4ZVOB

Caspase-7 variant 4 (v4) with reprogrammed substrate specificity due to y230v/w232y/s234v/q276d substitutions bound to veid inhibitor.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
b'YKIPVEADFLFAYSTVPGYVSYRVPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESDSDDPHFHEKKQIPCVVSMLTKELYFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
total genus 16
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvoB00
4ZVOB 1RHJB 2CJYB 2CDRB 2XYPB 2QLBB 3KJNB 2CNNB 4ZVPB 1PYOB 2Y1LB 1QDUB 1RWMB 2HBRB 2XZTB 4JB8B 4ZVTB 3EDRB 3EDQB 2C2KB 4DCJB 2C2MB 2HBZB 3D6MB 3GJTB 2C2ZB 2CNLB 1SC3B 5IC4B 2H51B 1RE1B 1RWKB 2H4WB 3R6GB 4ZVQB 1GFWB 1RWXB 2H48B 3P4UB 1SC1B 2QL9B 1RHRB 3R6LB 1I51B 4ZVSB 2CJXB 2HBQB 3GJSB 2H5JB 2C2OB 2QL5B 1NMEB 1RWNB 2Y0BB 5IC6B 4ZVUB 1RHMB 1I3OB 3GJRB 1F9EB 1RWOB 2QL7B 2XYGB 3RJMB 3SIPB 4ZVRB 1SC4B 2CNOB 2QLFB 2XYHB 1RWWB 3P45B 2P2CB 1ICEB 1PAUB 2DKOB 1RHUB 2H5IB 3D6FB 2XZDB 3R5JB 1RHKB 2C1EB 3IBCB 4LSZB 1IBCB 3QNWB 2FQQB 4DCPB 2H65B 1RWPB 2CNKB 2HBYB 3NS7B 5K20B 1BMQB 3GJQB 1QTNB 4DCOB 2H54B 3D6HB 3R7BB 3R7SB 1RHQB 2H4YB 3R7NB 3KJFB 3IBFB 1RWVB 2QLJB 3KJQB
chains in the Genus database with same CATH superfamily
4RWXA 4I56A 1FFWB 2A6OA 4Q2MA 3I82A 3D67A 2QFIA 2X1AA 4JV2A 4RW8B 1G6BA 2DHAA 1CVJA 3IWXA 3M9OB 4DR5F 1WTFA 2M0GB 3V6JA 1RT5A 2KHDA 2OMLA 3M8PB 1K9MT 4KTQA 1Q5VA 3GIRA 2UZAA 3NAIA 2CG8A 4MK8A 1U1NA 5D4LA 1VIOA 2PSZA 3T5HA 4Z37A 5L9NA 1S4FA 4UQTA 4MKYA 4P75A 2HFZA 1R0CB 2HHWA 1FWPA 1S79A 2EKYA 3IA0A 1XMOF 2RDDA 1R27B 1YLXA 2J9DA 1GH8A 5EHHA 1Q8LA 2IIHA 3QWPA 2JNJA 4IKAA 4R5PA 4G3IA 2C2ZB 4LVNP 3RRHA 2R9LA 1YJ7A 1IR1A 1E6VB 2AHOB 2E1RA 4OYIA 3TUPA 2ZOFA 3UCUP 3M8WA 4OHWA 1ZOTA 2E7VA 3CCVS 1S99A 1U47A 3IRWP 4CRJA 1Q0NA 2PO4A 2E7WA 3SQGA 2VA3A 2F4FA 1S6PB 3CGIA 4HH1A 1LK7A 2KZZA 3J7YI 2F3JA 4M95A 2WOMA 1KQSR 4QOTA 1RWXB 4RZRA 3PYDA 3CJ4A 2MPUA 3M8SA 3J81j 2PI4A 3ZO7A 4YHHJ 2H9ZA 3K8WA 4HDGA 4PG8A 1FJEB 3DYAA 4YDDB 4B9TA 1RYRA 3ZZUA 1VJWA 5DO2A 1RT3B 4EZ6A 1NMEB 1IQZA 1F9HA 3MGJA 4KGMA 1WTBA 5KFOA 2LEBA 3PIPQ 3VVTA 2CZVC 4X64F 3EZ5A 3D1OA 4FPIA 2V2QA 3CCZA 3FMWA 3Q8VA 2IVFB 1SKWA 1B7YB 2AZ1A 2CQ3A 1T03A 1ZM2A 1F9EB 3DDNA 3ZZTA 4RWWA 4F4WA 3I32A 1RTIB 5ETLA 2VQEJ 2XO6A 1WUUA 2RF2A 3POTB 4LF2A 3ZTQA 3PRBA 3UFCX 3KLFB 1RU2A 5LSLA 4X65J 2B9YA 1S9FA 1MU2A 1SPBP 4ETXA 4M5DB 4NXMJ 1H7XA 1FX2A 2M4MA 4CLLA 3BZQA 3I96A 4DPWA 2VFTA 2IFXA 3ENVA 3GSIA 1ZPWX 2UUAF 4MFBB 1SV5A 1FNOA 5HROB 3OLBA 1NM2A 4N8NA 3R5GA 2FDNA 4LT6A 2QO3A 2VOOA 4QWDA 4A8OA 2VODA 1QY7A 2R8IA 4CLFA 1TK5A 3PW7A 2V69A 1HR0F 4F0KA 1FDDA 5THWA 3WIVA 1DHMA 3NNHA 1A7GE 2HIYA 2OUGA 5KG1A 2D3OR 1RJJA 1YG0A 3I9ZA 4KFBB 3JYTA 4WE1A 3G8TA 4B9SA 2IA0A 2Q43A 1R8HA 5KOXA 2BE7D 2KM8B 2B4UA 3GYGA 1TKTB 2MDAA 1DARA 4DLEA 3NWGA 3KXDA 4J90A 4PUOA 2QMWA 1LW0A 1KVIA 3J7A1 3O6QA 3CIMA 5HVFA 1CPZA 4NASA 2M8DB 2C3PA 2NYIA 2QN6B 1LWEA 3I4HX 4DPYA 1J2VA 1T7PA 5GAHU 3MFIA 1QUVA 1DURA 2ABYA 3CB4A 4YHHF 3EYZA 3KOAA 1N34J 4P74A 4OFZA 2PGCA 4H4OA 3CTRA 3A12A 2MZ1A 2OPSA 2R8HA 3IAS9 1WHYA 3V5RA 4DBQA 3OVBA 5KFKA 4DR5J 3IR7B 2WAQD 1L3VA 3HJFA 1RAGB 3H5UA 4LIWA 1SH2A 4GVBA 5J1EB 2BRKA 3OR2A 2ZH3A 4CO4A 1TL7B 4HEA9 3NNAA 2CDRB 2EXUA 2HZCA 2OPQB 3C16A 3JS9A 4HHUA 3QZ7A 2IBKA 1MWYA 3DI6B 4KRWA 4LSLA 4NCGB 5ETVA 4A8YA 3Q2TC 1RT6A 2IYGA 2YNFA 2VL1A 5DG7A 3LP1B 3M30B 5B0BA 4F3OA 3P8BB 4PUOB 2AJ2A 3B6BA 4R8UB 4EU0A 4Y3CA 3T19A 4X62F 3MFHA 3CWJA 3D3BJ 4JB8B 1SJFA 2BJ8A 4Y34A 1B4SA 4FYDA 3PHEA 2HBZB 2CVIA 3PRVA 3Q2SC 3QT7A 1BQNA 5HVHA 2E66A 2HNYB 4YEAA 3KLFA 3K5PA 3I0RA 4NOHA 4AL6A 3IP0A 3NRBA 4NYOA 4TU7A 2J9EA 4DV6J 3ZFVA 3GYXB 5IT0A 2ZH4A 1YI2S 1JLCA 1D9DA 4QWAA 7AT1B 2MZRA 2OPSB 4XK8C 3WBZA 2G0IA 4EBEA 1R8PA 4B3MF 4LQ9A 3W2WA 4BBYA 5F9NA 4I68A 3L9ZA 4RW4A 5AXLA 4IH6A 2CXEA 3BN4A 1FXRA 3CJ5A 2DY9A 2AV5A 5DG8A 3H2LA 3MPYA 5HK4A 3PYEA 1S6QB 3TX0A 4ZN1A 2UU9F 5A8KB 3BDPA 5M2PA 2OFHX 3CMQA 5KFIA 2FIUA 2J8AA 2IM2A 4M5LA 5GADU 2WSFC 4ATNA 2V4QA 1S1XA 1SBRA 2RUGA 2YX1A 4MJKA 4FF3A 1Y10A 2BABA 3KLHB 3FSIA 3KJQB 4U96A 4DL7A 4X65F 3CE8A 4ZCIA 2CPJA 2VC0A 2VG7B 4WFXA 3UNGC 4URGA 2MZSA 4DQPA 2HFUA 3KMQA 1CULA 1TVRA 4CH7A 4OJ3A 1CEZA 3G6YA 1BLUA 2FUG9 4XTTA 4C3KA 3KK1B 3CCMS 2UUAJ 1UZHA 4FPRA 4OHZA 4DQRA 3MMBB 1RKJA 5HBMA 1SC4B 2IA6A 4IOAQ 1VQSA 4O44B 3SSQA 2LECA 2J7KA 3JSMA 3G6ES 2XYHB 1WSRA 3P6YC 2G4BA 1YVFA 2EEYA 3IBWA 2FZCB 2DD8S 3EGNA 3MM6A 1XK8A 4R5PB 1NH7A 1UW9A 4ZCMA 5HP1A 3JTOA 4LVOP 4QQBA 2FLLA 5BXIA 1E6VA 1Q95G 1RKIA 4O0NA 3RBXA 1UVJA 1CS4B 1NKEA 5EN1A 3JXOA 4WYWA 3AD8C 2G2ZA 2V34A 2LEPA 4PG7A 3DOKA 4PXCA 4NLUA 2E5LF 1S76D 3PKYA 2CJQA 3LP2A 3BKTA 2DHHA 2FD2A 2GO9A 3D7SB 3OHAA 1Z2LA 4FYVB 4OV1A 4GC6A 1NDPA 2CQ1A 3RB6A 2I1RA 2V2ZA 1NSKL 4DCPB 3DLKA 1OQ3A 2PE8A 4ZIVA 4EWTA 4F0HA 1DLOB 3KHHA 1WI8A 5H1SV 3H4DA 1VYAA 2HW3A 2AYMA 1AFIA 3CCTA 1ZTTA 3RYLA 4ECVA 3RB4A 3TUZC 4R25A 2C22A 4L3KA 3RW6A 2AX1A 4TXSA 2DBBA 4G1IA 1ZTWA 1M0SA 3FSYA 2HG4A 3BS9A 3R7BB 5K8MA 4A4JA 3BBFA 1RGVA 2JLGA 1REVA 4HT5A 2AYBA 4KH0B 1EB0A 4X4QA 2OD4A 3MWBA 1QVFR 4FYWB 1NB7A 1FK9B 3ZNUA 2VPXB 3LA0A 5J2QB 6AT1B 1S1TA 2XCPA 3EWGA 1KWMA 4UW2A 4DQQA 3MCMA 1IWAA 4WPAA 3QZ8A 2ROPA 1FVQA 4ZLLA 2HQIA 1CJVA 3SCJE 2WB4A 2ZH9A 1HMVB 2L48A 2HHUA 3C15A 2QC3A 1UWAA 1U0HA 2QLXA 4YP3A 3LPEA 5CZXA 3JAMU 1JXVA 4P73A 4YDXA 1NPPA 1O5JA 2ALYB 3GCXP 3F0NA 4ZVTB 5C2CA 3VAMA 1IKVA 1N48A 4C8LA 3FEYB 4DCJB 2HWIA 2DR8A 2F9JA 3NS6A 5EX3A 1VFJA 5KG6A 1UVIA 2JVOA 1RT3A 2P8IA 3FBEA 4OI3A 3ZTSA 1S77D 4B3MJ 5MAOA 2AYGA 4UQGA 1NJXA 3OVSA 2IDLA 2XMJA 1X60A 4B08A 3HHLA 2DXDA 4FYYB 2W01A 2E9TA 1U45A 3BBCA 3KJVA 1Y11A 4M5KA 1FRLA 1MROB 5E41A 3KK2A 2FJBB 3M2VA 1URNA 2DT9A 2QYCA 2G9OA 3KNGA 4WFYA 5AXMA 3SYZA 3KLEA 1GFWB 1Q1KA 1VQ6S 2MEWA 2B5JA 1TK0A 2GIRA 3CC4S 1Y0HA 5FD1A 3PX4A 2IY5B 3GTYX 2BJDA 1HNZF 1WOOA 3NOGA 1VMBA 4CT9A 4DR6J 2BW2A 4MFBA 2YKMB 5B0GA 3X3UA 4CLTA 4ETZA 3CXCR 1U48A 1N6QB 1M1KT 2ZE2A 2XHCA 4Y2AA 1XNQJ 3FFIB 1AZSA 2UUCJ 1H74A 5ETMA 1S5ZA 5E0OA 4A8WA 4RUBA 5KFSA 2L3MA 2BBEA 1TL7A 2ZH1A 2E9RX 1BWEA 1MMLA 2VKRA 1T0TV 3AFGA 1YRTA 1J5OB 3RAXA 2HNDB 8AT1B 4I6YA 2FY8A 5KG7A 5JMNA 1TV6A 4WZMA 2W2PP 4RNMA 3DHWC 3HD1A 3KNAA 2AMCB 2CQCA 2U2FA 3V81A 3S6EA 1HNXF 3B4MA 1TKTA 3TANA 1C0TA 1LW0B 3T6BA 3CC2S 2ZKTA 3OR1B 4NI2A 2B8QA 1D0EA 5L1IA 4IRDA 5BYSA 2E9ZA 3GCWP 5F8HA 2IVMA 4JI1J 1FCAA 3AOCA 1K73T 2MSSA 2IPOB 2E5LJ 4LF4J 3OFGA 1RT4A 2RAQA 3TR5A 3UW1A 3W61A 3BB5A 3MUVP 2XULA 3VF0B 3HM9A 4C2MA 1SKSA 1N6QA 4DSFA 2XZDB 2RQKA 5A8WA 4Y2IA 1LWEB 2N3OA 5D6GA 3V6KA 2J0SD 1RHKB 2BJEA 3MAAB 3PO4A 2VB6A 3TEHB 2BJ3A 2V8VA 4TKTA 1QE1A 4J9NA 4JV1A 3PX6A 5DQHA 3I56S 1B7FA 3AOBA 3HKWA 1WOSA 5J1EA 4NA3A 2CQIA 1LXJA 3PFEA 2O3DA 4KH1B 3B8HA 2DXEA 4DV7F 4HHJA 1YJWS 4X66F 2A0FB 4NZ7A 4WK1A 2W7PA 3KDOA 2CNKB 1GMVA 3BBBA 1VHIA 4QIGA 3W8GA 5IS2A 3K57A 3JB9k 4OZNA 3O8WA 1Q4RA 2IM1A 4IOBA 2W9BA 4E0DA 5ETRA 5GMDA 2RRNA 1S9EB 1HBNB 2LVWA 3A8IA 3ILJA 3R97A 4DHVA 4DJBA 1WSVA 2XWXA 1S57A 2CQ4A 5C24A 3TJ8A 3W2VA 5JVGQ 5KFHA 3DXBA 4HTJA 1X5PA 4B3RJ 3CCSS 2O67A 2R8GA 1FRMA 2ZH8A 2YWFA 4ZP9A 4K4UA 3P5TL 3VAIA 5CYJA 3C14A 1J5EF 3QO9A 1KDNA 2KL8A 2VIHA 3OL7A 2EFVA 4ZVOB 1BY9A 2KT5A 1RHJB 2KKHA 2OH2A 2UUCF 3L4BC 4EBDA 2IM3A 4V19X 1D09B 4YQWA 3HSZA 2RQCA 1FJGF 1FD2A 2BE2B 1Y3JA 2DR6A 4JI3J 2ZH6A 1PGZA 3DMJB 1FRHA 1YWXA 3H90A 3MR2A 1PO6A 3IRXA 1B0TA 4I2PB 2HEKA 5HN0A 1N56A 5I3QA 2HGLA 4OX8A 4RU9A 3DOLA 4DV4J 1CS4A 2EC2A 4OYAA 5HJXA 3FK4A 4DV0F 1ZH5A 1CJTA 1ZM9A 3VQTA 3TA1A 3LANA 5EGYA 2QEXS 1VQNS 1VQ4S 4IH7A 3DU6A 4CLPA 1FWLA 1MMNA 1T9XA 5KG2A 1XMOJ 1IVZA 2ACMA 1FFSB 4NLQA 4PYDA 3VCDA 5I3UA 1S0MA 1SJ4P 4ANEA 4ANCA 5DQGA 3FEZA 3Q8RB 2HSEB 2GS8A 2XO7A 2HMIB 3QAUA 5D0GA 3JAMY 2HAFA 4PQAA 1VK8A 1NB2A 2EWHA 4Q43A 4ECTA 1UVLA 3A1YG 4E8UA 1YKWA 2K8GA 3PO5A 1HYSB 2E1PA 2QX0A 4HACB 1TVRB 2YQ3A 1IBKF 3CW2C 4RW8A 2MKKA 3DLHA 2FYXA 4K4VA 5KFBA 5L39A 2C3OA 3KK1A 2NS1B 3R5BA 1MN7A 2MY7A 2XBPA 3OJSA 3UCZP 3MM7B 1N36F 1NLKL 1NPKA 2NPIA 2X51A 1O8BA 4RW9A 4WP3A 1VGYA 2YWHA 4O44A 1QAXA 3HVAA 4UF4A 3RG6A 4EK2A 2WBMA 2VBWA 2HHXA 1AFJA 4TYBA 4J5OA 1A0OB 2JRSA 2Z2YB 1HLWA 3GJRB 2ZITA 4DX6A 5G0RB 3SBMA 1N88A 2OSRA 4JYAJ 5IT9U 1RABB 1KHWA 2B4OA 2QYGA 5DDQC 1NK9A 2GAGC 1KVKA 2D1CA 3GFXA 3JTNA 3LP2B 1CQMA 3CD5A 1FDAA 4J9MA 2VQEF 1H6KX 2AD9A 1O51A 4PXEA 3CCLS 2N3LA 3DDKA 3FZBA 2DB1A 3H2VE 4CLYA 4XPCA 4LF4F 3D0HE 3KMSA 3J7Z5 4ED0A 3EPIA 4QR2A 2FJXA 4KKOB 4NCAA 4MIWA 4B3OA 2HWTA 3QAEA 5DLGA 2Z2MA 4AT1B 2KI2A 2MHNA 4DUYJ 4A8KA 2DGWA 3CCWA 2RKIA 3EGVA 1VHFA 2DK2A 2K3IA 3G96A 2G0JA 2CA9A 3ZTPA 1CJKA 2LXUA 2WW4A 3G8SA 4DV0J 2YKOA 4I2QB 2HQ3A 1LWCA 1Q78A 2LKZA 5HATA 1IR2A 4CDIA 2C2EA 3WC2A 4YOEA 2X7IA 5I4MA 1Q86T 2B43A 3GR0A 3M8ZA 2LQ9A 1Y9OA 3OTDA 3AY0A 1HR0J 2IVYA 4F2SA 4JI6J 1X8DA 1DTTA 1HBMB 5D77A 1F5CA 5FJ4A 2V6AA 1NNDA 5F3TA 4EUVA 5GAGI 1VQLS 2HBYB 4DG1B 4N8OA 4A8SA 3VTIA 2YNHA 4ZVGA 3I55S 3GILA 2MZJA 2VG5B 3H59A 3LP0A 4DI6A 4A8MP 3PHTA 4MIAA 4USTA 1RT2A 2P5VA 5D4OA 4RJVA 3VAJA 1KFSA 1QUPA 1FKPB 2C2RA 1U6BA 5F8NA 1KTQA 4DZ6A 1HL6A 3BR8A 3KJFB 5EWGA 2XS5A 3W3SA 3CNQP 3SEOA 3ZTOA 3DLBA 3DLGB 3AT1B 4LSNA 2IDEA 4ZPAA 4A8XA 1R7IA 1WHWA 3PR4A 5AE3A 1HPZB 4JI3F 1C0UB 2ZD1B 1N34F 3EZUA 4P6QA 4ZK7M 5T7LB 3PM9A 1H0HB 3OTCA 5F41A 4QJVA 3NCRA 2CNNB 3KG0A 4YB1P 4QWEA 2RIJA 1UFWA 5IT4A 2CWXA 2FVSA 1FESA 1N54B 5K8OA 1HBMA 5KFPA 3MM5A 1KHVA 2O66A 3SDEA 3KK2B 2MKHA 2YNHB 3KTQA 1TMMA 3UWTA 4KT0C 5A8WB 2B9XA 3OL6A 3N5FA 3GIJA 4NLXA 4BDPA 2R7WA 1VR6A 4X4UA 3BEGB 2DITA 1WJ9A 1SUQA 3CCJS 1IJFB 1OWXA 3GFZA 3MDFA 4KHRA 3LGMA 1WELA 4ZHRA 3MR3A 4OJGA 1HBUA 3LF0A 4MK9A 3VR1A 4J9PA 1RSCA 2D9OA 1R3NA 3ZNJ1 3SI8A 3GP9A 1JNZB 4ZVEA 3BYRA 4U8VA 5L1LA 1PKUA 2IMOA 1CC7A 3RW7A 4DV6F 5CHCB 3D3CJ 2Q66A 3J81U 1WC6A 2HNDA 2YNGA 1S7HA 3R6GB 5EWEA 2KFNA 1NDKA 1S6QA 2VDIA 3G4SS 1IUJA 1ZAXA 2RKIB 3IAM9 2H48B 5EDWA 4RUAA 5LSOA 2JX2A 2H1YA 3NP5A 3J7ZT 1UA0A 1VRUB 2JEIA 1I51B 2N4CA 2KZMA 5A6PA 4WTYA 1RWNB 2HFOA 2ZC3A 1N5YA 5L1KA 3D0GE 2YX7A 4X4NA 2DR9A 3PYGA 2AJ0A 3Q8UA 9RUBA 3KDNA 4DPXA 4HHHA 4N41A 2ZHBA 1L5UA 3TA0A 4QWBA 3I5AA 2HHSA 2KDOA 4OMFG 4F26A 4ZLPA 1T05B 3OTOJ 3RBEA 2KTQA 5HLFB 4LF1A 1MWQA 2W2QP 2NZCA 1G4CA 2WCXA 3PW2A 5HBMB 5LOQA 2UXDJ 1IN0A 1NXIA 2XYGB 2WRMA 4PPZA 1RA6A 4EEYA 2PFFB 1G7CB 3M2RA 1H3DA 1QAYA 1FTCA 1ZM4A 2IRXA 4EO6A 2QA4S 2RHSB 1JLGA 4DUYF 3RRGA 1VBYA 1Z1ZA 1VQ8S 2HZVA 3LQVA 1JX4A 4TU9A 1O0PA 2VF3A 5H9FJ 1M1GA 4ECQA 1ZAWA 1OSDA 1F2HA 4OZ2A 5B0EA 1WNEA 1HI0P 2VONA 2MQMA 3DOKB 1U1OA 3UR0A 4ZPWR 3W2VB 5C24B 2ACYA 5HMXA 3TZZA 4DQSA 2V9KA 4ED2A 4OYWA 1Y5LB 2EPIA 4WBFA 3HXMA 2V8PA 1YDLA 2JL9A 3OSPA 1VRTA 2OFGX 4IG3A 2XCAA 1R6YA 3RUBL 2EFPA 4RL1A 2N82B 5B09A 3RZAA 2C3YA 4CYUA 3EMTA 4ES3A 1KS2A 2Z57B 4H54A 4IFYB 2HLUA 2RUSA 3MM8B 2XC9A 1BMQB 3AD7C 3ENQA 1DQ8A 3HFKA 3DXSX 5E3CA 3OSNA 2R7TA 1V3SA 4KV8B 1GMWA 4I2PA 1XIQA 2DGTA 4ZLJA 2R2RA 2ASDA 1U8SA 3C8YA 1DQAA 2V67A 1XEZA 2BM1A 5BYRA 2DIUA 5U47A 3MPVA 2P9CA 3P3DA 2XMUA 3TOQA 3KG1A 4E98A 2J6SA 3IN5A 2VICA 2BM0A 1F5BA 1GAOA 1WC0A 4X2BA 2EFQA 4O4GB 2LQ8A 3LPYA 4PYAA 2RT3A 5IOLA 2QSFA 2W9BB 1IKWA 4FP9A 1GTHA 1NHVA 2FHJA 4W4MA 4MIBA 5HVGA 4U7CA 1N5YB 4OZ0A 3NBPB 3L95X 3I6PA 1XN9A 2VC1A 4DSKA 3CULA 5DJBA 2O1PA 2OPRA 2JEJA 1H2TZ 3HZEA 4NLVA 1M5VC 2B9EA 3W65A 5IM0B 3QO9B 2ASYA 4TQRA 4HACA 2UUBF 4DWIA 4H4MA 2HQDA 1APSA 2P6SA 2FJDB 1NDCA 3GV5B 1K0VA 3Q24A 3IWLA 3QGPA 1NRKA 2WONB 1TL5A 2R8JA 5GMEA 5LT5A 4LR8A 2AEMA 2LU2A 5LMUJ 2I5JA 3EPGA 1SJQA 2WW8A 4IDKA 1EQMA 3MHYA 1P1LA 3VQSA 1NK7A 1REVB 5C42A 1B99A 1AB8A 2P9EA 3KLEB 3DLLQ 3AXMA 3C66A 3DOLB 3UDLA 4CO2A 1HQUA 3M8QB 5JVHQ 4ZVQB 1RTDA 3GYNA 2F8EX 3DM2B 1V9OA 4DN9A 3AODA 2HK2A 1XBWA 3EM1A 4DMZA 4OZ3A 2OTJS 1U2CA 4ZVSB 4U9RA 3SV4A 2OEKA 1WC5A 2Y0BB 3SSSA 4KHPJ 5KG4A 2KG0A 4LMZA 4M5HA 3PZPA 2QMXA 2ZBPA 3G9CA 2MHEA 2BKOA 1TK8A 4ED7A 5DGBA 3C6TB 1I1GA 1P27B 3GR1A 2MKIA 5T7LA 2R7UA 4O3RA 1FRKA 2ZJRQ 3DGVA 4ED3A 3TJ9A 5CQGA 4CM2A 2A6MA 1RUSA 2D7SA 4ZITA 2RILA 4ED1A 3OTBA 1EKRA 4DR3J 2F5GA 5HSPA 3CCES 1Z2ZA 3U1NA 4NMXA 5DS7A 3SDEB 3Q8QB 3I5BA 3QWUA 2RQ4A 5SUHA 1Y00A 4DV5J 1KVJA 1T9UA 4C8OA 1PBUA 4ZMMA 2V8GA 3RU0A 3P96A 4LRDA 4OYMA 4IG0B 2D9PA 4RX6A 1Q8KA 1VQ7S 4JI7F 2KH9A 4ECRA 1XMBA 3IO1A 2JLFA 3MCOA 2UUBJ 2AJ1A 1CLFA 3MAAA 1S0NA 1FKPA 4IRCA 2EFNA 3BSCA 3FC9A 4Y2MA 1S72S 4F25A 2Y8WA 2IHR1 1HWIA 1JJCB 3HP6A 3LW5C 3Q86A 4ERDA 2A18A 4I7FA 1N0UA 2AP6A 3TAPA 4HDHA 4LFCF 3NMRA 4FXDA 1K47A 3K2YA 4AE5A 1Q53A 3N4WA 1UWBB 2HFNA 2ZD1A 2MKJA 2PN6A 1Y7PA 2XNQA 3QGGA 4HL9A 2L9WA 3CDUA 3MPDA 1B70B 3FMBA 3HD2A 4DV7J 2AF6A 3MM9A 4WK3A 2VA2A 5A0YA 2H5EA 3MM5B 1VCTA 4TLQA 2BW7A 3IR6B 3JTPA 2GHPA 4C8NA 3DLEB 3HX9A 2HVEA 1HWKA 1KTVA 2HZAA 1UZDA 4OZLA 3R7SB 2W8LA 3OTEA 2Z0GA 3IBFB 3R27A 2NLWA 4ZP7A 4C98A 2MXYA 3OLAA 2DRBA 2CPEA 3D0IE 3G71S 2CAJA 4KHPF 1DTTB 2RS8A 2POKA 5KFQA 1ZPVA 1XNRF 3OL9A 1R43A 4NLOA 2DO4A 4FVMA 1P9QC 2E1AA 1M5PC 2J7WA 1TL3A 1F1BB 4CI0B 4U6PA 1PYSB 1J5EJ 1S1UA 3PNIA 4PWWA 1NU4A 1VRQC 2NZ4A 5KAKA 2GMHA 4P2MA 2AGQA 4DEZA 2OP5A 1LK5A 1RT7A 1X4GA 2ATCB 1LFWA 2V2VA 3E51A 1N5SA 2XZTB 1X4BA 4OJ1A 1QAIA 2AJQA 5B0FA 2FJEB 1FRJA 1F5AA 2J0WA 4XAKA 2BR0A 4LFBF 1TELA 2BANA 4PPDA 3M05A 2AGPA 3ILOA 1W7WA 3KJVB 1CJUB 1EKSA 2YKNB 2NSBA 4F8RA 4NXNF 2B3TB 3GWCA 4ALZA 3M6WA 2HMIA 1KOOA 3EX7B 3TAQA 5H9FK 1KONA 2H51B 2K7JA 2ZWOA 3BSOA 3HFVA 4CYUB 3MCNA 1BHNA 1NDLA 2GGPA 1DBDA 3CJ8A 1TUGB 1ULRA 4EYHB 4C8KA 4QU7A 3GE9A 3S01A 3FJ2A 1AZSB 5AE2A 1W26A 2QL9B 1IKXA 1UVNA 4I1TA 5LL6d 4RR5A 1X0PA 3QIDA 2EBGA 2Q3PA 3AXKA 3MPUB 4RNNA 2YQ0A 1WDTA 4AFFA 4WCEQ 5LXYA 3RBZA 4CH1A 4ED4A 4DFMA 1LFPA 1NH8A 3KHLA 3QT8A 4WYLA 4XDDA 1IKVB 3GQCA 4DR2F 1AUDA 1KSPA 4AD6A 2L08A 1RWUA 4O4GA 1RT1A 1A9NB 4IH5A 2EFGA 4Y6IA 5ETPA 4BCAA 4DZDA 1SVDA 4J9QA 4X4SA 3MEDA 3N6NA 4WKYA 4NRTA 2VQFJ 1FI4A 2AWZA 4NMLA 1VISA 4USVA 4OHVA 2OPPB 1DJ0A 1PYTA 3RJMB 4ZVRB 4ZVFA 1SIZA 2OPRB 4OLPA 3CDAA 4EGLA 3BO3A 3MAQA 4WF9Q 3MEEB 2HPUA 1OS5A 4JI7J 3K5LA 2QLFB 1TKZA 4P2SA 1KLMB 2QLWA 3MD1A 2DNOA 3P45B 5KFZA 2HS3A 2QMUB 3MM8A 3FDSA 2B6AB 1I94J 4CO0A 4C97A 3VVUA 1DY3A 3CUNA 2A2DA 1QE1B 4OI2A 5DDPC 1BC6A 5DETA 3HF5A 4X84A 4KR0B 1FFGB 2W4DA 3WDOA 4J9RA 1F9FA 4C3MA 5B0CA 4O0IA 4YR0A 1U24A 3BPDA 4LFCJ 2UXCJ 3M2RB 2F7VA 4NX9A 3NGUA 2GQCA 3I87A 3WQPA 5AXNA 3AJDA 4N47A 4DV1F 3TQ1A 3RB3A 3G87A 1NKBA 1NHKL 3VALA 3IXQA 2XQCA 4A8QA 3LUYA 1XR5A 3PJXA 3MEGA 5B7WA 1FWKA 1HW8A 5A2QY 2V4RA 1CQNA 2OAUA 4USMA 3PY8A 3EICA 1RT6B 3MZIA 2ZH7A 3FBFA 3C3LA 1F2GA 5KTQA 2YX4A 1RBOB 2Z2ZA 4JP8A 1OPZA 3FZ2A 5DQIA 3ISZA 2FTRA 2OO4A 3TZYA 1TUVA 3OR1A 1A6LA 4CO3A 2HQFA 1QLNA 2PT0A 4RO0A 1JK9B 3KLHA 2XY7A 1PC4A 2JFDA 1M1HA 1TKXB 1LWFB 5D78A 4ICLB 4RW6B 4DPOA 1XNQF 2HQGA 3ITHA 2IJRA 2OHDA 3JSBA 5HO4A 2E5IA 1QTMA 1RA7A 3FBCA 3FCHA 3HLUA 4M63A 5IQ6A 4DR2J 1QSSA 2IMWP 1JWWA 2FVPA 1X9WA 2W7AA 3A4TA 3B82A 3KJNB 3M1VB 4RBVA 4MYUA 4AUKA 2OKQA 4UOGA 1YRUA 8ATCB 5E5NA 4DX8H 4F02A 3NMAA 2Y1JA 1HARA 4L73A 3T41A 5CA5A 1VS3A 3R8YA 2Y1LB 4HYKA 3W66A 1CG2A 4USHA 2PA3A 5FIIA 4LFBJ 2BJ9A 2KG1A 2XMVA 3VGVA 3IS9B 2KRRA 3RAMA 3CCRS 5KG0A 1IBMF 3BO2A 5CD4A 2HVIA 3PEJA 4ZHRB 2GMLA 4WP9A 3CCUS 4NYZA 4U7UK 2KU7A 1YBUA 3QLHA 3R1HA 4JI1F 4FDFA 1AA1B 1T95A 2IAJA 2DEJA 2FHJD 2P9GA 4I7FB 5A2QU 1EETA 2KB2A 1WC1A 1X5SA 4IYQA 2NUUG 3C6TA 2NSCA 4J9UE 4P7VA 1PILA 4RBTA 5D15A 3HK2A 1HYSA 1VBKA 4URSA 1WF1A 4AL7A 3CJRA 2FB0A 2Q6CA 2L9NA 2K7KA 4TLRA 1HPZA 1NJZA 1SL0A 2OJ3A 1YJNS 4A47A 4WE1B 4O3QA 2UVVA 3TP2A 1P6TA 2D3O1 2F63A 3R6LB 5I42B 2ASJA 2HHHJ 3UN2A 5D8HB 3WIUA 5F8GA 3ET6A 1WG4A 2D69A 4USIA 4EFAC 1FT8A 2V94A 2VJUA 2KO1A 2QFJA 3HO1A 4IO1A 1PC5A 2JJ4D 2XTJP 3LAMA 2WVBA 3MCSA 5J2QA 3UN5A 1LW2A 2CPIA 3T9ZA 1EHWA 3LOUA 1YGYA 4GO7X 4IG0A 3CIZA 3M9MB 2VQFF 3PV8A 2HIQA 1VC5A 4B9UA 4NLWA 3DM2A 2HVHA 1Y5NB 4JBCA 2HNZB 4G65A 2ZOGA 3LGHA 2B0GA 3A8EA 4KGKA 4F4AA 1IBLJ 4M5DA 1FJ7A 1HMVA 1R8CA 4C0BA 2CQBA 2GVZA 2OI2A 3BH7B 4XPEA 2ZM6F 1HBUB 3M2UA 3PW5A 3HSDA 2OIHA 1N8RT 3Q8SB 1WC4A 2QA1A 2CNOB 5ETKA 4LR7A 2MLXA 1OY9A 3OR2B 3OXLA 2ZJQQ 4QYZJ 1DLOA 4DS4A 1IXKA 1PJ7A 4BC9A 2DGXA 2V4JA 3HHKA 2Q1LA 4LSLB 4M5NA 2BOAA 4ZJOA 3QSIA 1GEHA 5HQMA 4Q8EA 2JOQA 1RTJB 1DZ5A 2UXCF 4OX6A 5IT9Y 4OV6A 2MKYA 2MZQA 4DV1J 1NK0A 4HT7A 5M2RA 4DV4F 2UXDF 3HDSA 3OJUA 3K17A 4HH0A 4O4RA 3DGPB 1VRTB 4HTIA 2BACA 1P1TA 1DTQB 4NYPA 2D74B 1XJWB 3QQCD 3L3CA 1VK3A 2BEFA 2DYAA 2YH1A 1TR0A 2R8KA 3H4BA 5DLFA 3T5JA 2UVUA 3MECB 1FJCA 2X1BA 3NS7B 1TL1A 3GJQB 4CWBA 1SXLA 4LSNB 2YPZA 4OLOA 2J0XA 2VD3A 4S0MA 2ZE2B 3V4IB 3T1AA 1NK5A 3T9NA 3ZC4A 1YX2A 3TRGA 4CM0A 2GO8A 4ID8A 1IBKJ 2IJNA 1JLGB 3H0PA 4ZKAA 1VC0A 2V8HA 4YB7A 4CIOA 1RLCL 1YJTA 5CH7B 5E2QA 2HHQA 2XY5A 5HMYA 1KKHA 2YWEA 2W4CA 3ZZYA 3J7YU 4FXVA 1OJ4A 3H98A 3QGIA 3G6XA 1TMJA 2I2YA 2XYPB 3NCPA 2YWWA 3UQSA 4ZPVR 4KYZA 1VLYA 5D4PA 4F4KA 1QD1A 4XIUA 4TU8A 2APOA 1H72C 1TKZB 5J2PB 4DUZJ 2FJAB 1HIYA 2CQ2A 2XI2A 1CULB 2JZ5A 3ENWA 4RLEA 2ZEJA 4MAKA 4TY9A 3ISND 4TY8A 2IBOA 2V5HG 4AXIA 3MMCA 2F40A 1U25A 1XC9A 3T5KA 1HA1A 3GFYA 5HQ8A 4ED6A 3M8PA 1SQFA 2HKEA 1K1SA 3NGSA 2M5YA 3DRSB 1ROFA 3GIMA 3EGZA 5F0UA 4ZVHA 3R2DJ 2YKMA 4QCLA 2AJFE 1FRIA 2J8SA 1HHTP 2VH7A 5HP1B 2LFVA 1NSPA 2E5JA 5KFTA 2RDJA 5F8JA 3MF5A 1JLBA 2DH8A 4K4TA 2YKQA 1ZBTA 2OEMA 4UUWA 5CD4H 1RE1B 3T5LA 2CPDA 5KFGA 4ED5A 2KVQE 5LMUF 2YVSA 3A3PB 4JI6F 4O3NA 3MOZA 3QFWA 5A8KA 2QG9B 5CCMA 2B4PA 2OPPA 1I5OB 3VAHA 5LXRA 2MSTA 4U67Q 1EP4B 4IFVA 4IO9Q 3IMQJ 1OYEA 2GZOA 4ECZA 4R0EA 2MKCA 2H5JB 3VWSA 2DNLA 1DAXA 3UCGA 1RCOB 5ETOA 2MKSA 1JKHA 1HI8A 2HGNA 4DV3J 1V5VA 4G1QB 2GQ2A 2LP4A 4BWJA 1VBXA 4UY85 4W98A 3A13A 1IBLF 5KT6A 3K5NA 4RBUA 2RSQA 1P9YA 2VPWB 4USKA 1FEEA 1X4HA 2BE2A 4Q0BA 2M9KA 1BD6A 5JUMA 2LEAA 4D3GA 1IKXB 2NXCA 3DMJA 1T9YA 5K14B 1RWOB 4LF5F 1BWVA 3D66A 4DR7F 4KO0A 3DKDA 2FLOA 2FPHX 2DNZA 2PA8D 3PJWA 2KT2A 5KOWA 5D3GB 1G1XA 4N76A 1JLQA 4CNZA 3D2WA 3EVWA 2MQ8A 3DRXA 1W25A 3EVOA 3KUHA 3LTOA 4P52A 3CMES 4KAIA 4FXWA 4YB6A 4YS2A 3GMGA 3SQOP 3TEGA 4DUZF 2LA4A 2D3UA 4MYTA 3VZIA 2B8PA 3PTWA 4MH8A 3UR3C 2ADBA 2OSQA 5FLXY 4HI2A 1FRXA 3CDEA 4TN2A 5ETTA 3EUNA 3BSNA 3M6VA 2WVCA 5F8IA 3MPWA 1HQEA 4GMKA 4A46A 4CQ1A 1YJUA 3T1YF 2NXUA 2XMTA 4DPTA 4YR2A 2XS2A 3IM8A 3I0SA 2YY3A 4PQUB 2YWKA 2ZBIA 2UUWA 4ICLA 4RW6A 2M2BA 4DL2A 2M88A 4ZP8A 3K7RA 3Q89A 4QYRA 4OHYA 3D9BA 2IRYA 4HVZA 3SFGA 2QA2A 1S10A 2ZBRA 2JEFA 4KV8A 3E01A 3NEKA 3MURP 1WWHA 1PBAA 1SB6A 2GA7A 3DRYA 4K5RA 4JI0F 2RNEA 5BJRA 4LF6J 1X5OA 3CDBA 3QJPA 3HHLC 4M5IA 3TWZA 2MQOA 3QBCA 1FDBA 3TQEA 2DPIA 2DNKA 3ISNC 1TL4A 1LV5A 4L72B 4NLYA 5MLCV 3D6HB 2R42A 1U0SA 5LMNJ 4Q7AA 4DF8A 2MQQA 4ILLA 2KFYA 3R1LA 1SKRA 1YJRA 2EVZA 2AT1B 1U2RA 3DOMA 2FZGB 3EVMA 4JOUA 4F4ZA 2QZ8A 4G6VB 5F3ZA 3Q8PB 2XMMA 2VJVA 4ECUA 1NBEB 4NCGA 1HW9A 3NCQA 1HNIB 2AGOA 2R2UA 3Q0AA 2VG6B 3PW4A 1TP7A 3HT0A 5L1JA 2VFVA 2DGUA 2GAHC 4ZJLA 5C2GA 1GMWD 1CJVB 1RAHB 5JJBA 2BYCA 4OZJA 2PMHA 2KVIA 3V6DA 2HURA 2NPFA 4EO8A 1XNRJ 3BSAA 4LUBA 1X4CA 3BYPA 1CC8A 3DHXA 1WG1A 1K44A 2XSJB 1X0FA 2XNRA 1RQ0A 4QBUA 5E3AA 3W8PA 1C4CA 2HHTA 1U6FA 1R31A 4NWBA 1YK9A 2ZFHA 4WFBQ 1RK8A 1SCJB 1LWCB 1O6XA 1EARA 3Q23A 1CJKB 2FVCA 1KNZA 4DV2F 1KP6A 2GC8A 3GJTB 1ZAVA 3TW0A 3CSKA 4OI0A 5HJYA 2DNPA 4NI2B 3W9HA 3NL0A 2QE5A 2HK3A 2CRLA 3H2UB 1YZ6A 1LKZA 2HRUA 2NUHA 2VKZG 4U8YA 5J1NA 5KT2A 4FBTA 1SL1A 4NLSA 2YKPA 3JSYA 4Y00A 2N7YA 4NXNJ 2QRRA 4KGZB 3V2UC 2RRAA 2Y1RI 1S6OA 2NYHA 3BKFA 4X4OA 1UEVA 3QRQA 5DM7Q 3H40A 4NLRA 4YB5A 1XR6A 4DSEA 2VG5A 3LP0B 3RAQA 1IKWB 5EUHA 4B3SJ 3CDWA 3KHRA 4ZDNA 3T1HJ 3UD3P 3I31A 4JI4F 1EX8A 2Z8QA 3H20A 4X4TA 2XLJA 2FZKB 1C0UA 4RKUC 3DYAB 2AEFA 1SJRA 5D0RA 5KG5A 1T8EA 2UVRA 4LRFA 5IZHA 1RT1B 2QT7A 1PIEA 3P5BP 4Z2XA 1I3OB 3SCLE 1WKJA 4IQXA 2LLZA 4L6V3 2COLA 3EE3A 1RT5B 4QZVB 4Z7CA 4QW9A 4DR7J 4LF5J 3MEDB 2V8DA 4QPXA 3C6UB 4LBIA 1HWLA 1VJQA 2BANB 3OQ2A 2I5JB 5J2PA 1NO8A 3UD4P 2Z58B 3IC1A 2ZKUA 3U1MA 1TAUA 1VQMS 1RAAB 1SC6A 2D3ZA 1HBOB 1KLMA 4DR1F 1QVGR 2CFXA 3EZOA 4RW7A 2XS7A 3M8QA 2YKAA 4CH0S 5DZ7A 4RNHA 1VDHA 2HWHA 4IOCQ 1U09A 4K4YA 3K89A 4LBPA 4L76A 3V4IA 4EZ9A 4IQMA 2B51A 2VBYA 5ETSA 4N77A 1AXQA 4NZ0A 2H5IB 1RT2B 3EGWB 3D6FB 4D3HA 3JSMB 2FLPA 1PJ6A 1I94F 2F8HA 2I8EA 1KR4A 3DLGA 4DFPA 1W2BR 4U7UD 3DRPA 2DH9A 1CJTB 2WZ1A 4Y0FA 3H7HB 1BUXA 2BKPA 3ILIA 4R0JA 1S9GB 1U1RA 3D5MA 2XMKA 5GAEI 4LF6F 4JYAF 4XO0A 4KJIA 2DHGA 2ZOMA 2V4JB 2FQQB 4G1PA 2F9DA 2LU1A 1WORA 2V2KA 1QSYA 1RTJA 4C8MA 3J80Y 5KFNA 5FLXU 2DHSA 1R8AA 1JXLA 4Z7YA 2FVRA 4PG4A 1NEEA 3LGNA 1Z4UA 2NR0A 3SFUA 2CJBA 2E1MC 2EG1A 4FF1A 2UP1A 4EYIB 1JIHA 3B4DA 2CPHA 1S1UB 2ROEA 2NXJA 1T3NA 4I4BA 4F7VA 2DR5A 5AJ3J 1XMQF 1NK8A 1URRA 4ECWA 2LDYA 1VQ5S 1EQ0A 1KOHA 1TL1B 1Q81T 1YJVA 3DRPB 2QLBB 1OQ6A 3HCXA 1D1UA 1S1WB 1WEZA 3U1LA 3MAHA 3C16B 3PR5B 2GJFA 5T41A 1GTEA 4OYXA 2IYIA 3QJLA 3EJMA 4F4YA 4MK7A 1QDUB 1SJ1A 5KFMA 4NLTA 4DV2J 2R7QA 3THPA 4DUTA 5I3PA 9ATCB 4F4XA 2G2YA 4DR3F 4FF2A 5C25A 1RI7A 2XEXA 3P49B 2E5GA 3EDRB 3UDCA 2KHCA 1C1CB 3TAMB 4WXOA 4OYOA 3HSJA 4J9SA 2C2MB 4DV5F 3BM7A 3MR7A 2LDIA 2PEHA 3D6MB 3M7VA 2ZH2A 4DL6A 2E7XA 4NLGA 2CPXA 1T3OA 2LQ5A 2FVQA 3SMZA 3U7JA 3B54A 3AA9A 1S48A 1UFKA 2IJFA 3HHDA 3A3OB 3O2IA 4I69A 2CWKA 4TQSA 3THVA 2IRUA 3DDIA 1RTHA 3ETMA 2JC0A 1RAFB 3PXGa 4H4KC 3CT9A 1UJ6A 5HLFA 3T1HF 3FQKA 4B3SF 5DM6Q 1I6JA 2L9DA 2PIIA 4ID5A 2EK6A 4RPFA 1NJIT 3CO9A 4LRBA 2EKNA 1CBKA 4H4OB 4CLSA 5E33A 2VDHA 2V9WA 3UVJB 1H7WA 4KGXB 2HBQB 1EIYB 3AJ1A 2I9SA 4F0MA 1AUSL 1LW2B 1S97A 1JLQB 5CABA 1RHMB 2UUTA 3N6LA 1DQ9A 4FZVA 3OFFA 1TV6B 1FERA 2YH0A 4RNOA 3H5YA 2FJVA 4C0HA 2DNHA 2C3MA 4ZP6A 5J2MB 2XMAA 4UZBA 2RS2A 1RBLA 1C1BB 2IM0A 2G1DA 2GW8A 3LP1A 5DZ6A 3CJTA 3RBDA 2G2OA 2IC3B 1H73A 4HKQA 4K7QA 2DGVA 4FF4A 3SSRA 1RDRA 1S6UA 2AX0A 1UMJA 2IAJB 4LR9A 4NL5A 4OQJA 3M32A 4UT4A 3QT5A 4JV0A 5IM0A 3E01B 1BQNB 2PDAA 2ZM6J 1D3WA 1REGX 3I0RB 4QR0A 2XSFA 3KK3B 3VAKA 2BQUA 1LXNA 5BR8J 4J91A 3OXGA 4GO5X 1S0VA 4DU8A 2BRLA 2V68A 3BH6B 1R0AA 2I0XA 3KUGA 3UD5A 2DO0A 1RHUB 1M5HA 1W2IA 1C0TB 2DIVA 4PCQA 3IG1A 4V1Ak 1GXTA 4LREA 2PC6A 4K2JA 3S1TA 5GAGU 2V50A 4EMDA 5C42B 1VQYA 1HWUA 2CQDA 3UNYA 4B9LA 4LF8J 4DOZA 3W7BA 2VG6A 3K5OA 3IGNA 2XY6A 1C1BA 3TZWA 3O3LA 5GAHI 4CLWA 1B0PA 4ZPTR 1S6PA 1SV5B 2H3EB 2H65B 3V6DB 2XHWA 1RB0A 5K20B 3WX8A 5L46A 1QTNB 1TKXA 2X1GA 3JQMA 4DCOB 3PX0A 4C8YA 5GVQA 4K0KF 4K50A 3JQKA 1OMSA 2YNGB 3ITHB 3JSRA 3DLKB 5E3QA 1WI6A 2ZHAA 4ECSA 2Y1IA 2M3DA 3R5AA 2L41A 3N01A 1RYSA 2Y3YA 3G82A 4GKJJ 1EJ7L 1IQTA 1FF2A 3GU0A 5CZVA 1R0AB 3LH2S 3J7AN 2Z2LA 1PCAA 2RVJA 1BGXT 1BQMB 2RD5C 4Y28C 4YUDA 2W9AA 2XZWA 3PRDA 4PXDA 5AXKA 4WZQA 4Y65A 3IWNC 4MKBA 4QIWD 4C3LA 4FNIA 2CUYA 4KPCA 4QIEA 2CQPA 3D54A 1WHXA 1RZMA 1S7IA 3M6XA 1NSQA 4JI2F 2AU0A 2BKNA 8RUCA 4PG6A 1HBOA 2KJVA 3C46A 3M8RA 2G13A 3VZHA 3G2XA 3W9JA 1T03B 2BUNA 3IS9A 1PYOB 1PSDA 2HHVA 4C48A 2RJZA 3IR5B 1UL3A 2EW9A 4DDFA 2W25A 3KG4A 3QPIA 2AKWB 1Q5YA 1VIXA 3AB4B 2KT3A 4I6WA 2Y0SD 4UOCA 3NY0A 2M70A 4O3OA 1OIAA 2CJ9A 2CPYA 2VBXA 3GB0A 3QGHA 3WX4A 4YY3J 3MR6A 2N4DA 3MUMP 1OPIA 2ZUGA 2VHGA 1KLNA 1M5OC 3EDQB 4PR6A 2C2KB 5KFLA 4BS2A 3DNCA 1Y3KA 3K8VA 2CIMA 3MECA 2LMIA 1U1KA 1G2EA 2BVZA 4M5MA 4WFAQ 3CJSA 2CQGA 5HROA 5FDLB 1FNMA 2JDJA 1Q8IA 1S1VB 1S9GA 2GHWA 2GVDA 2ZBCA 5EX0A 2W24A 2WSCC 3NLCA 3CJKA 4HLBA 4QW8A 4H4KA 3PKMA 2X1FA 5A8RA 2R7RA 4WIQA 3HVWA 4P7TA 4ECYA 5AE1A 4KIAA 4NE9C 2CDQA 2YXLA 2RMLA 3BGUA 1GT8A 3ET6B 1EP4A 4IFVB 1PAEX 2X3GA 4KB7A 4OJHA 5EWFA 4MKAA 1S49A 4ECXA 3ZZZA 1WF0A 3O5TB 2BA9A 3WZ0A 1RHRB 1R8BA 3DN9A 4NPOA 4O3PA 1JKHB 1TUWA 2AZ3A 1HQ2A 5IV3A 2UV8G 3NG8A 4AQYF 1VQ9S 1HI1A 2ASLA 1HNWF 1RAJA 1QSLA 2DGSA 2GVZB 2CZ4A 3MMCB 1OYDA 1AT1B 4ILRA 4V19J 2JHEA 2DNNA 4L74A 3R2CJ 4RW9B 1YZ7A 2MGZB 1X4FA 1N5VA 2DJWA 2M52A 2QJ3A 5DG9A 1BQXA 1V3RA 1X4DA 2DGOA 1JB0C 4DFJA 4TVAB 1LOUA 3CJKB 1UEUA 5T14A 4USWA 4JI2J 2PEBA 2R2SA 1RT7B 2FC9A 3H8YA 3G82B 4P9SA 3AAWB 1JLBB 2W1BA 2WVFA 1UWBA 4DS5A 2LYVA 3BGRB 2X3DA 1TFWA 2J6UA 1N32F 3DGPA 1GQEA 1S1XB 5HMZA 3MMAA 4FS2A 1CJUA 1PAUB 1ZA1B 2DKOB 4NLDA 3PJ9A 2CKWA 4NRUA 4YY3F 5ETNA 3DLEA 3WC0A 1TKDA 2GGPB 3TVYA 1RT4B 4JI8F 5KFVA 3H25A 1GK8A 2HNYA 3R5JB 3SCKE 1J27A 3MR5A 1IBMJ 3W5ZA 2C1EB 2YTCA 4GRSA 3S8SA 2B5JB 1MLAA 2UV8A 4I6AA 4QWCA 5DDRC 2G0CA 5CYMB 3AOAA 2CJKA 1V5IB 2F4VJ 4K59A 1LNQA 2A3JA 5KFJA 2C3UA 1GX6A 4PWDB 5IWAF 1HD0A 1KQGB 1V3ZA 4K0KJ 2XGPA 3B78A 2VZ9A 4PXBA 4ZOSA 1FE0A 3HPOA 1B64A 1U7LA 1FHTA 4IR9A 4KE5A 4AXJA 4F50A 4B3TJ 2BZ2A 3H5XA 1RP5A 3BN7A 3VAGA 3AH6A 1F3FA 1T9WA 4C11A 1RAEB 1K1QA 2VBZA 4NLPA 1L3SA 3DOMB 7FDRA 4EI2A 2EI5A 4N7TA 1ZZFA 3GIIA 4K4ZA 4QU6A 3DC2A 3UDVA 2ALZA 3R7NB 2VFSA 3KKFA 5J2NB 2HHHF 3QMQA 4W92B 1C1CA 3TAMA 3W60A 2CG4A 5LMNF 3NGKA 1XR7A 2CPZA 2ZNZA 3H42A 4ITSA 1V6HA 3K58A 1U49A 2YKNA 2GX8A 1N52B 3E3XA 4NXMF 1H2UX 2CJYB 1IM4A 4ZPCA 3HMJG 2CYYA 2ZDPA 2ZVSA 1K0TA 2AQ4A 1NK6A 2DCLA 1U6ZA 3GONA 4E2FB 1WOPA 1Q16B 2DH7A 2W2MP 3OBIA 1UJ5A 5D4NA 4ZVPB 3E2EA 5E3RA 4LF9F 3T3FA 3I0SB 1WEXA 1VOMA 3DRRB 5K5MA 1WKLA 4PQUA 3CC7S 1SUQB 1D9AA 4ID5B 3OV7A 1H2VZ 1Y5IB 1RWMB 2HBRB 1QJHA 1NK4A 5F8LA 3HKZD 2ILYA 3HULA 3MMJA 3AJ2A 3OPKA 4F3MA 4ZIWA 5SZTA 1U1LA 1N4LA 4JI5F 1KN6A 3F56A 4YMEA 2Y8YA 3CJ0A 2HRYA 2VUGA 1SH0A 1N32J 2W7OA 5CXTA 1YQHA 2GCFA 3ZTRA 2ERRA 2AW0A 1RCXB 3G86A 1YRXA 1YHQS 4F2RA 3BGFA 1KEKA 1OY6A 4AL5A 2AYEA 1WACA 1N5TA 1JJ4A 4ANDA 5DRKA 4J9KA 4NA2A 3VV2B 5C25B 1FEHA 1U0HB 5HMWA 3QJJA 1Y4ZB 1HBNA 3CD0A 2JC1A 4K2XA 1HNIA 2QV6A 2XWYA 2NREA 3DLJA 5HI7A 1F6TA 4ZJQA 5KT3A 4JV5F 1SC1B 2LCWA 4B9VA 4WWSA 4AQYJ 3N79A 4G1QA 3ELHA 1D8ZA 4FN5A 4OHXA 5KT4A 3OUYA 1Q7YT 1HNWJ 3D4JA 3TI0A 5KFCA 1WHVA 1X9MA 2A1BA 2B4VA 2QL5B 4TY8B 4B17A 4B3TF 4Q0BB 2R7XA 3PFOA 3VGSA 4JI4J 1YITS 3CVKA 5L9XA 5CYQB 2GIFA 2E1CA 1YBAA 3HHLB 3M1VA 3DRSA 2E5HA 1T94A 4LBHA 4P72A 5KFUA 4F3QA 1UW4A 5BYQA 2RB7A 4ES2A 3IM9A 1L3UA 1X4AA 2KXFA 2ZZNA 4ED8A 4UTGA 1IM6A 3CEDA 3JQJA 3NKYA 1H38A 1FK9A 2JLEA 3IRXB 3M2VB 1T9VA 3EXCX 5G0RA 4U95A 5IV4A 3TVZA 5LJ5Y 3MTKA 3OVAA 2WTFA 2EC0A 3W62A 2QL7B 2HFVA 4OI1A 1JNRB 4X62J 3MOJB 5C5JA 2EG2A 2VU5A 3MEGB 1ZM3A 1PJ5A 4KC5A 3K5MA 4GKJF 3DFEA 3FCWA 1RWWB 4ELUA 2DVIA 3RR8A 4USJC 4WKRA 4FVCA 1MU2B 1M5SA 3HVRA 1JLEA 3QLHB 2KJWA 4L75A 4KGVB 3ETOA 1FO1A 1JXEA 2DISA 2IC3A 4PAAA 3W5XA 3W9IA 4N56A 4IG3B 4PABA 1Q8BA 1J5OA 1YBTA 2QTWA 2YBVA 4Q2LA 2F4VF 2DNGA 1HKAA 2ZBQA 5IWAJ 3A8JA 1MN9A 2QIFA 3CJ2A 1BQMA 2CQ0A 3IBCB 4KQZA 1N5QA 4RNFA 2KXNB 1IBCB 3ZZPA 2GMJA 3LWMA 1T11A 3KLIB 1GXUA 2NCKL 4LF7F 4O3SA 2CADA 4CTAB 3OT9A 5KFWA 3QNWB 2PFDA 3V4MA 1Q79A 3MM7A 2W8KA 3G8QA 1F0XA 1FKOB 2MJUA 3M6UA 4PWUA 1RWPB 5ETQA 3FNNA 4P2XA 2E29A 4KFBA 1JJHA 1HNVA 2EK1A 3PW0A 2VV5A 2SXLA 3D6TB 3CCQS 2K3KA 1ZZNA 1SL2A 1D9FA 2DNRA 2DRAA 3R9LA 4GVLA 1U2FA 5JXSA 3CO0P 3BPSP 2PMWA 2Y9HA 2WBRA 2PD1A 4JV5J 2RE1A 1SJ3P 3D68A 4IUFA 1GNKA 4OI6A 4RW7B 1BXNA 3SQGB 4DR1J 5GADI 2JFKA 4UZCA 2FHOB 1JLEB 3UDEA 2HFSA 3BV8A 3GV7B 4WP8A 1NKCA 5KG3A 2WOMB 1TL3B 3SXLA 3TA2A 4ZN3A 4DV3F 3TJAA 2RU3A 3N9UC 5CAAA 3BQ0A 4LF9J 4RUHA 1SQGA 2O5DA 5AT1B 4LFAF 4JUZA 2AEJA 2VOPA 5HAOA 5H9EK 4KKOA 3VAFA 2W2NP 1TTHB 2V0NA 1MNEA 2ZWPA 4I64A 2ZJPQ 4CTAA 1H98A 1U8WA 2CPFA 4OZ5A 2DNYA 2JH3A 4JI5J 3NNCA 5A8RB 1NCLA 3ZZOA 1TFYA 3HHLD 4P2FA 4C4WA 2B7CB 2HGMA 4BWMA 3FUYA 1XWLA 2RF2B 4A48A 3NWRA 4LIRA 2C2NA 2C42A 2VG7A 2M7SA 1C4AA 4I67A 1WF2A 4I0WA 2ILZA 3KWMA 3BQ1A 2B6AA 1K8AT 3X1LB 3GPAA 4CO5A 5IC4B 1U26A 2GNKA 2HVDA 3T1YJ 3TUIC 3L09A 1TAQA 4KHMA 1IR0A 1GXLA 1NUEA 4J9VA 4UOFA 1U1PA 4ZLNA 1VI7A 4LRCA 4MT1A 3ULHA 3QRRA 4MMOA 4PKDB 3UVJA 2XM3A 1FX4A 3P4UB 4CP5A 2RH3A 1FE4A 3AB2B 5K8NA 1KD1T 3ONQA 4P71A 4ZPDA 4JI0J 3L7PA 1N0VC 3LALA 1VRUA 2KYXA 6FDRA 1HHQA 1RU1A 4ZVUB 3QYYA 1T9TA 1ITPA 3KHGA 5I3UB 4WU2A 2VPYB 2I6WA 4DL5A 4ELTA 5KFYA 1MW7A 1FKOA 4IR1A 4M94A 4DL0C 1LQ9A 2WVEA 1FVSA 4DPUA 3L7UA 2VFUA 3FRZA 4K8RA 4FNHA 3TO8A 4CLZA 3KLGA 4J9OA 2BX6A 2JEGA 1DFDA 2W2OP 4FKYA 1SI9A 3M32B 3QIPA 3ZZRA 3I5CA 3DRRA 5KFEA 4CLUA 3NGDA 3QATA 2XGQA 2ATLA 3PYFA 1HHSA 3O1LA 2GFFA 1MG7A 4CO1A 4DU7A 3VHQA 3HSGA 1S12A 4LFAJ 1UAWA 3NGRA 5IQQA 2J6TA 3NS5A 1NPRA 3BF4A 3N0VA 4USUA 3QT6A 3LO3A 5DDOC 1WDDA 4GC7A 2DHXA 1VQPS 4DXLA 4PWDA 2P2CB 1XERA 3CPWR 2B9WA 3HI9A 3MMBA 1ICEB 5B08A 1JLAB 4C11B 3E8OA 3LWLA 3MTJA 3TX8A 3GG1A 3GV8B 4OX7A 5K8PA 3TARA 4UUXA 1NHUA 4WFZA 4LF7J 2DXFA 2Q79A 1S1TB 2DGQA 2Z4PA 3NOCA 5A6WA 2DY1A 3IFEA 2DTJA 2FGCA 5HQLA 2ZUAA 1VLOA 4ILMA 4R8UA 5E7OB 4Q5VA 3FCVA 2BV3A 3PACA 3AHPA 2K2PA 2KN4A 3BGRA 3MM9B 4KSEB 2W9CB 2C2DA 1R89A 1SH3A 5J2MA 1HNZJ 3EXYA 3MMAB 3RGIA 3VGTA 2O01C 2CVEA 1QM9A 3UO0A 4DF4A 5KFDA 3R5DA 2K06A 1KC8T 2NQPA 4DSLA 1JMTA 3DCAA 4IFYA 1E6YA 3FSXA 1LEOA 2A2CA 3PEHA 4OYBA 1FXLA 5B0DA 2FJWA 2OEJA 1LWFA 3S7RA 1RTZA 2H4YB 1KFDA 2HS0A 2WK4A 4QIVA 3GG0A 5CYMA 1JLFA 1UJ4A 5K14A 1X4EA 3FQLA 5HL7Q 1S1WA 1PG5B 3AQPA 3BR9A 1AROP 4KO0B 4PG5A 4J37A 2ZH5A 3FEXB 2HQCA 2WB1D 4PZVA 2YWGA 1MROA 3U02A 2J0QD 2HLTA 3HT3A 3OFHA 1RLDA 2F8MA 1FNXH 1FD8A 4OYZA 1OSCA 3BO4A 1UVMA 4NCBA 3GLJA 2DPJA 1T02A 2CZ9A 3HHEA 4QPTA 3OFEA 5B0AA 5ADZA 3M8YA 3IG1B 5LSRA 3KLVA 4EBCA 1FXDA 2ZDOA 4WFNQ 3GFHA 4DLGA 2CJAA 5J2NA 2HNZA 2DCUB 1ZYQA 4DSJA 3AA8A 2WVDA 1NJWA 2BQ3A 2A10A 5F8MA 3QSYB 1HWJA 4TYAA 2HRTA 5LJ3Y 2JWNA 4AYBD 3Q8YA 4CLKA 1RTHB 2YNIB 2ZHOA 4NEYA 2WHOA 3BQ2A 1HQEB 3L7OA 3KLGB 4ZCLA 3HHNB 2F65A 1S1VA 3C19A 1D8YA 3O44A 3UI3A 4FBUA 2G1HA 3OUYB 4A8FA 3C2PA 2FLNA 2CNLB 3KLIA 2WONA 1VQOS 1SQEA 2DEIA 1YSJA 2MTLA 2Z30B 4X66J 1NJYA 2R3VA 5KFRA 2JSXA 5CYQA 3VGUA 2UXBJ 1ELOA 1MSWD 2DNMA 2K1RB 1WC3A 2H4WB 4UY8T 3QRPA 3RRKA 2DRDA 2NXEA 1U4BA 2MLZA 1JQGA 2V63A 4DX5A 2FGOA 5I42A 4W90B 1R6VA 1MMDA 2B7BB 6FD1A 4CT8A 3RB0A 4WXWA 1B0VA 2F1FA 3A8KA 3MD3A 3POTA 3K59A 4B3RF 2BE9B 1C2PA 3TUJC 2CJXB 3D1HA 4C0OC 3V6HA 1U1QA 1WKKA 4LRAA 2C2OB 2XLIA 2GIQA 5IC6B 2HYIB 2PI5A 4LQ3A 1NZ8A 4ZPBA 5IFMA 1JJ2R 2MJNA 4YFUA 2EBEA 2OELA 3OXFA 1FJGJ 1IKYA 1BE4A 1KQKA 2MQPA 4C8ZA 1UTAA 4Q45A 2J7UA 2Z56B 4K4WA 2EFOA 2LQBA 2R2TA 3MEEA 4CCHA 3FRYA 5L38A 2XSJA 1P8GA 2AIRB 2R7OA 4M1KA 4M5JA 1GMUA 5AJ3F 1XMQJ 2BOPA 2FY1A 3NXZA 5J1PA 4GKKJ 3N5BA 1F3VA 2GVDB 4Y2KA 2K1RA 2OGUA 2RDIA 3GZ7A 3TVKA 3UN3A 3TZXA 4K4XA 5RUBA 1HFEL 5M2UA 1X31C 2KXHA 5HANA 2R4FA 2VFRA 1OY8A 1U1MA 2LA6A 3N6MA 1HNVB 4O23A 3W64A 1YIJS 1M5KC 5KFAA 2GQQA 1UEKA 4WJBA 5KT7A 3SV3A 2KM8C 2DR7A 4M8LA 1RISA 5E3PA 2GHVC 1RTIA 3J81Y 2P6TA 2MY8A 2YQ1A 2GJ2A 2XG8A 4ZA1A 1FDNA 3D1QA 3THTA 1OO0B 1RACB 2YPYA 2FC8A 2BDPA 3ICLA 3CD7A 4OIXA 4CNYA 3BDEA 1N33F 3ADAC 1ZS6A 4JI8J 1UPMB 5LM7E 2C28A 4RUCA 1XQIA 2FHKA 3FKBA 1KQFB 4ZCKA 2J5AA 2MB0B 2W4PA 1NAQA 2XLKA 2XI3A 2QSWA 4HI1A 2UXBF 4YR3A 1AYEA 4FKXA 4KBIA 2VASA 4DR4F 1S4EA 2NXNA 3UPFA 1EAYC 3IGVA 4MKVA 3CMAS 2HVZA 3KK3A 1ZETA 2RHQB 4IRKA 1RBAA 1RHQB 2AJ4A 3ENAA 3FGVA 2ZZMA 3MEKA 1RWVB 1KRPA 3W63A 3JYTB 1RXOB 1TQLA 5G4DA 4QYZK 1S9EA 2E44A 3RTVA 3QIPB 5C7PA 1X9SA 2HAIA 1WD6A 4N5SA 4WIIA 1T05A 2BMBA 3FVYA 4K5SA 3N28A 4F04B 2JVRA 1QAJA 2ZC4A 3C14B 2FHMA 1JLCB 2OD6A 1SIWB 2B56A 1R0BG 3T6JA 3FFIA 3G6VA 7FD1A 3W2WB 4KPYA 1TU0B 3HVTA 4GKKF 2MLYA 4RW4B 5DGAA 1NZAA 1CSJA 4Q44A 2M8HA 4M5GA 1EETB 3HFZB 3ILLA 4DL3A 1VBZA 4RU2A 5D3GA 2R7SA 4YN3B 2HHPA 2KRBA 5KFXA 3U27A 2UVWA 2ZVIA 3PDNA 1TZ0A 2BJ1A 5CCLA 5BR8F 4C9DA 1UETA 4KY3A 3MUTP 2RU9A 4GVBB 2J76E 4J9LA 4PRFA 2VPZB 3CD6S 2U1AA 4OX9J 4DN0A 1SC3B 3F44A 4WU3A 1AW0A 1VC6A 3DI6A 3BGLA 3M4XA 3R5CA 3TNVA 1XTZA 5KT5A 2XMWA 4B02A 3C6UA 1RWKB 1FA0A 2R7VA 4UOHA 3M30A 3F73A 3OW2R 5A0YB 3Q22A 4LF8F 5L8RC 5KFFA 4FYXB 4B9MA 1N33J 2OTLS 1LWXA 4C6AA 4DR6F 2BJ7A 3I4PA 1GX5A 4F67A 4B3OB 3M9NB 5ITHA 1L3TA 1FKAF 3OD2A 3BKUA 3OHBA 1UVKA 1UPPA 3AQOA 3GJSB 3OL8A 1DRZA 1N36J 3PVXA 4NEZA 5A76A 5H9EJ 1SKUB 4BC7A 4DR4J 3PIOQ 1JLAA 1WEYA 3HJVA 4TNOA 4X4PA 2Q6BA 4X4RA 1U02A 2LXFA 4IDKB 3CF5Q 4DL4A 3CJ3A 1YJ9S 3K0JA 2MQLA 3DU5A 1MWZA 3GIKA 1IJEB 1S0OA 4X4VA 4WTOB 2BQRA 5FDLA 3BJYA 3AD9C 4X64J 3FBBA 2UU9J 2KYZA 3KUEA 3BREA 2BXJA 2PMZD 5D0HA 2LXIA 2CQHA 4OI4A 5D0EA 1HNXJ 3LAKA 3ZXWA 3MI7X 4PEOA 1UA1A 4DSIA 2ZNYA 4DG1A 1Q82T 3F41A 3ZZ0A 1EZZB 2XB2D 3SIPB 2OPQA 4DFKA 2D41A 4XDCA 2QA4G 5F9LA 2ADCA 4P10A 2W9CA 4NA1A 1IWGA 3PCOB 4MTPA 1ZA2B 2YNFB 3KFWX 2MYFA 3UE2A 3QFHA 3NBPA 4DX7A 4F36A 5IXUA 3V81B 3WHIA 3Q83A 3KYLA 3M2UB 4BHQA 3TYTA 4BLGA 3SZ2A 3J80U 3I9V9 3W5YA 1UP1A 4QIFA 1NSAA 2HS4A 1UCNA 2MMYA 2RRBA 4OL8A 3CJQA 1X5TA 3HZGA 1WG5A 3MXHP 3BGOP 1E6YB 4B9NA 4NZ6A 3RR7A 2J9DE 1L3KA 1RAOA 3US5A 4H4MB 4Q8FA 2GJIA 1JLFB 1X7VA 1KBRA 2DNQA 2OMOA 2RQMA 2MZTA 4OYPA 3SCIE 4LSZB 5K9FA 1ACMB 2ROGA 1RADB 2OLWA 3HVTB 4OX9F 2MGZA 1S59A 3MM6B 3NAHA 3NGTA 3R3TA 4I2QA 2MQNA 4DQIA 2WSEC 2LQJA 3GSDA 3PG9A 4OZ1A 5GMKa 2J9CA 3D28A 2ZZTA 4CZCA 4ES1A 4ZS6A 4C7QA 2N7CA 1DTQA 1FTRA 1G3OA 1RAIB 4ELVA 4HR2A 2QGFB 2H54B 4LJMA 2GV1A 5GAEU 4QR1A 1YTYA 1UFLA 1HQUB 3A3NB 2I38A 1M90T 1RTDB 2KFZA 3C15B 3OTOF 4K4SA 1IKYB 1UKUA 1B3TA 4L3NA 4URQU 3W1YC 4ER8A 2YNIA 4FS1A 4Y2CA 2QLJB 3H5SA 5F0WA 4ENOA 1Q7LB 4J7CA 1VQKS 1HD1A 1F60B
chains in the Genus database with same CATH topology
4ZVOB 1RHJB 2CJYB 2CDRB 2XYPB 2QLBB 3KJNB 2CNNB 4ZVPB 1PYOB 2Y1LB 1QDUB 1RWMB 2HBRB 2XZTB 4JB8B 4ZVTB 3EDRB 3EDQB 2C2KB 4DCJB 2C2MB 2HBZB 3D6MB 3GJTB 2C2ZB 2CNLB 1SC3B 5IC4B 2H51B 1RE1B 1RWKB 2H4WB 3R6GB 4ZVQB 1GFWB 1RWXB 2H48B 3P4UB 1SC1B 2QL9B 1RHRB 3R6LB 1I51B 4ZVSB 2CJXB 2HBQB 3GJSB 2H5JB 2C2OB 2QL5B 1NMEB 1RWNB 2Y0BB 5IC6B 4ZVUB 1RHMB 1I3OB 3GJRB 1F9EB 1RWOB 2QL7B 2XYGB 3RJMB 3SIPB 4ZVRB 1SC4B 2CNOB 2QLFB 2XYHB 1RWWB 3P45B 2P2CB 1ICEB 1PAUB 2DKOB 1RHUB 2H5IB 3D6FB 2XZDB 3R5JB 1RHKB 2C1EB 3IBCB 4LSZB 1IBCB 3QNWB 2FQQB 4DCPB 2H65B 1RWPB 2CNKB 2HBYB 3NS7B 5K20B 1BMQB 3GJQB 1QTNB 4DCOB 2H54B 3D6HB 3R7BB 3R7SB 1RHQB 2H4YB 3R7NB 3KJFB 3IBFB 1RWVB 2QLJB 3KJQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVO B;  1RHJ B;  2CJY B;  2CDR B;  2XYP B;  2QLB B;  3KJN B;  2CNN B;  4ZVP B;  1PYO B;  2Y1L B;  1QDU B;  1RWM B;  2HBR B;  2XZT B;  4JB8 B;  4ZVT B;  3EDR B;  3EDQ B;  2C2K B;  4DCJ B;  2C2M B;  2HBZ B;  3D6M B;  3GJT B;  2C2Z B;  2CNL B;  1SC3 B;  5IC4 B;  2H51 B;  1RE1 B;  1RWK B;  2H4W B;  3R6G B;  4ZVQ B;  1GFW B;  1RWX B;  2H48 B;  3P4U B;  1SC1 B;  2QL9 B;  1RHR B;  3R6L B;  1I51 B;  4ZVS B;  2CJX B;  2HBQ B;  3GJS B;  2H5J B;  2C2O B;  2QL5 B;  1NME B;  1RWN B;  2Y0B B;  5IC6 B;  4ZVU B;  1RHM B;  1I3O B;  3GJR B;  1F9E B;  1RWO B;  2QL7 B;  2XYG B;  3RJM B;  3SIP B;  4ZVR B;  1SC4 B;  2CNO B;  2QLF B;  2XYH B;  1RWW B;  3P45 B;  2P2C B;  1ICE B;  1PAU B;  2DKO B;  1RHU B;  2H5I B;  3D6F B;  2XZD B;  3R5J B;  1RHK B;  2C1E B;  3IBC B;  4LSZ B;  1IBC B;  3QNW B;  2FQQ B;  4DCP B;  2H65 B;  1RWP B;  2CNK B;  2HBY B;  3NS7 B;  5K20 B;  1BMQ B;  3GJQ B;  1QTN B;  4DCO B;  2H54 B;  3D6H B;  3R7B B;  3R7S B;  1RHQ B;  2H4Y B;  3R7N B;  3KJF B;  3IBF B;  1RWV B;  2QLJ B;  3KJQ B; 
#chains in the Genus database with same CATH topology
 4RWX A;  4I56 A;  1FFW B;  2A6O A;  4Q2M A;  3I82 A;  3D67 A;  2QFI A;  2X1A A;  4JV2 A;  4RW8 B;  1G6B A;  2DHA A;  1CVJ A;  3IWX A;  3M9O B;  4DR5 F;  1WTF A;  2M0G B;  3V6J A;  1RT5 A;  2KHD A;  2OML A;  3M8P B;  1K9M T;  4KTQ A;  1Q5V A;  3GIR A;  2UZA A;  3NAI A;  2CG8 A;  4MK8 A;  1U1N A;  5D4L A;  1VIO A;  2PSZ A;  3T5H A;  4Z37 A;  5L9N A;  1S4F A;  4UQT A;  4MKY A;  4P75 A;  2HFZ A;  1R0C B;  2HHW A;  1FWP A;  1S79 A;  2EKY A;  3IA0 A;  1XMO F;  2RDD A;  1R27 B;  1YLX A;  2J9D A;  1GH8 A;  5EHH A;  1Q8L A;  2IIH A;  3QWP A;  2JNJ A;  4IKA A;  4R5P A;  4G3I A;  2C2Z B;  4LVN P;  3RRH A;  2R9L A;  1YJ7 A;  1IR1 A;  1E6V B;  2AHO B;  2E1R A;  4OYI A;  3TUP A;  2ZOF A;  3UCU P;  3M8W A;  4OHW A;  1ZOT A;  2E7V A;  3CCV S;  1S99 A;  1U47 A;  3IRW P;  4CRJ A;  1Q0N A;  2PO4 A;  2E7W A;  3SQG A;  2VA3 A;  2F4F A;  1S6P B;  3CGI A;  4HH1 A;  1LK7 A;  2KZZ A;  3J7Y I;  2F3J A;  4M95 A;  2WOM A;  1KQS R;  4QOT A;  1RWX B;  4RZR A;  3PYD A;  3CJ4 A;  2MPU A;  3M8S A;  3J81 j;  2PI4 A;  3ZO7 A;  4YHH J;  2H9Z A;  3K8W A;  4HDG A;  4PG8 A;  1FJE B;  3DYA A;  4YDD B;  4B9T A;  1RYR A;  3ZZU A;  1VJW A;  5DO2 A;  1RT3 B;  4EZ6 A;  1NME B;  1IQZ A;  1F9H A;  3MGJ A;  4KGM A;  1WTB A;  5KFO A;  2LEB A;  3PIP Q;  3VVT A;  2CZV C;  4X64 F;  3EZ5 A;  3D1O A;  4FPI A;  2V2Q A;  3CCZ A;  3FMW A;  3Q8V A;  2IVF B;  1SKW A;  1B7Y B;  2AZ1 A;  2CQ3 A;  1T03 A;  1ZM2 A;  1F9E B;  3DDN A;  3ZZT A;  4RWW A;  4F4W A;  3I32 A;  1RTI B;  5ETL A;  2VQE J;  2XO6 A;  1WUU A;  2RF2 A;  3POT B;  4LF2 A;  3ZTQ A;  3PRB A;  3UFC X;  3KLF B;  1RU2 A;  5LSL A;  4X65 J;  2B9Y A;  1S9F A;  1MU2 A;  1SPB P;  4ETX A;  4M5D B;  4NXM J;  1H7X A;  1FX2 A;  2M4M A;  4CLL A;  3BZQ A;  3I96 A;  4DPW A;  2VFT A;  2IFX A;  3ENV A;  3GSI A;  1ZPW X;  2UUA F;  4MFB B;  1SV5 A;  1FNO A;  5HRO B;  3OLB A;  1NM2 A;  4N8N A;  3R5G A;  2FDN A;  4LT6 A;  2QO3 A;  2VOO A;  4QWD A;  4A8O A;  2VOD A;  1QY7 A;  2R8I A;  4CLF A;  1TK5 A;  3PW7 A;  2V69 A;  1HR0 F;  4F0K A;  1FDD A;  5THW A;  3WIV A;  1DHM A;  3NNH A;  1A7G E;  2HIY A;  2OUG A;  5KG1 A;  2D3O R;  1RJJ A;  1YG0 A;  3I9Z A;  4KFB B;  3JYT A;  4WE1 A;  3G8T A;  4B9S A;  2IA0 A;  2Q43 A;  1R8H A;  5KOX A;  2BE7 D;  2KM8 B;  2B4U A;  3GYG A;  1TKT B;  2MDA A;  1DAR A;  4DLE A;  3NWG A;  3KXD A;  4J90 A;  4PUO A;  2QMW A;  1LW0 A;  1KVI A;  3J7A 1;  3O6Q A;  3CIM A;  5HVF A;  1CPZ A;  4NAS A;  2M8D B;  2C3P A;  2NYI A;  2QN6 B;  1LWE A;  3I4H X;  4DPY A;  1J2V A;  1T7P A;  5GAH U;  3MFI A;  1QUV A;  1DUR A;  2ABY A;  3CB4 A;  4YHH F;  3EYZ A;  3KOA A;  1N34 J;  4P74 A;  4OFZ A;  2PGC A;  4H4O A;  3CTR A;  3A12 A;  2MZ1 A;  2OPS A;  2R8H A;  3IAS 9;  1WHY A;  3V5R A;  4DBQ A;  3OVB A;  5KFK A;  4DR5 J;  3IR7 B;  2WAQ D;  1L3V A;  3HJF A;  1RAG B;  3H5U A;  4LIW A;  1SH2 A;  4GVB A;  5J1E B;  2BRK A;  3OR2 A;  2ZH3 A;  4CO4 A;  1TL7 B;  4HEA 9;  3NNA A;  2CDR B;  2EXU A;  2HZC A;  2OPQ B;  3C16 A;  3JS9 A;  4HHU A;  3QZ7 A;  2IBK A;  1MWY A;  3DI6 B;  4KRW A;  4LSL A;  4NCG B;  5ETV A;  4A8Y A;  3Q2T C;  1RT6 A;  2IYG A;  2YNF A;  2VL1 A;  5DG7 A;  3LP1 B;  3M30 B;  5B0B A;  4F3O A;  3P8B B;  4PUO B;  2AJ2 A;  3B6B A;  4R8U B;  4EU0 A;  4Y3C A;  3T19 A;  4X62 F;  3MFH A;  3CWJ A;  3D3B J;  4JB8 B;  1SJF A;  2BJ8 A;  4Y34 A;  1B4S A;  4FYD A;  3PHE A;  2HBZ B;  2CVI A;  3PRV A;  3Q2S C;  3QT7 A;  1BQN A;  5HVH A;  2E66 A;  2HNY B;  4YEA A;  3KLF A;  3K5P A;  3I0R A;  4NOH A;  4AL6 A;  3IP0 A;  3NRB A;  4NYO A;  4TU7 A;  2J9E A;  4DV6 J;  3ZFV A;  3GYX B;  5IT0 A;  2ZH4 A;  1YI2 S;  1JLC A;  1D9D A;  4QWA A;  7AT1 B;  2MZR A;  2OPS B;  4XK8 C;  3WBZ A;  2G0I A;  4EBE A;  1R8P A;  4B3M F;  4LQ9 A;  3W2W A;  4BBY A;  5F9N A;  4I68 A;  3L9Z A;  4RW4 A;  5AXL A;  4IH6 A;  2CXE A;  3BN4 A;  1FXR A;  3CJ5 A;  2DY9 A;  2AV5 A;  5DG8 A;  3H2L A;  3MPY A;  5HK4 A;  3PYE A;  1S6Q B;  3TX0 A;  4ZN1 A;  2UU9 F;  5A8K B;  3BDP A;  5M2P A;  2OFH X;  3CMQ A;  5KFI A;  2FIU A;  2J8A A;  2IM2 A;  4M5L A;  5GAD U;  2WSF C;  4ATN A;  2V4Q A;  1S1X A;  1SBR A;  2RUG A;  2YX1 A;  4MJK A;  4FF3 A;  1Y10 A;  2BAB A;  3KLH B;  3FSI A;  3KJQ B;  4U96 A;  4DL7 A;  4X65 F;  3CE8 A;  4ZCI A;  2CPJ A;  2VC0 A;  2VG7 B;  4WFX A;  3UNG C;  4URG A;  2MZS A;  4DQP A;  2HFU A;  3KMQ A;  1CUL A;  1TVR A;  4CH7 A;  4OJ3 A;  1CEZ A;  3G6Y A;  1BLU A;  2FUG 9;  4XTT A;  4C3K A;  3KK1 B;  3CCM S;  2UUA J;  1UZH A;  4FPR A;  4OHZ A;  4DQR A;  3MMB B;  1RKJ A;  5HBM A;  1SC4 B;  2IA6 A;  4IOA Q;  1VQS A;  4O44 B;  3SSQ A;  2LEC A;  2J7K A;  3JSM A;  3G6E S;  2XYH B;  1WSR A;  3P6Y C;  2G4B A;  1YVF A;  2EEY A;  3IBW A;  2FZC B;  2DD8 S;  3EGN A;  3MM6 A;  1XK8 A;  4R5P B;  1NH7 A;  1UW9 A;  4ZCM A;  5HP1 A;  3JTO A;  4LVO P;  4QQB A;  2FLL A;  5BXI A;  1E6V A;  1Q95 G;  1RKI A;  4O0N A;  3RBX A;  1UVJ A;  1CS4 B;  1NKE A;  5EN1 A;  3JXO A;  4WYW A;  3AD8 C;  2G2Z A;  2V34 A;  2LEP A;  4PG7 A;  3DOK A;  4PXC A;  4NLU A;  2E5L F;  1S76 D;  3PKY A;  2CJQ A;  3LP2 A;  3BKT A;  2DHH A;  2FD2 A;  2GO9 A;  3D7S B;  3OHA A;  1Z2L A;  4FYV B;  4OV1 A;  4GC6 A;  1NDP A;  2CQ1 A;  3RB6 A;  2I1R A;  2V2Z A;  1NSK L;  4DCP B;  3DLK A;  1OQ3 A;  2PE8 A;  4ZIV A;  4EWT A;  4F0H A;  1DLO B;  3KHH A;  1WI8 A;  5H1S V;  3H4D A;  1VYA A;  2HW3 A;  2AYM A;  1AFI A;  3CCT A;  1ZTT A;  3RYL A;  4ECV A;  3RB4 A;  3TUZ C;  4R25 A;  2C22 A;  4L3K A;  3RW6 A;  2AX1 A;  4TXS A;  2DBB A;  4G1I A;  1ZTW A;  1M0S A;  3FSY A;  2HG4 A;  3BS9 A;  3R7B B;  5K8M A;  4A4J A;  3BBF A;  1RGV A;  2JLG A;  1REV A;  4HT5 A;  2AYB A;  4KH0 B;  1EB0 A;  4X4Q A;  2OD4 A;  3MWB A;  1QVF R;  4FYW B;  1NB7 A;  1FK9 B;  3ZNU A;  2VPX B;  3LA0 A;  5J2Q B;  6AT1 B;  1S1T A;  2XCP A;  3EWG A;  1KWM A;  4UW2 A;  4DQQ A;  3MCM A;  1IWA A;  4WPA A;  3QZ8 A;  2ROP A;  1FVQ A;  4ZLL A;  2HQI A;  1CJV A;  3SCJ E;  2WB4 A;  2ZH9 A;  1HMV B;  2L48 A;  2HHU A;  3C15 A;  2QC3 A;  1UWA A;  1U0H A;  2QLX A;  4YP3 A;  3LPE A;  5CZX A;  3JAM U;  1JXV A;  4P73 A;  4YDX A;  1NPP A;  1O5J A;  2ALY B;  3GCX P;  3F0N A;  4ZVT B;  5C2C A;  3VAM A;  1IKV A;  1N48 A;  4C8L A;  3FEY B;  4DCJ B;  2HWI A;  2DR8 A;  2F9J A;  3NS6 A;  5EX3 A;  1VFJ A;  5KG6 A;  1UVI A;  2JVO A;  1RT3 A;  2P8I A;  3FBE A;  4OI3 A;  3ZTS A;  1S77 D;  4B3M J;  5MAO A;  2AYG A;  4UQG A;  1NJX A;  3OVS A;  2IDL A;  2XMJ A;  1X60 A;  4B08 A;  3HHL A;  2DXD A;  4FYY B;  2W01 A;  2E9T A;  1U45 A;  3BBC A;  3KJV A;  1Y11 A;  4M5K A;  1FRL A;  1MRO B;  5E41 A;  3KK2 A;  2FJB B;  3M2V A;  1URN A;  2DT9 A;  2QYC A;  2G9O A;  3KNG A;  4WFY A;  5AXM A;  3SYZ A;  3KLE A;  1GFW B;  1Q1K A;  1VQ6 S;  2MEW A;  2B5J A;  1TK0 A;  2GIR A;  3CC4 S;  1Y0H A;  5FD1 A;  3PX4 A;  2IY5 B;  3GTY X;  2BJD A;  1HNZ F;  1WOO A;  3NOG A;  1VMB A;  4CT9 A;  4DR6 J;  2BW2 A;  4MFB A;  2YKM B;  5B0G A;  3X3U A;  4CLT A;  4ETZ A;  3CXC R;  1U48 A;  1N6Q B;  1M1K T;  2ZE2 A;  2XHC A;  4Y2A A;  1XNQ J;  3FFI B;  1AZS A;  2UUC J;  1H74 A;  5ETM A;  1S5Z A;  5E0O A;  4A8W A;  4RUB A;  5KFS A;  2L3M A;  2BBE A;  1TL7 A;  2ZH1 A;  2E9R X;  1BWE A;  1MML A;  2VKR A;  1T0T V;  3AFG A;  1YRT A;  1J5O B;  3RAX A;  2HND B;  8AT1 B;  4I6Y A;  2FY8 A;  5KG7 A;  5JMN A;  1TV6 A;  4WZM A;  2W2P P;  4RNM A;  3DHW C;  3HD1 A;  3KNA A;  2AMC B;  2CQC A;  2U2F A;  3V81 A;  3S6E A;  1HNX F;  3B4M A;  1TKT A;  3TAN A;  1C0T A;  1LW0 B;  3T6B A;  3CC2 S;  2ZKT A;  3OR1 B;  4NI2 A;  2B8Q A;  1D0E A;  5L1I A;  4IRD A;  5BYS A;  2E9Z A;  3GCW P;  5F8H A;  2IVM A;  4JI1 J;  1FCA A;  3AOC A;  1K73 T;  2MSS A;  2IPO B;  2E5L J;  4LF4 J;  3OFG A;  1RT4 A;  2RAQ A;  3TR5 A;  3UW1 A;  3W61 A;  3BB5 A;  3MUV P;  2XUL A;  3VF0 B;  3HM9 A;  4C2M A;  1SKS A;  1N6Q A;  4DSF A;  2XZD B;  2RQK A;  5A8W A;  4Y2I A;  1LWE B;  2N3O A;  5D6G A;  3V6K A;  2J0S D;  1RHK B;  2BJE A;  3MAA B;  3PO4 A;  2VB6 A;  3TEH B;  2BJ3 A;  2V8V A;  4TKT A;  1QE1 A;  4J9N A;  4JV1 A;  3PX6 A;  5DQH A;  3I56 S;  1B7F A;  3AOB A;  3HKW A;  1WOS A;  5J1E A;  4NA3 A;  2CQI A;  1LXJ A;  3PFE A;  2O3D A;  4KH1 B;  3B8H A;  2DXE A;  4DV7 F;  4HHJ A;  1YJW S;  4X66 F;  2A0F B;  4NZ7 A;  4WK1 A;  2W7P A;  3KDO A;  2CNK B;  1GMV A;  3BBB A;  1VHI A;  4QIG A;  3W8G A;  5IS2 A;  3K57 A;  3JB9 k;  4OZN A;  3O8W A;  1Q4R A;  2IM1 A;  4IOB A;  2W9B A;  4E0D A;  5ETR A;  5GMD A;  2RRN A;  1S9E B;  1HBN B;  2LVW A;  3A8I A;  3ILJ A;  3R97 A;  4DHV A;  4DJB A;  1WSV A;  2XWX A;  1S57 A;  2CQ4 A;  5C24 A;  3TJ8 A;  3W2V A;  5JVG Q;  5KFH A;  3DXB A;  4HTJ A;  1X5P A;  4B3R J;  3CCS S;  2O67 A;  2R8G A;  1FRM A;  2ZH8 A;  2YWF A;  4ZP9 A;  4K4U A;  3P5T L;  3VAI A;  5CYJ A;  3C14 A;  1J5E F;  3QO9 A;  1KDN A;  2KL8 A;  2VIH A;  3OL7 A;  2EFV A;  4ZVO B;  1BY9 A;  2KT5 A;  1RHJ B;  2KKH A;  2OH2 A;  2UUC F;  3L4B C;  4EBD A;  2IM3 A;  4V19 X;  1D09 B;  4YQW A;  3HSZ A;  2RQC A;  1FJG F;  1FD2 A;  2BE2 B;  1Y3J A;  2DR6 A;  4JI3 J;  2ZH6 A;  1PGZ A;  3DMJ B;  1FRH A;  1YWX A;  3H90 A;  3MR2 A;  1PO6 A;  3IRX A;  1B0T A;  4I2P B;  2HEK A;  5HN0 A;  1N56 A;  5I3Q A;  2HGL A;  4OX8 A;  4RU9 A;  3DOL A;  4DV4 J;  1CS4 A;  2EC2 A;  4OYA A;  5HJX A;  3FK4 A;  4DV0 F;  1ZH5 A;  1CJT A;  1ZM9 A;  3VQT A;  3TA1 A;  3LAN A;  5EGY A;  2QEX S;  1VQN S;  1VQ4 S;  4IH7 A;  3DU6 A;  4CLP A;  1FWL A;  1MMN A;  1T9X A;  5KG2 A;  1XMO J;  1IVZ A;  2ACM A;  1FFS B;  4NLQ A;  4PYD A;  3VCD A;  5I3U A;  1S0M A;  1SJ4 P;  4ANE A;  4ANC A;  5DQG A;  3FEZ A;  3Q8R B;  2HSE B;  2GS8 A;  2XO7 A;  2HMI B;  3QAU A;  5D0G A;  3JAM Y;  2HAF A;  4PQA A;  1VK8 A;  1NB2 A;  2EWH A;  4Q43 A;  4ECT A;  1UVL A;  3A1Y G;  4E8U A;  1YKW A;  2K8G A;  3PO5 A;  1HYS B;  2E1P A;  2QX0 A;  4HAC B;  1TVR B;  2YQ3 A;  1IBK F;  3CW2 C;  4RW8 A;  2MKK A;  3DLH A;  2FYX A;  4K4V A;  5KFB A;  5L39 A;  2C3O A;  3KK1 A;  2NS1 B;  3R5B A;  1MN7 A;  2MY7 A;  2XBP A;  3OJS A;  3UCZ P;  3MM7 B;  1N36 F;  1NLK L;  1NPK A;  2NPI A;  2X51 A;  1O8B A;  4RW9 A;  4WP3 A;  1VGY A;  2YWH A;  4O44 A;  1QAX A;  3HVA A;  4UF4 A;  3RG6 A;  4EK2 A;  2WBM A;  2VBW A;  2HHX A;  1AFJ A;  4TYB A;  4J5O A;  1A0O B;  2JRS A;  2Z2Y B;  1HLW A;  3GJR B;  2ZIT A;  4DX6 A;  5G0R B;  3SBM A;  1N88 A;  2OSR A;  4JYA J;  5IT9 U;  1RAB B;  1KHW A;  2B4O A;  2QYG A;  5DDQ C;  1NK9 A;  2GAG C;  1KVK A;  2D1C A;  3GFX A;  3JTN A;  3LP2 B;  1CQM A;  3CD5 A;  1FDA A;  4J9M A;  2VQE F;  1H6K X;  2AD9 A;  1O51 A;  4PXE A;  3CCL S;  2N3L A;  3DDK A;  3FZB A;  2DB1 A;  3H2V E;  4CLY A;  4XPC A;  4LF4 F;  3D0H E;  3KMS A;  3J7Z 5;  4ED0 A;  3EPI A;  4QR2 A;  2FJX A;  4KKO B;  4NCA A;  4MIW A;  4B3O A;  2HWT A;  3QAE A;  5DLG A;  2Z2M A;  4AT1 B;  2KI2 A;  2MHN A;  4DUY J;  4A8K A;  2DGW A;  3CCW A;  2RKI A;  3EGV A;  1VHF A;  2DK2 A;  2K3I A;  3G96 A;  2G0J A;  2CA9 A;  3ZTP A;  1CJK A;  2LXU A;  2WW4 A;  3G8S A;  4DV0 J;  2YKO A;  4I2Q B;  2HQ3 A;  1LWC A;  1Q78 A;  2LKZ A;  5HAT A;  1IR2 A;  4CDI A;  2C2E A;  3WC2 A;  4YOE A;  2X7I A;  5I4M A;  1Q86 T;  2B43 A;  3GR0 A;  3M8Z A;  2LQ9 A;  1Y9O A;  3OTD A;  3AY0 A;  1HR0 J;  2IVY A;  4F2S A;  4JI6 J;  1X8D A;  1DTT A;  1HBM B;  5D77 A;  1F5C A;  5FJ4 A;  2V6A A;  1NND A;  5F3T A;  4EUV A;  5GAG I;  1VQL S;  2HBY B;  4DG1 B;  4N8O A;  4A8S A;  3VTI A;  2YNH A;  4ZVG A;  3I55 S;  3GIL A;  2MZJ A;  2VG5 B;  3H59 A;  3LP0 A;  4DI6 A;  4A8M P;  3PHT A;  4MIA A;  4UST A;  1RT2 A;  2P5V A;  5D4O A;  4RJV A;  3VAJ A;  1KFS A;  1QUP A;  1FKP B;  2C2R A;  1U6B A;  5F8N A;  1KTQ A;  4DZ6 A;  1HL6 A;  3BR8 A;  3KJF B;  5EWG A;  2XS5 A;  3W3S A;  3CNQ P;  3SEO A;  3ZTO A;  3DLB A;  3DLG B;  3AT1 B;  4LSN A;  2IDE A;  4ZPA A;  4A8X A;  1R7I A;  1WHW A;  3PR4 A;  5AE3 A;  1HPZ B;  4JI3 F;  1C0U B;  2ZD1 B;  1N34 F;  3EZU A;  4P6Q A;  4ZK7 M;  5T7L B;  3PM9 A;  1H0H B;  3OTC A;  5F41 A;  4QJV A;  3NCR A;  2CNN B;  3KG0 A;  4YB1 P;  4QWE A;  2RIJ A;  1UFW A;  5IT4 A;  2CWX A;  2FVS A;  1FES A;  1N54 B;  5K8O A;  1HBM A;  5KFP A;  3MM5 A;  1KHV A;  2O66 A;  3SDE A;  3KK2 B;  2MKH A;  2YNH B;  3KTQ A;  1TMM A;  3UWT A;  4KT0 C;  5A8W B;  2B9X A;  3OL6 A;  3N5F A;  3GIJ A;  4NLX A;  4BDP A;  2R7W A;  1VR6 A;  4X4U A;  3BEG B;  2DIT A;  1WJ9 A;  1SUQ A;  3CCJ S;  1IJF B;  1OWX A;  3GFZ A;  3MDF A;  4KHR A;  3LGM A;  1WEL A;  4ZHR A;  3MR3 A;  4OJG A;  1HBU A;  3LF0 A;  4MK9 A;  3VR1 A;  4J9P A;  1RSC A;  2D9O A;  1R3N A;  3ZNJ 1;  3SI8 A;  3GP9 A;  1JNZ B;  4ZVE A;  3BYR A;  4U8V A;  5L1L A;  1PKU A;  2IMO A;  1CC7 A;  3RW7 A;  4DV6 F;  5CHC B;  3D3C J;  2Q66 A;  3J81 U;  1WC6 A;  2HND A;  2YNG A;  1S7H A;  3R6G B;  5EWE A;  2KFN A;  1NDK A;  1S6Q A;  2VDI A;  3G4S S;  1IUJ A;  1ZAX A;  2RKI B;  3IAM 9;  2H48 B;  5EDW A;  4RUA A;  5LSO A;  2JX2 A;  2H1Y A;  3NP5 A;  3J7Z T;  1UA0 A;  1VRU B;  2JEI A;  1I51 B;  2N4C A;  2KZM A;  5A6P A;  4WTY A;  1RWN B;  2HFO A;  2ZC3 A;  1N5Y A;  5L1K A;  3D0G E;  2YX7 A;  4X4N A;  2DR9 A;  3PYG A;  2AJ0 A;  3Q8U A;  9RUB A;  3KDN A;  4DPX A;  4HHH A;  4N41 A;  2ZHB A;  1L5U A;  3TA0 A;  4QWB A;  3I5A A;  2HHS A;  2KDO A;  4OMF G;  4F26 A;  4ZLP A;  1T05 B;  3OTO J;  3RBE A;  2KTQ A;  5HLF B;  4LF1 A;  1MWQ A;  2W2Q P;  2NZC A;  1G4C A;  2WCX A;  3PW2 A;  5HBM B;  5LOQ A;  2UXD J;  1IN0 A;  1NXI A;  2XYG B;  2WRM A;  4PPZ A;  1RA6 A;  4EEY A;  2PFF B;  1G7C B;  3M2R A;  1H3D A;  1QAY A;  1FTC A;  1ZM4 A;  2IRX A;  4EO6 A;  2QA4 S;  2RHS B;  1JLG A;  4DUY F;  3RRG A;  1VBY A;  1Z1Z A;  1VQ8 S;  2HZV A;  3LQV A;  1JX4 A;  4TU9 A;  1O0P A;  2VF3 A;  5H9F J;  1M1G A;  4ECQ A;  1ZAW A;  1OSD A;  1F2H A;  4OZ2 A;  5B0E A;  1WNE A;  1HI0 P;  2VON A;  2MQM A;  3DOK B;  1U1O A;  3UR0 A;  4ZPW R;  3W2V B;  5C24 B;  2ACY A;  5HMX A;  3TZZ A;  4DQS A;  2V9K A;  4ED2 A;  4OYW A;  1Y5L B;  2EPI A;  4WBF A;  3HXM A;  2V8P A;  1YDL A;  2JL9 A;  3OSP A;  1VRT A;  2OFG X;  4IG3 A;  2XCA A;  1R6Y A;  3RUB L;  2EFP A;  4RL1 A;  2N82 B;  5B09 A;  3RZA A;  2C3Y A;  4CYU A;  3EMT A;  4ES3 A;  1KS2 A;  2Z57 B;  4H54 A;  4IFY B;  2HLU A;  2RUS A;  3MM8 B;  2XC9 A;  1BMQ B;  3AD7 C;  3ENQ A;  1DQ8 A;  3HFK A;  3DXS X;  5E3C A;  3OSN A;  2R7T A;  1V3S A;  4KV8 B;  1GMW A;  4I2P A;  1XIQ A;  2DGT A;  4ZLJ A;  2R2R A;  2ASD A;  1U8S A;  3C8Y A;  1DQA A;  2V67 A;  1XEZ A;  2BM1 A;  5BYR A;  2DIU A;  5U47 A;  3MPV A;  2P9C A;  3P3D A;  2XMU A;  3TOQ A;  3KG1 A;  4E98 A;  2J6S A;  3IN5 A;  2VIC A;  2BM0 A;  1F5B A;  1GAO A;  1WC0 A;  4X2B A;  2EFQ A;  4O4G B;  2LQ8 A;  3LPY A;  4PYA A;  2RT3 A;  5IOL A;  2QSF A;  2W9B B;  1IKW A;  4FP9 A;  1GTH A;  1NHV A;  2FHJ A;  4W4M A;  4MIB A;  5HVG A;  4U7C A;  1N5Y B;  4OZ0 A;  3NBP B;  3L95 X;  3I6P A;  1XN9 A;  2VC1 A;  4DSK A;  3CUL A;  5DJB A;  2O1P A;  2OPR A;  2JEJ A;  1H2T Z;  3HZE A;  4NLV A;  1M5V C;  2B9E A;  3W65 A;  5IM0 B;  3QO9 B;  2ASY A;  4TQR A;  4HAC A;  2UUB F;  4DWI A;  4H4M A;  2HQD A;  1APS A;  2P6S A;  2FJD B;  1NDC A;  3GV5 B;  1K0V A;  3Q24 A;  3IWL A;  3QGP A;  1NRK A;  2WON B;  1TL5 A;  2R8J A;  5GME A;  5LT5 A;  4LR8 A;  2AEM A;  2LU2 A;  5LMU J;  2I5J A;  3EPG A;  1SJQ A;  2WW8 A;  4IDK A;  1EQM A;  3MHY A;  1P1L A;  3VQS A;  1NK7 A;  1REV B;  5C42 A;  1B99 A;  1AB8 A;  2P9E A;  3KLE B;  3DLL Q;  3AXM A;  3C66 A;  3DOL B;  3UDL A;  4CO2 A;  1HQU A;  3M8Q B;  5JVH Q;  4ZVQ B;  1RTD A;  3GYN A;  2F8E X;  3DM2 B;  1V9O A;  4DN9 A;  3AOD A;  2HK2 A;  1XBW A;  3EM1 A;  4DMZ A;  4OZ3 A;  2OTJ S;  1U2C A;  4ZVS B;  4U9R A;  3SV4 A;  2OEK A;  1WC5 A;  2Y0B B;  3SSS A;  4KHP J;  5KG4 A;  2KG0 A;  4LMZ A;  4M5H A;  3PZP A;  2QMX A;  2ZBP A;  3G9C A;  2MHE A;  2BKO A;  1TK8 A;  4ED7 A;  5DGB A;  3C6T B;  1I1G A;  1P27 B;  3GR1 A;  2MKI A;  5T7L A;  2R7U A;  4O3R A;  1FRK A;  2ZJR Q;  3DGV A;  4ED3 A;  3TJ9 A;  5CQG A;  4CM2 A;  2A6M A;  1RUS A;  2D7S A;  4ZIT A;  2RIL A;  4ED1 A;  3OTB A;  1EKR A;  4DR3 J;  2F5G A;  5HSP A;  3CCE S;  1Z2Z A;  3U1N A;  4NMX A;  5DS7 A;  3SDE B;  3Q8Q B;  3I5B A;  3QWU A;  2RQ4 A;  5SUH A;  1Y00 A;  4DV5 J;  1KVJ A;  1T9U A;  4C8O A;  1PBU A;  4ZMM A;  2V8G A;  3RU0 A;  3P96 A;  4LRD A;  4OYM A;  4IG0 B;  2D9P A;  4RX6 A;  1Q8K A;  1VQ7 S;  4JI7 F;  2KH9 A;  4ECR A;  1XMB A;  3IO1 A;  2JLF A;  3MCO A;  2UUB J;  2AJ1 A;  1CLF A;  3MAA A;  1S0N A;  1FKP A;  4IRC A;  2EFN A;  3BSC A;  3FC9 A;  4Y2M A;  1S72 S;  4F25 A;  2Y8W A;  2IHR 1;  1HWI A;  1JJC B;  3HP6 A;  3LW5 C;  3Q86 A;  4ERD A;  2A18 A;  4I7F A;  1N0U A;  2AP6 A;  3TAP A;  4HDH A;  4LFC F;  3NMR A;  4FXD A;  1K47 A;  3K2Y A;  4AE5 A;  1Q53 A;  3N4W A;  1UWB B;  2HFN A;  2ZD1 A;  2MKJ A;  2PN6 A;  1Y7P A;  2XNQ A;  3QGG A;  4HL9 A;  2L9W A;  3CDU A;  3MPD A;  1B70 B;  3FMB A;  3HD2 A;  4DV7 J;  2AF6 A;  3MM9 A;  4WK3 A;  2VA2 A;  5A0Y A;  2H5E A;  3MM5 B;  1VCT A;  4TLQ A;  2BW7 A;  3IR6 B;  3JTP A;  2GHP A;  4C8N A;  3DLE B;  3HX9 A;  2HVE A;  1HWK A;  1KTV A;  2HZA A;  1UZD A;  4OZL A;  3R7S B;  2W8L A;  3OTE A;  2Z0G A;  3IBF B;  3R27 A;  2NLW A;  4ZP7 A;  4C98 A;  2MXY A;  3OLA A;  2DRB A;  2CPE A;  3D0I E;  3G71 S;  2CAJ A;  4KHP F;  1DTT B;  2RS8 A;  2POK A;  5KFQ A;  1ZPV A;  1XNR F;  3OL9 A;  1R43 A;  4NLO A;  2DO4 A;  4FVM A;  1P9Q C;  2E1A A;  1M5P C;  2J7W A;  1TL3 A;  1F1B B;  4CI0 B;  4U6P A;  1PYS B;  1J5E J;  1S1U A;  3PNI A;  4PWW A;  1NU4 A;  1VRQ C;  2NZ4 A;  5KAK A;  2GMH A;  4P2M A;  2AGQ A;  4DEZ A;  2OP5 A;  1LK5 A;  1RT7 A;  1X4G A;  2ATC B;  1LFW A;  2V2V A;  3E51 A;  1N5S A;  2XZT B;  1X4B A;  4OJ1 A;  1QAI A;  2AJQ A;  5B0F A;  2FJE B;  1FRJ A;  1F5A A;  2J0W A;  4XAK A;  2BR0 A;  4LFB F;  1TEL A;  2BAN A;  4PPD A;  3M05 A;  2AGP A;  3ILO A;  1W7W A;  3KJV B;  1CJU B;  1EKS A;  2YKN B;  2NSB A;  4F8R A;  4NXN F;  2B3T B;  3GWC A;  4ALZ A;  3M6W A;  2HMI A;  1KOO A;  3EX7 B;  3TAQ A;  5H9F K;  1KON A;  2H51 B;  2K7J A;  2ZWO A;  3BSO A;  3HFV A;  4CYU B;  3MCN A;  1BHN A;  1NDL A;  2GGP A;  1DBD A;  3CJ8 A;  1TUG B;  1ULR A;  4EYH B;  4C8K A;  4QU7 A;  3GE9 A;  3S01 A;  3FJ2 A;  1AZS B;  5AE2 A;  1W26 A;  2QL9 B;  1IKX A;  1UVN A;  4I1T A;  5LL6 d;  4RR5 A;  1X0P A;  3QID A;  2EBG A;  2Q3P A;  3AXK A;  3MPU B;  4RNN A;  2YQ0 A;  1WDT A;  4AFF A;  4WCE Q;  5LXY A;  3RBZ A;  4CH1 A;  4ED4 A;  4DFM A;  1LFP A;  1NH8 A;  3KHL A;  3QT8 A;  4WYL A;  4XDD A;  1IKV B;  3GQC A;  4DR2 F;  1AUD A;  1KSP A;  4AD6 A;  2L08 A;  1RWU A;  4O4G A;  1RT1 A;  1A9N B;  4IH5 A;  2EFG A;  4Y6I A;  5ETP A;  4BCA A;  4DZD A;  1SVD A;  4J9Q A;  4X4S A;  3MED A;  3N6N A;  4WKY A;  4NRT A;  2VQF J;  1FI4 A;  2AWZ A;  4NML A;  1VIS A;  4USV A;  4OHV A;  2OPP B;  1DJ0 A;  1PYT A;  3RJM B;  4ZVR B;  4ZVF A;  1SIZ A;  2OPR B;  4OLP A;  3CDA A;  4EGL A;  3BO3 A;  3MAQ A;  4WF9 Q;  3MEE B;  2HPU A;  1OS5 A;  4JI7 J;  3K5L A;  2QLF B;  1TKZ A;  4P2S A;  1KLM B;  2QLW A;  3MD1 A;  2DNO A;  3P45 B;  5KFZ A;  2HS3 A;  2QMU B;  3MM8 A;  3FDS A;  2B6A B;  1I94 J;  4CO0 A;  4C97 A;  3VVU A;  1DY3 A;  3CUN A;  2A2D A;  1QE1 B;  4OI2 A;  5DDP C;  1BC6 A;  5DET A;  3HF5 A;  4X84 A;  4KR0 B;  1FFG B;  2W4D A;  3WDO A;  4J9R A;  1F9F A;  4C3M A;  5B0C A;  4O0I A;  4YR0 A;  1U24 A;  3BPD A;  4LFC J;  2UXC J;  3M2R B;  2F7V A;  4NX9 A;  3NGU A;  2GQC A;  3I87 A;  3WQP A;  5AXN A;  3AJD A;  4N47 A;  4DV1 F;  3TQ1 A;  3RB3 A;  3G87 A;  1NKB A;  1NHK L;  3VAL A;  3IXQ A;  2XQC A;  4A8Q A;  3LUY A;  1XR5 A;  3PJX A;  3MEG A;  5B7W A;  1FWK A;  1HW8 A;  5A2Q Y;  2V4R A;  1CQN A;  2OAU A;  4USM A;  3PY8 A;  3EIC A;  1RT6 B;  3MZI A;  2ZH7 A;  3FBF A;  3C3L A;  1F2G A;  5KTQ A;  2YX4 A;  1RBO B;  2Z2Z A;  4JP8 A;  1OPZ A;  3FZ2 A;  5DQI A;  3ISZ A;  2FTR A;  2OO4 A;  3TZY A;  1TUV A;  3OR1 A;  1A6L A;  4CO3 A;  2HQF A;  1QLN A;  2PT0 A;  4RO0 A;  1JK9 B;  3KLH A;  2XY7 A;  1PC4 A;  2JFD A;  1M1H A;  1TKX B;  1LWF B;  5D78 A;  4ICL B;  4RW6 B;  4DPO A;  1XNQ F;  2HQG A;  3ITH A;  2IJR A;  2OHD A;  3JSB A;  5HO4 A;  2E5I A;  1QTM A;  1RA7 A;  3FBC A;  3FCH A;  3HLU A;  4M63 A;  5IQ6 A;  4DR2 J;  1QSS A;  2IMW P;  1JWW A;  2FVP A;  1X9W A;  2W7A A;  3A4T A;  3B82 A;  3KJN B;  3M1V B;  4RBV A;  4MYU A;  4AUK A;  2OKQ A;  4UOG A;  1YRU A;  8ATC B;  5E5N A;  4DX8 H;  4F02 A;  3NMA A;  2Y1J A;  1HAR A;  4L73 A;  3T41 A;  5CA5 A;  1VS3 A;  3R8Y A;  2Y1L B;  4HYK A;  3W66 A;  1CG2 A;  4USH A;  2PA3 A;  5FII A;  4LFB J;  2BJ9 A;  2KG1 A;  2XMV A;  3VGV A;  3IS9 B;  2KRR A;  3RAM A;  3CCR S;  5KG0 A;  1IBM F;  3BO2 A;  5CD4 A;  2HVI A;  3PEJ A;  4ZHR B;  2GML A;  4WP9 A;  3CCU S;  4NYZ A;  4U7U K;  2KU7 A;  1YBU A;  3QLH A;  3R1H A;  4JI1 F;  4FDF A;  1AA1 B;  1T95 A;  2IAJ A;  2DEJ A;  2FHJ D;  2P9G A;  4I7F B;  5A2Q U;  1EET A;  2KB2 A;  1WC1 A;  1X5S A;  4IYQ A;  2NUU G;  3C6T A;  2NSC A;  4J9U E;  4P7V A;  1PIL A;  4RBT A;  5D15 A;  3HK2 A;  1HYS A;  1VBK A;  4URS A;  1WF1 A;  4AL7 A;  3CJR A;  2FB0 A;  2Q6C A;  2L9N A;  2K7K A;  4TLR A;  1HPZ A;  1NJZ A;  1SL0 A;  2OJ3 A;  1YJN S;  4A47 A;  4WE1 B;  4O3Q A;  2UVV A;  3TP2 A;  1P6T A;  2D3O 1;  2F63 A;  3R6L B;  5I42 B;  2ASJ A;  2HHH J;  3UN2 A;  5D8H B;  3WIU A;  5F8G A;  3ET6 A;  1WG4 A;  2D69 A;  4USI A;  4EFA C;  1FT8 A;  2V94 A;  2VJU A;  2KO1 A;  2QFJ A;  3HO1 A;  4IO1 A;  1PC5 A;  2JJ4 D;  2XTJ P;  3LAM A;  2WVB A;  3MCS A;  5J2Q A;  3UN5 A;  1LW2 A;  2CPI A;  3T9Z A;  1EHW A;  3LOU A;  1YGY A;  4GO7 X;  4IG0 A;  3CIZ A;  3M9M B;  2VQF F;  3PV8 A;  2HIQ A;  1VC5 A;  4B9U A;  4NLW A;  3DM2 A;  2HVH A;  1Y5N B;  4JBC A;  2HNZ B;  4G65 A;  2ZOG A;  3LGH A;  2B0G A;  3A8E A;  4KGK A;  4F4A A;  1IBL J;  4M5D A;  1FJ7 A;  1HMV A;  1R8C A;  4C0B A;  2CQB A;  2GVZ A;  2OI2 A;  3BH7 B;  4XPE A;  2ZM6 F;  1HBU B;  3M2U A;  3PW5 A;  3HSD A;  2OIH A;  1N8R T;  3Q8S B;  1WC4 A;  2QA1 A;  2CNO B;  5ETK A;  4LR7 A;  2MLX A;  1OY9 A;  3OR2 B;  3OXL A;  2ZJQ Q;  4QYZ J;  1DLO A;  4DS4 A;  1IXK A;  1PJ7 A;  4BC9 A;  2DGX A;  2V4J A;  3HHK A;  2Q1L A;  4LSL B;  4M5N A;  2BOA A;  4ZJO A;  3QSI A;  1GEH A;  5HQM A;  4Q8E A;  2JOQ A;  1RTJ B;  1DZ5 A;  2UXC F;  4OX6 A;  5IT9 Y;  4OV6 A;  2MKY A;  2MZQ A;  4DV1 J;  1NK0 A;  4HT7 A;  5M2R A;  4DV4 F;  2UXD F;  3HDS A;  3OJU A;  3K17 A;  4HH0 A;  4O4R A;  3DGP B;  1VRT B;  4HTI A;  2BAC A;  1P1T A;  1DTQ B;  4NYP A;  2D74 B;  1XJW B;  3QQC D;  3L3C A;  1VK3 A;  2BEF A;  2DYA A;  2YH1 A;  1TR0 A;  2R8K A;  3H4B A;  5DLF A;  3T5J A;  2UVU A;  3MEC B;  1FJC A;  2X1B A;  3NS7 B;  1TL1 A;  3GJQ B;  4CWB A;  1SXL A;  4LSN B;  2YPZ A;  4OLO A;  2J0X A;  2VD3 A;  4S0M A;  2ZE2 B;  3V4I B;  3T1A A;  1NK5 A;  3T9N A;  3ZC4 A;  1YX2 A;  3TRG A;  4CM0 A;  2GO8 A;  4ID8 A;  1IBK J;  2IJN A;  1JLG B;  3H0P A;  4ZKA A;  1VC0 A;  2V8H A;  4YB7 A;  4CIO A;  1RLC L;  1YJT A;  5CH7 B;  5E2Q A;  2HHQ A;  2XY5 A;  5HMY A;  1KKH A;  2YWE A;  2W4C A;  3ZZY A;  3J7Y U;  4FXV A;  1OJ4 A;  3H98 A;  3QGI A;  3G6X A;  1TMJ A;  2I2Y A;  2XYP B;  3NCP A;  2YWW A;  3UQS A;  4ZPV R;  4KYZ A;  1VLY A;  5D4P A;  4F4K A;  1QD1 A;  4XIU A;  4TU8 A;  2APO A;  1H72 C;  1TKZ B;  5J2P B;  4DUZ J;  2FJA B;  1HIY A;  2CQ2 A;  2XI2 A;  1CUL B;  2JZ5 A;  3ENW A;  4RLE A;  2ZEJ A;  4MAK A;  4TY9 A;  3ISN D;  4TY8 A;  2IBO A;  2V5H G;  4AXI A;  3MMC A;  2F40 A;  1U25 A;  1XC9 A;  3T5K A;  1HA1 A;  3GFY A;  5HQ8 A;  4ED6 A;  3M8P A;  1SQF A;  2HKE A;  1K1S A;  3NGS A;  2M5Y A;  3DRS B;  1ROF A;  3GIM A;  3EGZ A;  5F0U A;  4ZVH A;  3R2D J;  2YKM A;  4QCL A;  2AJF E;  1FRI A;  2J8S A;  1HHT P;  2VH7 A;  5HP1 B;  2LFV A;  1NSP A;  2E5J A;  5KFT A;  2RDJ A;  5F8J A;  3MF5 A;  1JLB A;  2DH8 A;  4K4T A;  2YKQ A;  1ZBT A;  2OEM A;  4UUW A;  5CD4 H;  1RE1 B;  3T5L A;  2CPD A;  5KFG A;  4ED5 A;  2KVQ E;  5LMU F;  2YVS A;  3A3P B;  4JI6 F;  4O3N A;  3MOZ A;  3QFW A;  5A8K A;  2QG9 B;  5CCM A;  2B4P A;  2OPP A;  1I5O B;  3VAH A;  5LXR A;  2MST A;  4U67 Q;  1EP4 B;  4IFV A;  4IO9 Q;  3IMQ J;  1OYE A;  2GZO A;  4ECZ A;  4R0E A;  2MKC A;  2H5J B;  3VWS A;  2DNL A;  1DAX A;  3UCG A;  1RCO B;  5ETO A;  2MKS A;  1JKH A;  1HI8 A;  2HGN A;  4DV3 J;  1V5V A;  4G1Q B;  2GQ2 A;  2LP4 A;  4BWJ A;  1VBX A;  4UY8 5;  4W98 A;  3A13 A;  1IBL F;  5KT6 A;  3K5N A;  4RBU A;  2RSQ A;  1P9Y A;  2VPW B;  4USK A;  1FEE A;  1X4H A;  2BE2 A;  4Q0B A;  2M9K A;  1BD6 A;  5JUM A;  2LEA A;  4D3G A;  1IKX B;  2NXC A;  3DMJ A;  1T9Y A;  5K14 B;  1RWO B;  4LF5 F;  1BWV A;  3D66 A;  4DR7 F;  4KO0 A;  3DKD A;  2FLO A;  2FPH X;  2DNZ A;  2PA8 D;  3PJW A;  2KT2 A;  5KOW A;  5D3G B;  1G1X A;  4N76 A;  1JLQ A;  4CNZ A;  3D2W A;  3EVW A;  2MQ8 A;  3DRX A;  1W25 A;  3EVO A;  3KUH A;  3LTO A;  4P52 A;  3CME S;  4KAI A;  4FXW A;  4YB6 A;  4YS2 A;  3GMG A;  3SQO P;  3TEG A;  4DUZ F;  2LA4 A;  2D3U A;  4MYT A;  3VZI A;  2B8P A;  3PTW A;  4MH8 A;  3UR3 C;  2ADB A;  2OSQ A;  5FLX Y;  4HI2 A;  1FRX A;  3CDE A;  4TN2 A;  5ETT A;  3EUN A;  3BSN A;  3M6V A;  2WVC A;  5F8I A;  3MPW A;  1HQE A;  4GMK A;  4A46 A;  4CQ1 A;  1YJU A;  3T1Y F;  2NXU A;  2XMT A;  4DPT A;  4YR2 A;  2XS2 A;  3IM8 A;  3I0S A;  2YY3 A;  4PQU B;  2YWK A;  2ZBI A;  2UUW A;  4ICL A;  4RW6 A;  2M2B A;  4DL2 A;  2M88 A;  4ZP8 A;  3K7R A;  3Q89 A;  4QYR A;  4OHY A;  3D9B A;  2IRY A;  4HVZ A;  3SFG A;  2QA2 A;  1S10 A;  2ZBR A;  2JEF A;  4KV8 A;  3E01 A;  3NEK A;  3MUR P;  1WWH A;  1PBA A;  1SB6 A;  2GA7 A;  3DRY A;  4K5R A;  4JI0 F;  2RNE A;  5BJR A;  4LF6 J;  1X5O A;  3CDB A;  3QJP A;  3HHL C;  4M5I A;  3TWZ A;  2MQO A;  3QBC A;  1FDB A;  3TQE A;  2DPI A;  2DNK A;  3ISN C;  1TL4 A;  1LV5 A;  4L72 B;  4NLY A;  5MLC V;  3D6H B;  2R42 A;  1U0S A;  5LMN J;  4Q7A A;  4DF8 A;  2MQQ A;  4ILL A;  2KFY A;  3R1L A;  1SKR A;  1YJR A;  2EVZ A;  2AT1 B;  1U2R A;  3DOM A;  2FZG B;  3EVM A;  4JOU A;  4F4Z A;  2QZ8 A;  4G6V B;  5F3Z A;  3Q8P B;  2XMM A;  2VJV A;  4ECU A;  1NBE B;  4NCG A;  1HW9 A;  3NCQ A;  1HNI B;  2AGO A;  2R2U A;  3Q0A A;  2VG6 B;  3PW4 A;  1TP7 A;  3HT0 A;  5L1J A;  2VFV A;  2DGU A;  2GAH C;  4ZJL A;  5C2G A;  1GMW D;  1CJV B;  1RAH B;  5JJB A;  2BYC A;  4OZJ A;  2PMH A;  2KVI A;  3V6D A;  2HUR A;  2NPF A;  4EO8 A;  1XNR J;  3BSA A;  4LUB A;  1X4C A;  3BYP A;  1CC8 A;  3DHX A;  1WG1 A;  1K44 A;  2XSJ B;  1X0F A;  2XNR A;  1RQ0 A;  4QBU A;  5E3A A;  3W8P A;  1C4C A;  2HHT A;  1U6F A;  1R31 A;  4NWB A;  1YK9 A;  2ZFH A;  4WFB Q;  1RK8 A;  1SCJ B;  1LWC B;  1O6X A;  1EAR A;  3Q23 A;  1CJK B;  2FVC A;  1KNZ A;  4DV2 F;  1KP6 A;  2GC8 A;  3GJT B;  1ZAV A;  3TW0 A;  3CSK A;  4OI0 A;  5HJY A;  2DNP A;  4NI2 B;  3W9H A;  3NL0 A;  2QE5 A;  2HK3 A;  2CRL A;  3H2U B;  1YZ6 A;  1LKZ A;  2HRU A;  2NUH A;  2VKZ G;  4U8Y A;  5J1N A;  5KT2 A;  4FBT A;  1SL1 A;  4NLS A;  2YKP A;  3JSY A;  4Y00 A;  2N7Y A;  4NXN J;  2QRR A;  4KGZ B;  3V2U C;  2RRA A;  2Y1R I;  1S6O A;  2NYH A;  3BKF A;  4X4O A;  1UEV A;  3QRQ A;  5DM7 Q;  3H40 A;  4NLR A;  4YB5 A;  1XR6 A;  4DSE A;  2VG5 A;  3LP0 B;  3RAQ A;  1IKW B;  5EUH A;  4B3S J;  3CDW A;  3KHR A;  4ZDN A;  3T1H J;  3UD3 P;  3I31 A;  4JI4 F;  1EX8 A;  2Z8Q A;  3H20 A;  4X4T A;  2XLJ A;  2FZK B;  1C0U A;  4RKU C;  3DYA B;  2AEF A;  1SJR A;  5D0R A;  5KG5 A;  1T8E A;  2UVR A;  4LRF A;  5IZH A;  1RT1 B;  2QT7 A;  1PIE A;  3P5B P;  4Z2X A;  1I3O B;  3SCL E;  1WKJ A;  4IQX A;  2LLZ A;  4L6V 3;  2COL A;  3EE3 A;  1RT5 B;  4QZV B;  4Z7C A;  4QW9 A;  4DR7 J;  4LF5 J;  3MED B;  2V8D A;  4QPX A;  3C6U B;  4LBI A;  1HWL A;  1VJQ A;  2BAN B;  3OQ2 A;  2I5J B;  5J2P A;  1NO8 A;  3UD4 P;  2Z58 B;  3IC1 A;  2ZKU A;  3U1M A;  1TAU A;  1VQM S;  1RAA B;  1SC6 A;  2D3Z A;  1HBO B;  1KLM A;  4DR1 F;  1QVG R;  2CFX A;  3EZO A;  4RW7 A;  2XS7 A;  3M8Q A;  2YKA A;  4CH0 S;  5DZ7 A;  4RNH A;  1VDH A;  2HWH A;  4IOC Q;  1U09 A;  4K4Y A;  3K89 A;  4LBP A;  4L76 A;  3V4I A;  4EZ9 A;  4IQM A;  2B51 A;  2VBY A;  5ETS A;  4N77 A;  1AXQ A;  4NZ0 A;  2H5I B;  1RT2 B;  3EGW B;  3D6F B;  4D3H A;  3JSM B;  2FLP A;  1PJ6 A;  1I94 F;  2F8H A;  2I8E A;  1KR4 A;  3DLG A;  4DFP A;  1W2B R;  4U7U D;  3DRP A;  2DH9 A;  1CJT B;  2WZ1 A;  4Y0F A;  3H7H B;  1BUX A;  2BKP A;  3ILI A;  4R0J A;  1S9G B;  1U1R A;  3D5M A;  2XMK A;  5GAE I;  4LF6 F;  4JYA F;  4XO0 A;  4KJI A;  2DHG A;  2ZOM A;  2V4J B;  2FQQ B;  4G1P A;  2F9D A;  2LU1 A;  1WOR A;  2V2K A;  1QSY A;  1RTJ A;  4C8M A;  3J80 Y;  5KFN A;  5FLX U;  2DHS A;  1R8A A;  1JXL A;  4Z7Y A;  2FVR A;  4PG4 A;  1NEE A;  3LGN A;  1Z4U A;  2NR0 A;  3SFU A;  2CJB A;  2E1M C;  2EG1 A;  4FF1 A;  2UP1 A;  4EYI B;  1JIH A;  3B4D A;  2CPH A;  1S1U B;  2ROE A;  2NXJ A;  1T3N A;  4I4B A;  4F7V A;  2DR5 A;  5AJ3 J;  1XMQ F;  1NK8 A;  1URR A;  4ECW A;  2LDY A;  1VQ5 S;  1EQ0 A;  1KOH A;  1TL1 B;  1Q81 T;  1YJV A;  3DRP B;  2QLB B;  1OQ6 A;  3HCX A;  1D1U A;  1S1W B;  1WEZ A;  3U1L A;  3MAH A;  3C16 B;  3PR5 B;  2GJF A;  5T41 A;  1GTE A;  4OYX A;  2IYI A;  3QJL A;  3EJM A;  4F4Y A;  4MK7 A;  1QDU B;  1SJ1 A;  5KFM A;  4NLT A;  4DV2 J;  2R7Q A;  3THP A;  4DUT A;  5I3P A;  9ATC B;  4F4X A;  2G2Y A;  4DR3 F;  4FF2 A;  5C25 A;  1RI7 A;  2XEX A;  3P49 B;  2E5G A;  3EDR B;  3UDC A;  2KHC A;  1C1C B;  3TAM B;  4WXO A;  4OYO A;  3HSJ A;  4J9S A;  2C2M B;  4DV5 F;  3BM7 A;  3MR7 A;  2LDI A;  2PEH A;  3D6M B;  3M7V A;  2ZH2 A;  4DL6 A;  2E7X A;  4NLG A;  2CPX A;  1T3O A;  2LQ5 A;  2FVQ A;  3SMZ A;  3U7J A;  3B54 A;  3AA9 A;  1S48 A;  1UFK A;  2IJF A;  3HHD A;  3A3O B;  3O2I A;  4I69 A;  2CWK A;  4TQS A;  3THV A;  2IRU A;  3DDI A;  1RTH A;  3ETM A;  2JC0 A;  1RAF B;  3PXG a;  4H4K C;  3CT9 A;  1UJ6 A;  5HLF A;  3T1H F;  3FQK A;  4B3S F;  5DM6 Q;  1I6J A;  2L9D A;  2PII A;  4ID5 A;  2EK6 A;  4RPF A;  1NJI T;  3CO9 A;  4LRB A;  2EKN A;  1CBK A;  4H4O B;  4CLS A;  5E33 A;  2VDH A;  2V9W A;  3UVJ B;  1H7W A;  4KGX B;  2HBQ B;  1EIY B;  3AJ1 A;  2I9S A;  4F0M A;  1AUS L;  1LW2 B;  1S97 A;  1JLQ B;  5CAB A;  1RHM B;  2UUT A;  3N6L A;  1DQ9 A;  4FZV A;  3OFF A;  1TV6 B;  1FER A;  2YH0 A;  4RNO A;  3H5Y A;  2FJV A;  4C0H A;  2DNH A;  2C3M A;  4ZP6 A;  5J2M B;  2XMA A;  4UZB A;  2RS2 A;  1RBL A;  1C1B B;  2IM0 A;  2G1D A;  2GW8 A;  3LP1 A;  5DZ6 A;  3CJT A;  3RBD A;  2G2O A;  2IC3 B;  1H73 A;  4HKQ A;  4K7Q A;  2DGV A;  4FF4 A;  3SSR A;  1RDR A;  1S6U A;  2AX0 A;  1UMJ A;  2IAJ B;  4LR9 A;  4NL5 A;  4OQJ A;  3M32 A;  4UT4 A;  3QT5 A;  4JV0 A;  5IM0 A;  3E01 B;  1BQN B;  2PDA A;  2ZM6 J;  1D3W A;  1REG X;  3I0R B;  4QR0 A;  2XSF A;  3KK3 B;  3VAK A;  2BQU A;  1LXN A;  5BR8 J;  4J91 A;  3OXG A;  4GO5 X;  1S0V A;  4DU8 A;  2BRL A;  2V68 A;  3BH6 B;  1R0A A;  2I0X A;  3KUG A;  3UD5 A;  2DO0 A;  1RHU B;  1M5H A;  1W2I A;  1C0T B;  2DIV A;  4PCQ A;  3IG1 A;  4V1A k;  1GXT A;  4LRE A;  2PC6 A;  4K2J A;  3S1T A;  5GAG U;  2V50 A;  4EMD A;  5C42 B;  1VQY A;  1HWU A;  2CQD A;  3UNY A;  4B9L A;  4LF8 J;  4DOZ A;  3W7B A;  2VG6 A;  3K5O A;  3IGN A;  2XY6 A;  1C1B A;  3TZW A;  3O3L A;  5GAH I;  4CLW A;  1B0P A;  4ZPT R;  1S6P A;  1SV5 B;  2H3E B;  2H65 B;  3V6D B;  2XHW A;  1RB0 A;  5K20 B;  3WX8 A;  5L46 A;  1QTN B;  1TKX A;  2X1G A;  3JQM A;  4DCO B;  3PX0 A;  4C8Y A;  5GVQ A;  4K0K F;  4K50 A;  3JQK A;  1OMS A;  2YNG B;  3ITH B;  3JSR A;  3DLK B;  5E3Q A;  1WI6 A;  2ZHA A;  4ECS A;  2Y1I A;  2M3D A;  3R5A A;  2L41 A;  3N01 A;  1RYS A;  2Y3Y A;  3G82 A;  4GKJ J;  1EJ7 L;  1IQT A;  1FF2 A;  3GU0 A;  5CZV A;  1R0A B;  3LH2 S;  3J7A N;  2Z2L A;  1PCA A;  2RVJ A;  1BGX T;  1BQM B;  2RD5 C;  4Y28 C;  4YUD A;  2W9A A;  2XZW A;  3PRD A;  4PXD A;  5AXK A;  4WZQ A;  4Y65 A;  3IWN C;  4MKB A;  4QIW D;  4C3L A;  4FNI A;  2CUY A;  4KPC A;  4QIE A;  2CQP A;  3D54 A;  1WHX A;  1RZM A;  1S7I A;  3M6X A;  1NSQ A;  4JI2 F;  2AU0 A;  2BKN A;  8RUC A;  4PG6 A;  1HBO A;  2KJV A;  3C46 A;  3M8R A;  2G13 A;  3VZH A;  3G2X A;  3W9J A;  1T03 B;  2BUN A;  3IS9 A;  1PYO B;  1PSD A;  2HHV A;  4C48 A;  2RJZ A;  3IR5 B;  1UL3 A;  2EW9 A;  4DDF A;  2W25 A;  3KG4 A;  3QPI A;  2AKW B;  1Q5Y A;  1VIX A;  3AB4 B;  2KT3 A;  4I6W A;  2Y0S D;  4UOC A;  3NY0 A;  2M70 A;  4O3O A;  1OIA A;  2CJ9 A;  2CPY A;  2VBX A;  3GB0 A;  3QGH A;  3WX4 A;  4YY3 J;  3MR6 A;  2N4D A;  3MUM P;  1OPI A;  2ZUG A;  2VHG A;  1KLN A;  1M5O C;  3EDQ B;  4PR6 A;  2C2K B;  5KFL A;  4BS2 A;  3DNC A;  1Y3K A;  3K8V A;  2CIM A;  3MEC A;  2LMI A;  1U1K A;  1G2E A;  2BVZ A;  4M5M A;  4WFA Q;  3CJS A;  2CQG A;  5HRO A;  5FDL B;  1FNM A;  2JDJ A;  1Q8I A;  1S1V B;  1S9G A;  2GHW A;  2GVD A;  2ZBC A;  5EX0 A;  2W24 A;  2WSC C;  3NLC A;  3CJK A;  4HLB A;  4QW8 A;  4H4K A;  3PKM A;  2X1F A;  5A8R A;  2R7R A;  4WIQ A;  3HVW A;  4P7T A;  4ECY A;  5AE1 A;  4KIA A;  4NE9 C;  2CDQ A;  2YXL A;  2RML A;  3BGU A;  1GT8 A;  3ET6 B;  1EP4 A;  4IFV B;  1PAE X;  2X3G A;  4KB7 A;  4OJH A;  5EWF A;  4MKA A;  1S49 A;  4ECX A;  3ZZZ A;  1WF0 A;  3O5T B;  2BA9 A;  3WZ0 A;  1RHR B;  1R8B A;  3DN9 A;  4NPO A;  4O3P A;  1JKH B;  1TUW A;  2AZ3 A;  1HQ2 A;  5IV3 A;  2UV8 G;  3NG8 A;  4AQY F;  1VQ9 S;  1HI1 A;  2ASL A;  1HNW F;  1RAJ A;  1QSL A;  2DGS A;  2GVZ B;  2CZ4 A;  3MMC B;  1OYD A;  1AT1 B;  4ILR A;  4V19 J;  2JHE A;  2DNN A;  4L74 A;  3R2C J;  4RW9 B;  1YZ7 A;  2MGZ B;  1X4F A;  1N5V A;  2DJW A;  2M52 A;  2QJ3 A;  5DG9 A;  1BQX A;  1V3R A;  1X4D A;  2DGO A;  1JB0 C;  4DFJ A;  4TVA B;  1LOU A;  3CJK B;  1UEU A;  5T14 A;  4USW A;  4JI2 J;  2PEB A;  2R2S A;  1RT7 B;  2FC9 A;  3H8Y A;  3G82 B;  4P9S A;  3AAW B;  1JLB B;  2W1B A;  2WVF A;  1UWB A;  4DS5 A;  2LYV A;  3BGR B;  2X3D A;  1TFW A;  2J6U A;  1N32 F;  3DGP A;  1GQE A;  1S1X B;  5HMZ A;  3MMA A;  4FS2 A;  1CJU A;  1PAU B;  1ZA1 B;  2DKO B;  4NLD A;  3PJ9 A;  2CKW A;  4NRU A;  4YY3 F;  5ETN A;  3DLE A;  3WC0 A;  1TKD A;  2GGP B;  3TVY A;  1RT4 B;  4JI8 F;  5KFV A;  3H25 A;  1GK8 A;  2HNY A;  3R5J B;  3SCK E;  1J27 A;  3MR5 A;  1IBM J;  3W5Z A;  2C1E B;  2YTC A;  4GRS A;  3S8S A;  2B5J B;  1MLA A;  2UV8 A;  4I6A A;  4QWC A;  5DDR C;  2G0C A;  5CYM B;  3AOA A;  2CJK A;  1V5I B;  2F4V J;  4K59 A;  1LNQ A;  2A3J A;  5KFJ A;  2C3U A;  1GX6 A;  4PWD B;  5IWA F;  1HD0 A;  1KQG B;  1V3Z A;  4K0K J;  2XGP A;  3B78 A;  2VZ9 A;  4PXB A;  4ZOS A;  1FE0 A;  3HPO A;  1B64 A;  1U7L A;  1FHT A;  4IR9 A;  4KE5 A;  4AXJ A;  4F50 A;  4B3T J;  2BZ2 A;  3H5X A;  1RP5 A;  3BN7 A;  3VAG A;  3AH6 A;  1F3F A;  1T9W A;  4C11 A;  1RAE B;  1K1Q A;  2VBZ A;  4NLP A;  1L3S A;  3DOM B;  7FDR A;  4EI2 A;  2EI5 A;  4N7T A;  1ZZF A;  3GII A;  4K4Z A;  4QU6 A;  3DC2 A;  3UDV A;  2ALZ A;  3R7N B;  2VFS A;  3KKF A;  5J2N B;  2HHH F;  3QMQ A;  4W92 B;  1C1C A;  3TAM A;  3W60 A;  2CG4 A;  5LMN F;  3NGK A;  1XR7 A;  2CPZ A;  2ZNZ A;  3H42 A;  4ITS A;  1V6H A;  3K58 A;  1U49 A;  2YKN A;  2GX8 A;  1N52 B;  3E3X A;  4NXM F;  1H2U X;  2CJY B;  1IM4 A;  4ZPC A;  3HMJ G;  2CYY A;  2ZDP A;  2ZVS A;  1K0T A;  2AQ4 A;  1NK6 A;  2DCL A;  1U6Z A;  3GON A;  4E2F B;  1WOP A;  1Q16 B;  2DH7 A;  2W2M P;  3OBI A;  1UJ5 A;  5D4N A;  4ZVP B;  3E2E A;  5E3R A;  4LF9 F;  3T3F A;  3I0S B;  1WEX A;  1VOM A;  3DRR B;  5K5M A;  1WKL A;  4PQU A;  3CC7 S;  1SUQ B;  1D9A A;  4ID5 B;  3OV7 A;  1H2V Z;  1Y5I B;  1RWM B;  2HBR B;  1QJH A;  1NK4 A;  5F8L A;  3HKZ D;  2ILY A;  3HUL A;  3MMJ A;  3AJ2 A;  3OPK A;  4F3M A;  4ZIW A;  5SZT A;  1U1L A;  1N4L A;  4JI5 F;  1KN6 A;  3F56 A;  4YME A;  2Y8Y A;  3CJ0 A;  2HRY A;  2VUG A;  1SH0 A;  1N32 J;  2W7O A;  5CXT A;  1YQH A;  2GCF A;  3ZTR A;  2ERR A;  2AW0 A;  1RCX B;  3G86 A;  1YRX A;  1YHQ S;  4F2R A;  3BGF A;  1KEK A;  1OY6 A;  4AL5 A;  2AYE A;  1WAC A;  1N5T A;  1JJ4 A;  4AND A;  5DRK A;  4J9K A;  4NA2 A;  3VV2 B;  5C25 B;  1FEH A;  1U0H B;  5HMW A;  3QJJ A;  1Y4Z B;  1HBN A;  3CD0 A;  2JC1 A;  4K2X A;  1HNI A;  2QV6 A;  2XWY A;  2NRE A;  3DLJ A;  5HI7 A;  1F6T A;  4ZJQ A;  5KT3 A;  4JV5 F;  1SC1 B;  2LCW A;  4B9V A;  4WWS A;  4AQY J;  3N79 A;  4G1Q A;  3ELH A;  1D8Z A;  4FN5 A;  4OHX A;  5KT4 A;  3OUY A;  1Q7Y T;  1HNW J;  3D4J A;  3TI0 A;  5KFC A;  1WHV A;  1X9M A;  2A1B A;  2B4V A;  2QL5 B;  4TY8 B;  4B17 A;  4B3T F;  4Q0B B;  2R7X A;  3PFO A;  3VGS A;  4JI4 J;  1YIT S;  3CVK A;  5L9X A;  5CYQ B;  2GIF A;  2E1C A;  1YBA A;  3HHL B;  3M1V A;  3DRS A;  2E5H A;  1T94 A;  4LBH A;  4P72 A;  5KFU A;  4F3Q A;  1UW4 A;  5BYQ A;  2RB7 A;  4ES2 A;  3IM9 A;  1L3U A;  1X4A A;  2KXF A;  2ZZN A;  4ED8 A;  4UTG A;  1IM6 A;  3CED A;  3JQJ A;  3NKY A;  1H38 A;  1FK9 A;  2JLE A;  3IRX B;  3M2V B;  1T9V A;  3EXC X;  5G0R A;  4U95 A;  5IV4 A;  3TVZ A;  5LJ5 Y;  3MTK A;  3OVA A;  2WTF A;  2EC0 A;  3W62 A;  2QL7 B;  2HFV A;  4OI1 A;  1JNR B;  4X62 J;  3MOJ B;  5C5J A;  2EG2 A;  2VU5 A;  3MEG B;  1ZM3 A;  1PJ5 A;  4KC5 A;  3K5M A;  4GKJ F;  3DFE A;  3FCW A;  1RWW B;  4ELU A;  2DVI A;  3RR8 A;  4USJ C;  4WKR A;  4FVC A;  1MU2 B;  1M5S A;  3HVR A;  1JLE A;  3QLH B;  2KJW A;  4L75 A;  4KGV B;  3ETO A;  1FO1 A;  1JXE A;  2DIS A;  2IC3 A;  4PAA A;  3W5X A;  3W9I A;  4N56 A;  4IG3 B;  4PAB A;  1Q8B A;  1J5O A;  1YBT A;  2QTW A;  2YBV A;  4Q2L A;  2F4V F;  2DNG A;  1HKA A;  2ZBQ A;  5IWA J;  3A8J A;  1MN9 A;  2QIF A;  3CJ2 A;  1BQM A;  2CQ0 A;  3IBC B;  4KQZ A;  1N5Q A;  4RNF A;  2KXN B;  1IBC B;  3ZZP A;  2GMJ A;  3LWM A;  1T11 A;  3KLI B;  1GXU A;  2NCK L;  4LF7 F;  4O3S A;  2CAD A;  4CTA B;  3OT9 A;  5KFW A;  3QNW B;  2PFD A;  3V4M A;  1Q79 A;  3MM7 A;  2W8K A;  3G8Q A;  1F0X A;  1FKO B;  2MJU A;  3M6U A;  4PWU A;  1RWP B;  5ETQ A;  3FNN A;  4P2X A;  2E29 A;  4KFB A;  1JJH A;  1HNV A;  2EK1 A;  3PW0 A;  2VV5 A;  2SXL A;  3D6T B;  3CCQ S;  2K3K A;  1ZZN A;  1SL2 A;  1D9F A;  2DNR A;  2DRA A;  3R9L A;  4GVL A;  1U2F A;  5JXS A;  3CO0 P;  3BPS P;  2PMW A;  2Y9H A;  2WBR A;  2PD1 A;  4JV5 J;  2RE1 A;  1SJ3 P;  3D68 A;  4IUF A;  1GNK A;  4OI6 A;  4RW7 B;  1BXN A;  3SQG B;  4DR1 J;  5GAD I;  2JFK A;  4UZC A;  2FHO B;  1JLE B;  3UDE A;  2HFS A;  3BV8 A;  3GV7 B;  4WP8 A;  1NKC A;  5KG3 A;  2WOM B;  1TL3 B;  3SXL A;  3TA2 A;  4ZN3 A;  4DV3 F;  3TJA A;  2RU3 A;  3N9U C;  5CAA A;  3BQ0 A;  4LF9 J;  4RUH A;  1SQG A;  2O5D A;  5AT1 B;  4LFA F;  4JUZ A;  2AEJ A;  2VOP A;  5HAO A;  5H9E K;  4KKO A;  3VAF A;  2W2N P;  1TTH B;  2V0N A;  1MNE A;  2ZWP A;  4I64 A;  2ZJP Q;  4CTA A;  1H98 A;  1U8W A;  2CPF A;  4OZ5 A;  2DNY A;  2JH3 A;  4JI5 J;  3NNC A;  5A8R B;  1NCL A;  3ZZO A;  1TFY A;  3HHL D;  4P2F A;  4C4W A;  2B7C B;  2HGM A;  4BWM A;  3FUY A;  1XWL A;  2RF2 B;  4A48 A;  3NWR A;  4LIR A;  2C2N A;  2C42 A;  2VG7 A;  2M7S A;  1C4A A;  4I67 A;  1WF2 A;  4I0W A;  2ILZ A;  3KWM A;  3BQ1 A;  2B6A A;  1K8A T;  3X1L B;  3GPA A;  4CO5 A;  5IC4 B;  1U26 A;  2GNK A;  2HVD A;  3T1Y J;  3TUI C;  3L09 A;  1TAQ A;  4KHM A;  1IR0 A;  1GXL A;  1NUE A;  4J9V A;  4UOF A;  1U1P A;  4ZLN A;  1VI7 A;  4LRC A;  4MT1 A;  3ULH A;  3QRR A;  4MMO A;  4PKD B;  3UVJ A;  2XM3 A;  1FX4 A;  3P4U B;  4CP5 A;  2RH3 A;  1FE4 A;  3AB2 B;  5K8N A;  1KD1 T;  3ONQ A;  4P71 A;  4ZPD A;  4JI0 J;  3L7P A;  1N0V C;  3LAL A;  1VRU A;  2KYX A;  6FDR A;  1HHQ A;  1RU1 A;  4ZVU B;  3QYY A;  1T9T A;  1ITP A;  3KHG A;  5I3U B;  4WU2 A;  2VPY B;  2I6W A;  4DL5 A;  4ELT A;  5KFY A;  1MW7 A;  1FKO A;  4IR1 A;  4M94 A;  4DL0 C;  1LQ9 A;  2WVE A;  1FVS A;  4DPU A;  3L7U A;  2VFU A;  3FRZ A;  4K8R A;  4FNH A;  3TO8 A;  4CLZ A;  3KLG A;  4J9O A;  2BX6 A;  2JEG A;  1DFD A;  2W2O P;  4FKY A;  1SI9 A;  3M32 B;  3QIP A;  3ZZR A;  3I5C A;  3DRR A;  5KFE A;  4CLU A;  3NGD A;  3QAT A;  2XGQ A;  2ATL A;  3PYF A;  1HHS A;  3O1L A;  2GFF A;  1MG7 A;  4CO1 A;  4DU7 A;  3VHQ A;  3HSG A;  1S12 A;  4LFA J;  1UAW A;  3NGR A;  5IQQ A;  2J6T A;  3NS5 A;  1NPR A;  3BF4 A;  3N0V A;  4USU A;  3QT6 A;  3LO3 A;  5DDO C;  1WDD A;  4GC7 A;  2DHX A;  1VQP S;  4DXL A;  4PWD A;  2P2C B;  1XER A;  3CPW R;  2B9W A;  3HI9 A;  3MMB A;  1ICE B;  5B08 A;  1JLA B;  4C11 B;  3E8O A;  3LWL A;  3MTJ A;  3TX8 A;  3GG1 A;  3GV8 B;  4OX7 A;  5K8P A;  3TAR A;  4UUX A;  1NHU A;  4WFZ A;  4LF7 J;  2DXF A;  2Q79 A;  1S1T B;  2DGQ A;  2Z4P A;  3NOC A;  5A6W A;  2DY1 A;  3IFE A;  2DTJ A;  2FGC A;  5HQL A;  2ZUA A;  1VLO A;  4ILM A;  4R8U A;  5E7O B;  4Q5V A;  3FCV A;  2BV3 A;  3PAC A;  3AHP A;  2K2P A;  2KN4 A;  3BGR A;  3MM9 B;  4KSE B;  2W9C B;  2C2D A;  1R89 A;  1SH3 A;  5J2M A;  1HNZ J;  3EXY A;  3MMA B;  3RGI A;  3VGT A;  2O01 C;  2CVE A;  1QM9 A;  3UO0 A;  4DF4 A;  5KFD A;  3R5D A;  2K06 A;  1KC8 T;  2NQP A;  4DSL A;  1JMT A;  3DCA A;  4IFY A;  1E6Y A;  3FSX A;  1LEO A;  2A2C A;  3PEH A;  4OYB A;  1FXL A;  5B0D A;  2FJW A;  2OEJ A;  1LWF A;  3S7R A;  1RTZ A;  2H4Y B;  1KFD A;  2HS0 A;  2WK4 A;  4QIV A;  3GG0 A;  5CYM A;  1JLF A;  1UJ4 A;  5K14 A;  1X4E A;  3FQL A;  5HL7 Q;  1S1W A;  1PG5 B;  3AQP A;  3BR9 A;  1ARO P;  4KO0 B;  4PG5 A;  4J37 A;  2ZH5 A;  3FEX B;  2HQC A;  2WB1 D;  4PZV A;  2YWG A;  1MRO A;  3U02 A;  2J0Q D;  2HLT A;  3HT3 A;  3OFH A;  1RLD A;  2F8M A;  1FNX H;  1FD8 A;  4OYZ A;  1OSC A;  3BO4 A;  1UVM A;  4NCB A;  3GLJ A;  2DPJ A;  1T02 A;  2CZ9 A;  3HHE A;  4QPT A;  3OFE A;  5B0A A;  5ADZ A;  3M8Y A;  3IG1 B;  5LSR A;  3KLV A;  4EBC A;  1FXD A;  2ZDO A;  4WFN Q;  3GFH A;  4DLG A;  2CJA A;  5J2N A;  2HNZ A;  2DCU B;  1ZYQ A;  4DSJ A;  3AA8 A;  2WVD A;  1NJW A;  2BQ3 A;  2A10 A;  5F8M A;  3QSY B;  1HWJ A;  4TYA A;  2HRT A;  5LJ3 Y;  2JWN A;  4AYB D;  3Q8Y A;  4CLK A;  1RTH B;  2YNI B;  2ZHO A;  4NEY A;  2WHO A;  3BQ2 A;  1HQE B;  3L7O A;  3KLG B;  4ZCL A;  3HHN B;  2F65 A;  1S1V A;  3C19 A;  1D8Y A;  3O44 A;  3UI3 A;  4FBU A;  2G1H A;  3OUY B;  4A8F A;  3C2P A;  2FLN A;  2CNL B;  3KLI A;  2WON A;  1VQO S;  1SQE A;  2DEI A;  1YSJ A;  2MTL A;  2Z30 B;  4X66 J;  1NJY A;  2R3V A;  5KFR A;  2JSX A;  5CYQ A;  3VGU A;  2UXB J;  1ELO A;  1MSW D;  2DNM A;  2K1R B;  1WC3 A;  2H4W B;  4UY8 T;  3QRP A;  3RRK A;  2DRD A;  2NXE A;  1U4B A;  2MLZ A;  1JQG A;  2V63 A;  4DX5 A;  2FGO A;  5I42 A;  4W90 B;  1R6V A;  1MMD A;  2B7B B;  6FD1 A;  4CT8 A;  3RB0 A;  4WXW A;  1B0V A;  2F1F A;  3A8K A;  3MD3 A;  3POT A;  3K59 A;  4B3R F;  2BE9 B;  1C2P A;  3TUJ C;  2CJX B;  3D1H A;  4C0O C;  3V6H A;  1U1Q A;  1WKK A;  4LRA A;  2C2O B;  2XLI A;  2GIQ A;  5IC6 B;  2HYI B;  2PI5 A;  4LQ3 A;  1NZ8 A;  4ZPB A;  5IFM A;  1JJ2 R;  2MJN A;  4YFU A;  2EBE A;  2OEL A;  3OXF A;  1FJG J;  1IKY A;  1BE4 A;  1KQK A;  2MQP A;  4C8Z A;  1UTA A;  4Q45 A;  2J7U A;  2Z56 B;  4K4W A;  2EFO A;  2LQB A;  2R2T A;  3MEE A;  4CCH A;  3FRY A;  5L38 A;  2XSJ A;  1P8G A;  2AIR B;  2R7O A;  4M1K A;  4M5J A;  1GMU A;  5AJ3 F;  1XMQ J;  2BOP A;  2FY1 A;  3NXZ A;  5J1P A;  4GKK J;  3N5B A;  1F3V A;  2GVD B;  4Y2K A;  2K1R A;  2OGU A;  2RDI A;  3GZ7 A;  3TVK A;  3UN3 A;  3TZX A;  4K4X A;  5RUB A;  1HFE L;  5M2U A;  1X31 C;  2KXH A;  5HAN A;  2R4F A;  2VFR A;  1OY8 A;  1U1M A;  2LA6 A;  3N6M A;  1HNV B;  4O23 A;  3W64 A;  1YIJ S;  1M5K C;  5KFA A;  2GQQ A;  1UEK A;  4WJB A;  5KT7 A;  3SV3 A;  2KM8 C;  2DR7 A;  4M8L A;  1RIS A;  5E3P A;  2GHV C;  1RTI A;  3J81 Y;  2P6T A;  2MY8 A;  2YQ1 A;  2GJ2 A;  2XG8 A;  4ZA1 A;  1FDN A;  3D1Q A;  3THT A;  1OO0 B;  1RAC B;  2YPY A;  2FC8 A;  2BDP A;  3ICL A;  3CD7 A;  4OIX A;  4CNY A;  3BDE A;  1N33 F;  3ADA C;  1ZS6 A;  4JI8 J;  1UPM B;  5LM7 E;  2C28 A;  4RUC A;  1XQI A;  2FHK A;  3FKB A;  1KQF B;  4ZCK A;  2J5A A;  2MB0 B;  2W4P A;  1NAQ A;  2XLK A;  2XI3 A;  2QSW A;  4HI1 A;  2UXB F;  4YR3 A;  1AYE A;  4FKX A;  4KBI A;  2VAS A;  4DR4 F;  1S4E A;  2NXN A;  3UPF A;  1EAY C;  3IGV A;  4MKV A;  3CMA S;  2HVZ A;  3KK3 A;  1ZET A;  2RHQ B;  4IRK A;  1RBA A;  1RHQ B;  2AJ4 A;  3ENA A;  3FGV A;  2ZZM A;  3MEK A;  1RWV B;  1KRP A;  3W63 A;  3JYT B;  1RXO B;  1TQL A;  5G4D A;  4QYZ K;  1S9E A;  2E44 A;  3RTV A;  3QIP B;  5C7P A;  1X9S A;  2HAI A;  1WD6 A;  4N5S A;  4WII A;  1T05 A;  2BMB A;  3FVY A;  4K5S A;  3N28 A;  4F04 B;  2JVR A;  1QAJ A;  2ZC4 A;  3C14 B;  2FHM A;  1JLC B;  2OD6 A;  1SIW B;  2B56 A;  1R0B G;  3T6J A;  3FFI A;  3G6V A;  7FD1 A;  3W2W B;  4KPY A;  1TU0 B;  3HVT A;  4GKK F;  2MLY A;  4RW4 B;  5DGA A;  1NZA A;  1CSJ A;  4Q44 A;  2M8H A;  4M5G A;  1EET B;  3HFZ B;  3ILL A;  4DL3 A;  1VBZ A;  4RU2 A;  5D3G A;  2R7S A;  4YN3 B;  2HHP A;  2KRB A;  5KFX A;  3U27 A;  2UVW A;  2ZVI A;  3PDN A;  1TZ0 A;  2BJ1 A;  5CCL A;  5BR8 F;  4C9D A;  1UET A;  4KY3 A;  3MUT P;  2RU9 A;  4GVB B;  2J76 E;  4J9L A;  4PRF A;  2VPZ B;  3CD6 S;  2U1A A;  4OX9 J;  4DN0 A;  1SC3 B;  3F44 A;  4WU3 A;  1AW0 A;  1VC6 A;  3DI6 A;  3BGL A;  3M4X A;  3R5C A;  3TNV A;  1XTZ A;  5KT5 A;  2XMW A;  4B02 A;  3C6U A;  1RWK B;  1FA0 A;  2R7V A;  4UOH A;  3M30 A;  3F73 A;  3OW2 R;  5A0Y B;  3Q22 A;  4LF8 F;  5L8R C;  5KFF A;  4FYX B;  4B9M A;  1N33 J;  2OTL S;  1LWX A;  4C6A A;  4DR6 F;  2BJ7 A;  3I4P A;  1GX5 A;  4F67 A;  4B3O B;  3M9N B;  5ITH A;  1L3T A;  1FKA F;  3OD2 A;  3BKU A;  3OHB A;  1UVK A;  1UPP A;  3AQO A;  3GJS B;  3OL8 A;  1DRZ A;  1N36 J;  3PVX A;  4NEZ A;  5A76 A;  5H9E J;  1SKU B;  4BC7 A;  4DR4 J;  3PIO Q;  1JLA A;  1WEY A;  3HJV A;  4TNO A;  4X4P A;  2Q6B A;  4X4R A;  1U02 A;  2LXF A;  4IDK B;  3CF5 Q;  4DL4 A;  3CJ3 A;  1YJ9 S;  3K0J A;  2MQL A;  3DU5 A;  1MWZ A;  3GIK A;  1IJE B;  1S0O A;  4X4V A;  4WTO B;  2BQR A;  5FDL A;  3BJY A;  3AD9 C;  4X64 J;  3FBB A;  2UU9 J;  2KYZ A;  3KUE A;  3BRE A;  2BXJ A;  2PMZ D;  5D0H A;  2LXI A;  2CQH A;  4OI4 A;  5D0E A;  1HNX J;  3LAK A;  3ZXW A;  3MI7 X;  4PEO A;  1UA1 A;  4DSI A;  2ZNY A;  4DG1 A;  1Q82 T;  3F41 A;  3ZZ0 A;  1EZZ B;  2XB2 D;  3SIP B;  2OPQ A;  4DFK A;  2D41 A;  4XDC A;  2QA4 G;  5F9L A;  2ADC A;  4P10 A;  2W9C A;  4NA1 A;  1IWG A;  3PCO B;  4MTP A;  1ZA2 B;  2YNF B;  3KFW X;  2MYF A;  3UE2 A;  3QFH A;  3NBP A;  4DX7 A;  4F36 A;  5IXU A;  3V81 B;  3WHI A;  3Q83 A;  3KYL A;  3M2U B;  4BHQ A;  3TYT A;  4BLG A;  3SZ2 A;  3J80 U;  3I9V 9;  3W5Y A;  1UP1 A;  4QIF A;  1NSA A;  2HS4 A;  1UCN A;  2MMY A;  2RRB A;  4OL8 A;  3CJQ A;  1X5T A;  3HZG A;  1WG5 A;  3MXH P;  3BGO P;  1E6Y B;  4B9N A;  4NZ6 A;  3RR7 A;  2J9D E;  1L3K A;  1RAO A;  3US5 A;  4H4M B;  4Q8F A;  2GJI A;  1JLF B;  1X7V A;  1KBR A;  2DNQ A;  2OMO A;  2RQM A;  2MZT A;  4OYP A;  3SCI E;  4LSZ B;  5K9F A;  1ACM B;  2ROG A;  1RAD B;  2OLW A;  3HVT B;  4OX9 F;  2MGZ A;  1S59 A;  3MM6 B;  3NAH A;  3NGT A;  3R3T A;  4I2Q A;  2MQN A;  4DQI A;  2WSE C;  2LQJ A;  3GSD A;  3PG9 A;  4OZ1 A;  5GMK a;  2J9C A;  3D28 A;  2ZZT A;  4CZC A;  4ES1 A;  4ZS6 A;  4C7Q A;  2N7C A;  1DTQ A;  1FTR A;  1G3O A;  1RAI B;  4ELV A;  4HR2 A;  2QGF B;  2H54 B;  4LJM A;  2GV1 A;  5GAE U;  4QR1 A;  1YTY A;  1UFL A;  1HQU B;  3A3N B;  2I38 A;  1M90 T;  1RTD B;  2KFZ A;  3C15 B;  3OTO F;  4K4S A;  1IKY B;  1UKU A;  1B3T A;  4L3N A;  4URQ U;  3W1Y C;  4ER8 A;  2YNI A;  4FS1 A;  4Y2C A;  2QLJ B;  3H5S A;  5F0W A;  4ENO A;  1Q7L B;  4J7C A;  1VQK S;  1HD1 A;  1F60 B; 
#chains in the Genus database with same CATH homology
 4ZVO B;  1RHJ B;  2CJY B;  2CDR B;  2XYP B;  2QLB B;  3KJN B;  2CNN B;  4ZVP B;  1PYO B;  2Y1L B;  1QDU B;  1RWM B;  2HBR B;  2XZT B;  4JB8 B;  4ZVT B;  3EDR B;  3EDQ B;  2C2K B;  4DCJ B;  2C2M B;  2HBZ B;  3D6M B;  3GJT B;  2C2Z B;  2CNL B;  1SC3 B;  5IC4 B;  2H51 B;  1RE1 B;  1RWK B;  2H4W B;  3R6G B;  4ZVQ B;  1GFW B;  1RWX B;  2H48 B;  3P4U B;  1SC1 B;  2QL9 B;  1RHR B;  3R6L B;  1I51 B;  4ZVS B;  2CJX B;  2HBQ B;  3GJS B;  2H5J B;  2C2O B;  2QL5 B;  1NME B;  1RWN B;  2Y0B B;  5IC6 B;  4ZVU B;  1RHM B;  1I3O B;  3GJR B;  1F9E B;  1RWO B;  2QL7 B;  2XYG B;  3RJM B;  3SIP B;  4ZVR B;  1SC4 B;  2CNO B;  2QLF B;  2XYH B;  1RWW B;  3P45 B;  2P2C B;  1ICE B;  1PAU B;  2DKO B;  1RHU B;  2H5I B;  3D6F B;  2XZD B;  3R5J B;  1RHK B;  2C1E B;  3IBC B;  4LSZ B;  1IBC B;  3QNW B;  2FQQ B;  4DCP B;  2H65 B;  1RWP B;  2CNK B;  2HBY B;  3NS7 B;  5K20 B;  1BMQ B;  3GJQ B;  1QTN B;  4DCO B;  2H54 B;  3D6H B;  3R7B B;  3R7S B;  1RHQ B;  2H4Y B;  3R7N B;  3KJF B;  3IBF B;  1RWV B;  2QLJ B;  3KJQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...