A 3BWDD 2Q28A 1NJ5A 2BUBA 4P5DA 3V48A 3GFOA 2D7DA 1PX2A 1Y3BE 4OB8A 4P8RA 4RUKA 4LV5B 1QC5A 2PD6A 4YRLA 1F4LA 4DUZB 3ZLJA 1R4NA 2ASVA 3OWHA 3D4OA 4HQFA 2XQJA 1KIFA 1U81A 1M7HA 1XMPA 2Q6OA 2QR2A 1GNPA 2CL7X 3GPBA 2PX5A 3KELA 2EP7A 1N5MA 4KB5A 3WGJA 4YCSA 3HKDB 1TTPB 1TUIA 2PSJA 1A95A 3EW7A 1ORDA 1G8KA 2A9QA 3R3XA 4G07A 5HGJA 3KZVA 3QQPA 2SCUA 1IIBA 3L0ZA 1A72A 4FILA 4IQGA 1M6YA 3UT5B 3WA7A 1GL7A 2WE7A 1GUAA 4RWZA 3TOXA 1JWBB 1VA4A 2OQVA 2G07A 4M1YA 3KUCA 4WZAE 2V5UA 4IUBS 4PYQA 4L16A 1R8JA 4H35A 4XGKA 3ZDYB 4DIEA 3Q8KA 1G2IA 1XA3A 4KQMA 4Q4CA 1YE5A 2RHRA 1LB1B 3R3JA 5I7EA 2ID7A 3OQ6A 2OHXA 3X1MA 2DTXA 2ORIA 1J56A 2X3FA 3PGLA 2OO5A 4PG5A 1O9BA 2I7VA 4FGWA 1J1IA 2OR3A 3EDYA 3U4IA 3Q3CA 3CSDA 1A1SA 4MEAA 3DR5A 3ZXIA 3WGZA 3R6LA 1DJOA 1ADBA 3BXOA 4YAGA 4BWFB 4OLAA 4PYNA 2GVDC 1X1BA 1HTBA 4IKOA 5ECWA 4II2A 3ZE7A 4FZ3A 4M7PA 4R2IA 3H9EO 4PGHA 1M8JA 3BREA 4A0GA 2AJDA 2BLLA 1JHYA 4HDKA 4H7HA 3AYXB 2DKOA 4DLSA 2ZU0C 7GPBA 3DVSX 4Y7CA 4F60A 1RLJA 3L04A 1II8A 3M33A 2E18A 3BICA 2QS9A 3JQ7B 1KSJA 1M73E 1VLQA 4O4JA 3PP8A 1JVNA 2A35A 1U0BB 3EPPA 4DCMA 2A59A 1EFKA 4LJ6A 4W5WA 5F1OA 1E2MA 1EEXB 5K0BA 3QF7A 4L0QA 1CZKA 3P9RA 1YVPA 3OQMA 3NU1A 5K3CA 1C4WA 2RDMA 4E4YA 3J81k 1E7MA 1I1OA 1PFYA 1MEEA 1YR7A 3D0RA 4L5IA 3KOWA 4K9DA 4E5SA 4DABA 5F12A 4I4TF 3MOSA 2XAAA 5LZ5A 4NMMA 2HTFA 3QVJA 2A5GA 4JJKA 4UCWA 5TS2A 2VYQA 3SFVA 3ST7A 1CIPA 2RAPA 1JPNA 4NPCA 3DE7X 4ENPA 4XWGA 1QBGA 1ZUHA 5K9ZA 2K7FA 1NIPA 2X7JA 3CR7A 2I2AA 3TW6A 2G8LA 4RX1A 3PI7A 4X45A 4FD2A 3VNUA 4D0NA 3A2KA 4M21A 4DLXA 4XEHA 4HNSA 4ZIRB 2OY0A 1VJTA 4DS3A 4PCVA 4A4DA 4C7JA 3S40A 3PNVA 5KQRA 1ONOA 3F6BX 4JVOA 4WNIA 3O84A 3ZCQA 2BMVA 3TGPA 1Z47A 3ETHA 2QDXA 2WWVD 3HO6A 1BZYA 1QHEA 4RTOA 1XD9A 3KOMA 4OLBA 2OEPA 4GSYA 5BNZA 1BQ4A 3CW9A 3GGSA 5EMHA 5KVCA 1U28C 1CS0B 4CR7A 4PU0A 1G18A 2ATCA 4Q9KA 4HDCA 1OZ0A 4OLHA 3PR3A 1ZJYA 4J7AA 5CLQA 1USWA 3G0OA 1HA3A 4UM9B 1KRWA 4X71A 3G8AA 1XCGB 4QHTA 5JADA 1BJKA 1JIUA 3LF1A 4AZ0B 1OW3B 1ISPA 4ZU3A 1I2MA 3EZ2A 2SECE 3AFIA 3L7IA 4M1SA 2HRZA 2I6QA 2XA9A 3ZIAA 4C0WA 4KXMA 4BATA 1SOUA 2O07A 3B1YA 4QU9A 2FEOA 3LPLA 4G5SA 1UQUA 3TQCA 1OFIA 5BN4A 5JCPA 4MQBA 2MHCA 3T7AA 4HEJA 1RJ9A 2OO5C 3NYQA 5BQ5A 3THOA 1DOZA 1EESA 3CWZA 1G2PA 3EC2A 5DTRA 4FYJA 5EQDA 5AVYA 4TROA 4QYSA 1FMCA 4QICA 4D57A 4GP9A 4FJ0A 4U7FA 2P1RA 1T4BA 4ATNA 4YMLA 3ORRA 2FJUA 1GNRA 1W47A 2IXTA 4N4AA 5HPYB 2XQVA 4R84A 3RQSA 3SD7A 1CZLA 1UJ4A 3VUFA 2PX2A 4INOA 2C5EA 4K6KA 2YHIB 3LOUA 2CVOA 1U7TA 4F6RB 5AW6A 4CMBA 1P9NA 1YU9A 4IIVA 3RS9A 4A8PA 1T8YA 1X1SA 4EAQA 1GAXA 4A73A 4IL5A 4JGGA 4ZOLF 3ROGA 1XJQA 3NEJA 4CTKA 4JH0A 1DAEA 3K72B 3HVRA 1CEEA 1JKIA 5DO9A 5BMOA 1ZL0A 4IWNA 5AJZA 4A2WA 5BMVF 4UUBA 2J3DA 4QQKA 1NVTA 2IGTA 521PA 4IOMA 1F0NA 1G8MA 5LDHA 3K5PA 3OTOB 4S12A 3G3EA 4QPDA 2R79A 4YDSA 3F4LA 3HO1A 2B4QA 3GDFA 1KYTA 4XIGS 1FP4B 3A1DA 4DIMA 3F3MA 1R3UA 2FW0A 4W6ZA 3QA9A 4Y0AA 1AO0A 1KA9H 2L42A 4HGZA 4EFDA 1ELOA 3QLUA 4CYMA 1NZJA 5KOJA 1IAQA 1UDWA 2QGZA 1W5TA 3VTKA 3EA4A 4L3VA 2C9MA 2GVNA 1KE1A 4GSKA 4V24A 1JDBC 1QZTA 2NT3A 3Q15C 1AF4A 4EPWA 4DCSA 2CDRA 4MW9A 1W1WA 4NZ9A 3LT1A 2NVOA 2Y0DA 2VJAA 4GMFA 2J5QA 1QLWA 5EE5B 3IJPA 4UDXX 1Q20A 2CGEA 3RYIA 4O1MA 4P4SB 2J9FA 2JLYA 4CEJB 4AKHA 4RD1A 4FFNA 5F7XA 2VWPA 5EIEA 2WF7A 4TQAA 4EGAA 1OI3A 1ZOOA 3MGGA 1FSFA 3BE5A 2AN5A 1F38A 3RUFA 3CZPA 1WG8A 1WP9A 2W8BA 3KYIB 3A36A 1FTYA 4G5GA 3X1WA 4G84A 2R0QC 2WSSD 4UHJA 3L49A 4XD7A 4XVUA 2KMLA 4HAOA 4OMCA 3A27A 2O5VA 1F7VA 1ZLXA 3OD5A 3AVOA 3WK8A 1LUAA 2R65A 4RIIA 3DDCA 3K9GA 3IR7A 3TXXA 4H1HA 3CSSA 5ALOA 2XNKA 2JZCA 1YJXA 3H8VA 3OZBA 3UFXA 2DPYA 4G97A 4PM4A 3GC6A 3R8CA 2V6GA 4GIBA 5IYZF 3BFKA 3RAEC 3WBBA 3TMYA 5BPFA 1VOTA 3M9LA 4Z9XA 4ZT5A 2AS0A 2IUUA 3ZW9A 2FPUA 4FMCF 4XASA 4H18A 1M76A 2HHJA 1J90A 1QYXA 2V1XA 3HC7A 3KPUA 3QX7A 1D03A 1FMLA 2ZQZA 4L08A 2QTTA 5K1ZA 2EFYA 2PMBA 3T15A 1G6HA 3NFYA 3ZDDA 5AXDA 4GMDA 1E8NA 3IP3A 4KMMA 4LBWA 1JXOA 2ZBRA 1D6MA 2CJWA 3E9ZA 4DNPA 3THYB 4IS3A 1CDOA 4RAOA 3G1UA 5ICMA 4K6MA 4Z2AA 1CRPA 4GR5A 2WP8J 3GFTA 4OEHA 3GUUA 1A8QA 1N9GA 3EXIB 4RPKA 2HWKA 4A9AA 1G66A 5CITA 3RJMA 4OIFA 4QJBA 2P5UA 2D2EA 5KVVA 2FKAA 1WR8A 1NW9B 4OF4A 3GCGA 2I33A 4KJXA 1LDMA 1NRJB 5AKHA 3RS0A 4BMXA 1ZFNA 4FFDA 5K5EA 1HE5A 1V26A 2BKVA 1AT1A 3A37A 3JZAA 3QBTA 3VC2A 4BC1A 5JZOA 4EJFA 1TL7C 4CLXA 3ICEA 3OPYB 1Z18A 2ZBQA 4DYDA 2OXFA 2PWYA 8ATCA 1K86A 1WZEA 2OMEA 5A62A 2D2FA 1F51E 3LP6A 3M8KA 4ZOEA 3GNLA 2UUOA 3MJVA 5E95A 4GO1A 4JVNA 1LWOA 1JKFA 3EEYA 1NUPA 1WVMA 3RIMA 3PHCA 2HWWA 5JOQA 1KO8A 3E22A 2JCGA 1U0HC 2HQSA 3DT6A 3P19A 3QLUC 4FM9A 2CT8A 1SZPA 3MZ0A 2JEYA 2D7JA 1P2VA 3NAZA 4G24A 1P91A 1T3GA 4KXLA 4Q3BA 4XGRA 4KR9A 2ZAMA 4JMLA 1IB0A 2EP8A 2A1TR 2RGUA 4UFNA 5T67A 1XXHB 1HR0B 2J0QA 3P7MA 1HFWA 1ZM3A 4WUTA 3SKVA 3OFSA 2EATA 1JMVA 4DHWA 3FN4A 3GA5A 3LA8A 3DQQA 2Q8PA 1T15A 4X1YB 1QYRA 3UJHA 1W2WB 2BEJA 2WF8A 4C89A 4EZBA 3T7SA 3F47A 3PHJA 1D5CA 2OESA 2Z1MA 1TW3A 4BQSA 3HBNA 2LCQA 1WULS 5AJUA 4CM3A 3NMUF 1HE2A 1KH3A 2Q2OA 3NC0C 1TUBA 2O2EA 2RONA 2GZAA 1MEJA 4R8MA 3U1TA 5FTNA 4QBGB 4EABA 2HU8A 3ZGYA 3UAYA 5CFNA 3ZDRA 3E53A 3UJPA 1G7SA 5DGDA 4AKSA 2KW5A 2GK6A 3A1SA 4FDAA 3G9UA 4YPOA 5KWSA 3GEEA 1YWGO 3EOAI 4R6XA 4UUNA 2OXCA 1PL8A 4YLEA 5A6SB 4ZGGA 4D3ZA 3WXBA 5IZCA 3BD8A 1GKKA 1CBUA 1V7PC 2IYLD 3I2IA 3ICVA 3T1VA 2VTBB 5BNFA 3IP7A 4J7CA 2LNDA 3OCWA 2ZM5A 4J91A 2RSLA 3W8FA 1XYVA 1IHYA 4WBNF 5IS2A 2OXIA 3V8RA 3NP7A 1Z25A 1PJ4A 5CJ2A 3SR4A 1FOEB 1T2FA 5C1IA 4BC0A 1CP2A 2YFHA 1ZIDA 3C5WP 2AX4A 3U60B 2KI5A 3PITA 1QC5B 4RTQA 1A4RA 5IUKC 1C2YA 3QUBA 4N5MA 5T5QA 1V7QA 3DDNA 4HJRA 5P8WA 3UXEA 4EUFA 2OYSA 4YAEA 2AC2A 2F1RA 3T7KA 2PKWA 4M9UA 5COAA 1QIHA 1VB5A 4OYRA 4R9SA 4GLOA 4M86A 3HZOA 3ZWYA 1G5TA 5JALA 1OAAA 4KE8A 2QXTA 1GCAA 4FKZA 1MHPA 2QMQA 3UO8B 1P73A 1JR6A 7ADHA 1IHXA 2OQRA 3BL8A 3NB0A 1DZ3A 1WMEA 3SJZA 1D2EA 2XCTB 2Q2VA 3E9RA 1U6JA 3CTMA 5DULA 3PGA1 4TXHA 5ALWA 4NZYA 4EW3A 3GLFE 1IEXA 3H42B 1YI8A 4LZZA 3FDXA 1IOVA 3Q7IA 3H2KA 1QX3A 5FQNA 4BO7A 2B21A 2PGLA 1Y6GA 3ER9A 4DSUA 4MQEA 5IKXA 4ISBA 3LBFA 3O6VA 3DTVD 2G1AA 4QQNA 1RQNA 3JYPA 4MKGA 5AVZA 1ISJA 3HSYA 2HSGA 1E1YA 3U7JA 3F9RA 2Z3WA 5FF9A 3TTWA 4MYUA 3SLRA 2ATVA 1WD5A 3SYRA 1YS2X 2IU6A 2J32A 3KSZO 1VE6A 1GKUB 3EC1A 3WI7A 1RXWA 1GQFA 1NR7A 3JXEA 2GJ9A 2QZJA 3NDRA 1B8PA 1VJ0A 1GTMA 4K26A 4QFDA 5LZ4A 2NXEA 3H87A 1JT2A 2RH9B 3L2OB 1EB9A 4QELA 4AG5A 3KP1A 4JLAA 3DCIA 4DA7A 4F2HA 2QMUA 3N58A 1O89A 4HDKB 2OC4A 1T1GA 1JSZA 2W71A 4G0OA 4RQUA 3IR6A 2VAPA 4PPGA 4EEKA 1XTUA 4JLMA 5CBPA 4CV3A 4N0DA 2XR1A 3DZDA 5IBQA 3YASA 3S5UA 4L1KA 2SBTA 1ZGBA 3RKUA 4BAZA 3IIJA 3R41A 5J63A 1P44A 4LFBB 3VR3D 1E96A 1QO0A 4WBXC 3WWOA 1S2NA 1A2QA 1GFZA 1WUHS 3WMRA 2GI4A 1HO3A 3ZCUA 2ZKLA 1UH5A 3B6ZA 3HA3A 1X3SA 1DUIA 2B6NA 1Z4NA 1Z6ZA 1DDOA 1OC4A 2P2CA 2RG1A 3D3WA 3OQJA 3NR2A 4M4SA 4GLBA 1WU8A 2ZVQX 4TSRA 4UEQA 3WBJA 4TXMA 1U3GA 1X9GA 2W5UA 1LPNA 1SO8A 1U7OA 1VJCA 2ZDHA 3PEUA 4J9UE 1LDGA 4KRYA 2BFMA 2H7XA 4WOJA 3RFCA 1P39A 2V7TA 3U3XA 1U8TA 3QJYA 3W34A 3SZRA 3IUNA 3N8DA 4JUCA 2VNHA 4MUGA 5DOVA 3N74A 3E05A 3Q11A 5JAQA 4CMKA 5ES4B 4QDXA 1Y3HA 4L4YA 5IZCC 5L3SB 2M1XA 1FLVA 3B5JA 421PA 3F4BA 2NNLD 4J94A 4TT3D 1V41E 4JLDA 5HF6A 3SDSA 1G7CA 1TRHA 3T6KA 4DLTA 5AW8A 2PZEA 1AY0A 4P0TA 4RH0A 1CWUA 4EFMA 3C6KA 3ADDA 2ZK7A 5HFJA 5CVCA 3FRHA 5ALLA 3RVKA 2O7NA 1OKKD 1L5MA 1OIWA 1BXGA 3M5CA 2FVYA 3EQ7A 3HEBA 2N0SA 4PF1A 4D8XA 1KFJB 2JA1A 4U2BA 5A7FA 1FP7A 3FOZA 3SNKA 4PG8A 3ZIDA 3ZZUA 2TECE 3GFVA 3R7DA 1L8LA 4R05A 4HNHA 5C8DA 4CCYA 5SZKB 5EMMA 5LLSA 4ZAZA 3AEKB 4R3UC 4GT1A 2ORVA 3A05A 2FZLA 3NTVA 1TD1A 1JDJA 2P77A 3JALB 4MIYA 5PGMA 3HDYA 3DFKA 4GSLA 4RD2A 2W48A 5B1SA 3JAWA 2XD9A 5KNDH 1ESMA 2HWUA 1JHAA 4QT4A 1ZIXA 4Z1OA 1IN7A 1UMKA 2O3RA 3CN9A 3G2NA 3U3MA 1M67A 4DEVA 3UENA 3G0HA 4QOHA 5AHWA 1YCHA 5SYNA 3HKCB 1BVYF 4N3AA 3TGWA 2JHPA 1I4OA 1QXSA 3OLYA 3IJ5A 4EA6A 1H3NA 2GK4A 5BR1A 5E7MA 4GGMX 4F9GA 3VU9A 1KQFA 1ORVA 5EIAA 3LSYA 4JEUA 2XE6A 4AIIA 4UARA 2GAOA 5IW8A 4CMIA 2QYSA 4QOJA 1GG2A 4ENVA 2E0IA 3ABSB 5B3AA 3FSGD 3BFPA 4MW4A 2QE7A 1BDBA 4TUYF 3B1ZA 4Y98A 3SGLA 1KK0A 1QO9A 1VMEA 1ZGAA 2P3QA 3DOCA 3EDMA 4B6EA 1Y3FE 5DE3A 1A9XA 3F1KA 1N1DA 2QRJA 2JGIA 2GNPA 3T34A 2KM1A 1VSUA 4M49A 3ET4A 1Q7BA 3GCXA 2R6FA 2BGKA 3LUCA 4UVHA 1SIBE 1Y4SA 4KVGA 4PZLA 4XE5A 1BFDA 3AFMA 2HDWA 4KH0A 3DVAB 3DHNA 4DSTA 3BG5A 3E15A 4P86A 3UY4A 4FNAA 1E3EA 2DUUA 1D1QA 1ILWA 4RSGA 5H81A 4QBKA 4CKBB 1IM8A 3VPSA 1GKIA 2IQ5A 2VOJA 3LQ2A 1BAPA 4FE4A 5JNUA 3AF2A 5H70A 2R86A 4MRRA 5DFAA 1F5SA 3VOTA 3VV3A 3AJAA 2CJPA 4S2EA 3SHFA 4A8JB 2NPIA 4F86A 3VH3A 3WQRA 4YT8A 2P30A 2P9JA 3IMFA 1KI7A 3QWAA 2W6QA 5L7WA 2WYUA 1IXKA 1T2CA 1AUOA 1G21B 4JDPA 2ZZKA 2IDKA 3I5XA 1MV5A 2OVBA 3K7EA 1ZN7A 2GF9A 2H3EA 5ELMA 2DWOA 3TQQA 1GEGA 3VR6A 3A4YA 1WIWA 2WNHA 3B53X 4K05A 3FH0A 2EJTA 4P92A 2IU0A 2JASA 4Y9DA 4TL6A 1WZCA 4WCDA 4U6SA 4YQZA 2HLHA 4ZK6A 1RTTA 2A5FA 1HNWB 1PJ2A 1QYDA 2Q6TA 5IXYA 2QSYA 5IM4F 2VQ6A 2D3TA 4INZA 4LX0A 4YRZA 3INYA 4B0PA 2PL3A 4JP1A 4MA4A 1CZHA 3T1QA 3DXZA 2R8RA 1LU9A 1G5IA 4KNWA 3OI7A 5EXDA 1CY8A 3FPEA 2C04A 2X4GA 2V6JA 4Z54A 3NGLA 2VVTA 3N59A 1MX3A 3TRHA 2PXCA 2CV2A 2HU7A 2M1ZA 4IJMA 4XPIA 1CB7A 3O75A 5J2UF 3OPNA 4YCCA 4EYSA 3ERCA 1V2GA 3GPDG 1YQTA 2ECKA 4O2AF 1A4IA 2XTJA 1NF3A 2PTHA 4DBLE 1RPZA 1EHCA 3ZKAA 5IXJA 4TRRA 5EZ5A 1FDUA 4C6SA 1X70A 2Q5FA 2C0PA 2G77B 4OXXA 3O4VA 4M7WA 3RVDA 1DL5A 4AICA 1LS6A 3PSHA 3GRYA 1MA0A 3OURA 2IEIA 3IP9A 5TPZA 3VNRA 1J23A 3QPBA 5DNEA 5C8YB 3C3CA 4XZ3A 1T4CA 3TW8B 4GM0A 1A97A 2XZLA 1U94A 1GAWA 1XNQB 1Z6YA 3O31A 3E3MA 3FRJA 2J4DA 1FU7A 5CLGA 4EJSA 5K0TA 3WL6A 1UBLS 3EYWA 1CUIA 1RQXA 4Z86A 5ITZA 2VP2A 3AHGA 1VMAA 1G0NA 1N6PA 1U99A 1Q92A 2B30A 3B12A 3CLUD 2O57A 2XUGA 3ZCTA 4LIPD 5FUXA 2D5LA 2VAXA 4LOIA 2MR5A 3VDMA 2ZVDA 4DLLA 3M9WA 1HY3A 1A76A 4HQ6A 4KC0A 4Q34A 3ZDAA 5DTQA 5F3WB 1HLDA 1SVIA 3PFWO 1KDZA 1YZLA 4XFDA 4ZC1A 4NONA 3TMKA 4E4RA 4N0QA 2XRZA 1HQKA 4XOIA 3DTNA 1MC8A 5HDBB 3BAZA 1AMOA 3OIFA 2IVZA 3QLJA 5JVDB 3UAXA 2X1MA 3A9TA 4OYLA 1D6JA 5IF9A 2Q6LA 2FG7C 4ZI7F 4PLYA 2AFRA 2VBIA 3C8DA 2PVPA 4RORA 5CAEB 3S8YA 4CEIB 2I4RA 1SQGA 1R0ZA 1VP9A 2WVAA 3ZTYA 2HT1A 1MW9X 2H16A 1VL2A 3LI2A 4PZCA 4S3MA 2R9VA 2X2FA 3UJ7A 1PHRA 5C9ZA 2H4JA 1IY2A 4MWOA 5G0TA 1GZHB 2JGMA 3BIWA 2WM2A 1EA7A 2CDBA 2NOAA 3CO5A 2QJTA 4L0CA 4ZI5A 3SIWA 3GEGA 1QX4A 3L8ZA 4Q37A 3T7EA 1VSQA 1ZNYA 4YRIA 5ADVA 4XM2A 3TG8A 4OFWA 4PHTA 1XZKA 4K6OA 2HMAA 3NFRA 2FJPA 4Q7MB 1ZEMA 2R3SA 4C2AA 2JF0A 4ES6A 2JRLA 5JAPA 3PUWA 2Z6VA 2GEVA 3GRRA 3ZCSA 3GLHE 4JCCA 4BCBA 5KVAA 4ZVKA 1CE8B 2DWQA 1T9CA 5JJLA 2ACVA 1SHUX 4IGFA 1CDEA 2IDJA 1FBTA 3MT8A 1E3QA 4GZ5A 1BGWA 5H4GA 3GW8A 1P0QA 3CE9A 4MO2A 1WB5A 1AXGA 4C7OA 3BK7A 4A23A 3QE9Y 5DHAA 5GJBA 4B34A 3L7NA 1OV4A 2OZLA 5JE8A 1U0RA 2X1HA 2BGJA 2OFPA 4N48A 2GJ4A 3VH4A 1MJGM 3TLMA 2BM1A 3KZKA 1NMYA 2MR6A 1P2BA 1N2JA 2V8OA 2BONA 2PH7A 4FEGA 4RY8A 5F7JA 5K3BA 1M2FA 4UD2A 5JFGA 1YI0A 3FZQA 1ZNWA 4DY6A 1K9VF 1KY4A 2FK8A 5DW0A 1QGED 1NR5A 1AV7A 1V25A 4Y2SA 2YJNA 1FUEA 1ZQ9A 3DD5A 4KQCA 4B45A 1XT6A 4GMHA 3ZHVA 3IPYA 3ZWMA 4CLRB 1LQTA 3L9WA 2OPHA 2EKLA 3E1KA 5KX5F 3WYFA 3OC0A 1TKBA 4AJOA 4MQ4A 5CGZA 1QM5A 1K6JA 1ULSA 2JJMA 1Q1BA 1OPRA 4I55A 4NX2A 1C3LA 4I1IA 4R9RA 1CJKC 4EJSC 4ZV4A 4PYLA 2FVXA 4O0MA 3ENKA 3IKTA 4C4ZA 2O2DA 1OILA 3COYA 1WY5A 3ED1A 4M46A 3QW2A 3QIVA 2HLDA 1N5DA 3QEBZ 1UBJS 2RIPA 2DPXA 4A0QA 2Z3ZA 4XWWA 2JLSA 3VKWA 1CQJA 4YMWA 1B8VA 3DDZX 3MJSA 2IZZA 2OZEA 2PYZA 4ABTA 4ZJYA 2VHVA 2JIBA 3ESYA 3IFSA 2HV8A 5FL7D 1M1YA 4JK3A 2E4WA 3BTUA 4OO3A 5JJBA 3COJA 2O8CB 2C82A 1DINA 5BXYA 2JEOA 3WMXA 2BUAA 4ARAA 4I4CA 1QYVA 4LX8A 4CMAA 4DLAA 2QRGA 1FVFA 3FGPA 5T6BA 5KJFA 4TV9A 2Q5EA 2A1TS 4QDTA 5G02A 2X8JA 1VHJA 3DTYA 1QHNA 2G5CA 1L1RA 1JFFB 2AZTA 4LV8B 2BZSA 5EE1A 5JG7A 1U7DA 1Z2DA 1NBHA 3F1LA 1XLWA 1EH5A 3N5CA 1BE6A 2PCJA 1BW9B 4FR0A 4MWTA 4PRZA 4MI6A 2HNBA 1PQYA 1TYEB 3DKKA 3KOOA 3RC1A 2PPLA 5DHSA 1DHRA 1OX6A 2Z9BA 1ENPA 2QUKA 4KN5A 5H3HA 3OZDA 2PWPA 3A4TA 3KKOA 5TJHA 3SHOA 2CKMA 3LCVB 4AWAA 3WLRA 5HWSA 1FNBA 5A06A 5LWQA 4EOGA 3TUZC 2WD9A 2AR0A 2ZSDA 5HFNA 4DLYA 1QANA 2WTNA 3OQBA 2AF4C 2GCPA 1Z17A 4MLPA 4Y2GA 4NBSA 2J31A 1OX4B 1XJWA 3Q5EA 5EIWA 5CIYA 3B78A 1P2SA 3FCSB 1GXSA 2J6BA 5SV2A 4Z49A 1YZGA 3T1NA 2C98A 5EIXA 3IAS1 1TM7E 1UBSB 2JEZA 2CC2A 2WHQA 3C39A 3L07A 3QKRA 4PICA 4QJ4A 4WNCA 4FHCA 5DM4A 1JBKA 1RSZA 2GK3A 3PQ7A 5JH7B 3ZIAD 5GJCA 1CS4C 5REQB 4TTSA 3D7MA 4WFKA 3ZVLA 3ZI0A 3PENA 2C59A 4FFPA 4TWIA 3CKMA 2BEWB 5DBGA 3AJ9A 3FD8A 4LBVA 4Q4JA 1KBQA 5JRZA 2UZ1A 3KXDA 2P5TB 1SUEA 2PU7A 4Z1MA 1VIMA 2DWUA 3AR8A 4EARA 4R7TA 4IUDS 5EWMB 2O9JA 1QPGA 1ONSA 1ZK2A 2B94A 1L0BA 3ELUA 5FWNA 1TE2A 1W48A 4KPGA 4YMUA 5FBZA 3MTQA 1A2BA 3I5YA 4XIIA 1PZHA 3DB2A 4ITUA 2JFYA 2ZT6A 4MKHA 2B4TO 3H3XA 1EB8A 3A6JA 1N5OX 3ODGA 3QX3A 3UHAA 1GARA 2C4MA 3B1JA 4NCIA 4OI4A 4AZTA 3NHYA 2V3CC 2QX4A 4YRAA 3K9QO 5CA0F 4HKTA 3O5AA 4ZCLA 3RG8A 4E88A 4RETA 3ZVNA 5C1OA 3V4RA 2GETA 3VNSA 2XVAA 3BSFA 3ELDA 4Y67A 4YUZA 1XC7A 2FY8A 2GHQA 5KKNB 3V9PA 2VWQA 3PC2A 4A10A 2VYND 5AJWA 3QI7A 1XZHA 4DA8A 4QTYA 1SXHA 1LC0A 2VXYA 1Z12A 3MHTA 1T0HB 4YHHB 1N0UA 1STOA 1WP4A 1XK7A 2JARA 1TO2E 2QLNA 1SQFA 1UMBB 5I3CA 4CI9A 5EE3A 3ZU2A 5AUQA 1C3VA 2P9EA 3L92A 4ND1A 2PQ0A 3KQTA 4R8RA 2HA0A 4GPZA 3A3NA 1K92A 3KEGA 4LFCB 1J0DA 4EEXA 2PMWB 5NULA 2AN4A 2FB9A 4EI8A 1U7HA 4HEA1 5JXJA 2FCRA 4U9IS 1CRLA 3OPYI 2RHBA 4G01B 5HFAA 1SJ9A 3ENVA 2BBTA 3EPRA 4D3YA 1A9ZA 1IUOA 2Q1XA 2H5EA 5ILQA 3R7SA 3G0BA 4MRMA 5DSZA 4YNBA 4EHFA 2HDNB 3NHRA 3IMCA 4Z8XA 3SAJA 2HLNA 1Y63A 3TK1A 2BBOA 2CCJA 3AXTA 3HWX1 4AS3A 2DERA 2GPWA 3W6NA 1F6DA 2ZRDA 2KLBA 3NRCA 3P2YA 4J2OA 4R2LA 5G0SA 4YREA 4H6XA 4Q3LA 2FMKA 1VHQA 3B1WA 4HDSA 5FBLB 3WWZA 3M89A 2FPSA 3L0CA 4XR4A 4AUEA 1EI9A 2NSHA 2VKTA 1TXGA 1O95A 3Q7PA 5CK5A 1LSSA 4B2YA 1YD7A 2FUKA 4Q02A 1EJ6A 1ZPDA 4AX8A 3OQOA 3C41J 1PRYA 2W93A 2FR1A 2ZULA 4RANA 3ZU5A 2A6PA 1MJNA 1XMSA 3N3BC 3BCHA 2V5VA 2IH5A 5I01A 3ZVMA 1BYIA 4ZTUB 5KQSA 1EQ2A 1JQLB 2CK3D 1HC7A 4U6QA 3C7KA 1UQRA 2V97A 3EG9B 2DMRA 3IA2A 3B82A 3PGVA 1N4DA 4HDNA 4MP6A 4B8ZA 4Q1DA 3GMTA 5LUBA 1NUSA 3OZWA 3WGGA 4D97A 5C3MA 3IBTA 4REMA 2NVUB 1HOXA 3OM1A 4BY9E 2XDYA 1UKVY 4GWKA 1BU8A 1OU0A 1F8GA 3C0KA 2BM0A 2AG5A 1FDVA 1ZD1A 1KI8A 5IC6A 4B3IA 1E32A 4LVOA 2VC2B 1V1RA 4M0PA 3UVEA 1J0AA 4MVJA 4C5AA 2XOKD 3E0QA 4KITB 2DKNA 3MGCA 3PBKA 2OPBA 4ZYZA 2AJBA 3ANYB 1TFRA 4FZRA 1IBSA 4ZCQA 1C9JA 1IZ9A 1MOQA 3C6XA 1NJ1A 2EZ9A 2J5BA 4MTCA 4V38A 5CG2A 5KQMA 5HRUA 3THXA 4Z4GA 1LRKA 1W5BA 3B6EA 3HB0A 3AY6A 3HKBA 4FDLA 5I7OA 3ABRB 3D81A 5BQXA 4XSGA 5KNCA 4RPHA 3GXBA 2ID4A 3OQ1A 1JEQB 4DJEC 2IYFA 1Z7BA 1RACA 3L1IA 3EODA 1E4EA 4FGUA 4W63A 4ZP1A 1VI2A 3HVIA 3DL0A 2WZBA 3DSRA 3QNUA 1DAKA 4UNPA 3WNCA 5ERGB 4TMKA 1LBQA