4ZVOB

Caspase-7 variant 4 (v4) with reprogrammed substrate specificity due to y230v/w232y/s234v/q276d substitutions bound to veid inhibitor.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYVSYRVPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESDSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 16
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvoB00
2XZTB 3D6MB 2CDRB 3P45B 2CNNB 2C2KB 4ZVSB 4ZVUB 1SC3B 3D6FB 2QLBB 2QL7B 3R6GB 1RWMB 1RWNB 1RWOB 4JB8B 1NMEB 3EDQB 2CNKB 2C2OB 3R7NB 3R7BB 3KJQB 1RWKB 3GJRB 2XZDB 2C2MB 3KJFB 3KJNB 2C2ZB 5IC4B 2H4WB 4ZVPB 2QLJB 4LSZB 2HBQB 2H54B 2H5JB 1BMQB 4ZVQB 3QNWB 3D6HB 2C1EB 1RWXB 1QTNB 1IBCB 3R6LB 3R5JB 3RJMB 1QDUB 1PAUB 1RHQB 1RWWB 3P4UB 2QL5B 2HBZB 3GJSB 3IBFB 2XYGB 2H5IB 3R7SB 5IC6B 2H51B 1SC4B 2CNLB 2HBRB 2Y0BB 3IBCB 2H48B 2Y1LB 1I51B 2H4YB 2QLFB 2CJXB 2H65B 3GJQB 1RWPB 2CNOB 2FQQB 3NS7B 3GJTB 3SIPB 1I3OB 2XYPB 4DCJB 1RE1B 2QL9B 1ICEB 1F9EB 3EDRB 1GFWB 1RHMB 2DKOB 4ZVTB 1RHKB 2XYHB 2HBYB 1PYOB 2CJYB 4ZVRB 4DCPB 4ZVOB 4DCOB 1RHJB 1RHRB 2P2CB 1RHUB 5K20B 1RWVB 1SC1B
chains in the Genus database with same CATH superfamily
1MN9A 2W7AA 3N6LA 3NGSA 4GVBB 4W98A 4JV0A 3TVYA 4O4GA 4E2FB 2R2TA 4DV0J 2AYBA 3BSOA 2VPZB 1TTHB 3W66A 3G8SA 3A3NB 3J7ZT 1SC3B 4CNYA 2QLBB 2EFOA 2N7YA 2VKZG 1KQGB 5D4PA 2F63A 3RB0A 2C2NA 3DDIA 4IG3A 2YWFA 4KJIA 4RW9B 2HHHF 4C3LA 2HHVA 3HSJA 2OPRB 3OD2A 1NU4A 2Z4PA 2OSRA 3FBCA 3GV7B 4K2XA 4LSNA 3Q8RB 2O5DA 2MKYA 4OZ2A 2E9ZA 4ECVA 3W9IA 2YKAA 2BE7D 3LP1B 4FKYA 1YIJS 1JXVA 1KQFB 3MOJB 4WFZA 1Y3JA 5E3RA 1RAJA 1X7VA 3DKDA 4UUWA 4RJVA 1O51A 3KJQB 4ZVFA 3EZ5A 3D28A 4RBTA 2LYVA 2YWHA 1VIOA 4TLQA 2C28A 1NKEA 2V8VA 1FVQA 4UQTA 2Q1LA 5J1PA 4DR3J 1RT3A 2AYEA 1M5KC 1LXNA 2FD2A 1R8AA 1FWKA 5HMYA 2VC1A 3KHLA 1U49A 2FIUA 4F3OA 2J8SA 4RL1A 2G2YA 2E9RX 3HJFA 2IJRA 4DUYJ 3DLEA 1Q82T 1OYDA 2A2DA 4AL6A 4DR6F 3AH6A 2BUNA 5D78A 2DXDA 4A8QA 3EJMA 1RT1B 4OX8A 3C15B 3ENAA 4XAKA 4U9RA 3THPA 4AXJA 4X62J 3KLGB 2MHEA 5EN1A 2DIUA 1BMQB 1S6UA 4MKAA 2NYIA 4C8NA 1J5OB 1CVJA 2PIIA 4DPWA 2I2YA 1HNWJ 2DR8A 1V3SA 2RAQA 1QTNB 2OUGA 3GYNA 2APOA 2IRYA 3LP2A 6AT1B 3IFEA 1URNA 1UZHA 3IRWP 3QLHA 1RTIB 3SQGA 1EQ0A 4LFAF 5AJ3J 3NL0A 3BBCA 3BKTA 5ETSA 3GFXA 5HQLA 4AL5A 2KG0A 3DMJB 4G1PA 2YPZA 4KPYA 2H51B 5FDLA 1N33F 5RUBA 2F9JA 4X65F 4I4BA 2G0CA 3D68A 3IBCB 4M5JA 3JYTA 3MMCA 3I9ZA 3BPSP 2RMLA 3PM9A 1D1UA 2H4YB 3RAQA 1BWVA 1U2CA 2RJZA 2VPYB 5KT2A 4PWDA 3C6UA 2KYXA 4PQAA 3MMAB 1Z2ZA 2VB6A 5AXLA 3NMAA 3POTA 2FQQB 4QOTA 9RUBA 1U47A 3UWTA 1EIYB 4LRAA 1YQHA 4IFVB 4DV6J 1S1WA 5LMNJ 3WIVA 2CWKA 4FYWB 4DN0A 1DFDA 1HNVA 5EHHA 5J2PB 4JI1F 4FXDA 5L1LA 4RLEA 1IBLJ 3R2DJ 1TL4A 3CIZA 1UW9A 1KP6A 3M2VA 3GILA 4F4AA 2KVIA 3NCPA 1QUPA 1RA7A 3O8WA 3DGPA 5C42B 2KH9A 4ED2A 2AGOA 5L39A 2HVEA 4JI2J 2U2FA 3AA9A 2GHVC 5B0GA 3PR4A 3CJRA 4XPCA 1RHMB 3OLAA 1R7IA 3A3PB 3IWNC 1EETA 2XY6A 4TY8B 1GEHA 2B6AB 1JKHB 3GIIA 4G3IA 1UVJA 1N6QA 2XSJA 3ZTQA 2V34A 4ZPWR 1DRZA 1JX4A 1X4HA 1Q5VA 2PI4A 1TKXB 2HK3A 4DCOB 1QAYA 3DRPA 2DEIA 5DQIA 3PVXA 1L3TA 5GMEA 3FQLA 2CJBA 4M5HA 2W8KA 5J2NA 2VPWB 4UOGA 1FNOA 2DH9A 4IO1A 4B02A 2DGSA 2M3DA 2MYFA 2XI2A 3NGUA 4M1KA 3THTA 4YMEA 4KV8A 1NHKL 3LO3A 3IC1A 3OUYA 5HANA 2E5LF 1QAXA 4ZP7A 2B4UA 2H1YA 4U67Q 2GJ2A 4JI1J 5F8MA 2BZ2A 1SBRA 5T7LA 1WI6A 2DK2A 2WOMA 3PXGa 3WDOA 2DHHA 4JB8B 4CLYA 4CT9A 5KFDA 3K5PA 3T5LA 2J6TA 2F7VA 3J7A1 3FDSA 4RBVA 4IH6A 4UY85 3MAAA 5EX0A 5FLXU 5DG7A 1IR1A 1MMDA 2WONA 2ILYA 2HFNA 2Z2LA 4DX7A 4OI6A 4WFAQ 4RNMA 2I6WA 3BQ2A 1UEVA 1WHVA 4ZJOA 1SKRA 5F8JA 1BQNA 4DSIA 2B9YA 5DZ6A 2B5JA 3SFGA 3TA2A 5KFXA 3TZZA 3UVJA 3PYEA 4RW8A 4ECRA 2R8GA 2F65A 3UE2A 3C3LA 1S1XA 4MYTA 1KDNA 4EYHB 2J9DE 1FJGF 2KVQE 2M9KA 1RAIB 1N33J 1R27B 2DGTA 4P2XA 3ZFVA 4IG3B 1C0UB 4FF3A 4F4XA 3CEDA 3MOZA 3MPDA 2R8HA 4N7TA 2K7JA 3TUIC 4PR6A 2HVIA 1U8WA 4A8YA 4YP3A 4KV8B 1LWEA 1Z2LA 1GMWA 1RJJA 1F5AA 1WD6A 2QLXA 2HGMA 1VS3A 3NCRA 2EPIA 3R27A 2HK2A 1DY3A 3DRSB 4OI3A 3LAMA 1TK0A 4DG1A 1Y5LB 2MTLA 4EGLA 1L3UA 3HT3A 1CULA 3PJWA 1IR2A 3VAHA 4P52A 2BQ3A 2HHHJ 4X65J 2RS8A 4ZVQB 2KXNB 2IIHA 3NGTA 4GC6A 2BRLA 3D66A 5K14A 1H7XA 2HVZA 2NUUG 4Q7AA 3QAUA 4DN9A 2RQKA 1Q1KA 5HP1B 2W01A 2VJVA 2R2UA 2AT1B 3D67A 3I0SA 5HMXA 2AGPA 3TJ8A 4UT4A 3FVYA 5F8NA 1RAOA 1RSCA 3CCSS 3FSIA 1SQFA 4ED7A 1B7FA 5HBMA 2Q6CA 2UUTA 3IAM9 4CLFA 2NR0A 2HZAA 4MH8A 5IC6B 1CJTA 1K1SA 1Y10A 3BZQA 2WCXA 4DL0C 2HBRB 5B08A 2K3KA 3GSIA 1CJKB 3QSIA 1QJHA 5LL6d 5IWAF 2P5VA 3OFFA 2YQ3A 4DR5F 2BJ8A 4P71A 2BV3A 1S99A 3OVSA 4Q43A 1LW0A 2JLFA 5KG1A 3EPGA 1R8BA 3UNYA 2A6MA 1NK5A 2BRKA 1OPIA 2W2MP 2XMUA 2B9XA 2L9WA 3CVKA 2XS2A 3GJQB 4ZA1A 3TANA 2AW0A 1YJNS 2IBOA 2PMWA 4CLUA 3OTDA 2VA3A 4GO7X 3CD0A 2WTFA 1EHWA 2OELA 2A3JA 4DX5A 4X66F 2R7TA 3EE3A 4DPXA 3EVMA 1U1PA 1PJ6A 3RAXA 2J6UA 2FTRA 4ANEA 3IG1B 3UR3C 2NXCA 1SKWA 4LFBF 3CTRA 3IBWA 3V5RA 3DLBA 1WACA 1X4EA 1TL7B 4OX7A 2V69A 1WUUA 4Q45A 1RABB 4OYBA 1CJUB 1Q8BA 4PZVA 4JV1A 3MM9B 2M8DB 3SMZA 3KG0A 3LPEA 1X8DA 1AUDA 2VFSA 1W7WA 4YOEA 2BM1A 3MF5A 4NLWA 1RTZA 2M4MA 5K9FA 2D3OR 2F4VF 1DJ0A 2ACYA 2FJAB 2Y3YA 2EFNA 4Y00A 2DGWA 1U1MA 2HHSA 1RLDA 4P74A 2GAGC 2VPXB 3SSSA 1PJ5A 3TNVA 1HR0F 5AE2A 2HFOA 3JAMY 4FF1A 1S1WB 3FNNA 1UVIA 3D6MB 4DBQA 3HF5A 4MIAA 1WTFA 1WKKA 2ROGA 3NOCA 4OYWA 3M6XA 2KFYA 1KLMA 4PABA 2ZJQQ 4A8OA 1NDKA 2P6SA 2V9KA 3ELHA 3PIOQ 2DRAA 3HHNB 3GQCA 2B6AA 3MPWA 4NLYA 5KT4A 3KK3A 3TJAA 2YNFA 4LSLA 3X3UA 4J9KA 3SYZA 2KO1A 2LXIA 3OTCA 1G4CA 5E0OA 4B3MF 4ZS6A 1U1OA 1U26A 3UQSA 2NYHA 3NGRA 4J9PA 1S6QA 1NMEB 1F9FA 1UPMB 2RB7A 1LWCA 1PGZA 1H72C 1DQAA 1K47A 2FGOA 3AD7C 3EZUA 4OI4A 2F4VJ 1IM6A 2G1HA 3R5CA 2JLGA 2DHSA 1Z4UA 4P2MA 3K2YA 1WORA 2HQ3A 2B4OA 5KG2A 2QX0A 4AL7A 1UWBB 4U95A 1ZAXA 2WSFC 3CJ0A 4LRFA 5ETPA 3N5FA 2NZCA 4N5SA 3D1QA 2RF2A 1SH2A 3DOLB 4DV0F 3R1LA 2EK6A 4Q44A 2IA0A 2Q3PA 2ZH7A 4DR6J 2F3JA 3HFZB 5BR8F 2C2EA 2YKNA 1FERA 1FX4A 3DXBA 4DQQA 4H4KA 3MTKA 2QLJB 1P8GA 3GG1A 4X4OA 1KLMB 1T03B 1DARA 3UCUP 4YUDA 2WOMB 4LREA 4FYYB 3W9HA 1T9WA 2YNFB 4LSLB 3TVZA 1HBNB 2XSFA 4Q0BB 1EZZB 3DHXA 2CG8A 4PYDA 5L1JA 3HVWA 2HG4A 1LKZA 4B3TF 2GMJA 2XQCA 2GQQA 1TUWA 2CWXA 3NBPA 2A6OA 3NWRA 5FIIA 2JEIA 5B09A 2WB1D 1D9DA 5C2GA 4ECWA 3GCWP 4TU8A 2XNRA 3R9LA 1NM2A 1E6VB 3BSNA 2UUCJ 3IBFB 3M8RA 1HHQA 3PW4A 4LJMA 1Y00A 4K5SA 2VOPA 2HS0A 2Y8YA 4A4JA 2FY8A 4WYLA 4WK1A 1WNEA 2VFUA 2POKA 6FDRA 2W4PA 2Y0BB 5D4OA 4LF5J 1D9AA 1NJXA 2Y1LB 2W24A 2QV6A 4QR0A 5GADI 3IXQA 3M9OB 4PG5A 1HBMB 1BWEA 5E3QA 1P27B 3JQJA 2H65B 5KG3A 5AE1A 1QSYA 3VAFA 4X62F 1VQMS 4J9UE 4I69A 5HSPA 3HZEA 4LF6J 4YQWA 1M90T 4DR7F 3HLUA 4DU7A 2CIMA 3H20A 5I3UB 4DUZF 1CPZA 3P5BP 1UA0A 2R2SA 4JBCA 1WWHA 3CDWA 2E5HA 3KKFA 5DQGA 2OEJA 3CCVS 2ZD1A 2B9EA 3D2WA 1N8RT 2HPUA 1KOOA 4LFAJ 5IM0A 4IH5A 3QRPA 3D0IE 4ZVTB 1RHKB 2DNMA 3ZC4A 3GP9A 4UQGA 5GAGU 1K73T 5SZTA 1MWZA 3TUJC 3V4MA 5KFOA 3EPIA 1FK9B 5DM7Q 1HI0P 4PWUA 1PAEX 1OY6A 2B56A 2MEWA 3W8PA 3GLJA 4CH1A 3A1YG 2AJ4A 3BR8A 3GG0A 5THWA 4USJC 3GMGA 4CP5A 2HMIA 1AXQA 2XULA 2DR6A 4KQZA 4URQU 1VHFA 2CZVC 3HSZA 4XIUA 2HKEA 2IC3B 1FT8A 1S0OA 2R7WA 5J2MA 1VBXA 3C2PA 5DLFA 4NZ6A 4RX6A 4ATNA 3BGRB 4ER8A 1SJ4P 1CJUA 2DGXA 1OQ3A 2FJDB 1WOPA 2XI3A 1C1CB 2VG6B 8AT1B 3TUPA 4WTOB 3W61A 4AQYF 2FPHX 3AOBA 4DF4A 4EO6A 2DRDA 2GIRA 2QL7B 2UZAA 3MM9A 2R9LA 4CIOA 1VBZA 4PWDB 3RG6A 2AJQA 2ALYB 2ZKUA 2GFFA 3BGFA 1FD2A 1VJWA 4LIWA 1LFWA 2BANB 4K50A 3VAMA 4CZCA 1X5PA 3KNGA 1SB6A 2G2ZA 2CNKB 2Y9HA 1X4DA 4K4ZA 3DOMA 4ED4A 3CCRS 4K4YA 2ZBCA 2YH1A 3RGIA 2CQCA 2VG7B 3PY8A 1FI4A 2VBYA 3CCES 3O6QA 3CDAA 2JH3A 3VHQA 5CCLA 1HBOB 4XDCA 5KFCA 4A8MP 3IRXB 5LSLA 3G8QA 4RNOA 1NJYA 4FF4A 4TQRA 3QGPA 2HFZA 5CYJA 2CZ9A 3BS9A 3JQKA 5KFAA 4IQXA 3OFHA 4LFBJ 2KRRA 2LQ9A 5F3ZA 2W8LA 4A8FA 5BYSA 4JP8A 5CYQA 3QGIA 3FBBA 2IA6A 3DMJA 1GTHA 1VRQC 2BYCA 2DNOA 4HACA 3VAGA 1H98A 3ZZOA 1IBKJ 2KJVA 2XS7A 1JMTA 1N88A 2CA9A 1PSDA 3NAHA 4JV5J 4FBTA 1KOHA 1D9FA 1PBUA 4PUOB 4K0KF 1T0TV 3ZTSA 5LT5A 1MU2B 2OTJS 5CH7B 4NZ0A 5A8RA 1U4BA 1FRIA 1QY7A 4NRTA 2XMAA 4PQUB 1DLOA 2E1AA 3OV7A 1T3NA 3QNWB 5GAEU 2QZ8A 4RWWA 1IM4A 4DU8A 2UUAF 4JI5J 2VICA 4ZKAA 4WYWA 3L09A 1M5VC 3JSYA 1T02A 1EJ7L 1HBOA 3AHPA 3OSPA 1Q81T 3BEGB 4DV5J 1PCAA 1X5OA 4CWBA 1J5EF 1X0PA 1FRJA 2PN6A 4ELTA 4LRBA 4BCAA 2D3ZA 4C98A 5DGBA 2H9ZA 4USKA 2KN4A 2VG5A 2ZVIA 4F67A 2B7BB 1ZA2B 2G13A 2K2PA 3ETOA 3TZXA 2HIYA 1TL5A 2FHKA 2AV5A 3K5LA 4IO9Q 1WC1A 3PDNA 2MKJA 4IG0A 3TEHB 5LXYA 5LOQA 2ZM6F 5DDRC 1LFPA 1BY9A 4NLRA 1SIZA 1P1LA 1R3NA 2VBZA 3TZYA 4YY3J 2HWHA 1HMVB 3IA0A 4M5NA 3KDOA 1QE1A 2W2QP 3QT5A 4ANCA 1WTBA 4PRFA 1X4CA 3CJ3A 4CQ1A 4NI2B 2C3OA 2G1DA 1REVA 1GMWD 2IAJB 3PR5B 4LIRA 5F0UA 1SH3A 3OTOF 4A8SA 3T1YF 1CS4B 3MUVP 1VHIA 5KFNA 2RDJA 2UVWA 2AJ2A 2ABYA 2PT0A 2V8GA 3M7VA 1HBUB 1JNRB 2AX0A 1JLEB 3F56A 3C66A 3JSRA 1N5YA 1JLAB 1NPPA 1HQEB 1VK8A 3LANA 1BUXA 3MECA 4NMLA 4EU0A 3HO1A 1LNQA 4X4VA 2JJ4D 3K89A 3M8YA 5U47A 3W7BA 2H5EA 2DCUB 3OW2R 2D3O1 1ZTWA 4OIXA 3VGVA 3CD6S 1OY8A 2GMHA 1JJCB 2V8DA 3MEEB 4FVCA 4W4MA 3UDLA 1TFWA 1D8YA 5IQQA 2QGFB 1S49A 2D74B 2AX1A 2GW8A 2XMJA 3ENWA 4Z2XA 4IG0B 1M5HA 1RHUB 3A12A 4H4OA 3TA0A 2MY8A 3NAIA 3RBDA 1LK7A 2FC8A 2V8HA 5KFZA 2FVQA 2EKYA 4DSFA 2XB2D 1F2HA 2SXLA 4TYBA 3B4DA 3PHTA 2V2KA 4FS1A 5D0RA 1TUVA 2VIHA 1KVKA 3BB5A 3GYGA 3JYTB 2DCLA 3QIPB 2CPJA 3RUBL 3JTOA 2MZSA 3KLEB 1LW0B 4JUZA 4RU9A 3OL6A 3E3XA 4GKKJ 1RAEB 3IWLA 1VQKS 4ZCMA 1XMOJ 1FWLA 2BW7A 3AQOA 2EK1A 3FEYB 1NSPA 5G4DA 1MWQA 4B17A 4NWBA 4DQSA 3G6ES 2FLOA 1PILA 3FJ2A 1JLEA 3MEGA 1QD1A 5D3GB 2MQNA 1N5YB 1L3SA 1H38A 1HNWF 4RNFA 2WSEC 4NEYA 3CUNA 1GXLA 2BKOA 4JOUA 1Q53A 2DGOA 2HAIA 1K1QA 1YJVA 3J80U 2NLWA 2C3PA 1Y3KA 2CQPA 3CWJA 2QYGA 2ZC4A 3M8PB 1RQ0A 3UR0A 1PC5A 2AEJA 1TMMA 5ADZA 3SXLA 2IM0A 2OFGX 3CD7A 4MAKA 4TYAA 3KHHA 1VQ9S 3MR3A 3ILLA 4GKKF 2CXEA 3MM6B 2VZ9A 3T6BA 4PUOA 2KYZA 5HROA 3G82B 2BJ9A 4QWCA 3LWMA 3SI8A 3H2LA 4OHXA 3GFZA 3W2WA 2E5GA 3CJ2A 2BKPA 5J2QB 2H4WB 2HVHA 4FXVA 2IM3A 1RYRA 2CVIA 1D0EA 2QEXS 3MR5A 3SZ2A 4U8VA 1UEUA 2FHMA 3MTJA 5GADU 1S59A 2F9DA 2FZGB 3TYTA 1YJTA 2EEYA 5CZVA 2VH7A 2YH0A 3A3OB 4KR0B 3IRXA 4PXDA 3SV3A 1S79A 3C6TA 1HPZA 2OKQA 1S9GA 2FUG9 3I0RB 3K59A 4JI3F 1YHQS 1UW4A 3D6HB 3RYLA 3W9JA 2C3YA 1LXJA 1WEZA 1K9MT 1G3OA 2FVCA 4G6VB 1C2PA 1NXIA 3GR0A 5D6GA 3AOAA 2XC9A 3MD3A 1CJVA 3M8PA 5E3CA 3BREA 2IMWP 2EKNA 4ZCIA 3EVOA 2XY5A 1R0CB 4HKQA 3R8YA 2Y8WA 2DITA 2V2ZA 1NNDA 4CH0S 1H3DA 3RB4A 4ZLNA 3N28A 1TL7A 3L9ZA 2CQIA 4C3KA 1HNXJ 2UUBJ 3G82A 2I5JB 1U6BA 2FJWA 1CLFA 3QWPA 1TKZA 2CJ9A 1SL1A 4K4TA 2VQEJ 3D1OA 4CYUB 2AEMA 2CQHA 2RE1A 4RNHA 8RUCA 4QWEA 5FD1A 4MKVA 3RW7A 3DFEA 4OYAA 4O3QA 2MZRA 5KFEA 1ELOA 5D77A 3KUGA 2XZWA 1MLAA 2CQ0A 2V63A 1F2GA 2NXEA 3M2VB 4ZVGA 3V6DA 4YB7A 3PTWA 4DR4F 4B3OB 4Z7CA 1JLQA 1N0VC 2MPUA 2HEKA 4DL5A 3BSCA 3HHKA 1R0AA 2V94A 1L3VA 2LKZA 4BC7A 5KFKA 5B0DA 1C0TB 2PMHA 2L41A 3KHGA 4KBIA 5H9EK 2BOAA 3OL9A 1DQ9A 5IT0A 3V4IA 4G65A 2ROPA 1RU1A 2N7CA 3ICLA 4BHQA 1HNIA 3LH2S 2I9SA 1JKHA 2RQMA 3DRRB 4KYZA 3UDEA 4J9QA 2YQ0A 3EVWA 3MR2A 1GFWB 1TL1A 2DKOB 3KK2B 1XNRF 2DNGA 3LWLA 3MEKA 3AOCA 4OJGA 1GK8A 1IKWA 1BXNA 3D0GE 4ZIVA 3JQMA 3OLBA 1VISA 4I7FB 3I0SB 3TZWA 2DNKA 5H9FJ 2ZE2A 4OYIA 4OHZA 4CM0A 3MM7B 3G4SS 4DV4J 4O4GB 4ECTA 2GMLA 1TELA 3BKFA 2LXUA 1RHJB 1S4FA 3I4PA 1S10A 3R2CJ 2FDNA 3VTIA 5H9EJ 1V3ZA 2IJFA 1URRA 2XCAA 1G6BA 2Z58B 1F6TA 4RW6B 2A10A 2CDRB 2V4JA 3OR2B 2LQBA 5E2QA 2IVFB 1HQEA 3R3TA 4ID8A 4D3GA 3V6DB 2FJVA 2VA2A 1B99A 4LF9J 5C5JA 3DI6B 2QC3A 2ZM6J 3CDEA 3QFWA 1VC0A 2ZBPA 4FPRA 2ZH6A 1QAIA 4LBIA 1YVFA 2OSQA 4KHMA 4URGA 5DLGA 3PKMA 1RT6B 4KH0B 4M5MA 4JI0F 3GE9A 5KFYA 1NK0A 3ENVA 4NA1A 1HQUA 2RSQA 1LW2B 3WX8A 5CAAA 4OX6A 2CDQA 2MMYA 3UCGA 1QAJA 1P9QC 3JSMA 3P3DA 3D54A 3I87A 2AGQA 3O5TB 4DUTA 4ED6A 3C16B 4L6V3 3ET6A 2CFXA 3C14A 3ITHA 4ZP8A 3R5BA 4HL9A 2IRXA 2C2MB 2CVEA 3D5MA 2JOQA 3FCWA 3N6MA 3PX6A 3O1LA 3RU0A 1KS2A 4M94A 4IOAQ 2GIFA 4L3NA 3KLGA 1VI7A 5DJBA 4EMDA 1LWEB 5EWFA 3ISZA 1FNMA 4ED8A 2AJFE 2ZDPA 3J81Y 4LF6F 3QQCD 1JLGA 2CPXA 2DNPA 4I64A 5HK4A 3GIMA 1IKVB 4NPOA 4USHA 4LMZA 2ZHOA 4F0MA 2H5JB 2XHCA 2KHDA 4YB5A 3W64A 4N56A 4NLUA 3VAKA 1UJ6A 2A2CA 5KFHA 4WWSA 4KHPJ 4X64J 4DDFA 2PFDA 2X1FA 1FVSA 4USVA 3N6NA 4C0OC 2W9AA 4MTPA 2Z2MA 1IJEB 2AZ1A 1RTDB 2DPJA 4GKJJ 3MCMA 4AT1B 2VC0A 4NA2A 4WTYA 2Z57B 1Q7LB 3A8JA 3TO8A 3C16A 4F26A 3N5BA 4ZN1A 3I5BA 1HYSB 4F2SA 3FSYA 2X1BA 4NYZA 3BN4A 2CADA 1NB7A 1FTRA 1N32F 3T9ZA 4I68A 3R7SB 2OPQA 3HDSA 1LWCB 2CQBA 2J7WA 3NGKA 3QAEA 3DOMB 1NHVA 3SSRA 2IMOA 2MZ1A 4ECUA 3RBZA 1O5JA 2BE9B 3CCTA 2RHQB 3I9V9 2WHOA 1S12A 2HRYA 1ZM3A 1JNZB 1VBKA 2VV5A 1T9XA 4EO8A 4YDDB 3DLKB 4KB7A 2GVZA 1S6OA 2G2OA 3UD5A 5A8KB 4NCGA 4QIVA 3W63A 2OIHA 3TEGA 3DGPB 5C42A 2HHWA 4USIA 1RUSA 4DEZA 1KWMA 2UV8G 3IG1A 1A0OB 1FRXA 1C4AA 3HFVA 3T41A 3WC0A 5AXKA 4AQYJ 5L46A 3FC9A 1C4CA 3FBFA 1M5OC 2ACMA 3FFIA 2IC3A 1NK4A 4JI7J 4DCJB 4JI5F 1RE1B 1CG2A 2HHPA 2F1FA 3AY0A 1JLBA 1N5QA 4NYOA 2R7RA 5KFBA 5ETNA 3RRGA 4RNNA 6FD1A 1V5VA 2J0QD 5D4LA 4FVMA 4WPAA 4WU3A 2UUWA 3TRGA 1SIWB 3CC7S 2NXNA 2KXFA 4GC7A 5J2NB 4DV7J 3I82A 2ZZNA 5LSRA 1SL0A 1LOUA 3L7OA 4QPTA 4CRJA 5BYRA 1NCLA 3M9NB 1O6XA 1S1VA 9ATCB 2HBYB 4B3MJ 5KT6A 1REGX 2RQ4A 1RHRB 4JI0J 2P2CB 4J9LA 2LEAA 4H4MA 1RDRA 2B9WA 4U6PA 4B3OA 3LUYA 1IQTA 4OYPA 2LP4A 3SEOA 5L8RC 4A46A 1I94J 1LWXA 2CNNB 1VOMA 1XIQA 3O44A 3SCLE 4ITSA 4Q2MA 2X51A 4UW2A 4ELUA 2EC0A 4O44B 2LECA 1S97A 4DR7J 2G0IA 5H9FK 1VQOS 1MW7A 2D7SA 2RHSB 3T1YJ 3CSKA 3OTOJ 4C48A 4QIFA 4DPYA 1S9EA 4QZVB 1KQSR 1KBRA 3GIKA 3MPUB 3QSYB 1Q7YT 1RT3B 1VC6A 4YR2A 3R7NB 2PC6A 2MZQA 1RGVA 2GHPA 2EFPA 1UVMA 1IKYA 4L72B 1YJRA 4GO5X 5KFVA 4V19X 4UOHA 2ZH2A 4Q5VA 1N4LA 1CSJA 1PYSB 1BHNA 1AB8A 2RU9A 3Q2TC 1S1UB 2MDAA 2HNZB 1UVLA 1N5TA 3Q2SC 3LP0B 1XNRJ 2EG1A 3G86A 1WC6A 2M8HA 2J0XA 2HAFA 4M5DA 3NP5A 2YKOA 4Y0FA 2E1PA 4AXIA 1H0HB 3M4XA 3V81B 2KU7A 3MGJA 4ILLA 4FPIA 4ID5A 3DLJA 2AYGA 4J9SA 3GSDA 5B0CA 4DV5F 1F5CA 2OHDA 2Y0SD 4HHUA 4DPOA 2PA8D 3ZZ0A 4E98A 5HMWA 1TK5A 2R7VA 3OQ2A 1U02A 3M30A 4RW4B 3LP2B 1RT6A 3HZGA 2HFSA 3M8ZA 5M2UA 3SV4A 2DPIA 2J9EA 2VASA 2NQPA 3IWXA 5F8HA 2R7UA 1U1QA 3OL8A 2FHJD 3CC2S 3OVAA 4DQPA 2LA6A 4F3QA 3G8TA 2QL5B 1YRXA 2K1RA 2HZVA 2RS2A 5K5MA 1SKSA 3DLLQ 1ROFA 1YDLA 2V50A 2WW4A 1G1XA 2GQ2A 2VF3A 3K58A 4NYPA 4DHVA 5IFMA 4JI6J 3MEGB 5D3GA 1SC4B 2J76E 2LA4A 3E01B 3TX8A 4OYZA 4B9VA 1RACB 2I8EA 3G6YA 4RW9A 2DR9A 2VFRA 2VQFJ 2ZWOA 2OPRA 2MJNA 3M1VB 2YNHB 2OFHX 1JWWA 3PEHA 2VJUA 3QYYA 4K0KJ 3EGVA 1NH7A 1U6ZA 4LF4J 1XJWB 2KM8C 4HTIA 3MFIA 3K7RA 2RIJA 3UPFA 2YX1A 1NPRA 1YZ6A 4ECZA 3S01A 2J7KA 5EWGA 2QFJA 4DF8A 2EW9A 4WFBQ 1ZAWA 2M70A 2JFDA 5KOXA 1EETB 2ZITA 5H1SV 2ASLA 2E1RA 2P9EA 4TY8A 2BW2A 3KWMA 4ECXA 4FYXB 2O01C 4ES2A 4EWTA 2QL9B 2QSFA 2R7QA 1KKHA 5ITHA 1TZ0A 2GVDA 4GMKA 5A0YB 4EBEA 3EDRB 1FK9A 2PE8A 2VFTA 3J81j 4J9MA 3DC2A 3KLVA 4CNZA 2YBVA 1UWAA 1DBDA 2D9OA 4NL5A 3SQOP 3J81U 1VRTB 2D1CA 1B0VA 2IYGA 2VQEF 1I6JA 2MGZB 2VDIA 1RAGB 1NSAA 3GTYX 3AAWB 3M32A 3SBMA 1NAQA 1WI8A 2CPEA 1P1TA 2EFVA 1GTEA 4EBDA 2JC1A 2BJ3A 2ZJPQ 4LF5F 1TUGB 4IDKA 3ILIA 5JXSA 2F5GA 3ENQA 1HIYA 1ZM4A 5L9NA 4IRKA 2G0JA 5I42B 3MM5B 5F8LA 2P9CA 2YKQA 2H3EB 2HQGA 4M5LA 1WC0A 5HATA 3BO3A 1U7LA 4LF7J 2I5JA 2GC8A 3K5OA 2K8GA 1S4EA 1Y7PA 2DHGA 4ZVUB 4X2BA 1U0HB 3C6UB 1Y4ZB 3Q22A 3H59A 2RILA 2VU5A 3GB0A 4O3PA 5DO2A 1ZPWX 1FKPB 5KFUA 1NSQA 5F8IA 2CQ1A 1Q79A 3PYFA 4MMOA 4DUZJ 4WJBA 3TAQA 1XR5A 2E5JA 4WFXA 2YKPA 2GO8A 3PNIA 4KIAA 2MQQA 4C8ZA 2CPZA 4HEA9 1JQGA 3GWCA 4O4RA 4K2JA 5AXMA 2W1BA 1S1XB 3NS5A 1FFWB 5K8NA 4DR2J 2B43A 4ED1A 3VAIA 1KFSA 1IWGA 5MLCV 2Q43A 3D4JA 3W3SA 3PACA 3FSXA 4ES3A 3MMAA 3TA1A 1S9GB 2KHCA 4HVZA 1WG1A 4RZRA 4UZBA 1JK9B 2DNNA 2VOOA 1E6YB 2DR7A 2YTCA 2DO4A 2XLKA 2YWEA 1IKXB 2XZDB 5G0RA 2AEFA 2JDJA 2ZVSA 4KGZB 5CABA 4ALZA 2B3TB 4RR5A 2ZJRQ 2UUBF 4MFBA 5DG9A 2EI5A 2N3LA 2BQRA 1Q78A 3CJQA 4B08A 1B64A 1DZ5A 4PG4A 5BXIA 4OV1A 3PEJA 4YR0A 3HM9A 2NUHA 1X4BA 5HL7Q 2KM8B 2J6SA 2VL1A 1VRUB 2Q79A 2XEXA 4N8OA 3IS9B 5A8RB 4OZ1A 3PW2A 2NREA 2ZH3A 1T03A 4DL6A 3C19A 2CPFA 2P8IA 4DQIA 4A47A 1H6KX 4RKUC 1VCTA 2ZH5A 4QYZJ 1B7YB 3C46A 1APSA 3NBPB 1H2UX 2CPIA 2BM0A 5C24A 2PD1A 2HNZA 5HBMB 1FDDA 1RT5A 3IMQJ 1E6VA 3AT1B 3PYGA 3JTNA 1OIAA 1FDNA 4USUA 3R6LB 3HHLB 4P75A 2HBZB 1WHYA 1NKCA 2FZCB 4A8WA 2BE2A 4DR1F 4OZ0A 4B9UA 4KY3A 4YFUA 3CULA 1E6YA 1YKWA 1DURA 2DXEA 2H5IB 1DHMA 4URSA 4UF4A 1N36F 1S76D 3T5JA 2WONB 3L7UA 4ID5B 3ONQA 4DZ6A 4F04B 1HQUB 5DG8A 4IYQA 5IV4A 4ZP6A 3KLHB 3P49B 2DGUA 2PMZD 2HLUA 4LSNB 3CJKB 4IRDA 5HO4A 4L3KA 5T7LB 3G9CA 3M30B 4GRSA 4RW4A 5C25A 4KO0B 3K0JA 1KSPA 3GR1A 3M2RA 4DV4F 2J8AA 1RADB 1YJ9S 4EZ9A 3D7SB 2KG1A 3C14B 4DSEA 1HWJA 5CD4A 2ATLA 2CJXB 4PG7A 3PV8A 5KG6A 1P9YA 5KFPA 1TFYA 2FB0A 5KG0A 5HROB 4LR8A 1JLFB 1R0BG 2AHOB 1SJQA 2WZ1A 1CS4A 2BOPA 4C8KA 1JJ4A 3TUZC 3VVTA 4R8UB 3V6JA 3OTEA 2O67A 4DV2F 2OGUA 5EDWA 3G6VA 2UUCF 1I3OB 2XYPB 5JUMA 1KHWA 3WX4A 2C2DA 4Q8EA 3HD1A 3HI9A 3EICA 3GFHA 4K5RA 3UCZP 2I0XA 1SV5B 1TP7A 1MROB 4P2FA 1VQLS 4G1IA 3TR5A 4DI6A 2V2VA 1KVIA 3FQKA 5J1NA 3U1MA 2HHXA 1YTYA 2X7IA 3DHWC 1S7IA 3QLHB 4PEOA 3KUHA 3ULHA 1BQXA 1YRTA 3IR6B 3KG1A 2IY5B 1HWLA 4Y2AA 4P9SA 3U27A 1RTDA 2QJ3A 3O2IA 3PRBA 1HQ2A 2OJ3A 3LA0A 1H74A 4RUCA 3MR6A 1FKOA 3PX0A 1FCAA 5K20B 3BR9A 5CA5A 1XMQJ 1SC1B 5AE3A 1KEKA 1JLFA 2RVJA 3OXFA 3MDFA 2HFVA 4DLGA 4PG8A 2M5YA 2Z8QA 1DQ8A 2KT5A 3NLCA 4RO0A 2NXUA 3DLHA 4DV6F 2UUAJ 3H8YA 3D6FB 1RBAA 2XGQA 1RWMB 3DU5A 2GNKA 4TN2A 2PO4A 4BLGA 3OJUA 2HSEB 2EVZA 2ZBIA 3HMJG 3H40A 4DSKA 5KFQA 3QGGA 1UAWA 2GA7A 4B3TJ 3Q24A 4JI3J 4NLQA 1RKJA 2C2OB 1X4AA 3OBIA 2NCKL 4KGVB 2B8QA 2DNRA 2MQ8A 3W62A 4AYBD 5HLFA 3P96A 1KN6A 1FDBA 3CB4A 5J2PA 1RTHA 4U7UK 1ACMB 2OPSA 4F50A 5DGAA 5C7PA 2L9NA 3MM8A 1MU2A 3I4HX 4LF9F 4RUHA 3KNAA 3C8YA 4DFPA 2CG4A 1EP4B 4IUFA 3PFEA 4ZVPB 2MSTA 2N4DA 3QWUA 2YX4A 1ZZFA 5IT4A 3SFUA 3PFOA 5L1IA 2B4VA 3LGMA 1HARA 4YR3A 1OWXA 1N56A 2PA3A 1Q0NA 4DR5J 4YY3F 2DNQA 4X4QA 2OEMA 5LMUJ 4C11A 3TQ1A 1RAFB 4H4MB 4CO4A 4QU7A 1Q95G 2WK4A 3R5AA 5BJRA 1NHUA 2E44A 3W5YA 3VAJA 2V0NA 5HN0A 2PSZA 2PEBA 3I56S 4DQRA 2B51A 1IBCB 3IR5B 2UVRA 4XDDA 3CC4S 4YB1P 1OQ6A 1RHQB 3T5HA 4DMZA 2UV8A 1IBKF 3DCAA 4WIQA 4FNIA 2RU3A 4L76A 2XMMA 1KTVA 1UCNA 5HP1A 4X4NA 2NXJA 2OMOA 1RTHB 3IS9A 1QSSA 1SUQA 1AUSL 1WC5A 4LQ9A 3M8WA 4ECQA 3IAS9 4CO0A 4KH1B 1O0PA 1U8SA 2CUYA 3M2UA 2CNLB 3AA8A 1EKSA 1JLCA 2CYYA 2W9CA 1NDCA 2OP5A 4RW8B 4UZCA 3NWGA 2PDAA 4GVBA 1S0NA 2UXCF 3AD9C 3FZBA 2KT3A 3DLGA 4OYMA 4ZPBA 4Z7YA 3TAMB 1N5SA 3DGVA 1JLQB 1G2EA 1C0UA 4Y6IA 4ZHRB 1FRMA 2YKNB 3BBFA 4J9VA 2DIVA 1KNZA 4KSEB 1S1VB 1JB0C 3JAMU 3I5AA 4M5DB 3M8SA 2ZOFA 4F4YA 1M1KT 3KLIA 4USMA 1RT4B 4P7TA 2E1MC 2VBXA 4WKYA 2BABA 1BGXT 3IM8A 1SQGA 1J2VA 3N9UC 3Q83A 4F0HA 4ED0A 4OJ3A 3P5TL 3MECB 4Y3CA 1S1TA 2MKKA 3CXCR 5DS7A 1LWFA 1RZMA 3TX0A 5LMNF 2Y1RI 5F8GA 4IQMA 2HHUA 5CD4H 4BWJA 2JVOA 3MEEA 4FNHA 4ZJQA 3KDNA 4FKXA 2OTLS 2HHQA 1VDHA 2Y1IA 2YPYA 1SUQB 3S6EA 3LALA 3H7HB 1I1GA 2M0GB 4WFYA 3QRQA 4M8LA 4UUXA 1N5VA 1NZAA 4QYRA 4CI0B 1PC4A 5B7WA 1YITS 3GYXB 1IN0A 2Z0GA 3CCUS 4H4OB 1D3WA 4N76A 1EARA 1EX8A 1TKTB 3OFGA 3KUEA 2W9BB 4CO2A 3BKUA 4CO3A 5D15A 1UVKA 2O3DA 2QTWA 4KGXB 4RW6A 1ZS6A 4YHHJ 1XWLA 2YQ1A 4J37A 4HDHA 5I3PA 3TAMA 2JEJA 4RW7B 4KGKA 1FESA 2HNDA 1FX2A 3AB2B 4R8UA 1ZM2A 4DPTA 1XBWA 2W2OP 4ES1A 5GAHU 3EUNA 2KXHA 2AIRB 4EBCA 3MI7X 1RU2A 2U1AA 2GX8A 1NK8A 3KLIB 3LTOA 1FJGJ 1FXLA 2KFNA 1RKIA 3NMRA 2LCWA 3LGNA 4O3NA 1VQ4S 4DV2J 2O1PA 3BN7A 2R8JA 4MKBA 4B3RJ 4Y2KA 1T9TA 4WP8A 4DL3A 2RUGA 1AZSB 2RKIB 2YNHA 3N4WA 3DLKA 4OFZA 4P7VA 3UN5A 3ZNUA 2YNIB 2DGVA 2V5HG 4AUKA 1NEEA 5HJYA 1SXLA 1W25A 3U1LA 1RTIA 3SQGB 3VGUA 4BBYA 2GJFA 3VQTA 1HNZF 2OAUA 3AFGA 1ZTTA 3NS6A 4ZN3A 4QPXA 1HKAA 3DNCA 4IOCQ 1OSCA 3E8OA 3DRXA 3G87A 3GFYA 3M9MB 3W2WB 4EFAC 2JFKA 3NNHA 1VC5A 3OTBA 4K59A 4Q2LA 3T9NA 5HAOA 4X4SA 3IP0A 5FJ4A 1FNXH 3MHYA 1F0XA 3KMSA 2BXJA 2QA4G 1ZA1B 3AD8C 1H73A 8ATCB 5GVQA 1W26A 1JIHA 2YX7A 4M63A 2ZBRA 3H5UA 3RBEA 1FXRA 3OSNA 3V6KA 2C22A 3RRHA 1DAXA 2R7OA 3LOUA 1HFEL 2IDEA 4R0EA 4ZLLA 5KFJA 1BQMB 1HPZB 1UMJA 3HVTB 1SJFA 1UFKA 5HVFA 1R31A 4HI2A 1GXTA 4I2PA 2HQFA 2NSCA 3KJVB 2HYIB 1OMSA 3BO2A 1R8PA 2GJIA 4OV6A 4I2QA 7AT1B 4KE5A 2XGPA 3OT9A 1RISA 1XTZA 4LR9A 2MKIA 1RLCL 1MG7A 1TL3A 2OPSB 3ILJA 3W60A 2OH2A 2DHXA 3HSDA 1HI1A 3I0RA 3JSBA 1WOOA 4Y65A 3HVRA 2VKRA 1HNZJ 3T6JA 2X1AA 5LMUF 4EUVA 1HBNA 2LLZA 5HLFB 3QJPA 4Q0BA 1WG4A 3W2VB 1RWWB 1YSJA 5J2MB 3FRZA 5A76A 3E51A 2JHEA 3OVBA 4OZLA 1UKUA 3R5DA 1AFJA 2LU2A 4I1TA 4PXEA 3Q23A 2GHWA 2A0FB 2HQCA 3EGNA 3FEZA 2WRMA 4WU2A 3KK1B 1ZETA 4O3SA 2XG8A 2DT9A 3JTPA 1N52B 2OPPA 2COLA 3OHAA 2FVPA 2A1BA 4IRCA 3BO4A 4B9LA 2W25A 4DOZA 3BBBA 1I51B 3BGOP 4J7CA 3UI3A 3QRRA 2KT2A 2ZH4A 2VBWA 3BGUA 5I4MA 3PG9A 1VBYA 4I6AA 1CBKA 4P73A 1SJRA 3OUYB 2BR0A 3GV8B 1TAQA 4MFBB 3ADAC 3HVAA 3DOLA 1N36J 4ERDA 3CO0P 1CQNA 1N48A 2HVDA 2JVRA 3VWSA 3AQPA 1GH8A 1TK8A 2BQUA 3KOAA 2E66A 1VLOA 4KFBA 2GS8A 4ZCKA 5J1EB 3KK2A 1FRKA 2IYIA 3ZZUA 1JLCB 4W92B 4NOHA 1FHTA 1T3OA 2EFQA 1ZPVA 2ZE2B 3CJ5A 3DRRA 4FZVA 2HLTA 4KT0C 3TQEA 4I7FA 3KLFA 4F4ZA 2ALZA 3SCJE 2ZNZA 3Q8VA 5F9LA 2ZD1B 4OHVA 3VALA 2D9PA 3US5A 2J9CA 2M2BA 2E7XA 5B0EA 3RRKA 4C8YA 1QM9A 2AZ3A 5IM0B 2AWZA 2OPPB 5KFMA 3DRPB 1X4FA 2V68A 1PYTA 4TU9A 1T95A 2EC2A 3BGLA 4A48A 3U1NA 1Y9OA 4J5OA 4OYOA 2Q6BA 5L1KA 3G96A 4LRDA 4ZMMA 2ZUAA 2F8MA 2OLWA 3QZ8A 2QFIA 1HWUA 1RWVB 2LU1A 3EWGA 3EXCX 3NXZA 5CZXA 2NPFA 5HVGA 5K8OA 3W8GA 1IBLF 2FVRA 1GAOA 1NJIT 4LQ3A 2KFZA 1K0TA 1TVRA 1X4GA 4NLTA 3CJKA 2X1GA 1CC8A 4ZVSB 5A8WB 4FDFA 2LQ5A 1VK3A 2HNYA 3GCXP 3HKZD 4BS2A 3HHLD 4F4WA 5FDLB 1TAUA 3H25A 1EKRA 2HS4A 3R6GB 4QR2A 4A8KA 3VGSA 1F3VA 1HBMA 4DV3F 2VG5B 1K44A 2CPYA 4C3MA 3KLFB 4CLLA 3ZTOA 1UJ4A 3UO0A 3HCXA 2ZKTA 3L3CA 4FS2A 4HR2A 2CQDA 1RT5B 3Q8SB 2KKHA 1NPKA 4MJKA 4OLPA 5IWAJ 2C3MA 3IN5A 4IFVA 4G1QB 1TMJA 4LF7F 3H5SA 3Q8QB 3CE8A 5IQ6A 1U1NA 1RK8A 5IC4B 3HP6A 4DSLA 2FY1A 4NCBA 1U2FA 3DDKA 2CPHA 3A8KA 1FWPA 4EK2A 4ZLJA 1B4SA 4B9SA 1NO8A 4F36A 4LSZB 1VQNS 4NLDA 2B7CB 3CIMA 4NASA 5A8WA 3DM2A 2LDYA 1S6PA 3OXGA 3QO9A 1K0VA 3CJ4A 4OQJA 1RB0A 1HWIA 4HHJA 3L4BC 4M95A 1YLXA 2AJ1A 1F9HA 3QMQA 3D3BJ 1UVNA 1S0MA 1FJCA 1HYSA 2FC9A 2ZDOA 3WHIA 2DNHA 3Q0AA 2E5IA 4HYKA 2K06A 1VQPS 4B3SJ 1XNQJ 1VQ5S 1U25A 1FFSB 2B8PA 2QE5A 3LF0A 1N32J 3PYDA 3QJLA 2QLWA 5L9XA 3EZOA 1HW9A 3J7YU 1LK5A 2HWTA 2AP6A 3ZZTA 2OD4A 3UW1A 1UZDA 2JL9A 4B9NA 5DZ7A 2MSSA 2HWIA 3T19A 2QYCA 1J5OA 2LEPA 5ETVA 1UJ5A 1HA1A 2ASYA 2OD6A 3Q8UA 1HI8A 4YHHF 3F0NA 3KLEA 4I2QB 1MROA 4X4PA 4WP3A 3MAHA 4ZLPA 4NLSA 3UN3A 3RTVA 1HR0J 1QLNA 3NNAA 1XEZA 4LF8F 3ZZPA 4UY8T 3BYPA 2E7VA 3TAPA 3FZ2A 3GV5B 4Y2MA 3DN9A 1FO1A 4N47A 5KFTA 4A8XA 2J9DA 1RCOB 3BV8A 2QLFB 3KK3B 2QA4S 4ILMA 4IH7A 2V4QA 1C1BA 3T5KA 2GGPA 4NCAA 3UFCX 5IT9Y 2P6TA 2DXFA 2JC0A 1VFJA 2R42A 4M5KA 5DRKA 3VVUA 1Q8KA 2BDPA 4KTQA 3MM8B 3SDEA 5A6PA 2WW8A 2YKMB 3GONA 1UFLA 2L48A 3NS7B 4LT6A 3GJTB 1ZYQA 1ZH5A 1WEXA 2B5JB 2FZKB 2WVFA 5K8PA 1T05A 3SIPB 3HHDA 3KYLA 1OO0B 1YJ7A 4OYXA 5ETRA 2PFFB 2E5LJ 1QE1B 2ROEA 3CCWA 2OEKA 4ZPVR 2UP1A 2C2RA 4FP9A 3ISND 1OYEA 1ULRA 2QMWA 2W4DA 4RUAA 2JSXA 2F8HA 2VONA 2RRBA 1RTJA 3KK1A 3L95X 4KPCA 2VUGA 3KXDA 3CCZA 3NNCA 3OHBA 2YVSA 4HH1A 3MPVA 1VQ6S 1OS5A 3UD3P 3O3LA 4U8YA 2IVMA 2FVSA 1WJ9A 3BM7A 2XLIA 4MK8A 2CQ3A 2DD8S 3W5XA 4K4WA 1V6HA 2VQFF 2DTJA 4O3RA 1WF1A 1PYOB 5HMZA 4DCPB 4C8OA 2FJEB 3CDUA 1IXKA 4JI6F 3H42A 3OXLA 4J9RA 2EFGA 2GGPB 2LVWA 2YWGA 3LQVA 3BF4A 5A2QY 4CT8A 4DG1B 3I32A 2GO9A 4MK7A 1NDLA 3SDEB 5HJXA 5CYMA 4CYUA 2YKMA 4XPEA 3MFHA 2KZMA 5CCMA 5EUHA 1GX6A 4IR1A 3K8VA 4CO5A 5MAOA 2HQDA 4QBUA 3PW7A 2UXBJ 1NSKL 4NLOA 1IR0A 4PYAA 1YI2S 1U1LA 4YS2A 1S77D 2HW3A 3FKBA 4ZPCA 1M1GA 2NSBA 3QT7A 5ETOA 1RWNB 1RWOB 1TKZB 1CJKA 2HGLA 1HWKA 2RNEA 3FRYA 4WKRA 4OX9J 5KT7A 5F41A 1RTJB 3CO9A 1VQ8S 2DNYA 4U7CA 3CMES 1DTTB 3LP0A 1HMVA 1IKXA 2HQIA 5G0RB 1Y5NB 1FA0A 1UWBA 4C0HA 1EAYC 4QWAA 3RR8A 2IM2A 4K4XA 2R8KA 4BWMA 5D0HA 1REVB 3GJRB 1RT2A 1FKAF 4ELVA 4R5PA 3HSGA 1SJ3P 3HPOA 4I0WA 2QO3A 2RH3A 1L3KA 1U09A 2YXLA 2C2ZB 3K8WA 1VQYA 1AW0A 1FD8A 2IHR1 4TLRA 4DXLA 4F7VA 3AJ1A 2WVBA 2VODA 4KKOB 4PXCA 1Q86T 1GT8A 2ZFHA 2DB1A 2IDLA 2DNLA 3PRDA 3THVA 2IRUA 2J7UA 5C24B 2I1RA 1F60B 2O66A 3BSAA 3BQ0A 5KFSA 3JB9k 3C15A 1Q5YA 3FCHA 5D0GA 3MZIA 4JI4J 1FEHA 4RW7A 4V1Ak 4M5IA 3DLEB 3I55S 2DYAA 2QN6B 4DS4A 4FBUA 2MLZA 4Y34A 4F8RA 2CKWA 2CZ4A 4X4UA 2KL8A 2F8EX 5ETTA 5LM7E 3P4UB 1R8HA 3D6TB 2ZZTA 1UPPA 2IVYA 3BPDA 1QVGR 3CPWR 2WBMA 2YNIA 2C42A 1M5PC 3M6WA 2LDIA 2UU9J 2L08A 3F44A 4H4KC 4DR3F 3GIRA 4QWBA 5KTQA 2JLEA 2MHNA 3AB4B 3MD1A 1UETA 5IS2A 5AJ3F 3PW0A 1KFDA 2VG6A 4NXMF 4F25A 2BMBA 3MAQA 4ECYA 1IVZA 1SJ1A 2JX2A 2MXYA 3H4BA 3KHRA 4DJBA 3MXHP 5KFGA 3B4MA 1R89A 4DV1J 2WVCA 5CQGA 3S1TA 1C1CA 1GNKA 1SH0A 3AXMA 2R7XA 4KRWA 2KB2A 4C7QA 5D8HB 5A2QU 4AD6A 4LFCJ 1S9FA 4ZPDA 3MM6A 1GMVA 4MKYA 2GAHC 3DYAB 2VHGA 1HLWA 2BX6A 3H0PA 2FLPA 3W1YC 1S6QB 2MLXA 1X31C 1YJUA 4PXBA 5KG4A 4J9OA 1FE4A 1SKUB 4JI2F 2R7SA 2RT3A 5KOWA 3POTB 4NA3A 2BJEA 4O0NA 4ZOSA 2UVVA 4ICLA 2ATCB 2DEJA 2LQJA 2LQ8A 5HI7A 3M32B 1XR7A 2GVDB 5A0YA 3LGHA 1JXLA 1IBMF 4C4WA 1XMQF 4DR1J 1X9WA 4ZCLA 1Q4RA 4UOCA 1RT7B 1HNVB 1VRTA 3ETMA 1LEOA 5AXNA 3FMWA 5IOLA 4JV5F 3PIPQ 2XYHB 3MM5A 3ZZRA 4B9TA 1FKOB 1HL6A 4OI2A 1LV5A 1H2TZ 4NXNJ 2E9TA 3W65A 4LF1A 1MNEA 1M5SA 4IDKB 5ETKA 2MQPA 4XO0A 2BVZA 1U48A 3FEXB 1RXOB 4FYVB 2E7WA 3PO4A 4JI8J 3X1LB 1TV6A 4JYAJ 1WKLA 3B78A 4DL4A 1FTCA 4OHWA 4HTJA 2AYMA 3GIJA 3H5XA 2GIQA 3HT0A 3UDVA 3TW0A 3RB6A 1JJ2R 1IQZA 4PQUA 3D3CJ 3B8HA 1RI7A 3DLGB 3HX9A 4N77A 2FLLA 4CH7A 3J7Z5 2CQ4A 1YJWS 1KR4A 1U2RA 1XMBA 2IFXA 3DRYA 1DTQA 3PX4A 4UTGA 1NLKL 2D3UA 3Q86A 4KHPF 5KFRA 3KJVA 1BLUA 3AJ2A 3EDQB 2XS5A 1W2IA 1R6VA 1VIXA 1RT4A 2DISA 2Z2ZA 3ZNJ1 1CC7A 3V4IB 5E3AA 2HIQA 2K3IA 1ZAVA 1KHVA 2V2QA 2W4CA 3CDBA 4ZPTR 1WC4A 5AT1B 2WVDA 4PCQA 1UL3A 4CO1A 3EXYA 1R0AB 5M2PA 3LP1A 4LR7A 1EB0A 3TARA 1N34J 3ZZZA 4DFMA 2IPOB 3UVJB 3KJFB 4IKAA 1U0SA 4HHHA 4PPZA 3ITHB 2HHTA 1YWXA 2XCPA 4B3RF 1BQNB 5B0FA 1BD6A 4USWA 1NDPA 1QUVA 3KFWX 4Q8FA 4WXWA 3VV2B 3PJ9A 3VCDA 2HBQB 2H54B 3TVKA 3IM9A 4C11B 4ED3A 2XMTA 4DR2F 3IR7B 1JLGB 1J27A 4S0MA 1M0SA 4TY9A 1IKVA 5KFIA 4L73A 4K7QA 3U02A 1RT2B 3QBCA 3GZ7A 5D0EA 1BE4A 1SCJB 1X5SA 4R5PB 1V5IB 1WSRA 5HQMA 3DU6A 3DI6A 4TNOA 2BKNA 5EGYA 4TKTA 1X9SA 5EX3A 4R0JA 3RBXA 2QRRA 1KLNA 2V4JB 1F5BA 4W90B 3R5JB 1QDUB 4L74A 2XO6A 3K57A 4FF2A 3DRSA 4I56A 5C2CA 3CCLS 4OLOA 4AFFA 2DH8A 5K14B 2UXDF 3GJSB 1K8AT 2X3DA 4JI7F 1UFWA 2B4PA 2W7PA 2GZOA 4QWDA 2LMIA 3JSMB 1SQEA 4I6WA 1N34F 3HHEA 4KKOA 3RAMA 3T3FA 1NRKA 2UVUA 1LW2A 2ZC3A 1YK9A 3A4TA 4MK9A 4YN3B 1YX2A 2BANA 4NRUA 4OZ5A 2W2PP 4DS5A 2FYXA 2I38A 2KI2A 4QIEA 5KG5A 4CTAA 3ET6B 3VR1A 2FJXA 3V81A 3QIPA 4EEYA 2R8IA 1CEZA 4RWXA 4CCHA 1PO6A 1V3RA 2CNOB 2MY7A 2OI2A 2ZH8A 1Z1ZA 1TQLA 1S1TB 4OJ1A 5LJ3Y 4NCGB 1MMLA 3M8QA 2RDDA 1TU0B 2OO4A 2ZWPA 3VZHA 2L3MA 2MGZA 1T9YA 3QT8A 3BH7B 4QIGA 3TWZA 1S72S 1XR6A 1WF0A 1U1RA 2XMWA 2VG7A 3CJTA 2AQ4A 2WBRA 4IFYB 1SV5A 3Q89A 2CQ2A 2HNYB 3NCQA 1F3FA 2PGCA 1X5TA 3RB3A 1KD1T 4I67A 3FCVA 1WDDA 3HFKA 5I3UA 4LVNP 3ZO7A 3WBZA 4QW8A 3PRVA 1MN7A 4LBPA 4TVAB 4TXSA 2LEBA 3R1HA 3E2EA 4ZVRB 3CCMS 4ZVOB 3T1HJ 2R2RA 1N54B 1KQKA 4CTAB 3G6XA 1N6QB 3C6TB 4LRCA 1SPBP 1UA1A 1WSVA 2RDIA 1UEKA 1X60A 1AROP 5KFFA 1HHTP 3HKWA 3EX7B 2V9WA 1S0VA 4HI1A 3IGNA 1TKXA 4DUYF 4QU6A 3JXOA 3HK2A 2V67A 4EZ6A 2YWKA 3EM1A 3LW5C 5LXRA 3AODA 4KHRA 4ICLB 4CLSA 4ETXA 2HRUA 4NLGA 1RAHB 4LUBA 2HURA 2ZEJA 4LFCF 3BJYA 3AJDA 3BDEA 1W2BR 4EI2A 4ED5A 3A8IA 5ETQA 3TI0A 3FFIB 4P6QA 1S48A 3A13A 1CJVB 4YEAA 4OZ3A 3D1HA 2F4FA 3RR7A 1EQMA 2N3OA 1F1BB 3ZXWA 4N8NA 5KAKA 4QW9A 3U7JA 4KFBB 1VGYA 4DV7F 3CNQP 2ZOMA 3BYRA 3D0HE 3CJSA 1SVDA 3OR1B 2DGQA 3EGZA 3UN2A 4PWWA 1J5EJ 4Y2IA 5A6WA 2CJQA 1VYAA 4MIWA 3G2XA 2BJ1A 1HNXF 1S1UA 4XK8C 4IOBA 1XN9A 2HRTA 1WEYA 1DTQB 4OZNA 1EP4A 4LVOP 4ZPAA 1RA6A 4CLKA 1VMBA 5DDOC 1WKJA 2HS3A 1GXUA 3MWBA 2EWHA 2CQGA 3QT6A 2VFVA 2W7OA 3V6HA 2JRSA 1RAAB 2ILZA 1Y0HA 1UP1A 4DX6A 1NKBA 2HFUA 2EXUA 3F41A 4ZDNA 4MYUA 1HD1A 2IJNA 4FN5A 5CYQB 1U0HA 2FHJA 4DFKA 2C1EB 1RWXB 3ZTPA 2GCFA 1XERA 4HT5A 4QCLA 5E33A 2G4BA 5IT9U 2CRLA 1OY9A 1YGYA 3WZ0A 4OMFG 1VR6A 2XYGB 2BBEA 3MMJA 5E3PA 3CGIA 2KTQA 3MM7A 2WSCC 3I5CA 4DSJA 1FKPA 3CD5A 4P2SA 1DTTA 4DL7A 1GQEA 3J7YI 1RT1A 2DVIA 1WHXA 1VQ7S 2BJDA 5KFLA 4ECSA 3QFHA 4F3MA 2ZHBA 5F0WA 1QTMA 1ZM9A 3F73A 1FXDA 2AJ0A 3SCIE 2YNGB 1OPZA 3NG8A 5LSOA 3NY0A 2MQLA 5IZHA 3T1AA 4X4TA 5J1EA 3EYZA 3H2VE 1R43A 1V9OA 2PEHA 3QATA 3BQ1A 4J91A 2NZ4A 4C97A 2YY3A 2UXBF 2ZH9A 4CM2A 1YRUA 3MUMP 4LBHA 2XBPA 2G9OA 1TL1B 4U7UD 3MCSA 4NZ7A 2RRNA 1T9VA 2HGNA 1Q8LA 1F9EB 2ASDA 1A9NB 2XMKA 2ERRA 4QJVA 1S7HA 1WOSA 1H2VZ 2DR5A 3NOGA 2ZHAA 1WDTA 2Z2YB 3LPYA 4DR4J 1SI9A 4O23A 2IAJA 2J0WA 2D41A 3GPAA 3H2UB 4NX9A 5B0AA 2RRAA 3H98A 5B0BA 4H54A 2ASJA 5KT5A 4LF4F 3AXKA 3I6PA 3HXMA 3VF0B 2DJWA 3MUTP 1L5UA 4K4UA 2EG2A 4DPUA 1WF2A 2QMUB 1TVRB 3ZZYA 1WC3A 2MZJA 2M52A 4CLWA 2YNGA 4AE5A 2FJBB 2HNDB 1CULB 2RUSA 3M8QB 3CCJS 2M7SA 3NRBA 4R25A 2AMCB 4RBUA 2XZTB 2Z30B 3M1VA 4E0DA 2HMIB 3WC2A 3KTQA 1B70B 2BA9A 2C2KB 3EGWB 3E01A 1T11A 4WCEQ 4HLBA 2ZBQA 3MURP 4F0KA 4ZK7M 1XC9A 1VJQA 3OJSA 3NKYA 2QT7A 4IFYA 4WIIA 1RYSA 3TJ9A 4P10A 1C1BB 7FD1A 1RCXB 3S8SA 3H5YA 4BC9A 4X64F 1AFIA 1PG5B 3BH6B 4K8RA 4CLZA 2FGCA 4WFNQ 5C25B 2QA1A 2DO0A 5HVHA 1CJTB 3GU0A 4XTTA 4RPFA 3DYAA 1MMNA 3DOKA 3SCKE 5LJ5Y 5I3QA 2ZZMA 2V6AA 3A8EA 4DZDA 3R7BB 3ILOA 3OPKA 2K7KA 2ADCA 2JWNA 1T8EA 4C0BA 4ZP9A 2JZ5A 1KRPA 1RWKB 2CAJA 3K5NA 2GVZB 5A8KA 4K4VA 4FYDA 1AYEA 2BEFA 2WB4A 3OL7A 1T9UA 3B82A 2MKCA 1FE0A 2XHWA 5T41A 3KJNB 1LQ9A 2XWYA 3LAKA 5DQHA 4DLEA 4I2PB 4PAAA 5F3TA 3PW5A 4WE1A 1U1KA 1JJHA 4F02A 4JYAF 2Z56B 3NEKA 3MEDA 4LF2A 5KT3A 1BQMA 3HVTA 5DDPC 1D8ZA 2Q66A 1YBUA 4NMXA 3L7PA 4HH0A 5GAEI 2HZCA 5GAGI 5T14A 2FHOB 3QGHA 3FMBA 3N79A 4F2RA 2AKWB 4GKJF 1VRUA 2L9DA 1U24A 1NJWA 2XMVA 3W2VA 4I6YA 1SC6A 2VD3A 4YB6A 3HD2A 5KG7A 2RQCA 5I42A 3J7AN 2IM1A 4NLXA 5J2QA 2R4FA 2V4RA 1DLOB 4ZITA 5DM6Q 4D3HA 2ZH1A 2QMXA 3DOKB 1AT1B 3R97A 3RJMB 2XSJB 1HD0A 3B6BA 1BC6A 3OR1A 3HULA 3QJJA 2KZZA 4J9NA 2OMLA 4MIBA 5ETMA 2MQMA 5E7OB 1GMUA 3G71S 1FJEB 1D09B 1PBAA 2W2NP 1HHSA 4Y28C 2MB0B 3H90A 2P9GA 4WE1B 1ZZNA 3K17A 3FK4A 1NK7A 3ISNC 3VGTA 5JJBA 1RT7A 3OR2A 4ANDA 3Q8PB 2VDHA 2MKSA 4O44A 4MT1A 1FF2A 5DETA 2XLJA 2Y1JA 1RWPB 3H4DA 4UOFA 2B0GA 3CW2C 5JVHQ 3MAAB 2DY9A 2DBBA 1T94A 4HDGA 3TP2A 4QYZK 1R8CA 4NI2A 3WIUA 5L38A 4HT7A 3PKYA 4DV3J 2EBGA 4OL8A 1YBTA 5CHCB 4B3SF 4NLVA 3TOQA 2W9BA 1XNQF 1ITPA 4U96A 3JS9A 5IV3A 4EYIB 5K8MA 1HBUA 1VLYA 4RUBA 5BYQA 4C8LA 4DWIA 4JV2A 1NH8A 3CMAS 5JVGQ 2KRBA 2NS1B 1PJ7A 2GV1A 4C6AA 4B9MA 3RW6A 2EBEA 1I5OB 1B0PA 2BE2B 4OZJA 1PKUA 4OX9F 7FDRA 2JNJA 1A6LA 3CT9A 3OFEA 3HHLA 4F4KA 4LF8J 4C9DA 1OJ4A 1FRHA 4DL2A 5BR8J 3PCOB 1P6TA 2C3UA 3FGVA 4ZJLA 4N41A 4ZVEA 1WHWA 4KO0A 1A7GE 1TR0A 3M2RB 5E5NA 1B3TA 3P45B 1SL2A 4CLPA 1X0FA 2GQCA 1HW8A 3KLHA 1ZBTA 1CQMA 2M88A 3WQPA 2OPQB 4ZHRA 1O8BA 2DY1A 3M2UB 5FLXY 4WF9Q 1FEEA 5CXTA 1VQSA 2W9CB 1AA1B 4ZIWA 2K1RB 3V2UC 2XM3A 3CCQS 3M05A 5E41A 2JEGA 3W5ZA 1UTAA 5SUHA 3QZ7A 1R6YA 1YG0A 3MMBB 2R3VA 2QA2A 4G1QA 1XQIA 2MKHA 3D9BA 2QIFA 3VQSA 4WBFA 4O0IA 5HQ8A 2V8PA 3S7RA 3NGDA 1M1HA 4JI4F 3HJVA 2IBKA 4KC5A 3B54A 4X4RA 3CF5Q 1KC8T 3ZTRA 3UDCA 1S6PB 1NK9A 1OSDA 3PHEA 2XWXA 2XY7A 3FBEA 3CMQA 4DX8H 2XTJP 1TL3B 5GMKa 2XNQA 2UXDJ 4KAIA 2E1CA 1I94F 2BJ7A 4ETZA 5GAHI 3SSQA 3M6UA 4GVLA 4QQBA 1XK8A 2PI5A 3UNGC 1B0TA 4PKDB 2ZNYA 3MMCB 4NE9C 2KDOA 3DM2B 5M2RA 3QO9B 1FRLA 1NZ8A 1S57A 2WVEA 3MCOA 3N01A 3N0VA 3Q8YA 3R5GA 1WELA 4HACB 4WK3A 4C8MA 4USTA 1FFGB 2UXCJ 4QR1A 1TV6B 2JEFA 1KTQA 1XMOF 3MR7A 5IXUA 2QG9B 4DV1F 1T7PA 1S5ZA 4BDPA 1NB2A 3HHLC 4Z37A 3EMTA 3CJ8A 1Q16B 3I96A 2J5AA 3MMBA 3UD4P 4K4SA 2CPDA 4ENOA 1PAUB 2DH7A 4E8UA 2RF2B 1Y11A 2A18A 1IJFB 4ILRA 2MJUA 4M5GA 3BDPA 2J0SD 2WAQD 4OI0A 4FXWA 1MWYA 4OJHA 1IBMJ 1RWUA 3QIDA 4PPDA 5KFWA 4TU7A 1Q8IA 1RBLA 3MEDB 3PJXA 1AZSA 2RKIA 3K5MA 2MLYA 3PZPA 2BACA 4WXOA 3BGRA 1H7WA 4TQSA 1U45A 2E29A 1S9EB 5ETLA 1TKDA 2H48B 4NXNF 3T1HF 4WP9A 1JXEA 1N0UA 4YDXA 4DFJA 4C2MA 4IR9A 3P8BB 2DHAA 1T05B 4KGMA 1G7CB 1Y5IB 2RD5C 3MCNA 4ZVHA 2MZTA 1YZ7A 5D4NA 1YBAA 2MQOA 1NJZA 1KVJA 2X3GA 3DXSX 2AD9A 2DRBA 2DNZA 1IWAA 4CLTA 3DDNA 5GMDA 4RU2A 4Y2CA 5EWEA 1U6FA 1NUEA 2N4CA 4O3OA 1FDAA 3P6YC 4V19J 1KONA 4WZQA 4L75A 2ZUGA 1IUJA 2QSWA 1IKYB 3I31A 1QSLA 1MSWD 3M6VA 4QIWD 4X66J 2LXFA 4X84A 2AU0A 2CJAA 2NPIA 4OI1A 2LFVA 1ICEB 3KG4A 4NLPA 2FLNA 2KJWA 1LWFB 1GX5A 1PIEA 3KMQA 1ZOTA 1C0TA 2D69A 3MPYA 1WG5A 1RP5A 4J90A 1FJ7A 3IGVA 2F40A 4P72A 1X9MA 3RZAA 1QVFR 2ADBA 3QPIA 4WZMA 1HNIB 1JLAA 2YWWA 3FUYA 2N82B 1JLBB 4NXMJ 4JI8F 4PG6A 2CJYB 5CYMB 1NK6A 5DDQC 2UU9F 1RBOB 1TKTA 2CJKA 3IO1A 5JMNA 4NEZA 2ZOGA 2AF6A 4OHYA 3J80Y 3VZIA 1NBEB 1IKWB 2XO7A 5F9NA 3PO5A 4CDIA
chains in the Genus database with same CATH topology
2XZTB 3D6MB 2CDRB 3P45B 2CNNB 2C2KB 4ZVSB 4ZVUB 1SC3B 3D6FB 2QLBB 2QL7B 3R6GB 1RWMB 1RWNB 1RWOB 4JB8B 1NMEB 3EDQB 2CNKB 2C2OB 3R7NB 3R7BB 3KJQB 1RWKB 3GJRB 2XZDB 2C2MB 3KJFB 3KJNB 2C2ZB 5IC4B 2H4WB 4ZVPB 2QLJB 4LSZB 2HBQB 2H54B 2H5JB 1BMQB 4ZVQB 3QNWB 3D6HB 2C1EB 1RWXB 1QTNB 1IBCB 3R6LB 3R5JB 3RJMB 1QDUB 1PAUB 1RHQB 1RWWB 3P4UB 2QL5B 2HBZB 3GJSB 3IBFB 2XYGB 2H5IB 3R7SB 5IC6B 2H51B 1SC4B 2CNLB 2HBRB 2Y0BB 3IBCB 2H48B 2Y1LB 1I51B 2H4YB 2QLFB 2CJXB 2H65B 3GJQB 1RWPB 2CNOB 2FQQB 3NS7B 3GJTB 3SIPB 1I3OB 2XYPB 4DCJB 1RE1B 2QL9B 1ICEB 1F9EB 3EDRB 1GFWB 1RHMB 2DKOB 4ZVTB 1RHKB 2XYHB 2HBYB 1PYOB 2CJYB 4ZVRB 4DCPB 4ZVOB 4DCOB 1RHJB 1RHRB 2P2CB 1RHUB 5K20B 1RWVB 1SC1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZT B;  3D6M B;  2CDR B;  3P45 B;  2CNN B;  2C2K B;  4ZVS B;  4ZVU B;  1SC3 B;  3D6F B;  2QLB B;  2QL7 B;  3R6G B;  1RWM B;  1RWN B;  1RWO B;  4JB8 B;  1NME B;  3EDQ B;  2CNK B;  2C2O B;  3R7N B;  3R7B B;  3KJQ B;  1RWK B;  3GJR B;  2XZD B;  2C2M B;  3KJF B;  3KJN B;  2C2Z B;  5IC4 B;  2H4W B;  4ZVP B;  2QLJ B;  4LSZ B;  2HBQ B;  2H54 B;  2H5J B;  1BMQ B;  4ZVQ B;  3QNW B;  3D6H B;  2C1E B;  1RWX B;  1QTN B;  1IBC B;  3R6L B;  3R5J B;  3RJM B;  1QDU B;  1PAU B;  1RHQ B;  1RWW B;  3P4U B;  2QL5 B;  2HBZ B;  3GJS B;  3IBF B;  2XYG B;  2H5I B;  3R7S B;  5IC6 B;  2H51 B;  1SC4 B;  2CNL B;  2HBR B;  2Y0B B;  3IBC B;  2H48 B;  2Y1L B;  1I51 B;  2H4Y B;  2QLF B;  2CJX B;  2H65 B;  3GJQ B;  1RWP B;  2CNO B;  2FQQ B;  3NS7 B;  3GJT B;  3SIP B;  1I3O B;  2XYP B;  4DCJ B;  1RE1 B;  2QL9 B;  1ICE B;  1F9E B;  3EDR B;  1GFW B;  1RHM B;  2DKO B;  4ZVT B;  1RHK B;  2XYH B;  2HBY B;  1PYO B;  2CJY B;  4ZVR B;  4DCP B;  4ZVO B;  4DCO B;  1RHJ B;  1RHR B;  2P2C B;  1RHU B;  5K20 B;  1RWV B;  1SC1 B; 
#chains in the Genus database with same CATH topology
 1MN9 A;  2W7A A;  3N6L A;  3NGS A;  4GVB B;  4W98 A;  4JV0 A;  3TVY A;  4O4G A;  4E2F B;  2R2T A;  4DV0 J;  2AYB A;  3BSO A;  2VPZ B;  1TTH B;  3W66 A;  3G8S A;  3A3N B;  3J7Z T;  1SC3 B;  4CNY A;  2QLB B;  2EFO A;  2N7Y A;  2VKZ G;  1KQG B;  5D4P A;  2F63 A;  3RB0 A;  2C2N A;  3DDI A;  4IG3 A;  2YWF A;  4KJI A;  4RW9 B;  2HHH F;  4C3L A;  2HHV A;  3HSJ A;  2OPR B;  3OD2 A;  1NU4 A;  2Z4P A;  2OSR A;  3FBC A;  3GV7 B;  4K2X A;  4LSN A;  3Q8R B;  2O5D A;  2MKY A;  4OZ2 A;  2E9Z A;  4ECV A;  3W9I A;  2YKA A;  2BE7 D;  3LP1 B;  4FKY A;  1YIJ S;  1JXV A;  1KQF B;  3MOJ B;  4WFZ A;  1Y3J A;  5E3R A;  1RAJ A;  1X7V A;  3DKD A;  4UUW A;  4RJV A;  1O51 A;  3KJQ B;  4ZVF A;  3EZ5 A;  3D28 A;  4RBT A;  2LYV A;  2YWH A;  1VIO A;  4TLQ A;  2C28 A;  1NKE A;  2V8V A;  1FVQ A;  4UQT A;  2Q1L A;  5J1P A;  4DR3 J;  1RT3 A;  2AYE A;  1M5K C;  1LXN A;  2FD2 A;  1R8A A;  1FWK A;  5HMY A;  2VC1 A;  3KHL A;  1U49 A;  2FIU A;  4F3O A;  2J8S A;  4RL1 A;  2G2Y A;  2E9R X;  3HJF A;  2IJR A;  4DUY J;  3DLE A;  1Q82 T;  1OYD A;  2A2D A;  4AL6 A;  4DR6 F;  3AH6 A;  2BUN A;  5D78 A;  2DXD A;  4A8Q A;  3EJM A;  1RT1 B;  4OX8 A;  3C15 B;  3ENA A;  4XAK A;  4U9R A;  3THP A;  4AXJ A;  4X62 J;  3KLG B;  2MHE A;  5EN1 A;  2DIU A;  1BMQ B;  1S6U A;  4MKA A;  2NYI A;  4C8N A;  1J5O B;  1CVJ A;  2PII A;  4DPW A;  2I2Y A;  1HNW J;  2DR8 A;  1V3S A;  2RAQ A;  1QTN B;  2OUG A;  3GYN A;  2APO A;  2IRY A;  3LP2 A;  6AT1 B;  3IFE A;  1URN A;  1UZH A;  3IRW P;  3QLH A;  1RTI B;  3SQG A;  1EQ0 A;  4LFA F;  5AJ3 J;  3NL0 A;  3BBC A;  3BKT A;  5ETS A;  3GFX A;  5HQL A;  4AL5 A;  2KG0 A;  3DMJ B;  4G1P A;  2YPZ A;  4KPY A;  2H51 B;  5FDL A;  1N33 F;  5RUB A;  2F9J A;  4X65 F;  4I4B A;  2G0C A;  3D68 A;  3IBC B;  4M5J A;  3JYT A;  3MMC A;  3I9Z A;  3BPS P;  2RML A;  3PM9 A;  1D1U A;  2H4Y B;  3RAQ A;  1BWV A;  1U2C A;  2RJZ A;  2VPY B;  5KT2 A;  4PWD A;  3C6U A;  2KYX A;  4PQA A;  3MMA B;  1Z2Z A;  2VB6 A;  5AXL A;  3NMA A;  3POT A;  2FQQ B;  4QOT A;  9RUB A;  1U47 A;  3UWT A;  1EIY B;  4LRA A;  1YQH A;  4IFV B;  4DV6 J;  1S1W A;  5LMN J;  3WIV A;  2CWK A;  4FYW B;  4DN0 A;  1DFD A;  1HNV A;  5EHH A;  5J2P B;  4JI1 F;  4FXD A;  5L1L A;  4RLE A;  1IBL J;  3R2D J;  1TL4 A;  3CIZ A;  1UW9 A;  1KP6 A;  3M2V A;  3GIL A;  4F4A A;  2KVI A;  3NCP A;  1QUP A;  1RA7 A;  3O8W A;  3DGP A;  5C42 B;  2KH9 A;  4ED2 A;  2AGO A;  5L39 A;  2HVE A;  4JI2 J;  2U2F A;  3AA9 A;  2GHV C;  5B0G A;  3PR4 A;  3CJR A;  4XPC A;  1RHM B;  3OLA A;  1R7I A;  3A3P B;  3IWN C;  1EET A;  2XY6 A;  4TY8 B;  1GEH A;  2B6A B;  1JKH B;  3GII A;  4G3I A;  1UVJ A;  1N6Q A;  2XSJ A;  3ZTQ A;  2V34 A;  4ZPW R;  1DRZ A;  1JX4 A;  1X4H A;  1Q5V A;  2PI4 A;  1TKX B;  2HK3 A;  4DCO B;  1QAY A;  3DRP A;  2DEI A;  5DQI A;  3PVX A;  1L3T A;  5GME A;  3FQL A;  2CJB A;  4M5H A;  2W8K A;  5J2N A;  2VPW B;  4UOG A;  1FNO A;  2DH9 A;  4IO1 A;  4B02 A;  2DGS A;  2M3D A;  2MYF A;  2XI2 A;  3NGU A;  4M1K A;  3THT A;  4YME A;  4KV8 A;  1NHK L;  3LO3 A;  3IC1 A;  3OUY A;  5HAN A;  2E5L F;  1QAX A;  4ZP7 A;  2B4U A;  2H1Y A;  4U67 Q;  2GJ2 A;  4JI1 J;  5F8M A;  2BZ2 A;  1SBR A;  5T7L A;  1WI6 A;  2DK2 A;  2WOM A;  3PXG a;  3WDO A;  2DHH A;  4JB8 B;  4CLY A;  4CT9 A;  5KFD A;  3K5P A;  3T5L A;  2J6T A;  2F7V A;  3J7A 1;  3FDS A;  4RBV A;  4IH6 A;  4UY8 5;  3MAA A;  5EX0 A;  5FLX U;  5DG7 A;  1IR1 A;  1MMD A;  2WON A;  2ILY A;  2HFN A;  2Z2L A;  4DX7 A;  4OI6 A;  4WFA Q;  4RNM A;  2I6W A;  3BQ2 A;  1UEV A;  1WHV A;  4ZJO A;  1SKR A;  5F8J A;  1BQN A;  4DSI A;  2B9Y A;  5DZ6 A;  2B5J A;  3SFG A;  3TA2 A;  5KFX A;  3TZZ A;  3UVJ A;  3PYE A;  4RW8 A;  4ECR A;  2R8G A;  2F65 A;  3UE2 A;  3C3L A;  1S1X A;  4MYT A;  1KDN A;  4EYH B;  2J9D E;  1FJG F;  2KVQ E;  2M9K A;  1RAI B;  1N33 J;  1R27 B;  2DGT A;  4P2X A;  3ZFV A;  4IG3 B;  1C0U B;  4FF3 A;  4F4X A;  3CED A;  3MOZ A;  3MPD A;  2R8H A;  4N7T A;  2K7J A;  3TUI C;  4PR6 A;  2HVI A;  1U8W A;  4A8Y A;  4YP3 A;  4KV8 B;  1LWE A;  1Z2L A;  1GMW A;  1RJJ A;  1F5A A;  1WD6 A;  2QLX A;  2HGM A;  1VS3 A;  3NCR A;  2EPI A;  3R27 A;  2HK2 A;  1DY3 A;  3DRS B;  4OI3 A;  3LAM A;  1TK0 A;  4DG1 A;  1Y5L B;  2MTL A;  4EGL A;  1L3U A;  3HT3 A;  1CUL A;  3PJW A;  1IR2 A;  3VAH A;  4P52 A;  2BQ3 A;  2HHH J;  4X65 J;  2RS8 A;  4ZVQ B;  2KXN B;  2IIH A;  3NGT A;  4GC6 A;  2BRL A;  3D66 A;  5K14 A;  1H7X A;  2HVZ A;  2NUU G;  4Q7A A;  3QAU A;  4DN9 A;  2RQK A;  1Q1K A;  5HP1 B;  2W01 A;  2VJV A;  2R2U A;  2AT1 B;  3D67 A;  3I0S A;  5HMX A;  2AGP A;  3TJ8 A;  4UT4 A;  3FVY A;  5F8N A;  1RAO A;  1RSC A;  3CCS S;  3FSI A;  1SQF A;  4ED7 A;  1B7F A;  5HBM A;  2Q6C A;  2UUT A;  3IAM 9;  4CLF A;  2NR0 A;  2HZA A;  4MH8 A;  5IC6 B;  1CJT A;  1K1S A;  1Y10 A;  3BZQ A;  2WCX A;  4DL0 C;  2HBR B;  5B08 A;  2K3K A;  3GSI A;  1CJK B;  3QSI A;  1QJH A;  5LL6 d;  5IWA F;  2P5V A;  3OFF A;  2YQ3 A;  4DR5 F;  2BJ8 A;  4P71 A;  2BV3 A;  1S99 A;  3OVS A;  4Q43 A;  1LW0 A;  2JLF A;  5KG1 A;  3EPG A;  1R8B A;  3UNY A;  2A6M A;  1NK5 A;  2BRK A;  1OPI A;  2W2M P;  2XMU A;  2B9X A;  2L9W A;  3CVK A;  2XS2 A;  3GJQ B;  4ZA1 A;  3TAN A;  2AW0 A;  1YJN S;  2IBO A;  2PMW A;  4CLU A;  3OTD A;  2VA3 A;  4GO7 X;  3CD0 A;  2WTF A;  1EHW A;  2OEL A;  2A3J A;  4DX5 A;  4X66 F;  2R7T A;  3EE3 A;  4DPX A;  3EVM A;  1U1P A;  1PJ6 A;  3RAX A;  2J6U A;  2FTR A;  4ANE A;  3IG1 B;  3UR3 C;  2NXC A;  1SKW A;  4LFB F;  3CTR A;  3IBW A;  3V5R A;  3DLB A;  1WAC A;  1X4E A;  1TL7 B;  4OX7 A;  2V69 A;  1WUU A;  4Q45 A;  1RAB B;  4OYB A;  1CJU B;  1Q8B A;  4PZV A;  4JV1 A;  3MM9 B;  2M8D B;  3SMZ A;  3KG0 A;  3LPE A;  1X8D A;  1AUD A;  2VFS A;  1W7W A;  4YOE A;  2BM1 A;  3MF5 A;  4NLW A;  1RTZ A;  2M4M A;  5K9F A;  2D3O R;  2F4V F;  1DJ0 A;  2ACY A;  2FJA B;  2Y3Y A;  2EFN A;  4Y00 A;  2DGW A;  1U1M A;  2HHS A;  1RLD A;  4P74 A;  2GAG C;  2VPX B;  3SSS A;  1PJ5 A;  3TNV A;  1HR0 F;  5AE2 A;  2HFO A;  3JAM Y;  4FF1 A;  1S1W B;  3FNN A;  1UVI A;  3D6M B;  4DBQ A;  3HF5 A;  4MIA A;  1WTF A;  1WKK A;  2ROG A;  3NOC A;  4OYW A;  3M6X A;  2KFY A;  1KLM A;  4PAB A;  2ZJQ Q;  4A8O A;  1NDK A;  2P6S A;  2V9K A;  3ELH A;  3PIO Q;  2DRA A;  3HHN B;  3GQC A;  2B6A A;  3MPW A;  4NLY A;  5KT4 A;  3KK3 A;  3TJA A;  2YNF A;  4LSL A;  3X3U A;  4J9K A;  3SYZ A;  2KO1 A;  2LXI A;  3OTC A;  1G4C A;  5E0O A;  4B3M F;  4ZS6 A;  1U1O A;  1U26 A;  3UQS A;  2NYH A;  3NGR A;  4J9P A;  1S6Q A;  1NME B;  1F9F A;  1UPM B;  2RB7 A;  1LWC A;  1PGZ A;  1H72 C;  1DQA A;  1K47 A;  2FGO A;  3AD7 C;  3EZU A;  4OI4 A;  2F4V J;  1IM6 A;  2G1H A;  3R5C A;  2JLG A;  2DHS A;  1Z4U A;  4P2M A;  3K2Y A;  1WOR A;  2HQ3 A;  2B4O A;  5KG2 A;  2QX0 A;  4AL7 A;  1UWB B;  4U95 A;  1ZAX A;  2WSF C;  3CJ0 A;  4LRF A;  5ETP A;  3N5F A;  2NZC A;  4N5S A;  3D1Q A;  2RF2 A;  1SH2 A;  3DOL B;  4DV0 F;  3R1L A;  2EK6 A;  4Q44 A;  2IA0 A;  2Q3P A;  2ZH7 A;  4DR6 J;  2F3J A;  3HFZ B;  5BR8 F;  2C2E A;  2YKN A;  1FER A;  1FX4 A;  3DXB A;  4DQQ A;  4H4K A;  3MTK A;  2QLJ B;  1P8G A;  3GG1 A;  4X4O A;  1KLM B;  1T03 B;  1DAR A;  3UCU P;  4YUD A;  2WOM B;  4LRE A;  4FYY B;  3W9H A;  1T9W A;  2YNF B;  4LSL B;  3TVZ A;  1HBN B;  2XSF A;  4Q0B B;  1EZZ B;  3DHX A;  2CG8 A;  4PYD A;  5L1J A;  3HVW A;  2HG4 A;  1LKZ A;  4B3T F;  2GMJ A;  2XQC A;  2GQQ A;  1TUW A;  2CWX A;  3NBP A;  2A6O A;  3NWR A;  5FII A;  2JEI A;  5B09 A;  2WB1 D;  1D9D A;  5C2G A;  4ECW A;  3GCW P;  4TU8 A;  2XNR A;  3R9L A;  1NM2 A;  1E6V B;  3BSN A;  2UUC J;  3IBF B;  3M8R A;  1HHQ A;  3PW4 A;  4LJM A;  1Y00 A;  4K5S A;  2VOP A;  2HS0 A;  2Y8Y A;  4A4J A;  2FY8 A;  4WYL A;  4WK1 A;  1WNE A;  2VFU A;  2POK A;  6FDR A;  2W4P A;  2Y0B B;  5D4O A;  4LF5 J;  1D9A A;  1NJX A;  2Y1L B;  2W24 A;  2QV6 A;  4QR0 A;  5GAD I;  3IXQ A;  3M9O B;  4PG5 A;  1HBM B;  1BWE A;  5E3Q A;  1P27 B;  3JQJ A;  2H65 B;  5KG3 A;  5AE1 A;  1QSY A;  3VAF A;  4X62 F;  1VQM S;  4J9U E;  4I69 A;  5HSP A;  3HZE A;  4LF6 J;  4YQW A;  1M90 T;  4DR7 F;  3HLU A;  4DU7 A;  2CIM A;  3H20 A;  5I3U B;  4DUZ F;  1CPZ A;  3P5B P;  1UA0 A;  2R2S A;  4JBC A;  1WWH A;  3CDW A;  2E5H A;  3KKF A;  5DQG A;  2OEJ A;  3CCV S;  2ZD1 A;  2B9E A;  3D2W A;  1N8R T;  2HPU A;  1KOO A;  4LFA J;  5IM0 A;  4IH5 A;  3QRP A;  3D0I E;  4ZVT B;  1RHK B;  2DNM A;  3ZC4 A;  3GP9 A;  4UQG A;  5GAG U;  1K73 T;  5SZT A;  1MWZ A;  3TUJ C;  3V4M A;  5KFO A;  3EPI A;  1FK9 B;  5DM7 Q;  1HI0 P;  4PWU A;  1PAE X;  1OY6 A;  2B56 A;  2MEW A;  3W8P A;  3GLJ A;  4CH1 A;  3A1Y G;  2AJ4 A;  3BR8 A;  3GG0 A;  5THW A;  4USJ C;  3GMG A;  4CP5 A;  2HMI A;  1AXQ A;  2XUL A;  2DR6 A;  4KQZ A;  4URQ U;  1VHF A;  2CZV C;  3HSZ A;  4XIU A;  2HKE A;  2IC3 B;  1FT8 A;  1S0O A;  2R7W A;  5J2M A;  1VBX A;  3C2P A;  5DLF A;  4NZ6 A;  4RX6 A;  4ATN A;  3BGR B;  4ER8 A;  1SJ4 P;  1CJU A;  2DGX A;  1OQ3 A;  2FJD B;  1WOP A;  2XI3 A;  1C1C B;  2VG6 B;  8AT1 B;  3TUP A;  4WTO B;  3W61 A;  4AQY F;  2FPH X;  3AOB A;  4DF4 A;  4EO6 A;  2DRD A;  2GIR A;  2QL7 B;  2UZA A;  3MM9 A;  2R9L A;  4CIO A;  1VBZ A;  4PWD B;  3RG6 A;  2AJQ A;  2ALY B;  2ZKU A;  2GFF A;  3BGF A;  1FD2 A;  1VJW A;  4LIW A;  1LFW A;  2BAN B;  4K50 A;  3VAM A;  4CZC A;  1X5P A;  3KNG A;  1SB6 A;  2G2Z A;  2CNK B;  2Y9H A;  1X4D A;  4K4Z A;  3DOM A;  4ED4 A;  3CCR S;  4K4Y A;  2ZBC A;  2YH1 A;  3RGI A;  2CQC A;  2VG7 B;  3PY8 A;  1FI4 A;  2VBY A;  3CCE S;  3O6Q A;  3CDA A;  2JH3 A;  3VHQ A;  5CCL A;  1HBO B;  4XDC A;  5KFC A;  4A8M P;  3IRX B;  5LSL A;  3G8Q A;  4RNO A;  1NJY A;  4FF4 A;  4TQR A;  3QGP A;  2HFZ A;  5CYJ A;  2CZ9 A;  3BS9 A;  3JQK A;  5KFA A;  4IQX A;  3OFH A;  4LFB J;  2KRR A;  2LQ9 A;  5F3Z A;  2W8L A;  4A8F A;  5BYS A;  4JP8 A;  5CYQ A;  3QGI A;  3FBB A;  2IA6 A;  3DMJ A;  1GTH A;  1VRQ C;  2BYC A;  2DNO A;  4HAC A;  3VAG A;  1H98 A;  3ZZO A;  1IBK J;  2KJV A;  2XS7 A;  1JMT A;  1N88 A;  2CA9 A;  1PSD A;  3NAH A;  4JV5 J;  4FBT A;  1KOH A;  1D9F A;  1PBU A;  4PUO B;  4K0K F;  1T0T V;  3ZTS A;  5LT5 A;  1MU2 B;  2OTJ S;  5CH7 B;  4NZ0 A;  5A8R A;  1U4B A;  1FRI A;  1QY7 A;  4NRT A;  2XMA A;  4PQU B;  1DLO A;  2E1A A;  3OV7 A;  1T3N A;  3QNW B;  5GAE U;  2QZ8 A;  4RWW A;  1IM4 A;  4DU8 A;  2UUA F;  4JI5 J;  2VIC A;  4ZKA A;  4WYW A;  3L09 A;  1M5V C;  3JSY A;  1T02 A;  1EJ7 L;  1HBO A;  3AHP A;  3OSP A;  1Q81 T;  3BEG B;  4DV5 J;  1PCA A;  1X5O A;  4CWB A;  1J5E F;  1X0P A;  1FRJ A;  2PN6 A;  4ELT A;  4LRB A;  4BCA A;  2D3Z A;  4C98 A;  5DGB A;  2H9Z A;  4USK A;  2KN4 A;  2VG5 A;  2ZVI A;  4F67 A;  2B7B B;  1ZA2 B;  2G13 A;  2K2P A;  3ETO A;  3TZX A;  2HIY A;  1TL5 A;  2FHK A;  2AV5 A;  3K5L A;  4IO9 Q;  1WC1 A;  3PDN A;  2MKJ A;  4IG0 A;  3TEH B;  5LXY A;  5LOQ A;  2ZM6 F;  5DDR C;  1LFP A;  1BY9 A;  4NLR A;  1SIZ A;  1P1L A;  1R3N A;  2VBZ A;  3TZY A;  4YY3 J;  2HWH A;  1HMV B;  3IA0 A;  4M5N A;  3KDO A;  1QE1 A;  2W2Q P;  3QT5 A;  4ANC A;  1WTB A;  4PRF A;  1X4C A;  3CJ3 A;  4CQ1 A;  4NI2 B;  2C3O A;  2G1D A;  1REV A;  1GMW D;  2IAJ B;  3PR5 B;  4LIR A;  5F0U A;  1SH3 A;  3OTO F;  4A8S A;  3T1Y F;  1CS4 B;  3MUV P;  1VHI A;  5KFN A;  2RDJ A;  2UVW A;  2AJ2 A;  2ABY A;  2PT0 A;  2V8G A;  3M7V A;  1HBU B;  1JNR B;  2AX0 A;  1JLE B;  3F56 A;  3C66 A;  3JSR A;  1N5Y A;  1JLA B;  1NPP A;  1HQE B;  1VK8 A;  3LAN A;  1BUX A;  3MEC A;  4NML A;  4EU0 A;  3HO1 A;  1LNQ A;  4X4V A;  2JJ4 D;  3K89 A;  3M8Y A;  5U47 A;  3W7B A;  2H5E A;  2DCU B;  3OW2 R;  2D3O 1;  1ZTW A;  4OIX A;  3VGV A;  3CD6 S;  1OY8 A;  2GMH A;  1JJC B;  2V8D A;  3MEE B;  4FVC A;  4W4M A;  3UDL A;  1TFW A;  1D8Y A;  5IQQ A;  2QGF B;  1S49 A;  2D74 B;  2AX1 A;  2GW8 A;  2XMJ A;  3ENW A;  4Z2X A;  4IG0 B;  1M5H A;  1RHU B;  3A12 A;  4H4O A;  3TA0 A;  2MY8 A;  3NAI A;  3RBD A;  1LK7 A;  2FC8 A;  2V8H A;  5KFZ A;  2FVQ A;  2EKY A;  4DSF A;  2XB2 D;  1F2H A;  2SXL A;  4TYB A;  3B4D A;  3PHT A;  2V2K A;  4FS1 A;  5D0R A;  1TUV A;  2VIH A;  1KVK A;  3BB5 A;  3GYG A;  3JYT B;  2DCL A;  3QIP B;  2CPJ A;  3RUB L;  3JTO A;  2MZS A;  3KLE B;  1LW0 B;  4JUZ A;  4RU9 A;  3OL6 A;  3E3X A;  4GKK J;  1RAE B;  3IWL A;  1VQK S;  4ZCM A;  1XMO J;  1FWL A;  2BW7 A;  3AQO A;  2EK1 A;  3FEY B;  1NSP A;  5G4D A;  1MWQ A;  4B17 A;  4NWB A;  4DQS A;  3G6E S;  2FLO A;  1PIL A;  3FJ2 A;  1JLE A;  3MEG A;  1QD1 A;  5D3G B;  2MQN A;  1N5Y B;  1L3S A;  1H38 A;  1HNW F;  4RNF A;  2WSE C;  4NEY A;  3CUN A;  1GXL A;  2BKO A;  4JOU A;  1Q53 A;  2DGO A;  2HAI A;  1K1Q A;  1YJV A;  3J80 U;  2NLW A;  2C3P A;  1Y3K A;  2CQP A;  3CWJ A;  2QYG A;  2ZC4 A;  3M8P B;  1RQ0 A;  3UR0 A;  1PC5 A;  2AEJ A;  1TMM A;  5ADZ A;  3SXL A;  2IM0 A;  2OFG X;  3CD7 A;  4MAK A;  4TYA A;  3KHH A;  1VQ9 S;  3MR3 A;  3ILL A;  4GKK F;  2CXE A;  3MM6 B;  2VZ9 A;  3T6B A;  4PUO A;  2KYZ A;  5HRO A;  3G82 B;  2BJ9 A;  4QWC A;  3LWM A;  3SI8 A;  3H2L A;  4OHX A;  3GFZ A;  3W2W A;  2E5G A;  3CJ2 A;  2BKP A;  5J2Q B;  2H4W B;  2HVH A;  4FXV A;  2IM3 A;  1RYR A;  2CVI A;  1D0E A;  2QEX S;  3MR5 A;  3SZ2 A;  4U8V A;  1UEU A;  2FHM A;  3MTJ A;  5GAD U;  1S59 A;  2F9D A;  2FZG B;  3TYT A;  1YJT A;  2EEY A;  5CZV A;  2VH7 A;  2YH0 A;  3A3O B;  4KR0 B;  3IRX A;  4PXD A;  3SV3 A;  1S79 A;  3C6T A;  1HPZ A;  2OKQ A;  1S9G A;  2FUG 9;  3I0R B;  3K59 A;  4JI3 F;  1YHQ S;  1UW4 A;  3D6H B;  3RYL A;  3W9J A;  2C3Y A;  1LXJ A;  1WEZ A;  1K9M T;  1G3O A;  2FVC A;  4G6V B;  1C2P A;  1NXI A;  3GR0 A;  5D6G A;  3AOA A;  2XC9 A;  3MD3 A;  1CJV A;  3M8P A;  5E3C A;  3BRE A;  2IMW P;  2EKN A;  4ZCI A;  3EVO A;  2XY5 A;  1R0C B;  4HKQ A;  3R8Y A;  2Y8W A;  2DIT A;  2V2Z A;  1NND A;  4CH0 S;  1H3D A;  3RB4 A;  4ZLN A;  3N28 A;  1TL7 A;  3L9Z A;  2CQI A;  4C3K A;  1HNX J;  2UUB J;  3G82 A;  2I5J B;  1U6B A;  2FJW A;  1CLF A;  3QWP A;  1TKZ A;  2CJ9 A;  1SL1 A;  4K4T A;  2VQE J;  3D1O A;  4CYU B;  2AEM A;  2CQH A;  2RE1 A;  4RNH A;  8RUC A;  4QWE A;  5FD1 A;  4MKV A;  3RW7 A;  3DFE A;  4OYA A;  4O3Q A;  2MZR A;  5KFE A;  1ELO A;  5D77 A;  3KUG A;  2XZW A;  1MLA A;  2CQ0 A;  2V63 A;  1F2G A;  2NXE A;  3M2V B;  4ZVG A;  3V6D A;  4YB7 A;  3PTW A;  4DR4 F;  4B3O B;  4Z7C A;  1JLQ A;  1N0V C;  2MPU A;  2HEK A;  4DL5 A;  3BSC A;  3HHK A;  1R0A A;  2V94 A;  1L3V A;  2LKZ A;  4BC7 A;  5KFK A;  5B0D A;  1C0T B;  2PMH A;  2L41 A;  3KHG A;  4KBI A;  5H9E K;  2BOA A;  3OL9 A;  1DQ9 A;  5IT0 A;  3V4I A;  4G65 A;  2ROP A;  1RU1 A;  2N7C A;  3ICL A;  4BHQ A;  1HNI A;  3LH2 S;  2I9S A;  1JKH A;  2RQM A;  3DRR B;  4KYZ A;  3UDE A;  4J9Q A;  2YQ0 A;  3EVW A;  3MR2 A;  1GFW B;  1TL1 A;  2DKO B;  3KK2 B;  1XNR F;  2DNG A;  3LWL A;  3MEK A;  3AOC A;  4OJG A;  1GK8 A;  1IKW A;  1BXN A;  3D0G E;  4ZIV A;  3JQM A;  3OLB A;  1VIS A;  4I7F B;  3I0S B;  3TZW A;  2DNK A;  5H9F J;  2ZE2 A;  4OYI A;  4OHZ A;  4CM0 A;  3MM7 B;  3G4S S;  4DV4 J;  4O4G B;  4ECT A;  2GML A;  1TEL A;  3BKF A;  2LXU A;  1RHJ B;  1S4F A;  3I4P A;  1S10 A;  3R2C J;  2FDN A;  3VTI A;  5H9E J;  1V3Z A;  2IJF A;  1URR A;  2XCA A;  1G6B A;  2Z58 B;  1F6T A;  4RW6 B;  2A10 A;  2CDR B;  2V4J A;  3OR2 B;  2LQB A;  5E2Q A;  2IVF B;  1HQE A;  3R3T A;  4ID8 A;  4D3G A;  3V6D B;  2FJV A;  2VA2 A;  1B99 A;  4LF9 J;  5C5J A;  3DI6 B;  2QC3 A;  2ZM6 J;  3CDE A;  3QFW A;  1VC0 A;  2ZBP A;  4FPR A;  2ZH6 A;  1QAI A;  4LBI A;  1YVF A;  2OSQ A;  4KHM A;  4URG A;  5DLG A;  3PKM A;  1RT6 B;  4KH0 B;  4M5M A;  4JI0 F;  3GE9 A;  5KFY A;  1NK0 A;  3ENV A;  4NA1 A;  1HQU A;  2RSQ A;  1LW2 B;  3WX8 A;  5CAA A;  4OX6 A;  2CDQ A;  2MMY A;  3UCG A;  1QAJ A;  1P9Q C;  3JSM A;  3P3D A;  3D54 A;  3I87 A;  2AGQ A;  3O5T B;  4DUT A;  4ED6 A;  3C16 B;  4L6V 3;  3ET6 A;  2CFX A;  3C14 A;  3ITH A;  4ZP8 A;  3R5B A;  4HL9 A;  2IRX A;  2C2M B;  2CVE A;  3D5M A;  2JOQ A;  3FCW A;  3N6M A;  3PX6 A;  3O1L A;  3RU0 A;  1KS2 A;  4M94 A;  4IOA Q;  2GIF A;  4L3N A;  3KLG A;  1VI7 A;  5DJB A;  4EMD A;  1LWE B;  5EWF A;  3ISZ A;  1FNM A;  4ED8 A;  2AJF E;  2ZDP A;  3J81 Y;  4LF6 F;  3QQC D;  1JLG A;  2CPX A;  2DNP A;  4I64 A;  5HK4 A;  3GIM A;  1IKV B;  4NPO A;  4USH A;  4LMZ A;  2ZHO A;  4F0M A;  2H5J B;  2XHC A;  2KHD A;  4YB5 A;  3W64 A;  4N56 A;  4NLU A;  3VAK A;  1UJ6 A;  2A2C A;  5KFH A;  4WWS A;  4KHP J;  4X64 J;  4DDF A;  2PFD A;  2X1F A;  1FVS A;  4USV A;  3N6N A;  4C0O C;  2W9A A;  4MTP A;  2Z2M A;  1IJE B;  2AZ1 A;  1RTD B;  2DPJ A;  4GKJ J;  3MCM A;  4AT1 B;  2VC0 A;  4NA2 A;  4WTY A;  2Z57 B;  1Q7L B;  3A8J A;  3TO8 A;  3C16 A;  4F26 A;  3N5B A;  4ZN1 A;  3I5B A;  1HYS B;  4F2S A;  3FSY A;  2X1B A;  4NYZ A;  3BN4 A;  2CAD A;  1NB7 A;  1FTR A;  1N32 F;  3T9Z A;  4I68 A;  3R7S B;  2OPQ A;  3HDS A;  1LWC B;  2CQB A;  2J7W A;  3NGK A;  3QAE A;  3DOM B;  1NHV A;  3SSR A;  2IMO A;  2MZ1 A;  4ECU A;  3RBZ A;  1O5J A;  2BE9 B;  3CCT A;  2RHQ B;  3I9V 9;  2WHO A;  1S12 A;  2HRY A;  1ZM3 A;  1JNZ B;  1VBK A;  2VV5 A;  1T9X A;  4EO8 A;  4YDD B;  3DLK B;  4KB7 A;  2GVZ A;  1S6O A;  2G2O A;  3UD5 A;  5A8K B;  4NCG A;  4QIV A;  3W63 A;  2OIH A;  3TEG A;  3DGP B;  5C42 A;  2HHW A;  4USI A;  1RUS A;  4DEZ A;  1KWM A;  2UV8 G;  3IG1 A;  1A0O B;  1FRX A;  1C4A A;  3HFV A;  3T41 A;  3WC0 A;  5AXK A;  4AQY J;  5L46 A;  3FC9 A;  1C4C A;  3FBF A;  1M5O C;  2ACM A;  3FFI A;  2IC3 A;  1NK4 A;  4JI7 J;  4DCJ B;  4JI5 F;  1RE1 B;  1CG2 A;  2HHP A;  2F1F A;  3AY0 A;  1JLB A;  1N5Q A;  4NYO A;  2R7R A;  5KFB A;  5ETN A;  3RRG A;  4RNN A;  6FD1 A;  1V5V A;  2J0Q D;  5D4L A;  4FVM A;  4WPA A;  4WU3 A;  2UUW A;  3TRG A;  1SIW B;  3CC7 S;  2NXN A;  2KXF A;  4GC7 A;  5J2N B;  4DV7 J;  3I82 A;  2ZZN A;  5LSR A;  1SL0 A;  1LOU A;  3L7O A;  4QPT A;  4CRJ A;  5BYR A;  1NCL A;  3M9N B;  1O6X A;  1S1V A;  9ATC B;  2HBY B;  4B3M J;  5KT6 A;  1REG X;  2RQ4 A;  1RHR B;  4JI0 J;  2P2C B;  4J9L A;  2LEA A;  4H4M A;  1RDR A;  2B9W A;  4U6P A;  4B3O A;  3LUY A;  1IQT A;  4OYP A;  2LP4 A;  3SEO A;  5L8R C;  4A46 A;  1I94 J;  1LWX A;  2CNN B;  1VOM A;  1XIQ A;  3O44 A;  3SCL E;  4ITS A;  4Q2M A;  2X51 A;  4UW2 A;  4ELU A;  2EC0 A;  4O44 B;  2LEC A;  1S97 A;  4DR7 J;  2G0I A;  5H9F K;  1VQO S;  1MW7 A;  2D7S A;  2RHS B;  3T1Y J;  3CSK A;  3OTO J;  4C48 A;  4QIF A;  4DPY A;  1S9E A;  4QZV B;  1KQS R;  1KBR A;  3GIK A;  3MPU B;  3QSY B;  1Q7Y T;  1RT3 B;  1VC6 A;  4YR2 A;  3R7N B;  2PC6 A;  2MZQ A;  1RGV A;  2GHP A;  2EFP A;  1UVM A;  1IKY A;  4L72 B;  1YJR A;  4GO5 X;  5KFV A;  4V19 X;  4UOH A;  2ZH2 A;  4Q5V A;  1N4L A;  1CSJ A;  1PYS B;  1BHN A;  1AB8 A;  2RU9 A;  3Q2T C;  1S1U B;  2MDA A;  2HNZ B;  1UVL A;  1N5T A;  3Q2S C;  3LP0 B;  1XNR J;  2EG1 A;  3G86 A;  1WC6 A;  2M8H A;  2J0X A;  2HAF A;  4M5D A;  3NP5 A;  2YKO A;  4Y0F A;  2E1P A;  4AXI A;  1H0H B;  3M4X A;  3V81 B;  2KU7 A;  3MGJ A;  4ILL A;  4FPI A;  4ID5 A;  3DLJ A;  2AYG A;  4J9S A;  3GSD A;  5B0C A;  4DV5 F;  1F5C A;  2OHD A;  2Y0S D;  4HHU A;  4DPO A;  2PA8 D;  3ZZ0 A;  4E98 A;  5HMW A;  1TK5 A;  2R7V A;  3OQ2 A;  1U02 A;  3M30 A;  4RW4 B;  3LP2 B;  1RT6 A;  3HZG A;  2HFS A;  3M8Z A;  5M2U A;  3SV4 A;  2DPI A;  2J9E A;  2VAS A;  2NQP A;  3IWX A;  5F8H A;  2R7U A;  1U1Q A;  3OL8 A;  2FHJ D;  3CC2 S;  3OVA A;  4DQP A;  2LA6 A;  4F3Q A;  3G8T A;  2QL5 B;  1YRX A;  2K1R A;  2HZV A;  2RS2 A;  5K5M A;  1SKS A;  3DLL Q;  1ROF A;  1YDL A;  2V50 A;  2WW4 A;  1G1X A;  2GQ2 A;  2VF3 A;  3K58 A;  4NYP A;  4DHV A;  5IFM A;  4JI6 J;  3MEG B;  5D3G A;  1SC4 B;  2J76 E;  2LA4 A;  3E01 B;  3TX8 A;  4OYZ A;  4B9V A;  1RAC B;  2I8E A;  3G6Y A;  4RW9 A;  2DR9 A;  2VFR A;  2VQF J;  2ZWO A;  2OPR A;  2MJN A;  3M1V B;  2YNH B;  2OFH X;  1JWW A;  3PEH A;  2VJU A;  3QYY A;  4K0K J;  3EGV A;  1NH7 A;  1U6Z A;  4LF4 J;  1XJW B;  2KM8 C;  4HTI A;  3MFI A;  3K7R A;  2RIJ A;  3UPF A;  2YX1 A;  1NPR A;  1YZ6 A;  4ECZ A;  3S01 A;  2J7K A;  5EWG A;  2QFJ A;  4DF8 A;  2EW9 A;  4WFB Q;  1ZAW A;  2M70 A;  2JFD A;  5KOX A;  1EET B;  2ZIT A;  5H1S V;  2ASL A;  2E1R A;  2P9E A;  4TY8 A;  2BW2 A;  3KWM A;  4ECX A;  4FYX B;  2O01 C;  4ES2 A;  4EWT A;  2QL9 B;  2QSF A;  2R7Q A;  1KKH A;  5ITH A;  1TZ0 A;  2GVD A;  4GMK A;  5A0Y B;  4EBE A;  3EDR B;  1FK9 A;  2PE8 A;  2VFT A;  3J81 j;  4J9M A;  3DC2 A;  3KLV A;  4CNZ A;  2YBV A;  1UWA A;  1DBD A;  2D9O A;  4NL5 A;  3SQO P;  3J81 U;  1VRT B;  2D1C A;  1B0V A;  2IYG A;  2VQE F;  1I6J A;  2MGZ B;  2VDI A;  1RAG B;  1NSA A;  3GTY X;  3AAW B;  3M32 A;  3SBM A;  1NAQ A;  1WI8 A;  2CPE A;  1P1T A;  2EFV A;  1GTE A;  4EBD A;  2JC1 A;  2BJ3 A;  2ZJP Q;  4LF5 F;  1TUG B;  4IDK A;  3ILI A;  5JXS A;  2F5G A;  3ENQ A;  1HIY A;  1ZM4 A;  5L9N A;  4IRK A;  2G0J A;  5I42 B;  3MM5 B;  5F8L A;  2P9C A;  2YKQ A;  2H3E B;  2HQG A;  4M5L A;  1WC0 A;  5HAT A;  3BO3 A;  1U7L A;  4LF7 J;  2I5J A;  2GC8 A;  3K5O A;  2K8G A;  1S4E A;  1Y7P A;  2DHG A;  4ZVU B;  4X2B A;  1U0H B;  3C6U B;  1Y4Z B;  3Q22 A;  3H59 A;  2RIL A;  2VU5 A;  3GB0 A;  4O3P A;  5DO2 A;  1ZPW X;  1FKP B;  5KFU A;  1NSQ A;  5F8I A;  2CQ1 A;  1Q79 A;  3PYF A;  4MMO A;  4DUZ J;  4WJB A;  3TAQ A;  1XR5 A;  2E5J A;  4WFX A;  2YKP A;  2GO8 A;  3PNI A;  4KIA A;  2MQQ A;  4C8Z A;  2CPZ A;  4HEA 9;  1JQG A;  3GWC A;  4O4R A;  4K2J A;  5AXM A;  2W1B A;  1S1X B;  3NS5 A;  1FFW B;  5K8N A;  4DR2 J;  2B43 A;  4ED1 A;  3VAI A;  1KFS A;  1IWG A;  5MLC V;  2Q43 A;  3D4J A;  3W3S A;  3PAC A;  3FSX A;  4ES3 A;  3MMA A;  3TA1 A;  1S9G B;  2KHC A;  4HVZ A;  1WG1 A;  4RZR A;  4UZB A;  1JK9 B;  2DNN A;  2VOO A;  1E6Y B;  2DR7 A;  2YTC A;  2DO4 A;  2XLK A;  2YWE A;  1IKX B;  2XZD B;  5G0R A;  2AEF A;  2JDJ A;  2ZVS A;  4KGZ B;  5CAB A;  4ALZ A;  2B3T B;  4RR5 A;  2ZJR Q;  2UUB F;  4MFB A;  5DG9 A;  2EI5 A;  2N3L A;  2BQR A;  1Q78 A;  3CJQ A;  4B08 A;  1B64 A;  1DZ5 A;  4PG4 A;  5BXI A;  4OV1 A;  3PEJ A;  4YR0 A;  3HM9 A;  2NUH A;  1X4B A;  5HL7 Q;  2KM8 B;  2J6S A;  2VL1 A;  1VRU B;  2Q79 A;  2XEX A;  4N8O A;  3IS9 B;  5A8R B;  4OZ1 A;  3PW2 A;  2NRE A;  2ZH3 A;  1T03 A;  4DL6 A;  3C19 A;  2CPF A;  2P8I A;  4DQI A;  4A47 A;  1H6K X;  4RKU C;  1VCT A;  2ZH5 A;  4QYZ J;  1B7Y B;  3C46 A;  1APS A;  3NBP B;  1H2U X;  2CPI A;  2BM0 A;  5C24 A;  2PD1 A;  2HNZ A;  5HBM B;  1FDD A;  1RT5 A;  3IMQ J;  1E6V A;  3AT1 B;  3PYG A;  3JTN A;  1OIA A;  1FDN A;  4USU A;  3R6L B;  3HHL B;  4P75 A;  2HBZ B;  1WHY A;  1NKC A;  2FZC B;  4A8W A;  2BE2 A;  4DR1 F;  4OZ0 A;  4B9U A;  4KY3 A;  4YFU A;  3CUL A;  1E6Y A;  1YKW A;  1DUR A;  2DXE A;  2H5I B;  1DHM A;  4URS A;  4UF4 A;  1N36 F;  1S76 D;  3T5J A;  2WON B;  3L7U A;  4ID5 B;  3ONQ A;  4DZ6 A;  4F04 B;  1HQU B;  5DG8 A;  4IYQ A;  5IV4 A;  4ZP6 A;  3KLH B;  3P49 B;  2DGU A;  2PMZ D;  2HLU A;  4LSN B;  3CJK B;  4IRD A;  5HO4 A;  4L3K A;  5T7L B;  3G9C A;  3M30 B;  4GRS A;  4RW4 A;  5C25 A;  4KO0 B;  3K0J A;  1KSP A;  3GR1 A;  3M2R A;  4DV4 F;  2J8A A;  1RAD B;  1YJ9 S;  4EZ9 A;  3D7S B;  2KG1 A;  3C14 B;  4DSE A;  1HWJ A;  5CD4 A;  2ATL A;  2CJX B;  4PG7 A;  3PV8 A;  5KG6 A;  1P9Y A;  5KFP A;  1TFY A;  2FB0 A;  5KG0 A;  5HRO B;  4LR8 A;  1JLF B;  1R0B G;  2AHO B;  1SJQ A;  2WZ1 A;  1CS4 A;  2BOP A;  4C8K A;  1JJ4 A;  3TUZ C;  3VVT A;  4R8U B;  3V6J A;  3OTE A;  2O67 A;  4DV2 F;  2OGU A;  5EDW A;  3G6V A;  2UUC F;  1I3O B;  2XYP B;  5JUM A;  1KHW A;  3WX4 A;  2C2D A;  4Q8E A;  3HD1 A;  3HI9 A;  3EIC A;  3GFH A;  4K5R A;  3UCZ P;  2I0X A;  1SV5 B;  1TP7 A;  1MRO B;  4P2F A;  1VQL S;  4G1I A;  3TR5 A;  4DI6 A;  2V2V A;  1KVI A;  3FQK A;  5J1N A;  3U1M A;  2HHX A;  1YTY A;  2X7I A;  3DHW C;  1S7I A;  3QLH B;  4PEO A;  3KUH A;  3ULH A;  1BQX A;  1YRT A;  3IR6 B;  3KG1 A;  2IY5 B;  1HWL A;  4Y2A A;  4P9S A;  3U27 A;  1RTD A;  2QJ3 A;  3O2I A;  3PRB A;  1HQ2 A;  2OJ3 A;  3LA0 A;  1H74 A;  4RUC A;  3MR6 A;  1FKO A;  3PX0 A;  1FCA A;  5K20 B;  3BR9 A;  5CA5 A;  1XMQ J;  1SC1 B;  5AE3 A;  1KEK A;  1JLF A;  2RVJ A;  3OXF A;  3MDF A;  2HFV A;  4DLG A;  4PG8 A;  2M5Y A;  2Z8Q A;  1DQ8 A;  2KT5 A;  3NLC A;  4RO0 A;  2NXU A;  3DLH A;  4DV6 F;  2UUA J;  3H8Y A;  3D6F B;  1RBA A;  2XGQ A;  1RWM B;  3DU5 A;  2GNK A;  4TN2 A;  2PO4 A;  4BLG A;  3OJU A;  2HSE B;  2EVZ A;  2ZBI A;  3HMJ G;  3H40 A;  4DSK A;  5KFQ A;  3QGG A;  1UAW A;  2GA7 A;  4B3T J;  3Q24 A;  4JI3 J;  4NLQ A;  1RKJ A;  2C2O B;  1X4A A;  3OBI A;  2NCK L;  4KGV B;  2B8Q A;  2DNR A;  2MQ8 A;  3W62 A;  4AYB D;  5HLF A;  3P96 A;  1KN6 A;  1FDB A;  3CB4 A;  5J2P A;  1RTH A;  4U7U K;  1ACM B;  2OPS A;  4F50 A;  5DGA A;  5C7P A;  2L9N A;  3MM8 A;  1MU2 A;  3I4H X;  4LF9 F;  4RUH A;  3KNA A;  3C8Y A;  4DFP A;  2CG4 A;  1EP4 B;  4IUF A;  3PFE A;  4ZVP B;  2MST A;  2N4D A;  3QWU A;  2YX4 A;  1ZZF A;  5IT4 A;  3SFU A;  3PFO A;  5L1I A;  2B4V A;  3LGM A;  1HAR A;  4YR3 A;  1OWX A;  1N56 A;  2PA3 A;  1Q0N A;  4DR5 J;  4YY3 F;  2DNQ A;  4X4Q A;  2OEM A;  5LMU J;  4C11 A;  3TQ1 A;  1RAF B;  4H4M B;  4CO4 A;  4QU7 A;  1Q95 G;  2WK4 A;  3R5A A;  5BJR A;  1NHU A;  2E44 A;  3W5Y A;  3VAJ A;  2V0N A;  5HN0 A;  2PSZ A;  2PEB A;  3I56 S;  4DQR A;  2B51 A;  1IBC B;  3IR5 B;  2UVR A;  4XDD A;  3CC4 S;  4YB1 P;  1OQ6 A;  1RHQ B;  3T5H A;  4DMZ A;  2UV8 A;  1IBK F;  3DCA A;  4WIQ A;  4FNI A;  2RU3 A;  4L76 A;  2XMM A;  1KTV A;  1UCN A;  5HP1 A;  4X4N A;  2NXJ A;  2OMO A;  1RTH B;  3IS9 A;  1QSS A;  1SUQ A;  1AUS L;  1WC5 A;  4LQ9 A;  3M8W A;  4ECQ A;  3IAS 9;  4CO0 A;  4KH1 B;  1O0P A;  1U8S A;  2CUY A;  3M2U A;  2CNL B;  3AA8 A;  1EKS A;  1JLC A;  2CYY A;  2W9C A;  1NDC A;  2OP5 A;  4RW8 B;  4UZC A;  3NWG A;  2PDA A;  4GVB A;  1S0N A;  2UXC F;  3AD9 C;  3FZB A;  2KT3 A;  3DLG A;  4OYM A;  4ZPB A;  4Z7Y A;  3TAM B;  1N5S A;  3DGV A;  1JLQ B;  1G2E A;  1C0U A;  4Y6I A;  4ZHR B;  1FRM A;  2YKN B;  3BBF A;  4J9V A;  2DIV A;  1KNZ A;  4KSE B;  1S1V B;  1JB0 C;  3JAM U;  3I5A A;  4M5D B;  3M8S A;  2ZOF A;  4F4Y A;  1M1K T;  3KLI A;  4USM A;  1RT4 B;  4P7T A;  2E1M C;  2VBX A;  4WKY A;  2BAB A;  1BGX T;  3IM8 A;  1SQG A;  1J2V A;  3N9U C;  3Q83 A;  4F0H A;  4ED0 A;  4OJ3 A;  3P5T L;  3MEC B;  4Y3C A;  1S1T A;  2MKK A;  3CXC R;  5DS7 A;  1LWF A;  1RZM A;  3TX0 A;  5LMN F;  2Y1R I;  5F8G A;  4IQM A;  2HHU A;  5CD4 H;  4BWJ A;  2JVO A;  3MEE A;  4FNH A;  4ZJQ A;  3KDN A;  4FKX A;  2OTL S;  2HHQ A;  1VDH A;  2Y1I A;  2YPY A;  1SUQ B;  3S6E A;  3LAL A;  3H7H B;  1I1G A;  2M0G B;  4WFY A;  3QRQ A;  4M8L A;  4UUX A;  1N5V A;  1NZA A;  4QYR A;  4CI0 B;  1PC4 A;  5B7W A;  1YIT S;  3GYX B;  1IN0 A;  2Z0G A;  3CCU S;  4H4O B;  1D3W A;  4N76 A;  1EAR A;  1EX8 A;  1TKT B;  3OFG A;  3KUE A;  2W9B B;  4CO2 A;  3BKU A;  4CO3 A;  5D15 A;  1UVK A;  2O3D A;  2QTW A;  4KGX B;  4RW6 A;  1ZS6 A;  4YHH J;  1XWL A;  2YQ1 A;  4J37 A;  4HDH A;  5I3P A;  3TAM A;  2JEJ A;  4RW7 B;  4KGK A;  1FES A;  2HND A;  1FX2 A;  3AB2 B;  4R8U A;  1ZM2 A;  4DPT A;  1XBW A;  2W2O P;  4ES1 A;  5GAH U;  3EUN A;  2KXH A;  2AIR B;  4EBC A;  3MI7 X;  1RU2 A;  2U1A A;  2GX8 A;  1NK8 A;  3KLI B;  3LTO A;  1FJG J;  1FXL A;  2KFN A;  1RKI A;  3NMR A;  2LCW A;  3LGN A;  4O3N A;  1VQ4 S;  4DV2 J;  2O1P A;  3BN7 A;  2R8J A;  4MKB A;  4B3R J;  4Y2K A;  1T9T A;  4WP8 A;  4DL3 A;  2RUG A;  1AZS B;  2RKI B;  2YNH A;  3N4W A;  3DLK A;  4OFZ A;  4P7V A;  3UN5 A;  3ZNU A;  2YNI B;  2DGV A;  2V5H G;  4AUK A;  1NEE A;  5HJY A;  1SXL A;  1W25 A;  3U1L A;  1RTI A;  3SQG B;  3VGU A;  4BBY A;  2GJF A;  3VQT A;  1HNZ F;  2OAU A;  3AFG A;  1ZTT A;  3NS6 A;  4ZN3 A;  4QPX A;  1HKA A;  3DNC A;  4IOC Q;  1OSC A;  3E8O A;  3DRX A;  3G87 A;  3GFY A;  3M9M B;  3W2W B;  4EFA C;  2JFK A;  3NNH A;  1VC5 A;  3OTB A;  4K59 A;  4Q2L A;  3T9N A;  5HAO A;  4X4S A;  3IP0 A;  5FJ4 A;  1FNX H;  3MHY A;  1F0X A;  3KMS A;  2BXJ A;  2QA4 G;  1ZA1 B;  3AD8 C;  1H73 A;  8ATC B;  5GVQ A;  1W26 A;  1JIH A;  2YX7 A;  4M63 A;  2ZBR A;  3H5U A;  3RBE A;  1FXR A;  3OSN A;  3V6K A;  2C22 A;  3RRH A;  1DAX A;  2R7O A;  3LOU A;  1HFE L;  2IDE A;  4R0E A;  4ZLL A;  5KFJ A;  1BQM B;  1HPZ B;  1UMJ A;  3HVT B;  1SJF A;  1UFK A;  5HVF A;  1R31 A;  4HI2 A;  1GXT A;  4I2P A;  2HQF A;  2NSC A;  3KJV B;  2HYI B;  1OMS A;  3BO2 A;  1R8P A;  2GJI A;  4OV6 A;  4I2Q A;  7AT1 B;  4KE5 A;  2XGP A;  3OT9 A;  1RIS A;  1XTZ A;  4LR9 A;  2MKI A;  1RLC L;  1MG7 A;  1TL3 A;  2OPS B;  3ILJ A;  3W60 A;  2OH2 A;  2DHX A;  3HSD A;  1HI1 A;  3I0R A;  3JSB A;  1WOO A;  4Y65 A;  3HVR A;  2VKR A;  1HNZ J;  3T6J A;  2X1A A;  5LMU F;  4EUV A;  1HBN A;  2LLZ A;  5HLF B;  3QJP A;  4Q0B A;  1WG4 A;  3W2V B;  1RWW B;  1YSJ A;  5J2M B;  3FRZ A;  5A76 A;  3E51 A;  2JHE A;  3OVB A;  4OZL A;  1UKU A;  3R5D A;  1AFJ A;  2LU2 A;  4I1T A;  4PXE A;  3Q23 A;  2GHW A;  2A0F B;  2HQC A;  3EGN A;  3FEZ A;  2WRM A;  4WU2 A;  3KK1 B;  1ZET A;  4O3S A;  2XG8 A;  2DT9 A;  3JTP A;  1N52 B;  2OPP A;  2COL A;  3OHA A;  2FVP A;  2A1B A;  4IRC A;  3BO4 A;  4B9L A;  2W25 A;  4DOZ A;  3BBB A;  1I51 B;  3BGO P;  4J7C A;  3UI3 A;  3QRR A;  2KT2 A;  2ZH4 A;  2VBW A;  3BGU A;  5I4M A;  3PG9 A;  1VBY A;  4I6A A;  1CBK A;  4P73 A;  1SJR A;  3OUY B;  2BR0 A;  3GV8 B;  1TAQ A;  4MFB B;  3ADA C;  3HVA A;  3DOL A;  1N36 J;  4ERD A;  3CO0 P;  1CQN A;  1N48 A;  2HVD A;  2JVR A;  3VWS A;  3AQP A;  1GH8 A;  1TK8 A;  2BQU A;  3KOA A;  2E66 A;  1VLO A;  4KFB A;  2GS8 A;  4ZCK A;  5J1E B;  3KK2 A;  1FRK A;  2IYI A;  3ZZU A;  1JLC B;  4W92 B;  4NOH A;  1FHT A;  1T3O A;  2EFQ A;  1ZPV A;  2ZE2 B;  3CJ5 A;  3DRR A;  4FZV A;  2HLT A;  4KT0 C;  3TQE A;  4I7F A;  3KLF A;  4F4Z A;  2ALZ A;  3SCJ E;  2ZNZ A;  3Q8V A;  5F9L A;  2ZD1 B;  4OHV A;  3VAL A;  2D9P A;  3US5 A;  2J9C A;  2M2B A;  2E7X A;  5B0E A;  3RRK A;  4C8Y A;  1QM9 A;  2AZ3 A;  5IM0 B;  2AWZ A;  2OPP B;  5KFM A;  3DRP B;  1X4F A;  2V68 A;  1PYT A;  4TU9 A;  1T95 A;  2EC2 A;  3BGL A;  4A48 A;  3U1N A;  1Y9O A;  4J5O A;  4OYO A;  2Q6B A;  5L1K A;  3G96 A;  4LRD A;  4ZMM A;  2ZUA A;  2F8M A;  2OLW A;  3QZ8 A;  2QFI A;  1HWU A;  1RWV B;  2LU1 A;  3EWG A;  3EXC X;  3NXZ A;  5CZX A;  2NPF A;  5HVG A;  5K8O A;  3W8G A;  1IBL F;  2FVR A;  1GAO A;  1NJI T;  4LQ3 A;  2KFZ A;  1K0T A;  1TVR A;  1X4G A;  4NLT A;  3CJK A;  2X1G A;  1CC8 A;  4ZVS B;  5A8W B;  4FDF A;  2LQ5 A;  1VK3 A;  2HNY A;  3GCX P;  3HKZ D;  4BS2 A;  3HHL D;  4F4W A;  5FDL B;  1TAU A;  3H25 A;  1EKR A;  2HS4 A;  3R6G B;  4QR2 A;  4A8K A;  3VGS A;  1F3V A;  1HBM A;  4DV3 F;  2VG5 B;  1K44 A;  2CPY A;  4C3M A;  3KLF B;  4CLL A;  3ZTO A;  1UJ4 A;  3UO0 A;  3HCX A;  2ZKT A;  3L3C A;  4FS2 A;  4HR2 A;  2CQD A;  1RT5 B;  3Q8S B;  2KKH A;  1NPK A;  4MJK A;  4OLP A;  5IWA J;  2C3M A;  3IN5 A;  4IFV A;  4G1Q B;  1TMJ A;  4LF7 F;  3H5S A;  3Q8Q B;  3CE8 A;  5IQ6 A;  1U1N A;  1RK8 A;  5IC4 B;  3HP6 A;  4DSL A;  2FY1 A;  4NCB A;  1U2F A;  3DDK A;  2CPH A;  3A8K A;  1FWP A;  4EK2 A;  4ZLJ A;  1B4S A;  4B9S A;  1NO8 A;  4F36 A;  4LSZ B;  1VQN S;  4NLD A;  2B7C B;  3CIM A;  4NAS A;  5A8W A;  3DM2 A;  2LDY A;  1S6P A;  3OXG A;  3QO9 A;  1K0V A;  3CJ4 A;  4OQJ A;  1RB0 A;  1HWI A;  4HHJ A;  3L4B C;  4M95 A;  1YLX A;  2AJ1 A;  1F9H A;  3QMQ A;  3D3B J;  1UVN A;  1S0M A;  1FJC A;  1HYS A;  2FC9 A;  2ZDO A;  3WHI A;  2DNH A;  3Q0A A;  2E5I A;  4HYK A;  2K06 A;  1VQP S;  4B3S J;  1XNQ J;  1VQ5 S;  1U25 A;  1FFS B;  2B8P A;  2QE5 A;  3LF0 A;  1N32 J;  3PYD A;  3QJL A;  2QLW A;  5L9X A;  3EZO A;  1HW9 A;  3J7Y U;  1LK5 A;  2HWT A;  2AP6 A;  3ZZT A;  2OD4 A;  3UW1 A;  1UZD A;  2JL9 A;  4B9N A;  5DZ7 A;  2MSS A;  2HWI A;  3T19 A;  2QYC A;  1J5O A;  2LEP A;  5ETV A;  1UJ5 A;  1HA1 A;  2ASY A;  2OD6 A;  3Q8U A;  1HI8 A;  4YHH F;  3F0N A;  3KLE A;  4I2Q B;  1MRO A;  4X4P A;  4WP3 A;  3MAH A;  4ZLP A;  4NLS A;  3UN3 A;  3RTV A;  1HR0 J;  1QLN A;  3NNA A;  1XEZ A;  4LF8 F;  3ZZP A;  4UY8 T;  3BYP A;  2E7V A;  3TAP A;  3FZ2 A;  3GV5 B;  4Y2M A;  3DN9 A;  1FO1 A;  4N47 A;  5KFT A;  4A8X A;  2J9D A;  1RCO B;  3BV8 A;  2QLF B;  3KK3 B;  2QA4 S;  4ILM A;  4IH7 A;  2V4Q A;  1C1B A;  3T5K A;  2GGP A;  4NCA A;  3UFC X;  5IT9 Y;  2P6T A;  2DXF A;  2JC0 A;  1VFJ A;  2R42 A;  4M5K A;  5DRK A;  3VVU A;  1Q8K A;  2BDP A;  4KTQ A;  3MM8 B;  3SDE A;  5A6P A;  2WW8 A;  2YKM B;  3GON A;  1UFL A;  2L48 A;  3NS7 B;  4LT6 A;  3GJT B;  1ZYQ A;  1ZH5 A;  1WEX A;  2B5J B;  2FZK B;  2WVF A;  5K8P A;  1T05 A;  3SIP B;  3HHD A;  3KYL A;  1OO0 B;  1YJ7 A;  4OYX A;  5ETR A;  2PFF B;  2E5L J;  1QE1 B;  2ROE A;  3CCW A;  2OEK A;  4ZPV R;  2UP1 A;  2C2R A;  4FP9 A;  3ISN D;  1OYE A;  1ULR A;  2QMW A;  2W4D A;  4RUA A;  2JSX A;  2F8H A;  2VON A;  2RRB A;  1RTJ A;  3KK1 A;  3L95 X;  4KPC A;  2VUG A;  3KXD A;  3CCZ A;  3NNC A;  3OHB A;  2YVS A;  4HH1 A;  3MPV A;  1VQ6 S;  1OS5 A;  3UD3 P;  3O3L A;  4U8Y A;  2IVM A;  2FVS A;  1WJ9 A;  3BM7 A;  2XLI A;  4MK8 A;  2CQ3 A;  2DD8 S;  3W5X A;  4K4W A;  1V6H A;  2VQF F;  2DTJ A;  4O3R A;  1WF1 A;  1PYO B;  5HMZ A;  4DCP B;  4C8O A;  2FJE B;  3CDU A;  1IXK A;  4JI6 F;  3H42 A;  3OXL A;  4J9R A;  2EFG A;  2GGP B;  2LVW A;  2YWG A;  3LQV A;  3BF4 A;  5A2Q Y;  4CT8 A;  4DG1 B;  3I32 A;  2GO9 A;  4MK7 A;  1NDL A;  3SDE B;  5HJX A;  5CYM A;  4CYU A;  2YKM A;  4XPE A;  3MFH A;  2KZM A;  5CCM A;  5EUH A;  1GX6 A;  4IR1 A;  3K8V A;  4CO5 A;  5MAO A;  2HQD A;  4QBU A;  3PW7 A;  2UXB J;  1NSK L;  4NLO A;  1IR0 A;  4PYA A;  1YI2 S;  1U1L A;  4YS2 A;  1S77 D;  2HW3 A;  3FKB A;  4ZPC A;  1M1G A;  2NSB A;  3QT7 A;  5ETO A;  1RWN B;  1RWO B;  1TKZ B;  1CJK A;  2HGL A;  1HWK A;  2RNE A;  3FRY A;  4WKR A;  4OX9 J;  5KT7 A;  5F41 A;  1RTJ B;  3CO9 A;  1VQ8 S;  2DNY A;  4U7C A;  3CME S;  1DTT B;  3LP0 A;  1HMV A;  1IKX A;  2HQI A;  5G0R B;  1Y5N B;  1FA0 A;  1UWB A;  4C0H A;  1EAY C;  4QWA A;  3RR8 A;  2IM2 A;  4K4X A;  2R8K A;  4BWM A;  5D0H A;  1REV B;  3GJR B;  1RT2 A;  1FKA F;  4ELV A;  4R5P A;  3HSG A;  1SJ3 P;  3HPO A;  4I0W A;  2QO3 A;  2RH3 A;  1L3K A;  1U09 A;  2YXL A;  2C2Z B;  3K8W A;  1VQY A;  1AW0 A;  1FD8 A;  2IHR 1;  4TLR A;  4DXL A;  4F7V A;  3AJ1 A;  2WVB A;  2VOD A;  4KKO B;  4PXC A;  1Q86 T;  1GT8 A;  2ZFH A;  2DB1 A;  2IDL A;  2DNL A;  3PRD A;  3THV A;  2IRU A;  2J7U A;  5C24 B;  2I1R A;  1F60 B;  2O66 A;  3BSA A;  3BQ0 A;  5KFS A;  3JB9 k;  3C15 A;  1Q5Y A;  3FCH A;  5D0G A;  3MZI A;  4JI4 J;  1FEH A;  4RW7 A;  4V1A k;  4M5I A;  3DLE B;  3I55 S;  2DYA A;  2QN6 B;  4DS4 A;  4FBU A;  2MLZ A;  4Y34 A;  4F8R A;  2CKW A;  2CZ4 A;  4X4U A;  2KL8 A;  2F8E X;  5ETT A;  5LM7 E;  3P4U B;  1R8H A;  3D6T B;  2ZZT A;  1UPP A;  2IVY A;  3BPD A;  1QVG R;  3CPW R;  2WBM A;  2YNI A;  2C42 A;  1M5P C;  3M6W A;  2LDI A;  2UU9 J;  2L08 A;  3F44 A;  4H4K C;  4DR3 F;  3GIR A;  4QWB A;  5KTQ A;  2JLE A;  2MHN A;  3AB4 B;  3MD1 A;  1UET A;  5IS2 A;  5AJ3 F;  3PW0 A;  1KFD A;  2VG6 A;  4NXM F;  4F25 A;  2BMB A;  3MAQ A;  4ECY A;  1IVZ A;  1SJ1 A;  2JX2 A;  2MXY A;  3H4B A;  3KHR A;  4DJB A;  3MXH P;  5KFG A;  3B4M A;  1R89 A;  4DV1 J;  2WVC A;  5CQG A;  3S1T A;  1C1C A;  1GNK A;  1SH0 A;  3AXM A;  2R7X A;  4KRW A;  2KB2 A;  4C7Q A;  5D8H B;  5A2Q U;  4AD6 A;  4LFC J;  1S9F A;  4ZPD A;  3MM6 A;  1GMV A;  4MKY A;  2GAH C;  3DYA B;  2VHG A;  1HLW A;  2BX6 A;  3H0P A;  2FLP A;  3W1Y C;  1S6Q B;  2MLX A;  1X31 C;  1YJU A;  4PXB A;  5KG4 A;  4J9O A;  1FE4 A;  1SKU B;  4JI2 F;  2R7S A;  2RT3 A;  5KOW A;  3POT B;  4NA3 A;  2BJE A;  4O0N A;  4ZOS A;  2UVV A;  4ICL A;  2ATC B;  2DEJ A;  2LQJ A;  2LQ8 A;  5HI7 A;  3M32 B;  1XR7 A;  2GVD B;  5A0Y A;  3LGH A;  1JXL A;  1IBM F;  4C4W A;  1XMQ F;  4DR1 J;  1X9W A;  4ZCL A;  1Q4R A;  4UOC A;  1RT7 B;  1HNV B;  1VRT A;  3ETM A;  1LEO A;  5AXN A;  3FMW A;  5IOL A;  4JV5 F;  3PIP Q;  2XYH B;  3MM5 A;  3ZZR A;  4B9T A;  1FKO B;  1HL6 A;  4OI2 A;  1LV5 A;  1H2T Z;  4NXN J;  2E9T A;  3W65 A;  4LF1 A;  1MNE A;  1M5S A;  4IDK B;  5ETK A;  2MQP A;  4XO0 A;  2BVZ A;  1U48 A;  3FEX B;  1RXO B;  4FYV B;  2E7W A;  3PO4 A;  4JI8 J;  3X1L B;  1TV6 A;  4JYA J;  1WKL A;  3B78 A;  4DL4 A;  1FTC A;  4OHW A;  4HTJ A;  2AYM A;  3GIJ A;  3H5X A;  2GIQ A;  3HT0 A;  3UDV A;  3TW0 A;  3RB6 A;  1JJ2 R;  1IQZ A;  4PQU A;  3D3C J;  3B8H A;  1RI7 A;  3DLG B;  3HX9 A;  4N77 A;  2FLL A;  4CH7 A;  3J7Z 5;  2CQ4 A;  1YJW S;  1KR4 A;  1U2R A;  1XMB A;  2IFX A;  3DRY A;  1DTQ A;  3PX4 A;  4UTG A;  1NLK L;  2D3U A;  3Q86 A;  4KHP F;  5KFR A;  3KJV A;  1BLU A;  3AJ2 A;  3EDQ B;  2XS5 A;  1W2I A;  1R6V A;  1VIX A;  1RT4 A;  2DIS A;  2Z2Z A;  3ZNJ 1;  1CC7 A;  3V4I B;  5E3A A;  2HIQ A;  2K3I A;  1ZAV A;  1KHV A;  2V2Q A;  2W4C A;  3CDB A;  4ZPT R;  1WC4 A;  5AT1 B;  2WVD A;  4PCQ A;  1UL3 A;  4CO1 A;  3EXY A;  1R0A B;  5M2P A;  3LP1 A;  4LR7 A;  1EB0 A;  3TAR A;  1N34 J;  3ZZZ A;  4DFM A;  2IPO B;  3UVJ B;  3KJF B;  4IKA A;  1U0S A;  4HHH A;  4PPZ A;  3ITH B;  2HHT A;  1YWX A;  2XCP A;  4B3R F;  1BQN B;  5B0F A;  1BD6 A;  4USW A;  1NDP A;  1QUV A;  3KFW X;  4Q8F A;  4WXW A;  3VV2 B;  3PJ9 A;  3VCD A;  2HBQ B;  2H54 B;  3TVK A;  3IM9 A;  4C11 B;  4ED3 A;  2XMT A;  4DR2 F;  3IR7 B;  1JLG B;  1J27 A;  4S0M A;  1M0S A;  4TY9 A;  1IKV A;  5KFI A;  4L73 A;  4K7Q A;  3U02 A;  1RT2 B;  3QBC A;  3GZ7 A;  5D0E A;  1BE4 A;  1SCJ B;  1X5S A;  4R5P B;  1V5I B;  1WSR A;  5HQM A;  3DU6 A;  3DI6 A;  4TNO A;  2BKN A;  5EGY A;  4TKT A;  1X9S A;  5EX3 A;  4R0J A;  3RBX A;  2QRR A;  1KLN A;  2V4J B;  1F5B A;  4W90 B;  3R5J B;  1QDU B;  4L74 A;  2XO6 A;  3K57 A;  4FF2 A;  3DRS A;  4I56 A;  5C2C A;  3CCL S;  4OLO A;  4AFF A;  2DH8 A;  5K14 B;  2UXD F;  3GJS B;  1K8A T;  2X3D A;  4JI7 F;  1UFW A;  2B4P A;  2W7P A;  2GZO A;  4QWD A;  2LMI A;  3JSM B;  1SQE A;  4I6W A;  1N34 F;  3HHE A;  4KKO A;  3RAM A;  3T3F A;  1NRK A;  2UVU A;  1LW2 A;  2ZC3 A;  1YK9 A;  3A4T A;  4MK9 A;  4YN3 B;  1YX2 A;  2BAN A;  4NRU A;  4OZ5 A;  2W2P P;  4DS5 A;  2FYX A;  2I38 A;  2KI2 A;  4QIE A;  5KG5 A;  4CTA A;  3ET6 B;  3VR1 A;  2FJX A;  3V81 A;  3QIP A;  4EEY A;  2R8I A;  1CEZ A;  4RWX A;  4CCH A;  1PO6 A;  1V3R A;  2CNO B;  2MY7 A;  2OI2 A;  2ZH8 A;  1Z1Z A;  1TQL A;  1S1T B;  4OJ1 A;  5LJ3 Y;  4NCG B;  1MML A;  3M8Q A;  2RDD A;  1TU0 B;  2OO4 A;  2ZWP A;  3VZH A;  2L3M A;  2MGZ A;  1T9Y A;  3QT8 A;  3BH7 B;  4QIG A;  3TWZ A;  1S72 S;  1XR6 A;  1WF0 A;  1U1R A;  2XMW A;  2VG7 A;  3CJT A;  2AQ4 A;  2WBR A;  4IFY B;  1SV5 A;  3Q89 A;  2CQ2 A;  2HNY B;  3NCQ A;  1F3F A;  2PGC A;  1X5T A;  3RB3 A;  1KD1 T;  4I67 A;  3FCV A;  1WDD A;  3HFK A;  5I3U A;  4LVN P;  3ZO7 A;  3WBZ A;  4QW8 A;  3PRV A;  1MN7 A;  4LBP A;  4TVA B;  4TXS A;  2LEB A;  3R1H A;  3E2E A;  4ZVR B;  3CCM S;  4ZVO B;  3T1H J;  2R2R A;  1N54 B;  1KQK A;  4CTA B;  3G6X A;  1N6Q B;  3C6T B;  4LRC A;  1SPB P;  1UA1 A;  1WSV A;  2RDI A;  1UEK A;  1X60 A;  1ARO P;  5KFF A;  1HHT P;  3HKW A;  3EX7 B;  2V9W A;  1S0V A;  4HI1 A;  3IGN A;  1TKX A;  4DUY F;  4QU6 A;  3JXO A;  3HK2 A;  2V67 A;  4EZ6 A;  2YWK A;  3EM1 A;  3LW5 C;  5LXR A;  3AOD A;  4KHR A;  4ICL B;  4CLS A;  4ETX A;  2HRU A;  4NLG A;  1RAH B;  4LUB A;  2HUR A;  2ZEJ A;  4LFC F;  3BJY A;  3AJD A;  3BDE A;  1W2B R;  4EI2 A;  4ED5 A;  3A8I A;  5ETQ A;  3TI0 A;  3FFI B;  4P6Q A;  1S48 A;  3A13 A;  1CJV B;  4YEA A;  4OZ3 A;  3D1H A;  2F4F A;  3RR7 A;  1EQM A;  2N3O A;  1F1B B;  3ZXW A;  4N8N A;  5KAK A;  4QW9 A;  3U7J A;  4KFB B;  1VGY A;  4DV7 F;  3CNQ P;  2ZOM A;  3BYR A;  3D0H E;  3CJS A;  1SVD A;  3OR1 B;  2DGQ A;  3EGZ A;  3UN2 A;  4PWW A;  1J5E J;  4Y2I A;  5A6W A;  2CJQ A;  1VYA A;  4MIW A;  3G2X A;  2BJ1 A;  1HNX F;  1S1U A;  4XK8 C;  4IOB A;  1XN9 A;  2HRT A;  1WEY A;  1DTQ B;  4OZN A;  1EP4 A;  4LVO P;  4ZPA A;  1RA6 A;  4CLK A;  1VMB A;  5DDO C;  1WKJ A;  2HS3 A;  1GXU A;  3MWB A;  2EWH A;  2CQG A;  3QT6 A;  2VFV A;  2W7O A;  3V6H A;  2JRS A;  1RAA B;  2ILZ A;  1Y0H A;  1UP1 A;  4DX6 A;  1NKB A;  2HFU A;  2EXU A;  3F41 A;  4ZDN A;  4MYU A;  1HD1 A;  2IJN A;  4FN5 A;  5CYQ B;  1U0H A;  2FHJ A;  4DFK A;  2C1E B;  1RWX B;  3ZTP A;  2GCF A;  1XER A;  4HT5 A;  4QCL A;  5E33 A;  2G4B A;  5IT9 U;  2CRL A;  1OY9 A;  1YGY A;  3WZ0 A;  4OMF G;  1VR6 A;  2XYG B;  2BBE A;  3MMJ A;  5E3P A;  3CGI A;  2KTQ A;  3MM7 A;  2WSC C;  3I5C A;  4DSJ A;  1FKP A;  3CD5 A;  4P2S A;  1DTT A;  4DL7 A;  1GQE A;  3J7Y I;  1RT1 A;  2DVI A;  1WHX A;  1VQ7 S;  2BJD A;  5KFL A;  4ECS A;  3QFH A;  4F3M A;  2ZHB A;  5F0W A;  1QTM A;  1ZM9 A;  3F73 A;  1FXD A;  2AJ0 A;  3SCI E;  2YNG B;  1OPZ A;  3NG8 A;  5LSO A;  3NY0 A;  2MQL A;  5IZH A;  3T1A A;  4X4T A;  5J1E A;  3EYZ A;  3H2V E;  1R43 A;  1V9O A;  2PEH A;  3QAT A;  3BQ1 A;  4J91 A;  2NZ4 A;  4C97 A;  2YY3 A;  2UXB F;  2ZH9 A;  4CM2 A;  1YRU A;  3MUM P;  4LBH A;  2XBP A;  2G9O A;  1TL1 B;  4U7U D;  3MCS A;  4NZ7 A;  2RRN A;  1T9V A;  2HGN A;  1Q8L A;  1F9E B;  2ASD A;  1A9N B;  2XMK A;  2ERR A;  4QJV A;  1S7H A;  1WOS A;  1H2V Z;  2DR5 A;  3NOG A;  2ZHA A;  1WDT A;  2Z2Y B;  3LPY A;  4DR4 J;  1SI9 A;  4O23 A;  2IAJ A;  2J0W A;  2D41 A;  3GPA A;  3H2U B;  4NX9 A;  5B0A A;  2RRA A;  3H98 A;  5B0B A;  4H54 A;  2ASJ A;  5KT5 A;  4LF4 F;  3AXK A;  3I6P A;  3HXM A;  3VF0 B;  2DJW A;  3MUT P;  1L5U A;  4K4U A;  2EG2 A;  4DPU A;  1WF2 A;  2QMU B;  1TVR B;  3ZZY A;  1WC3 A;  2MZJ A;  2M52 A;  4CLW A;  2YNG A;  4AE5 A;  2FJB B;  2HND B;  1CUL B;  2RUS A;  3M8Q B;  3CCJ S;  2M7S A;  3NRB A;  4R25 A;  2AMC B;  4RBU A;  2XZT B;  2Z30 B;  3M1V A;  4E0D A;  2HMI B;  3WC2 A;  3KTQ A;  1B70 B;  2BA9 A;  2C2K B;  3EGW B;  3E01 A;  1T11 A;  4WCE Q;  4HLB A;  2ZBQ A;  3MUR P;  4F0K A;  4ZK7 M;  1XC9 A;  1VJQ A;  3OJS A;  3NKY A;  2QT7 A;  4IFY A;  4WII A;  1RYS A;  3TJ9 A;  4P10 A;  1C1B B;  7FD1 A;  1RCX B;  3S8S A;  3H5Y A;  4BC9 A;  4X64 F;  1AFI A;  1PG5 B;  3BH6 B;  4K8R A;  4CLZ A;  2FGC A;  4WFN Q;  5C25 B;  2QA1 A;  2DO0 A;  5HVH A;  1CJT B;  3GU0 A;  4XTT A;  4RPF A;  3DYA A;  1MMN A;  3DOK A;  3SCK E;  5LJ5 Y;  5I3Q A;  2ZZM A;  2V6A A;  3A8E A;  4DZD A;  3R7B B;  3ILO A;  3OPK A;  2K7K A;  2ADC A;  2JWN A;  1T8E A;  4C0B A;  4ZP9 A;  2JZ5 A;  1KRP A;  1RWK B;  2CAJ A;  3K5N A;  2GVZ B;  5A8K A;  4K4V A;  4FYD A;  1AYE A;  2BEF A;  2WB4 A;  3OL7 A;  1T9U A;  3B82 A;  2MKC A;  1FE0 A;  2XHW A;  5T41 A;  3KJN B;  1LQ9 A;  2XWY A;  3LAK A;  5DQH A;  4DLE A;  4I2P B;  4PAA A;  5F3T A;  3PW5 A;  4WE1 A;  1U1K A;  1JJH A;  4F02 A;  4JYA F;  2Z56 B;  3NEK A;  3MED A;  4LF2 A;  5KT3 A;  1BQM A;  3HVT A;  5DDP C;  1D8Z A;  2Q66 A;  1YBU A;  4NMX A;  3L7P A;  4HH0 A;  5GAE I;  2HZC A;  5GAG I;  5T14 A;  2FHO B;  3QGH A;  3FMB A;  3N79 A;  4F2R A;  2AKW B;  4GKJ F;  1VRU A;  2L9D A;  1U24 A;  1NJW A;  2XMV A;  3W2V A;  4I6Y A;  1SC6 A;  2VD3 A;  4YB6 A;  3HD2 A;  5KG7 A;  2RQC A;  5I42 A;  3J7A N;  2IM1 A;  4NLX A;  5J2Q A;  2R4F A;  2V4R A;  1DLO B;  4ZIT A;  5DM6 Q;  4D3H A;  2ZH1 A;  2QMX A;  3DOK B;  1AT1 B;  3R97 A;  3RJM B;  2XSJ B;  1HD0 A;  3B6B A;  1BC6 A;  3OR1 A;  3HUL A;  3QJJ A;  2KZZ A;  4J9N A;  2OML A;  4MIB A;  5ETM A;  2MQM A;  5E7O B;  1GMU A;  3G71 S;  1FJE B;  1D09 B;  1PBA A;  2W2N P;  1HHS A;  4Y28 C;  2MB0 B;  3H90 A;  2P9G A;  4WE1 B;  1ZZN A;  3K17 A;  3FK4 A;  1NK7 A;  3ISN C;  3VGT A;  5JJB A;  1RT7 A;  3OR2 A;  4AND A;  3Q8P B;  2VDH A;  2MKS A;  4O44 A;  4MT1 A;  1FF2 A;  5DET A;  2XLJ A;  2Y1J A;  1RWP B;  3H4D A;  4UOF A;  2B0G A;  3CW2 C;  5JVH Q;  3MAA B;  2DY9 A;  2DBB A;  1T94 A;  4HDG A;  3TP2 A;  4QYZ K;  1R8C A;  4NI2 A;  3WIU A;  5L38 A;  4HT7 A;  3PKY A;  4DV3 J;  2EBG A;  4OL8 A;  1YBT A;  5CHC B;  4B3S F;  4NLV A;  3TOQ A;  2W9B A;  1XNQ F;  1ITP A;  4U96 A;  3JS9 A;  5IV3 A;  4EYI B;  5K8M A;  1HBU A;  1VLY A;  4RUB A;  5BYQ A;  4C8L A;  4DWI A;  4JV2 A;  1NH8 A;  3CMA S;  5JVG Q;  2KRB A;  2NS1 B;  1PJ7 A;  2GV1 A;  4C6A A;  4B9M A;  3RW6 A;  2EBE A;  1I5O B;  1B0P A;  2BE2 B;  4OZJ A;  1PKU A;  4OX9 F;  7FDR A;  2JNJ A;  1A6L A;  3CT9 A;  3OFE A;  3HHL A;  4F4K A;  4LF8 J;  4C9D A;  1OJ4 A;  1FRH A;  4DL2 A;  5BR8 J;  3PCO B;  1P6T A;  2C3U A;  3FGV A;  4ZJL A;  4N41 A;  4ZVE A;  1WHW A;  4KO0 A;  1A7G E;  1TR0 A;  3M2R B;  5E5N A;  1B3T A;  3P45 B;  1SL2 A;  4CLP A;  1X0F A;  2GQC A;  1HW8 A;  3KLH A;  1ZBT A;  1CQM A;  2M88 A;  3WQP A;  2OPQ B;  4ZHR A;  1O8B A;  2DY1 A;  3M2U B;  5FLX Y;  4WF9 Q;  1FEE A;  5CXT A;  1VQS A;  2W9C B;  1AA1 B;  4ZIW A;  2K1R B;  3V2U C;  2XM3 A;  3CCQ S;  3M05 A;  5E41 A;  2JEG A;  3W5Z A;  1UTA A;  5SUH A;  3QZ7 A;  1R6Y A;  1YG0 A;  3MMB B;  2R3V A;  2QA2 A;  4G1Q A;  1XQI A;  2MKH A;  3D9B A;  2QIF A;  3VQS A;  4WBF A;  4O0I A;  5HQ8 A;  2V8P A;  3S7R A;  3NGD A;  1M1H A;  4JI4 F;  3HJV A;  2IBK A;  4KC5 A;  3B54 A;  4X4R A;  3CF5 Q;  1KC8 T;  3ZTR A;  3UDC A;  1S6P B;  1NK9 A;  1OSD A;  3PHE A;  2XWX A;  2XY7 A;  3FBE A;  3CMQ A;  4DX8 H;  2XTJ P;  1TL3 B;  5GMK a;  2XNQ A;  2UXD J;  4KAI A;  2E1C A;  1I94 F;  2BJ7 A;  4ETZ A;  5GAH I;  3SSQ A;  3M6U A;  4GVL A;  4QQB A;  1XK8 A;  2PI5 A;  3UNG C;  1B0T A;  4PKD B;  2ZNY A;  3MMC B;  4NE9 C;  2KDO A;  3DM2 B;  5M2R A;  3QO9 B;  1FRL A;  1NZ8 A;  1S57 A;  2WVE A;  3MCO A;  3N01 A;  3N0V A;  3Q8Y A;  3R5G A;  1WEL A;  4HAC B;  4WK3 A;  4C8M A;  4UST A;  1FFG B;  2UXC J;  4QR1 A;  1TV6 B;  2JEF A;  1KTQ A;  1XMO F;  3MR7 A;  5IXU A;  2QG9 B;  4DV1 F;  1T7P A;  1S5Z A;  4BDP A;  1NB2 A;  3HHL C;  4Z37 A;  3EMT A;  3CJ8 A;  1Q16 B;  3I96 A;  2J5A A;  3MMB A;  3UD4 P;  4K4S A;  2CPD A;  4ENO A;  1PAU B;  2DH7 A;  4E8U A;  2RF2 B;  1Y11 A;  2A18 A;  1IJF B;  4ILR A;  2MJU A;  4M5G A;  3BDP A;  2J0S D;  2WAQ D;  4OI0 A;  4FXW A;  1MWY A;  4OJH A;  1IBM J;  1RWU A;  3QID A;  4PPD A;  5KFW A;  4TU7 A;  1Q8I A;  1RBL A;  3MED B;  3PJX A;  1AZS A;  2RKI A;  3K5M A;  2MLY A;  3PZP A;  2BAC A;  4WXO A;  3BGR A;  1H7W A;  4TQS A;  1U45 A;  2E29 A;  1S9E B;  5ETL A;  1TKD A;  2H48 B;  4NXN F;  3T1H F;  4WP9 A;  1JXE A;  1N0U A;  4YDX A;  4DFJ A;  4C2M A;  4IR9 A;  3P8B B;  2DHA A;  1T05 B;  4KGM A;  1G7C B;  1Y5I B;  2RD5 C;  3MCN A;  4ZVH A;  2MZT A;  1YZ7 A;  5D4N A;  1YBA A;  2MQO A;  1NJZ A;  1KVJ A;  2X3G A;  3DXS X;  2AD9 A;  2DRB A;  2DNZ A;  1IWA A;  4CLT A;  3DDN A;  5GMD A;  4RU2 A;  4Y2C A;  5EWE A;  1U6F A;  1NUE A;  2N4C A;  4O3O A;  1FDA A;  3P6Y C;  4V19 J;  1KON A;  4WZQ A;  4L75 A;  2ZUG A;  1IUJ A;  2QSW A;  1IKY B;  3I31 A;  1QSL A;  1MSW D;  3M6V A;  4QIW D;  4X66 J;  2LXF A;  4X84 A;  2AU0 A;  2CJA A;  2NPI A;  4OI1 A;  2LFV A;  1ICE B;  3KG4 A;  4NLP A;  2FLN A;  2KJW A;  1LWF B;  1GX5 A;  1PIE A;  3KMQ A;  1ZOT A;  1C0T A;  2D69 A;  3MPY A;  1WG5 A;  1RP5 A;  4J90 A;  1FJ7 A;  3IGV A;  2F40 A;  4P72 A;  1X9M A;  3RZA A;  1QVF R;  2ADB A;  3QPI A;  4WZM A;  1HNI B;  1JLA A;  2YWW A;  3FUY A;  2N82 B;  1JLB B;  4NXM J;  4JI8 F;  4PG6 A;  2CJY B;  5CYM B;  1NK6 A;  5DDQ C;  2UU9 F;  1RBO B;  1TKT A;  2CJK A;  3IO1 A;  5JMN A;  4NEZ A;  2ZOG A;  2AF6 A;  4OHY A;  3J80 Y;  3VZI A;  1NBE B;  1IKW B;  2XO7 A;  5F9N A;  3PO5 A;  4CDI A; 
#chains in the Genus database with same CATH homology
 2XZT B;  3D6M B;  2CDR B;  3P45 B;  2CNN B;  2C2K B;  4ZVS B;  4ZVU B;  1SC3 B;  3D6F B;  2QLB B;  2QL7 B;  3R6G B;  1RWM B;  1RWN B;  1RWO B;  4JB8 B;  1NME B;  3EDQ B;  2CNK B;  2C2O B;  3R7N B;  3R7B B;  3KJQ B;  1RWK B;  3GJR B;  2XZD B;  2C2M B;  3KJF B;  3KJN B;  2C2Z B;  5IC4 B;  2H4W B;  4ZVP B;  2QLJ B;  4LSZ B;  2HBQ B;  2H54 B;  2H5J B;  1BMQ B;  4ZVQ B;  3QNW B;  3D6H B;  2C1E B;  1RWX B;  1QTN B;  1IBC B;  3R6L B;  3R5J B;  3RJM B;  1QDU B;  1PAU B;  1RHQ B;  1RWW B;  3P4U B;  2QL5 B;  2HBZ B;  3GJS B;  3IBF B;  2XYG B;  2H5I B;  3R7S B;  5IC6 B;  2H51 B;  1SC4 B;  2CNL B;  2HBR B;  2Y0B B;  3IBC B;  2H48 B;  2Y1L B;  1I51 B;  2H4Y B;  2QLF B;  2CJX B;  2H65 B;  3GJQ B;  1RWP B;  2CNO B;  2FQQ B;  3NS7 B;  3GJT B;  3SIP B;  1I3O B;  2XYP B;  4DCJ B;  1RE1 B;  2QL9 B;  1ICE B;  1F9E B;  3EDR B;  1GFW B;  1RHM B;  2DKO B;  4ZVT B;  1RHK B;  2XYH B;  2HBY B;  1PYO B;  2CJY B;  4ZVR B;  4DCP B;  4ZVO B;  4DCO B;  1RHJ B;  1RHR B;  2P2C B;  1RHU B;  5K20 B;  1RWV B;  1SC1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...