4ZVTB

Caspase-7 variant 1 (v1) with reprogrammed substrate specificity due to y230a/w232m/s234n substitutions, bound to veid inhibitor.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYASMRNPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 17
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvtB00
3SIPB 5IC4B 4ZVSB 1PAUB 1RWXB 2Y1LB 5IC6B 3KJQB 2XYHB 2QL7B 1BMQB 1RWPB 2H65B 1QDUB 2QLJB 1RHUB 3QNWB 4ZVQB 1RHRB 2CDRB 2DKOB 2FQQB 3P45B 2C2ZB 2H5IB 4ZVUB 1RWKB 2C1EB 1IBCB 2H54B 2HBZB 3GJTB 1F9EB 2CNLB 1RHMB 5K20B 2QL5B 2XYGB 2Y0BB 2HBQB 3EDQB 3D6HB 4DCPB 2XZTB 4JB8B 4LSZB 2HBRB 3R7NB 2H5JB 1RWVB 2CJXB 3KJNB 3IBCB 2C2MB 1SC4B 3NS7B 1RHJB 4ZVPB 2HBYB 1RHKB 3KJFB 1RWWB 4DCOB 1RWOB 3RJMB 3R7BB 2H4YB 3EDRB 3GJQB 2C2KB 1PYOB 4ZVOB 3P4UB 1RHQB 2XZDB 2CNNB 3GJSB 3R7SB 3D6FB 3GJRB 3IBFB 1RE1B 1RWMB 2H48B 3R6GB 1QTNB 3R5JB 1NMEB 2CNOB 4ZVTB 2H4WB 1ICEB 1RWNB 2H51B 2QL9B 4DCJB 2XYPB 1I51B 2CJYB 4ZVRB 2QLFB 1I3OB 3D6MB 1SC3B 2C2OB 1SC1B 2P2CB 2QLBB 1GFWB 3R6LB 2CNKB
chains in the Genus database with same CATH superfamily
3O5TB 1DLOA 2HQ3A 3A8IA 4L74A 1JLEA 3HKZD 3LTOA 5I3PA 2ALZA 2LU1A 4PXDA 2BQUA 1S10A 1Y3JA 4WFBQ 4B9LA 4DR3J 1S97A 4BLGA 2XS5A 1YJVA 2QEXS 4J9LA 2CNLB 4Y2KA 2QA4S 5D77A 2UP1A 1KWMA 1XMQJ 3MAAB 1CS4B 2HFZA 2DB1A 3TYTA 4B3OA 5BXIA 1SC4B 3GYXB 1RGVA 4J9VA 5KTQA 4LF1A 4CTAA 1LW0B 3ITHA 4TU7A 1S6UA 2HHUA 3R5JB 3FSYA 4WXOA 3K0JA 4ETZA 2QV6A 1ICEB 1KRPA 1XTZA 2AHOB 2IM3A 3MR6A 4A48A 3M2RA 4E2FB 4K4VA 1KTVA 1FKPB 5IS2A 1XC9A 2YQ1A 2AIRB 2HGMA 1REVA 4TXSA 2UUCJ 2FJXA 2QE5A 3T1HF 4NMXA 4OIXA 2DNGA 4ZN1A 3A8EA 3TAQA 2ALYB 3KHLA 2B5JB 2MKKA 4KKOA 2OELA 4DS5A 1VBXA 4RNMA 1VQ8S 2H5EA 4NEZA 2ZUGA 3U27A 4DCPB 1T3OA 2EFGA 4DV6J 3IG1B 4LFAJ 3NL0A 4C8ZA 3MMAA 3PKYA 4DUTA 1GMWA 5D4LA 1X4DA 2KRBA 4X65F 2DNHA 5HVFA 2C3OA 4OZ3A 2ZBQA 4ED7A 1KVKA 1A9NB 1FWKA 1KOHA 4CCHA 4ZN3A 2C2DA 3S1TA 1NK9A 4EUVA 3E01B 4I69A 5KOXA 2VJVA 1K47A 2HAFA 2KVQE 4MMOA 4G65A 3PACA 4OYAA 3CDEA 3R8YA 5JVGQ 2EBEA 2KXFA 4OV6A 1NB2A 3K7RA 3J7Z5 2B0GA 4X84A 2UXCF 5HSPA 5ETNA 2UU9F 4FS2A 1KONA 3BB5A 1SKRA 1HPZA 3PHTA 1VRQC 4I67A 3WBZA 3MM6A 4KHPJ 2RB7A 4DZDA 3CC4S 1TL7B 4CYUA 1S59A 5DLFA 2Z2YB 2MDAA 3RBXA 3M32B 2BZ2A 2KT2A 1C4CA 3GYGA 4OYPA 5KFTA 2DPIA 1JJ2R 1WORA 2FZKB 1EIYB 3CSKA 2CDQA 3QO9A 2HHXA 1H73A 1F5CA 4WE1A 1X5PA 3QGGA 3Q86A 1MWZA 2Z8QA 3MMBA 1XMBA 1JMTA 5HQ8A 4KBIA 1U6ZA 4UOGA 1ZZFA 1D9AA 4LF9J 3AOBA 2FVQA 5D6GA 5K14B 2HWTA 4CLTA 4DFPA 2FD2A 3SCIE 3KG0A 1HBOB 3I0SB 1JXVA 4UTGA 3GIIA 2OO4A 3ZZZA 2N3LA 1BLUA 3I9ZA 1OO0B 4LVNP 5L1LA 3TUPA 3R6LB 2ZDPA 4JV2A 2X1GA 4X66J 4J9SA 3MURP 4HTIA 2CQIA 3Q89A 4YS2A 4GRSA 3EVOA 2UUWA 4J91A 4WFYA 3M8QA 4FKXA 3DHXA 4W90B 4OYZA 1W7WA 1BHNA 3R5DA 2ZITA 2IM0A 1TKDA 3CDBA 5CABA 4H4OB 1YZ6A 4HI2A 2D9PA 2JNJA 2XHCA 2WVFA 2KN4A 1KVJA 3MCOA 3TZXA 3D1OA 3AA9A 4B02A 3FZ2A 1KVIA 2XZDB 3C14B 1D9DA 2LKZA 2ZOGA 1NK7A 1FHTA 4PYDA 1V6HA 1WKKA 1WOOA 4FYVB 4HYKA 5KT5A 2FLLA 3KYLA 4MIBA 5EGYA 1S7IA 2HIQA 1H74A 1S0MA 3W2VB 2AGQA 5L1IA 2P9GA 4UUXA 2FVRA 1H38A 2VBZA 3MPUB 2C28A 1B3TA 3SIPB 3MM9A 2GZOA 1PAUB 4JI1J 4DR7J 1TK8A 3QWUA 4RJVA 1VGYA 1OSCA 3BH7B 3UI3A 4ID5B 5K5MA 4WK1A 3SCLE 3HHEA 1LEOA 3N5FA 4NXNF 2V34A 5CYQA 3VQSA 2ZD1B 3W2VA 4HVZA 1KTQA 3BJYA 1U47A 2XSJA 4DV0J 2OSRA 4OMFG 3TX0A 3IC1A 4JBCA 2J9CA 2OAUA 4GVBA 5BJRA 3CD0A 2RHQB 4JYAJ 1YJ9S 5L38A 1KQFB 4LVOP 4U95A 1V9OA 3FCHA 3V6DB 2PFDA 3NOCA 4M1KA 2YQ0A 4LF4J 1Q4RA 5E0OA 5D15A 1S0OA 3GILA 2RF2B 5DDRC 1JLGA 2AEMA 5D0RA 4N76A 2G0JA 4PWWA 2IC3B 3MTJA 4IOAQ 1F9HA 1LWXA 3I31A 2RJZA 1L3TA 4WU3A 1CJUA 2MPUA 3LGHA 3L7UA 1RHUB 3ZZYA 2GMJA 3I32A 2DNNA 1SCJB 5KG7A 4YR0A 5E3RA 4CLUA 3JSYA 3DKDA 3FJ2A 2Q43A 2GMHA 3H20A 3EPIA 2W8KA 1FD2A 1RT1B 4G1QA 4C8KA 5J1EB 4DPXA 1YJRA 4RW6B 2IPOB 2MQNA 3Q23A 1Y11A 2YY3A 1KNZA 2LEBA 2QO3A 2M9KA 3BR8A 3QWPA 1VHIA 2N82B 3IWXA 2U1AA 2YWWA 2X7IA 1DTQB 2CZVC 2CG4A 4F3OA 4DEZA 3HO1A 1SKWA 2F65A 3ZTSA 1FK9B 5KFYA 3TEGA 3DI6B 1JNZB 1UPMB 2K7KA 3CE8A 2RS2A 4O23A 4WZMA 3HFVA 2E29A 3H2LA 5BYSA 3KUEA 3FC9A 4OJHA 4EEYA 1ZM4A 2BV3A 2JEGA 2Q6CA 2XMTA 4M63A 3JQJA 4B3TJ 4A46A 2MZJA 4JUZA 2BE9B 4O3SA 1CJVB 2NR0A 1NHVA 1G1XA 4FP9A 1S9EB 4CNYA 4TVAB 2I9SA 4ATNA 2OLWA 2IAJB 3D67A 3VAJA 4RKUC 5HROA 2OI2A 2ZBRA 4JI5F 2K2PA 2YNGB 2CZ9A 4QBUA 2UUTA 4CLKA 1HNZJ 1GH8A 3PKMA 4TU8A 2ZE2B 4A8YA 1DTTA 1KLMA 3QT6A 1EP4A 4OJGA 1SJRA 2J0XA 1GTHA 4OYBA 1N32J 3KFWX 4ICLA 3CVKA 2GGPB 2P2CB 2YNGA 5IV4A 1S12A 5IC4B 1V3SA 3M8PA 3NCQA 1IBKJ 4NRUA 3PX4A 2JC0A 1HL6A 3TZZA 2QYCA 1K0TA 3K17A 2L48A 3P96A 4OYWA 1RTIB 4H4MA 3RZAA 3HHNB 2V94A 3ZTRA 4ZPVR 3UN2A 5I3UB 1HI0P 4WYWA 3L95X 4C48A 1SBRA 1HQEB 3K89A 1NHKL 2EBGA 2N4CA 1M5OC 3HT3A 3EPGA 1HARA 5E7OB 2KXHA 2JVRA 1S6QA 5CXTA 2DNOA 4JI3J 3AA8A 2DRDA 2E1MC 3PG9A 3OR1A 1JJ4A 4TY9A 2BRLA 5AE3A 2V2KA 2ZHOA 1KHWA 2HHHJ 4O0IA 2VPZB 1VRTA 3WHIA 4NI2A 1VQPS 3HKWA 1NKCA 2OD6A 5KG5A 2C2OB 3CNQP 4IR9A 2VD3A 4KY3A 1J5EJ 5CCMA 4WK3A 3IS9B 4W4MA 2PI4A 4QYRA 3U1MA 3KXDA 3RB6A 1LWFB 3DU6A 4IOBA 1VLOA 3CDWA 4ZVUB 1RT3B 2RAQA 2H54B 2JH3A 3CCQS 5JVHQ 3R9LA 3V2UC 2DCLA 3MFIA 3MFHA 3T5JA 3KDNA 4M8LA 5HANA 1TL5A 4OFZA 1PO6A 4AUKA 3RJMB 3R7BB 4DSKA 3MTKA 1X4FA 4CLWA 2OGUA 3R7SB 2LLZA 2WVBA 1DQ9A 1JNRB 2DBBA 2ILZA 4HHHA 1AUDA 2QZ8A 2BM0A 2GO8A 1JLFA 4I1TA 2M70A 2LFVA 2LDYA 4NCBA 2EC0A 3H4BA 3MR5A 2N7YA 4JI7J 4QZVB 4P2SA 5GMDA 2R7TA 5HQMA 1N52B 3M9MB 1NK6A 4AQYF 3KUHA 2RVJA 3QJLA 4DFKA 4FF4A 3QATA 3QNWB 3D0GE 2YPYA 3GG0A 2MQOA 3CJKB 5I4MA 1VC5A 4BHQA 4OZLA 3OTEA 2M0GB 1R27B 3AB2B 1U1OA 3S8SA 1H0HB 1ZYQA 4YMEA 1XIQA 5J1NA 4DR1J 1MMLA 1SVDA 1U2FA 3IMQJ 1TU0B 3F0NA 3KK1A 2P8IA 1HMVB 3T6BA 4DR2J 1B7YB 2AJ0A 1WI6A 4RZRA 4ED4A 2MGZA 4EFAC 3EWGA 4OV1A 4DPOA 2KM8C 4N41A 3CJKA 3HHLC 2VPWB 1QTNB 3ISNC 3OL7A 5F3ZA 2CQ4A 4ECYA 1K1QA 1M1HA 2KJWA 2ABYA 2W7AA 2UUAJ 2G13A 4NA3A 4DSJA 5KFMA 2YKMB 3C15B 1KFDA 3OUYA 3HHLD 2NYHA 2V9KA 3CCUS 4C7QA 3J7ZT 2M2BA 1H3DA 2H3EB 3LWMA 4EBCA 2VL1A 5FLXU 3NNAA 2MKCA 2QL5B 4AFFA 4DX7A 3DC2A 3CJQA 1EQ0A 4W98A 2L41A 4MKVA 1RAJA 1LWCB 3MWBA 5FIIA 1VQYA 1S76D 1C2PA 3HVAA 3J7A1 5L1KA 4O44B 2EKNA 1IVZA 3H7HB 4TY8A 2ZWOA 1R43A 2YBVA 2W2PP 2YWKA 5EDWA 3MPYA 1Z4UA 4ZP7A 5IQQA 3N01A 4ZCIA 1K44A 1SQFA 2XNRA 1IUJA 2JZ5A 2VH7A 4NYZA 4IG0B 1R8BA 5AXMA 3Q22A 1LWCA 3T1AA 1Q79A 4JI0J 1HHSA 5KFAA 4ZVFA 1JLQB 3CCVS 2AQ4A 4C3MA 5H9EK 4L73A 4DJBA 4NLXA 3C6UA 1NO8A 1G2EA 3P6YC 2EFOA 4L76A 4EO6A 5F8HA 4I68A 3HPOA 1UWBA 3KLEB 4O4GA 5ADZA 3KLGA 3DLGB 2FB0A 2W2OP 1QSSA 3KLFB 4C0HA 3V5RA 1GQEA 3GJTB 3VHQA 2KHCA 3ILLA 3W8GA 4L6V3 5KFSA 3DOKB 3KLHA 3Q83A 4L3KA 2PE8A 4MKYA 4LSLB 1Q7YT 2KFYA 2E1RA 4OHWA 2BANA 3LP1B 3PW0A 3KLIA 4KAIA 3EGZA 2VJUA 1UW4A 3B4DA 3I55S 3VWSA 2BACA 1BQXA 3SCKE 1Q8KA 1RYRA 3MEEA 3GJSB 1EETB 1UEKA 3HFZB 2RMLA 3CULA 4EK2A 3D28A 1RISA 3KJVB 1S4EA 4I64A 5D0GA 4CM0A 5EWEA 5F8LA 2OMLA 3C8YA 3CEDA 4C11A 5ITHA 3DOMB 3QYYA 1MN9A 4WFAQ 3ZTQA 3FEZA 2NPIA 1FKOB 1RTDB 1QY7A 4LFCJ 4DOZA 3D0IE 2KT5A 3M2UA 3TP2A 1M1GA 2XMKA 1R3NA 1WDTA 4J9KA 4ECRA 3QBCA 5M2RA 1RK8A 1Q78A 1HHTP 1U48A 5J2MA 3M05A 1RT2A 3ZNJ1 3DOMA 4CO4A 2F9DA 5GAEU 4ED8A 4PUOA 2W8LA 2X3DA 3OFFA 1YSJA 1FA0A 2CFXA 2HBRB 2K1RB 3AFGA 2V2VA 4DU8A 3EE3A 1GEHA 4ZKAA 1RWWB 3AJ2A 4FXWA 1VBKA 2NS1B 1IQTA 2D41A 4LT6A 1NK8A 2CJQA 4PG5A 5CAAA 4UQTA 1GT8A 2Y1JA 2AYGA 3HLUA 4F3MA 2QJ3A 2NCKL 1Y0HA 4PAAA 1TR0A 2Z57B 1CPZA 4WFZA 5C24B 2GX8A 3W66A 1HQUB 1IBLJ 2MQPA 2QLXA 2LEPA 2YNFB 2Y0SD 5B09A 2IRYA 3D6TB 1JJCB 2QMWA 2ROPA 1Q82T 1SL2A 5EUHA 2HNZA 1WG4A 3I87A 5GADU 1WSVA 2RQCA 3E3XA 3UWTA 4M94A 3Q2SC 2HQIA 1IKXA 3G2XA 3KK3A 2MKHA 3L4BC 2FQQB 1SI9A 2C2ZB 1C1CA 4M5GA 5BYQA 3U1NA 3M7VA 4LR9A 2VFTA 1SH2A 3RAQA 1RT5B 1MG7A 1UZDA 1H6KX 2VU5A 3W1YC 4X64J 7FDRA 3KHHA 5LT5A 3SXLA 2IHR1 3M6UA 4NRTA 3T1YJ 5GAGI 4YHHJ 3FVYA 3MUVP 1LXJA 2AWZA 3MM8A 1WC6A 2W4DA 3SBMA 2ZZTA 2HPUA 5A8RB 3T19A 3V6HA 1R31A 1DURA 3CJ4A 1S0VA 3V4IA 4DHVA 4ECTA 2V6AA 2GQ2A 4PXEA 2XI3A 5ETLA 1UVIA 1BQNB 4C8MA 1S1WB 5C7PA 3NEKA 4ZP6A 3QLHA 3IR7B 1TFYA 1YK9A 3MD1A 2BOPA 3M8YA 4EU0A 1M0SA 1BXNA 4TNOA 4S0MA 5JMNA 3HVRA 1NSPA 3O2IA 5HI7A 4OI4A 4YB6A 1N4LA 3Q8QB 2HHSA 1S1WA 2FGOA 3THTA 2QMUB 2BJDA 3O1LA 2RKIA 5F8MA 1CULB 5HMWA 2CPJA 1MLAA 3TQ1A 2GJ2A 5DG9A 3CTRA 2NXNA 3BDPA 3CT9A 1K9MT 1VMBA 3HHDA 1XNRJ 4U96A 1OY8A 1WC1A 4U6PA 2IDLA 2GHVC 1I51B 2HMIB 2KG1A 3OVSA 3S6EA 5LSOA 2NXEA 4LF7J 3ICLA 1RZMA 3NY0A 4NLDA 1VQOS 4ZA1A 2IJFA 1X4CA 3E8OA 1RA7A 3OR2B 1RTHA 2HNYB 2ZH3A 3ZTOA 1TKZB 3VAKA 4MH8A 4YP3A 1VQ5S 3PIPQ 2HMIA 4KC5A 1S77D 5I3QA 4QWEA 3HVWA 3MCSA 1WHXA 1XNQJ 4P72A 5CYMB 3QT5A 4F4KA 3K58A 2FLOA 2DGXA 3FBBA 4F2RA 2Q79A 4EBDA 1ZA1B 2AJ2A 2AYEA 1RBOB 2RE1A 2U2FA 4WU2A 2CZ4A 3AOCA 5F9NA 4PYAA 1FFWB 2B9XA 2DXDA 1Q5YA 4WP3A 2ZH1A 4FYWB 1E6YB 1UAWA 5ETVA 3AD9C 4ZLJA 4ECZA 3JS9A 5EWFA 1TKXB 5DZ7A 1X4AA 2R7WA 3MDFA 2E7XA 2HURA 3N6MA 4CDIA 2RRBA 4PWUA 2ZM6F 3I0RA 3LGMA 1IKWB 2QSWA 2PN6A 2G0CA 4NPOA 3B78A 1CC8A 1VJWA 4K4XA 1TMJA 4CH7A 3LPEA 4IH7A 2Z4PA 1TV6A 1B99A 1QDUB 2QA4G 1E6YA 4ED2A 2CVIA 1CJKB 8RUCA 4U9RA 2E44A 4P73A 1S1VB 1TKXA 2O1PA 2MB0B 1U1QA 3UR0A 3W62A 5T41A 2R7XA 2RQKA 2N4DA 4J9RA 3PW2A 2VOPA 4LFBJ 3CMQA 4LRDA 5IWAJ 3MPDA 3OVAA 2AJQA 1RKIA 3W2WA 1NNDA 1BGXT 3ILOA 1HNXF 2YTCA 1GX5A 4MK9A 3N4WA 2YPZA 1FJGF 3OVBA 1RT6B 3AB4B 2DXEA 4OI1A 1QE1B 2YWHA 4I56A 4L75A 3VGUA 2ZJQQ 5A2QY 1RAAB 2QA2A 2H51B 3TAMB 1FFSB 4AD6A 2IBKA 3QT7A 3G82A 1JLAA 4UT4A 1B0VA 2QSFA 4OYXA 2CNKB 1CJTA 3UO0A 4GO7X 3MM5B 1WOSA 1TP7A 4K5RA 2F5GA 3TWZA 1NKBA 5HO4A 2GVDA 3CCLS 2FUG9 2XNQA 3W7BA 4O3PA 4DV4F 4K50A 2BE7D 2UV8A 4ZJOA 1X4EA 1I94J 4NXMJ 1URRA 5L1JA 3LP2B 5FD1A 4LREA 4Y65A 5IM0A 2DR8A 2BKOA 1M90T 2ASDA 4DX8H 1B7FA 4ALZA 2AT1B 3KUGA 4KTQA 1SJ4P 2MY7A 3J80U 2OEKA 1R8AA 1Q7LB 2VB6A 3LALA 2HRYA 3OFGA 1RAHB 1ZA2B 2D9OA 4KIAA 3B6BA 4DR4J 1XK8A 4ZVHA 3F73A 4RWWA 2POKA 2KYXA 1WDDA 1LXNA 5AXNA 1RAEB 2XYPB 1I1GA 3DGPA 1JLBA 2J0SD 4MFBB 1IBMJ 3K59A 5M2PA 3RG6A 2IVMA 4F4ZA 3JSBA 2J76E 3CF5Q 2R8HA 4PKDB 3DRRA 4UOCA 4OX9J 3QT8A 1VC6A 3K57A 1NK5A 1OS5A 1RWKB 3G86A 1WKJA 4Y6IA 3IWNC 2UUBF 1FF2A 2GW8A 3UR3C 1NDCA 3SMZA 3GP9A 1LQ9A 1N6QA 5LMUJ 3I5CA 1SXLA 1CC7A 3OBIA 1L3VA 4ETXA 2W2NP 2WB4A 3IBWA 3NBPB 3Q8SB 4ECVA 4OLPA 2RIJA 3QPIA 1NLKL 3BPSP 4IG3B 3OHAA 3LW5C 4RW8B 1HBUB 1CQNA 1SPBP 3GFHA 1O6XA 2MZ1A 5F41A 4RW7A 1VISA 1RTJB 1RABB 2J9DE 4ZVTB 3T5KA 3MCMA 4RW4B 3K5NA 3T9ZA 3EICA 2PEHA 4FZVA 1X5SA 4QPTA 4OYOA 1QAXA 1RWUA 5E33A 2XO7A 3MPVA 3QJJA 4DR6J 2M5YA 2B9YA 2MHEA 4WBFA 2M7SA 5A0YB 3BYPA 3POTB 2BBEA 1S1TA 4LIWA 3KOAA 1D1UA 3MR2A 3PO4A 2GIRA 4RW4A 1RSCA 3MHYA 1RB0A 1XJWB 1NSKL 3UCZP 1CG2A 2FJDB 2HW3A 1SV5A 1JKHA 1TL4A 4DG1B 1YQHA 4USIA 2GCFA 3PZPA 4DCOB 3H90A 1U8SA 3POTA 1P9YA 4OZ5A 2CNNB 1U0HB 3AY0A 4DN0A 4F0HA 4RNNA 1TQLA 1Y9OA 2JHEA 1X9MA 3N5BA 2A3JA 1U6FA 4DQIA 5AJ3J 2NXCA 1KC8T 5KFGA 2RHSB 1FCAA 2V8DA 3V4MA 2YWFA 3IM9A 5C42A 4LUBA 2RNEA 1N0UA 1SC3B 3W5ZA 1JLCB 5KFIA 2QLWA 3R1HA 2EKYA 4CWBA 4F8RA 5KFFA 2W2MP 4F4AA 4RL1A 3ZNUA 4ZDNA 3TEHB 2MJUA 3ZTPA 2CQ0A 1GNKA 3CJ2A 2F3JA 2MQQA 1S1XB 4RBVA 1RADB 1IKVA 4HHJA 2G4BA 4QYZJ 4QR2A 2KT3A 2KO1A 4IR1A 4J9NA 3FRZA 5H9FK 5GMKa 2ZJRQ 4DV2F 1AZSB 3DM2B 3M8WA 3LP0A 1M5VC 4DV5J 1SL1A 3EXYA 4PQUB 2H5JB 1ZTWA 4DFJA 4B3MF 4A8XA 5HP1A 1SJ1A 1CBKA 2OJ3A 4IRKA 3EDRB 2ZHBA 2E5GA 3KG1A 2CRLA 2A6MA 4OHZA 1CVJA 4FF1A 1VS3A 2D1CA 4X4QA 3GG1A 1R0BG 3PJXA 1FX4A 3ENQA 3AQOA 1HNWJ 4X4RA 1W2BR 3DLEB 2OUGA 3B4MA 2HNDB 4KT0C 4FYXB 2B4UA 4Q43A 3GV8B 4CO3A 2UXDF 3LANA 2DIUA 5GAHU 4DV3F 2ZNYA 1GX6A 3CC2S 2IBOA 4ZVRB 4JI6F 1QAIA 4P75A 1KHVA 4USJC 4Y34A 3TNVA 4YDXA 3BGRB 4PPZA 2EFQA 5A8KB 5J2NB 4ECQA 3UDVA 2CAJA 3FCWA 3K2YA 4HT7A 3M1VB 3C3LA 4X62F 4B9TA 2JLGA 1S4FA 3KNAA 4NE9C 1DHMA 4F7VA 1YWXA 4JP8A 1UZHA 2YH0A 1S9GB 3NP5A 1VRUA 2JC1A 4ZP8A 2LQ9A 3FBFA 2RILA 2OPQA 3U02A 1Q8LA 1UWAA 2NLWA 4WPAA 4URSA 2MQLA 2HFVA 4K2XA 2R4FA 4HTJA 1LFWA 2VIHA 4CP5A 4ZJLA 2WSFC 4WF9Q 4X4UA 1FXRA 3SSSA 2V63A 3SFUA 2M3DA 2LA4A 2FVSA 3OXLA 2NSBA 4C98A 4LR7A 3VGTA 2HLTA 4NX9A 2OEMA 4USMA 1I3OB 1T9XA 4B08A 3G8QA 2PT0A 4IQMA 4QWBA 1WACA 3FFIA 3HZGA 2V69A 1O51A 3W5XA 1NDKA 4P2XA 2L9NA 2NSCA 1UEUA 3O3LA 2GAGC 1SL0A 4K0KJ 2VFVA 4OYMA 2FY8A 1ZAXA 2B4PA 4N5SA 2HK2A 3MMCB 3IO1A 3KG4A 4CM2A 4F50A 3DLKA 1RI7A 1ZAVA 2FJBB 2IMOA 2QGFB 3NAHA 1IM6A 1MWQA 2FC8A 3DCAA 2RSQA 1R89A 3NS7B 2CUYA 3ET6B 3RRHA 3FNNA 2Y8YA 1RWOB 4DPYA 4PG6A 2JWNA 2BM1A 1WF2A 4LQ9A 3MMCA 3BYRA 3FSIA 1GXUA 1ELOA 3PTWA 2YKOA 4Q8EA 5HJYA 2R7RA 3T3FA 1FWPA 3EGNA 2WB1D 2CQHA 4CQ1A 2UXBF 3FMWA 2YNIA 1QJHA 5J2QB 2V2QA 4EYHB 4V19X 1IR1A 2EVZA 1T03A 1P9QC 2HSEB 4Y3CA 1OYEA 3UD5A 3TUIC 1F60B 2DT9A 4DSEA 3HT0A 1VQMS 1YITS 1FI4A 1KDNA 3HDSA 4ITSA 4BCAA 4RW9B 4N8OA 2FHJD 4ZPDA 3HVTB 3M2VA 1S6OA 3BEGB 1BQMB 2LXIA 3CCTA 4V1Ak 3DDIA 3H59A 2H1YA 4FPIA 4X4OA 4AL7A 2ASJA 3A8KA 3BN4A 1AW0A 1OPIA 2J7KA 3IBCB 5ETOA 4U7UD 5KFLA 3P49B 4RW9A 4JV5J 4DR5J 2ERRA 4LF5F 2CPIA 2AGOA 2IY5B 1NSQA 2J0QD 1JB0C 4KR0B 3BGFA 2DHXA 1YRUA 2DR9A 1NH7A 2R7UA 3DRSB 4NWBA 3PCOB 2FIUA 1Z2ZA 1Q86T 4H54A 5BR8J 3WZ0A 1SUQB 3HHKA 2W9BB 4LF8J 2FJAB 3GLJA 4CLZA 5CA5A 1F2HA 4LSNA 1TTHB 5EX3A 3CJ5A 4WP8A 5A8WA 2B8PA 2YXLA 1FJCA 4J9PA 1FVQA 2CQCA 3SSRA 4QWAA 3OL9A 1GMVA 5C2GA 2BEFA 2V4JB 3PR5B 1HW9A 4PPDA 1YRTA 3H5XA 1RT4B 5RUBA 2GNKA 1FESA 1S6PB 1HD0A 3NGSA 3DLHA 4CIOA 3WX4A 3R27A 3SDEB 3MM7B 4GKKJ 3DU5A 3ZZUA 2VQFJ 4TLQA 2XLJA 2DO0A 2XB2D 2VONA 2C2KB 1YJTA 2OPRB 1YVFA 1RKJA 2SXLA 7AT1B 5F8IA 2XS2A 4N56A 2ZFHA 5HBMA 3MECA 1S1UB 3H42A 1WF1A 1UVNA 1L3SA 2WOMB 4DCJB 1AFJA 3RGIA 4QJVA 3ZC4A 2RQMA 5E5NA 4WFXA 2E5LF 3JTPA 1XERA 3P5BP 4O0NA 5A6WA 1S49A 1U26A 1E6VB 4OI0A 1XR5A 1DQAA 4O4RA 3RW7A 3FBEA 3BN7A 2W7OA 1PAEX 3KHRA 1FO1A 2EK1A 2VPXB 3BM7A 4I7FB 2WONA 2WOMA 1VHFA 3EZUA 1KP6A 3QFWA 2HVHA 2B6AA 2HHVA 4HEA9 4O3OA 4C9DA 2P6SA 2DH9A 1T7PA 2VKZG 2C2NA 1VQNS 3VAHA 1J5OA 4TQSA 2CPDA 1SKUB 2XMUA 2CJBA 1C0UA 1XMOJ 1NJIT 1E6VA 1GAOA 2PMZD 5E3CA 3DRPB 3H4DA 1XR6A 4FVMA 4I2QB 4C3LA 4BC7A 5J2PB 5LJ3Y 2BJ8A 1DARA 1G7CB 1VQ4S 2UZAA 3BPDA 2WZ1A 2RT3A 4USKA 1TKTB 4P52A 4DLEA 3BBFA 5HLFB 4OX8A 1YBAA 4ZPAA 4L72B 3AD8C 1HI1A 3TJAA 5GAEI 4LF6J 1U24A 3PYDA 1GFWB 1SIWB 1NH8A 3TI0A 2JL9A 4FNIA 4I2QA 4KHRA 1D09B 3PEJA 2WW4A 2DR7A 2BJ1A 1RQ0A 4DSFA 1DZ5A 1HR0F 1YKWA 4DBQA 4ZHRA 2GIQA 1HWKA 4B9MA 4UOFA 3MOJB 4NLQA 1N5YA 2WVCA 5ETKA 5KG0A 2ZZMA 4ZK7M 2Z2ZA 4DV1J 4PABA 4ZPCA 1HI8A 3SQGA 1XN9A 1NXIA 4M5DA 4UZBA 5IT9Y 2DYAA 1TL1A 1M5PC 1MMDA 1BD6A 3X3UA 2IRUA 4M5HA 2ADCA 1C0TA 4XDCA 1U2RA 5GADI 5G0RA 2VC0A 5C25A 2WHOA 2H48B 2QIFA 4HT5A 1LV5A 3DMJA 2G2ZA 3TZYA 4M5MA 4GKJF 4J9UE 3J81Y 2EG2A 3DYAB 2J8AA 4LRFA 4XPCA 2ZH7A 4HDGA 1FJEB 1PYSB 3DRYA 3CB4A 4PR6A 5K8MA 4GC6A 3TOQA 3OL8A 3QFHA 2DNMA 1ZZNA 1MNEA 3RW6A 4KO0B 4I0WA 3VAIA 1D0EA 4OYIA 1D8YA 5D0HA 2DHAA 3K5OA 3LOUA 4N8NA 2HBQB 3UQSA 4ANCA 2KZZA 2YWGA 5T7LB 2P9EA 3TUJC 1NRKA 3B82A 2JDJA 2VG7B 3NWGA 3IWLA 4UY8T 2H4YB 3MAAA 1CS4A 2R9LA 3QIPB 2DCUB 4YB7A 4DXLA 3CO9A 1Y00A 4NCGB 4EZ9A 3DXBA 1TUVA 2VG6B 1LW0A 1R8CA 4IDKB 2K3IA 2OH2A 1QUPA 3DXSX 2YNHB 2W9AA 3A8JA 5E3QA 4ANEA 4ZPWR 4NCGA 1D8ZA 2FHOB 4ZVSB 5LXYA 3ETOA 4KRWA 1UKUA 3KJQB 4CNZA 2HVEA 2Y9HA 1C1BB 2B8QA 4YY3F 1HBMB 1FKPA 3KTQA 5F0UA 1H2TZ 2PC6A 1TK5A 4ES1A 1A7GE 4NLVA 3D54A 4TQRA 2B43A 4M5KA 4ZITA 3GB0A 3PV8A 2PSZA 2NQPA 3PYEA 2DNLA 5KT6A 1FNMA 3DDKA 2B5JA 3HD2A 1HLWA 3AD7C 3AHPA 2F7VA 4OI6A 3IG1A 1SIZA 1HBMA 4JI8J 5FDLB 4LIRA 2G2OA 2VOOA 2XCPA 5KFHA 1QVGR 4YR3A 5LXRA 1JX4A 1WEXA 1SH3A 1NDLA 4DUYJ 2CPZA 2B4VA 1UFKA 5KFXA 2BDPA 5CH7B 2VICA 3BV8A 3Q8UA 2KVIA 1T05B 1WWHA 4C0OC 1Z2LA 2IYGA 4K4SA 2Z58B 1M5SA 8AT1B 4JI4F 3E01A 2KM8B 1X4BA 1F0XA 1YZ7A 4KGVB 3LPYA 4ZP9A 3HHLB 3LUYA 1ZTTA 1RWXB 4U7CA 3OTBA 3ADAC 1RWPB 2MKIA 4ED1A 2OFHX 2ZVSA 4Q2LA 4P74A 1N33F 5T14A 3UVJB 2K8GA 2FVPA 1JJHA 3Q8VA 4KGMA 2HQDA 4MIAA 2XZWA 2K7JA 2L08A 1QD1A 3HJVA 5C5JA 2OEJA 5LMNF 4USUA 3MEGB 4ED0A 1DQ8A 3CGIA 5AXKA 2G9OA 3GSDA 3UPFA 1TL7A 4ZCLA 4NYPA 2MLZA 4G6VB 4DUZF 2ATCB 3H5YA 1P1LA 4HLBA 2XMVA 1EARA 5KFQA 3G6VA 4P7TA 4IQXA 3CO0P 3RBZA 2Q6BA 3EUNA 4URQU 3M32A 2CQDA 2VQEJ 3AXKA 3QAEA 2CJKA 3G9CA 3VTIA 3QGHA 3DN9A 2GJFA 3F44A 5LSRA 2D3OR 2I5JB 1SQGA 2XY7A 2JX2A 2CKWA 3N79A 1RDRA 1DFDA 4XO0A 1N36J 1M1KT 2VODA 3TA2A 1VBYA 3C46A 5K14A 2JEFA 1PKUA 1WHVA 1HBOA 3C19A 3I0SA 1X0PA 4PCQA 3RB3A 4GMKA 4CLLA 4D3HA 2I5JA 1A6LA 3N9UC 1L3UA 5KG6A 2DKOB 1NPPA 4R5PB 2IDEA 3W9JA 2UVWA 4P9SA 4F4XA 4KFBB 1RAIB 4UF4A 3HJFA 3A3NB 2DEJA 2HFOA 2DRBA 3P5TL 3GMGA 2AKWB 3HF5A 4F25A 2F40A 4I2PB 5KFOA 4B3RF 4H4OA 3A1YG 1TL3B 3PJ9A 2GVZB 2ZH2A 3DLBA 3DOLB 3GFZA 1R0AB 1UL3A 3UDCA 2YKAA 2EFVA 3C14A 1UPPA 3QQCD 2J7UA 3VAGA 4ES2A 2PA3A 1YBTA 1FX2A 3TRGA 1X60A 1R8PA 3HX9A 2HZVA 2W1BA 4USHA 3N28A 4JI2J 3GONA 1F5BA 1TMMA 5THWA 2Q1LA 3ELHA 1PC5A 1N34F 5B7WA 2D3ZA 4RUBA 2MMYA 2EPIA 3M8ZA 3PFEA 2CDRB 2KHDA 3OD2A 4ZPTR 1WUUA 2HBZB 3CJ3A 4IFYB 4ID5A 4KPCA 3M30B 3PHEA 3GTYX 4OI2A 3TAPA 5KFBA 1F2GA 3KMSA 1WELA 3UW1A 1N88A 3GR1A 2ZD1A 4MKBA 4PWDB 3CD6S 1U1NA 2WTFA 2MLXA 1REGX 1RP5A 4KGKA 3BZQA 2XMWA 2RUSA 1Z1ZA 1FTRA 1NUEA 4AL5A 2ZKTA 2BW2A 2F4VF 1M5HA 1F5AA 4DF4A 4ELVA 3C6TB 2LQBA 2V0NA 4MKAA 3V6DA 4WIIA 2UVVA 1WJ9A 3M6XA 5G4DA 4MK7A 4M5JA 4Q0BB 2DK2A 1IKYB 3NNCA 2IA6A 2ROEA 4OQJA 2I0XA 5D3GB 2FHJA 2EI5A 2RF2A 4B3SF 3X1LB 5LSLA 2GMLA 5KT7A 2IC3A 2EC2A 2C3UA 2PO4A 5IT0A 4ECUA 4QCLA 2HK3A 2HLUA 1O5JA 1MSWD 5EX0A 2GA7A 2PD1A 2ZEJA 2HHWA 3CUNA 2J6UA 3LH2S 3OTOF 4DV7F 2CJAA 1U25A 2HS4A 1WC0A 3I9V9 3NG8A 3T1HJ 9RUBA 1QLNA 3JAMU 1HYSB 1RT1A 4RLEA 2O5DA 5J1EA 1RCOB 4ER8A 1RBAA 2HQFA 4RW6A 2MZRA 4LBHA 2V8VA 1RWMB 1EJ7L 2J8SA 2V8PA 4ECWA 4YDDB 3NRBA 2MHNA 1FRMA 4OJ1A 2F8HA 2E9TA 3OTCA 3FQLA 1BUXA 3BR9A 2V8GA 2DHGA 3IR5B 1DTQA 3AQPA 4DR3F 2CQGA 4X65J 1ZH5A 3D6MB 2LECA 1HNIB 4C8LA 1FK9A 1TVRB 3N6NA 1U1KA 3DI6A 1XMQF 5KFVA 2CA9A 1IQZA 4WTOB 3OLAA 2QLJB 1Y4ZB 1I5OB 1RLDA 1UP1A 1UFWA 1JK9B 3KDOA 3J7AN 3ZZTA 1U1MA 4MYTA 5ETMA 3M8RA 4WKRA 4OHXA 1WG1A 2BE2B 1F6TA 2CQ3A 2Y0BB 2KDOA 3IRWP 2UXCJ 5B0FA 2DEIA 1YLXA 3R7NB 2UU9J 3QJPA 5LM7E 2IYIA 1RJJA 1CJVA 3VVTA 2CADA 1PC4A 1V5IB 3GSIA 1S9EA 2KTQA 5DDPC 2GC8A 2IAJA 5HMXA 3BS9A 4E98A 1KOOA 1RE1B 2IFXA 2HHTA 4RBUA 1X7VA 3NGTA 5FJ4A 1AT1B 2XLKA 4RWXA 2KJVA 1PBAA 2UUCF 2QL9B 4B9UA 2XHWA 3C66A 2ZE2A 5LMNJ 5ETQA 3E2EA 4KYZA 3M8SA 3A4TA 3CCJS 3HSZA 1HFEL 2GGPA 3Q24A 1WHWA 4DV6F 1TFWA 4LFAF 2R2SA 4K4WA 4XDDA 4M5NA 2ILYA 2DY1A 2W25A 3UDEA 4O3RA 3D6HB 2I1RA 1RXOB 1WTBA 5GAHI 2X3GA 3HZEA 4UZCA 3I5BA 4DL0C 1RTIA 4KH0B 4PEOA 2HRTA 1FE4A 2OPPB 1MU2B 3DHWC 5LOQA 5I3UA 2LXUA 3KK2B 4CH0S 4QU6A 4EBEA 3L3CA 1HQEA 5IT4A 4YQWA 1UVJA 4YB1P 3TZWA 4C0BA 1K8AT 2DH7A 5HL7Q 1HBNB 3ENVA 3CPWR 5AE1A 3BO3A 3DGVA 2YVSA 3NNHA 2W01A 4HACB 2BRKA 2QLFB 2HHPA 1IWGA 2HG4A 4KHPF 2BKNA 1S7HA 4KSEB 2CPEA 3G6XA 2XY6A 1NJXA 1NJZA 1HIYA 5B0BA 2J6TA 5KG1A 3QIDA 1W26A 2O01C 4OJ3A 1T9TA 3JYTB 2A0FB 3IS9A 2KH9A 1HNVB 1N48A 2YX4A 3MI7X 5KFDA 4E0DA 1LWFA 4IH6A 4CT9A 1RT3A 2XSFA 1H7WA 4WXWA 3IRXB 3T5LA 3W8PA 4LF9F 2CQBA 4UUWA 3HCXA 1RACB 2AEJA 4NXNJ 5D78A 4USVA 1KQSR 3UN5A 1FT8A 4AT1B 1LWEB 4KV8B 2J7WA 3KNGA 4IO9Q 1VQ7S 4KQZA 1PJ6A 1QAYA 4XPEA 3G96A 4DQPA 2ZH6A 5L46A 1FJ7A 1XQIA 1LW2B 1T3NA 3K5LA 4V19J 1EZZB 3BGLA 1DBDA 1FE0A 1NCLA 3GYNA 3FEXB 1NBEB 4OL8A 1DAXA 2C3YA 4IYQA 4CH1A 1U6BA 4DU7A 3CJ8A 2HIYA 2Y1LB 4M5LA 4DZ6A 3M9NB 2QL7B 2J9EA 1NZAA 2FPHX 2LQJA 1G4CA 4NEYA 3W63A 4ANDA 1TAQA 2VC1A 2F8EX 5KFNA 2KZMA 3MPWA 4OZ1A 1WG5A 3MAHA 4WIQA 3D9BA 3LA0A 4RNOA 2KXNB 2DHHA 3CXCR 3BBCA 4ZMMA 2NXJA 3UDLA 3DLLQ 3EM1A 4FXDA 1S99A 3IR6B 1HMVA 4OZ2A 2EXUA 3D6FB 4QIWD 1YIJS 2GQQA 2N3OA 4LBIA 1NHUA 1OWXA 1WF0A 2ASYA 4JI1F 4DR7F 1Y7PA 2NZ4A 2HS0A 2ZNZA 3M4XA 1F3FA 3HSJA 5DM6Q 1DLOB 4FDFA 4LRAA 3RYLA 1WHYA 3JSMB 2CPFA 3VR1A 1TAUA 4UW2A 1HQ2A 5B08A 1PCAA 1RYSA 4DV0F 1U49A 2YKMA 2YKPA 2AZ1A 4F4WA 2F8MA 3C15A 4JYAF 1X8DA 3CJTA 3UCGA 4B3OB 2VBWA 2NUHA 1N5SA 2ZBPA 2XZTB 3JSMA 4LF2A 4CTAB 2XC9A 4LF4F 3ITHB 3OFEA 1I6JA 3GJQB 2ZZNA 2O66A 2DJWA 2LXFA 1TELA 3GU0A 4EGLA 2XLIA 5KT4A 4RNFA 4HH0A 3AODA 2GHWA 1RBLA 4KB7A 2MXYA 2RU9A 3M2RB 2RH3A 4O44A 2CNOB 4G1PA 2EW9A 4QW8A 1RWNB 3IA0A 4JV0A 2GHPA 1R7IA 1HD1A 4JI5J 2E7WA 1UVLA 3NLCA 2QLBB 4IG0A 1REVB 4O3QA 2EFNA 2DNPA 1FEHA 2BKPA 1KKHA 4ZLLA 2Y3YA 3SI8A 4DQSA 5IC6B 3E51A 1FRIA 1V3RA 1JLQA 3OTDA 5CZXA 4KKOB 2H5IB 4N47A 2A6OA 3RU0A 2Y8WA 2HKEA 3KLEA 3DLGA 3MMAB 1ZETA 1OPZA 3KLFA 3BKFA 2AX1A 4Y2IA 2YH1A 5JXSA 2AV5A 2CJXB 3DOKA 1U1RA 4X4TA 4P2FA 5HATA 3AOAA 2PGCA 4ZVOB 4LSLA 2LMIA 2WRMA 3JSRA 1VQ9S 1IJEB 3PYGA 2VFUA 4XK8C 5B0AA 3ZZRA 5B0GA 3LP1A 3I56S 1EETA 8ATCB 1G3OA 3GWCA 3UD4P 3FSXA 2XGQA 5A76A 2DGSA 2RRAA 2H4WB 3ULHA 4WTYA 5F0WA 4LR8A 4K4ZA 3QRQA 2HVIA 3KJVA 3BO2A 4TN2A 2YKNB 2AU0A 4B3TF 3WIVA 1HPZB 1N54B 4HDHA 4NLGA 3MM6B 2BX6A 1FKOA 1RTDA 1N56A 4C4WA 1LKZA 3RB0A 4CYUB 3CIZA 3R2CJ 1KQGB 2RU3A 3HXMA 2OKQA 3ZZOA 1YHQS 5MAOA 3QO9B 4DL7A 1SJQA 1JWWA 4WE1B 2YKNA 4NZ0A 3TUZC 2QC3A 1HNZF 4KHMA 3MMBB 3GFXA 4BS2A 1ZPWX 2WAQD 1LNQA 2K1RA 1N32F 3TO8A 4K4YA 2AJFE 4NZ7A 2VDHA 2WVEA 1XEZA 3MD3A 3JTOA 4K4UA 2E9ZA 1IBKF 4GC7A 1IN0A 3IXQA 5DG8A 2R3VA 1N5TA 3OJSA 4ELTA 4KGZB 2BR0A 2AGPA 3MXHP 2QFIA 1NPKA 5C24A 2IIHA 2RRNA 3NGUA 3M8QB 3PFOA 1HQUA 5K8OA 4DQQA 5CHCB 3B54A 5HK4A 2ADBA 2J5AA 2YNFA 3HSDA 3P45B 1KFSA 1WI8A 5FLXY 3VQTA 3AJ1A 1NJWA 2MKSA 4JI3F 3NS5A 2BOAA 4AQYJ 4A4JA 4OZNA 3WIUA 2R7SA 2PA8D 4PXBA 2F9JA 1JXLA 2RDJA 3D2WA 1RT5A 1B0TA 2WSCC 1RA6A 2HHHF 4A8FA 4HKQA 3IFEA 2BMBA 1PYOB 3MMJA 4XAKA 2LVWA 1PIEA 4NLTA 4CLPA 2UV8G 2MSSA 2J0WA 4NL5A 1R6VA 1J5EF 2VA3A 4IKAA 4M5IA 2LEAA 5B0EA 4NCAA 3D5MA 2DPJA 3PRDA 5A8RA 3MM9B 3R5GA 2EWHA 1FKAF 3SV3A 5DRKA 5D0EA 1N5VA 2HZCA 3OJUA 2KYZA 3HK2A 1BQNA 4K4TA 4KH1B 1MW7A 1VJQA 3FK4A 5CYQB 5DG7A 2BQRA 3ZZPA 3W5YA 2XSJB 2ZDOA 2MSTA 2I8EA 2Z0GA 4NASA 5KFWA 3EGWB 4CO1A 3H2VE 2DGQA 4GVBB 4LSZB 1HWIA 3R5BA 1FDBA 1YX2A 4DSIA 1HWUA 3GIMA 1ACMB 4Q5VA 5J1PA 5AE2A 2L9WA 1F9FA 4JI7F 2DY9A 4DX5A 2VBYA 3EMTA 3Q2TC 3VZHA 2IMWP 1CULA 5CQGA 2Z2LA 1JLGB 2CYYA 2XS7A 4FN5A 4H4KA 3DLJA 2HQGA 1IM4A 4ILMA 3O6QA 1CJUB 2HFNA 4X4SA 1QUVA 3H0PA 5DQHA 2YX7A 2D3UA 1WC4A 2ZBCA 1L3KA 1ZOTA 3QSYB 2V67A 4DR1F 3W65A 2C2EA 2OP5A 3EJMA 2VUGA 4ZVQB 3MOZA 4DR2F 3CDUA 1BWVA 1FEEA 3H8YA 3CCSS 5ETPA 4G1QB 1S57A 2B51A 3IM8A 2DNQA 3ILIA 2B56A 3OR2A 2HNYA 5LL6d 5H1SV 4Q44A 3N0VA 1TKZA 2BW7A 2ZOMA 3H40A 5DGAA 5E3AA 5CYMA 5F8JA 4QQBA 4CLSA 3I4HX 3D3CJ 3PVXA 4X4PA 5CZVA 2Y1IA 2UUAF 2DNZA 1X9SA 2E1CA 2KI2A 2CIMA 4EZ6A 4RPFA 1VIOA 3TJ9A 4FYYB 4ED6A 5F3TA 1U09A 3OFHA 1IKWA 4P7VA 4TYAA 1U02A 2WBMA 4RUAA 2B4OA 1F9EB 4OHYA 4B9VA 3WDOA 1CJKA 3OXGA 1OSDA 4L3NA 5HROB 2XGPA 1S1VA 4J9QA 2I38A 3CJRA 4R0EA 2MZTA 2C2MB 1FDNA 2ZKUA 2JSXA 3G71S 1WEZA 4KGXB 4QYZK 1V3ZA 4JI0F 4QWDA 2P6TA 2JJ4D 1DTTB 1KLMB 3G6YA 1EP4B 2BVZA 4NA1A 1AUSL 1RT6A 2XMAA 4LRCA 3LO3A 1KSPA 2L9DA 4MTPA 4ICLB 5KT2A 1HA1A 2XWXA 2OFGX 3TW0A 2AEFA 1QE1A 1T02A 3JQMA 4A8QA 2D3O1 2VA2A 3M8PB 1SC1B 3G6ES 2W24A 1H2UX 3TAMA 1AA1B 3K8VA 2EEYA 4HL9A 4BDPA 3C2PA 1C4AA 5HJXA 2QA1A 2AD9A 2OD4A 1ZM9A 3MM5A 4H4MB 5KFUA 1AROP 1YRXA 4EWTA 4NLRA 4I6AA 3CCMS 1RHMB 2XYGB 2M4MA 1Y10A 3GCWP 1S6QB 3BDEA 1J27A 4ZVGA 3OR1B 1D3WA 1X5OA 1EB0A 3LP2A 3OSNA 2ZJPQ 3CCZA 4LJMA 4DMZA 1CLFA 2D74B 2R7OA 3R5CA 4R8UB 3R6GB 1VRTB 4LFCF 4NI2B 2I6WA 2DGOA 4QW9A 3F56A 2FHMA 3OL6A 2QN6B 4GO5X 2AP6A 4X2BA 4ZJQA 1YTYA 4MFBA 4FKYA 2ZBIA 2JRSA 2M88A 4R8UA 1KS2A 3GIJA 4RU9A 3QGPA 2I2YA 3H5UA 3NS6A 2DR5A 4ZVEA 5HMZA 3BSOA 2R8JA 3H5SA 1VR6A 1WC5A 4YOEA 1QAJA 3RAXA 3KLVA 3PIOQ 2AZ3A 5DQGA 3EGVA 4JB8B 3WC2A 2HQCA 2ZVIA 3C16B 2X1AA 1AB8A 2R7QA 3GPAA 4DDFA 3FKBA 1JLFB 1PJ5A 5F9LA 2AJ4A 3BQ0A 4C8YA 3NBPA 3PNIA 2C3MA 1IBLF 2K06A 1NK0A 4IG3A 4F67A 3GQCA 1KR4A 4YN3B 1UJ4A 4MAKA 4RW8A 1HBUA 4NLWA 2HWIA 2IJRA 4NYOA 2R8IA 4ZLPA 2HGNA 3C16A 3T9NA 1RTJA 4ZS6A 3MZIA 2HZAA 2WSEC 4F3QA 2BYCA 4Y2CA 4IH5A 5KAKA 3K5PA 4FNHA 3W61A 3LGNA 3OXFA 2VG5B 2NUUG 2LQ8A 2R2RA 4X64F 4ZIWA 2E1PA 5E41A 2JLFA 5DDQC 5DETA 2CQ2A 1QSYA 3T1YF 5KOWA 4YHHF 5A0YA 2BABA 3KK1B 5I42B 1VLYA 2IM1A 3CW2C 3BQ2A 2MGZB 1SJ3P 1IWAA 3PX6A 1EX8A 3WQPA 1PSDA 2VG5A 3FDSA 3LQVA 3PW5A 1P1TA 1PBUA 2D69A 3L7PA 4DG1A 1R0CB 4F04B 3PM9A 3BSAA 4I4BA 3O44A 1U1PA 5I42A 4OI3A 1UJ5A 2VV5A 5HAOA 1U0HA 1TZ0A 2JFDA 4EO8A 2QMXA 3BREA 3MUMP 3TX8A 2GO9A 3TVYA 3MGJA 2EK6A 3OUYB 1NDPA 2OTLS 3BGOP 2EFPA 4QIGA 5DS7A 3H2UB 1JLCA 2UVUA 4J9MA 2R8KA 1RAGB 2NREA 2QG9B 5DJBA 2ZM6J 1FTCA 1H72C 1U2CA 3SSQA 4QU7A 3FBCA 3U7JA 4CO2A 4XTTA 1S1XA 3VAMA 2COLA 4ED3A 1OIAA 3TJ8A 3LF0A 4A47A 4K59A 3KJNB 5D8HB 3ISND 1XNRF 1AZSA 3DM2A 4A8MP 4TY8B 3J80Y 5IZHA 1X4GA 1APSA 4PQUA 2V2ZA 5F8GA 1UA0A 2PIIA 3I82A 3SYZA 4WJBA 1FRHA 1S9FA 5KG2A 3WC0A 4E8UA 1HNXJ 3UD3P 2X1FA 1FVSA 4X4NA 1FJGJ 4LF7F 3UNGC 1Y3KA 1NJYA 3DLEA 2HNDA 4OX6A 4NLOA 3C6UB 1BE4A 4AXJA 2CWKA 1UWBB 4O4GB 4AYBD 3KLGB 1QVFR 1YJUA 1MMNA 3BGRA 5IQ6A 4IO1A 5A8KA 1KQKA 3S7RA 1XNQF 3KLHB 5J2NA 3BKUA 4CO0A 1AYEA 3PW7A 2P9CA 3M1VA 4NLYA 1MROB 2XCAA 5L8RC 2O3DA 4JOUA 2BANB 2MYFA 2NYIA 5K20B 4PRFA 2R8GA 3KLIB 2VPYB 3NCRA 3PXGa 1VIXA 1S9GA 1F3VA 5DDOC 3MEEB 2W7PA 3D68A 5DQIA 4G3IA 4DV4J 4F36A 3CMES 3PEHA 4RUHA 5ETSA 3GZ7A 1YJNS 3V6KA 2X1BA 2JLEA 1MROA 5IOLA 3NWRA 1MN7A 4QIEA 3RR8A 3BKTA 3O8WA 4C11B 3RRGA 2ZH5A 1YI2S 4A8SA 1ZM3A 1FD8A 4U8YA 3I6PA 2RDDA 3TQEA 3HFKA 3W64A 2CPYA 2GFFA 2VZ9A 1T94A 3M2UB 3NAIA 2WK4A 3CCWA 2Z56B 4A8KA 2JFKA 4IOCQ 4ES3A 5J2MB 4B17A 3AT1B 1H7XA 1L5UA 4LFBF 1RT2B 2AF6A 4YB5A 5IWAF 3VAFA 2QRRA 1IBCB 4PUOB 3I4PA 5ETRA 5CCLA 3FUYA 2RDIA 5L9NA 3FEYB 1Y5NB 5DZ6A 3J7YU 4Y00A 2DTJA 2MZSA 2PMWA 4CT8A 2CPXA 2HBYB 1OQ6A 4NZ6A 2UUBJ 3ETMA 4Q45A 1VDHA 4NOHA 1ZPVA 4NLSA 3SV4A 1T9UA 3ET6A 3TR5A 3VGSA 2V50A 2JEIA 1DJ0A 4USTA 5AT1B 2G1DA 2GV1A 1VQKS 2VFRA 3VCDA 2R42A 5E2QA 2HNZB 1R8HA 2A2DA 1S72S 1IKXB 3KK3B 4EYIB 1I94F 4YFUA 4NXMF 4WKYA 1C1CB 2V8HA 2VHGA 5J2QA 2H65B 4CO5A 2DR6A 1TUWA 2XG8A 3G87A 2KG0A 4NMLA 4OLOA 4PG8A 4BWMA 7FD1A 3HVTA 1ZAWA 1W2IA 3EDQB 4QPXA 4B9SA 1BQMA 1FXLA 2MZQA 3MM8B 1H98A 4DR4F 4ZVPB 3KJFB 1YG0A 1HW8A 2HHQA 1RHQB 2ZOFA 2KL8A 1IBMF 2IJNA 3V4IB 3GCXP 1GK8A 4OZJA 3OPKA 5KFCA 2AYBA 2MJNA 1U8WA 3D1QA 4OX9F 4PZVA 3ENWA 3MF5A 3EXCX 5A2QU 1O0PA 3W9IA 3QLHB 1UFLA 4KPYA 3DRSA 2HEKA 3FQKA 2JOQA 3A12A 2C3PA 4DPWA 3THPA 5LMUF 4F26A 2XI2A 3CD7A 3CCRS 3RUBL 5F8NA 2F1FA 5HMYA 1SUQA 1CQMA 2W9BA 1UA1A 3KWMA 1BC6A 2C1EB 4FBTA 4J5OA 5L9XA 2XMMA 1T9YA 3TANA 2J9DA 3NCPA 4N7TA 2GS8A 2PI5A 4KJIA 2HS3A 5B0CA 4Y0FA 1JXEA 2E5HA 3GIRA 1DY3A 2V4JA 2RKIB 3TVKA 4F02A 1RT4A 1SKSA 1S6PA 2A2CA 4IFVB 1WTFA 4F4YA 3SDEA 2FDNA 3MM7A 1B70B 2IVFB 3BBBA 2ZH4A 5CD4A 4DV2J 1U1LA 2AW0A 5H9EJ 1LOUA 1OQ3A 1K73T 1KLNA 2OPRA 1Q95G 4B3MJ 4DR6F 2V9WA 1EHWA 3ILJA 1CEZA 1K0VA 1Q8IA 2XQCA 3M6VA 2XO6A 3L9ZA 5DM7Q 4LRBA 4IFVA 4WZQA 3D0HE 1S1UA 1VK8A 3HM9A 5SZTA 2YX1A 1LK5A 5B0DA 4RX6A 5HQLA 4JV1A 5KG4A 2UXDJ 5ETTA 2AYMA 1RTHB 4DV3J 2HFSA 2CQ1A 3OHBA 1NEEA 3UE2A 4DPTA 1KBRA 4JI6J 1SJFA 1TK0A 3FGVA 4MYUA 1N8RT 1LK7A 1BY9A 3MEKA 3PR4A 4X62J 4I7FA 5HN0A 1WEYA 4P6QA 3TA0A 2F63A 5AJ3F 2DISA 1NZ8A 2CWXA 3CIMA 3GE9A 2DHSA 6FD1A 1EKSA 3D1HA 3IBFB 4WWSA 4BC9A 1RT7B 3DRPA 3I0RB 3EYZA 1H2VZ 5J2PA 3MAQA 4Z37A 4FF3A 2MQMA 4U7UK 3PRBA 3GIKA 4RBTA 1TKTA 3Q8RB 4WYLA 2OSQA 1TV6B 1NM2A 5HLFA 1YDLA 1S48A 1VQLS 3BSCA 3UCUP 2DGWA 4C3KA 4TYBA 4DV5F 1WC3A 4C8NA 1UETA 4ZOSA 1QTMA 1RT7A 3NGKA 2Z30B 3PDNA 4OZ0A 2LYVA 1DRZA 3D3BJ 3H25A 1UEVA 3MEDB 1RAOA 5BYRA 3K5MA 3W2WB 1YJWS 2C42A 4R25A 1HNWF 4DL2A 4QIVA 3V81B 4ID8A 1Q0NA 5KFEA 1SQEA 3DDNA 3R2DJ 4LMZA 3MEDA 1NPRA 3SQOP 4RNHA 1FDAA 3G82B 4FYDA 2Q3PA 1JLAB 2E9RX 2EG1A 3W60A 3S01A 1CJTB 5IV3A 1X4HA 1O8BA 1FNXH 2DH8A 4R0JA 2A18A 3V81A 3CMAS 2BJ7A 2KRRA 1FFGB 2NZCA 5LJ5Y 3BQ1A 3KKFA 2GVDB 2NXUA 5DGBA 2XBPA 2Y1RI 3DYAA 3WX8A 1D9FA 3BH6B 4RR5A 3JB9k 1EKRA 1BMQB 2QTWA 3A3PB 4CLFA 1VI7A 2QFJA 3IP0A 2UXBJ 2VFSA 2KKHA 1RCXB 4PXCA 3SEOA 3H98A 5IM0B 3GFYA 2LQ5A 4F2SA 4LQ3A 1RLCL 1VC0A 4KO0A 2ZUAA 2QYGA 3N6LA 2B3TB 2DNKA 2MKYA 2B7BB 5T7LA 2HWHA 2VG7A 5JUMA 3QZ8A 2A1BA 3QIPA 4ILRA 3DGPB 1JLBB 3G8TA 2GAHC 2VG6A 3W9HA 4K0KF 5KT3A 4LF5J 3VV2B 3GR0A 4G1IA 4IDKA 3DRRB 2FYXA 2VBXA 2GIFA 2W2QP 5KG3A 2YNHA 2FGCA 1IR0A 4J90A 4NLPA 4F0KA 1VFJA 1RHRB 4CRJA 1ROFA 1N6QB 1C1BA 4DF8A 3PJWA 3US5A 3NMAA 9ATCB 5KFZA 3HI9A 4Q8FA 3U1LA 2ZWPA 5KFKA 3R3TA 1UJ6A 2ACYA 1VQ6S 3KMQA 2X51A 4I6WA 1KEKA 4RW7B 4URGA 3OLBA 2A10A 4PQAA 4ZPBA 2E66A 1RAFB 3V6JA 3FRYA 2APOA 3IAM9 1PILA 2E5IA 4DWIA 2RS8A 5FDLA 2R2UA 2BJ3A 3AH6A 2HYIB 1UVMA 5EHHA 2FC9A 2DIVA 2AMCB 1A0OB 4FPRA 4FS1A 2VKRA 4TLRA 4DL5A 1T05A 4RUCA 2J6SA 3HSGA 1UCNA 6AT1B 1VOMA 1IXKA 1S1TB 1XWLA 3D66A 3DRXA 1HHQA 2CVEA 3BSNA 2OIHA 1X9WA 2DGTA 4XIUA 2N7CA 3M9OB 3UN3A 3HHLA 4D3GA 5IXUA 1YGYA 2ROGA 3RR7A 1SV5B 2MLYA 4YUDA 1JKHB 4CZCA 2E5LJ 4JV5F 4DR5F 3LAKA 3UVJA 4K7QA 1WD6A 1RU1A 3AJDA 2IVYA 4FXVA 3ZO7A 4U67Q 4CLYA 4DL6A 1X31C 2FTRA 1OJ4A 4LBPA 3VALA 3MEGA 3MR3A 2G0IA 1T11A 2P5VA 2BJEA 3L7OA 4UY85 6FDRA 5BR8F 3QRPA 1NAQA 3P8BB 2OTJS 4Q7AA 3DFEA 4LF8F 5C42B 4HR2A 4WCEQ 2HRUA 1GMWD 3CCES 3OV7A 4USWA 3ZZ0A 3SCJE 4Z7CA 1PGZA 1XBWA 5E3PA 2NPFA 4BWJA 2WVDA 5KFRA 1QSLA 1YBUA 1WNEA 1K1SA 1IKVB 4DI6A 4GKKF 3D7SB 2DO4A 3TARA 1NB7A 2VQFF 4CI0B 3LP0B 4FVCA 2MQ8A 1RTZA 3MR7A 1UW9A 3J81j 1U7LA 2XEXA 2CG8A 1UMJA 4K5SA 2DGVA 2KFZA 5HVGA 5HP1B 4R5PA 3VGVA 3RBDA 1OY6A 4DX6A 2G2YA 2WW8A 1RWVB 1VK3A 2JVOA 4KFBA 2XTJP 1U45A 1HR0J 3Q8PB 3CD5A 1GXLA 1FRJA 3P4UB 2OPSB 2ZH8A 1N0VC 3IAS9 4I2PA 4QOTA 2FJEB 2ZC4A 1TL3A 2GVZA 3DOLA 2FLNA 3T6JA 4C8OA 4YR2A 4DSLA 1GTEA 1CSJA 2HVZA 3RBEA 4HHUA 3ENAA 1R0AA 3CJSA 4DLGA 3BO4A 3DNCA 3UFCX 4FF2A 2OPSA 2DNRA 3BGUA 1UTAA 1Q16B 4ZIVA 1P6TA 1U0SA 4GKJJ 1SB6A 1VRUB 2ASLA 2FHKA 2ZH9A 3LWLA 2FZCB 2OPQB 1XMOF 1IJFB 4ELUA 1BWEA 1T9WA 1HWJA 4MIWA 3SZ2A 5A6PA 2V4RA 4TKTA 4IFYA 3IGNA 2V5HG 2PDAA 2DXFA 4J7CA 3M30A 5D4OA 1PJ7A 3VZIA 2M8DB 1S0NA 3CC7S 3QGIA 1EAYC 4AE5A 1VBZA 2B9WA 2KU7A 2O67A 4PWDA 1JQGA 4LF6F 3M6WA 4U8VA 4PG4A 4MK8A 1NU4A 1PG5B 4FBUA 2D7SA 3FFIB 5GVQA 2PEBA 2FLPA 3C6TA 3I96A 1MWYA 5D4PA 4J37A 2AX0A 3D4JA 2Z2MA 5CYJA 1RU2A 1S5ZA 3CDAA 4Q0BA 1IKYA 2XM3A 3BF4A 1WSRA 1VYAA 5D3GA 4UQGA 4DPUA 4DV1F 3Q8YA 1NSAA 1VQSA 1XR7A 3DLKB 2YWEA 3QMQA 1P27B 4W92B 1ULRA 3CWJA 1WKLA 1NK4A 2JEJA 4H4KC 3PX0A 4WFNQ 2G1HA 5KFPA 2HGLA 3RB4A 4RO0A 3UNYA 4F0MA 2ACMA 4YY3J 4A8OA 1RHJB 2QT7A 1TUGB 1S79A 4RU2A 2IRXA 2W9CB 3MUTP 4Q2MA 2LP4A 3OW2R 1HYSA 3QZ7A 2ZC3A 4AL6A 1M5KC 2LDIA 4QR0A 3PY8A 3A3OB 4P10A 2YNIB 4N77A 4P71A 1OYDA 4IRDA 4IUFA 1T03B 1V5VA 3JTNA 2VF3A 2BXJA 2CJYB 4Y2MA 2LU2A 2F4FA 4O3NA 2FJVA 3NGDA 1YJ7A 3ZXWA 2W9CA 2HAIA 3JQKA 3L09A 1OY9A 2W4CA 2DNYA 1FERA 5C2CA 2YKQA 2OMOA 3M2VB 2BUNA 3HP6A 3AXMA 1HNIA 5K9FA 1Q5VA 1FWLA 2GJIA 5L39A 5M2UA 1TVRA 4ECXA 3B8HA 5DO2A 1FRKA 4JI4J 3NGRA 1FNOA 3EX7B 5EWGA 4DL4A 1KD1T 2M52A 2ZHAA 1Y5IB 1T9VA 4DFMA 1N33J 5K8PA 2BE2A 3OSPA 1ZBTA 2L3MA 5IT9U 3RRKA 2GQCA 3ISZA 2CJ9A 3I5AA 4A8WA 2RQ4A 3ONQA 2AJ1A 3G8SA 3IN5A 4ECSA 4Z7YA 2LA6A 3ZFVA 1X0FA 2XY5A 2DRAA 3QSIA 5AXLA 4DUZJ 4HI1A 4QIFA 2C22A 2OHDA 4K8RA 2DD8S 2WBRA 1KN6A 3HD1A 3TA1A 3QRRA 5JJBA 2IA0A 4C2MA 2CPHA 4LSNB 2MTLA 3J81U 2KB2A 5H9FJ 1AXQA 2MKJA 4HH1A 3R1LA 5A8WB 3HMJG 3PYFA 2XULA 2E7VA 3OT9A 1AFIA 5U47A 1T0TV 2QX0A 1N5QA 3R5AA 4C97A 2B7CB 3NMRA 4JI8F 1G6BA 2UVRA 3IGVA 2R2TA 3SFGA 4DUYF 4WP9A 2FJWA 5DLGA 3P3DA 4Y28C 2DITA 4C6AA 5IFMA 2V68A 3TVZA 4ERDA 1FRXA 1FDDA 2WCXA 4EI2A 1IR2A 1ITPA 2OPPA 5HBMB 3MECB 5D4NA 3GJRB 1MU2A 2ATLA 1W25A 2BJ9A 4K2JA 4NLUA 3CJ0A 1T8EA 3KK2A 2BQ3A 5HVHA 2E1AA 4P2MA 4QWCA 1NMEB 3PW4A 4B3RJ 3HULA 4I6YA 1WOPA 2IM2A 2RD5C 1Q81T 1JIHA 2CQPA 3PO5A 1HWLA 4X4VA 2HVDA 1HBNA 4M95A 3RTVA 3THVA 2VDIA 3JXOA 1QM9A 3LAMA 1FRLA 1NKEA 4HACA 1B4SA 1Q1KA 2RUGA 1ZS6A 2K3KA 5SUHA 4UOHA 1X5TA 2XYHB 1GMUA 2WONB 1EQMA 5MLCV 1B0PA 1B64A 2B6AB 2YQ3A 3AAWB 2Q66A 4OX7A 2DGUA 2VQEF 1N34J 3JYTA 4DN9A 1J5OB 1HNVA 4QR1A 3W3SA 2M8HA 1C0UB 4ILLA 1RUSA 4Y2AA 3EVWA 3JAMY 3QAUA 4X66F 4AXIA 1RHKB 3EZOA 2CXEA 1N36F 1URNA 3IRXA 1PYTA 2FY1A 3KHGA 3K8WA 4MJKA 3GV5B 3RAMA 2DVIA 3PRVA 5KFJA 4ED5A 3FZBA 1OMSA 1LWEA 4KV8A 4KE5A 3F41A 1HKAA 2E5JA 2H9ZA 2XMJA 4TU9A 1U4BA 2F4VJ 4J9OA 3J7YI 1Y5LB 4EMDA 1R6YA 1LW2A 4NA2A 4ZLNA 2FVCA 4ZHRB 2LCWA 1T95A 4ZCKA 4IRCA 3OQ2A 3EVMA 3NKYA 2BA9A 1N5YB 1Q53A 3Q0AA 4Z2XA 2HFUA 1GXTA 1SC6A 2R7VA 4B3SJ 3A13A 3SQGB 4M5DB 1F1BB 1UVKA 4ZCMA 1TL1B 1Q8BA 1VCTA 1LFPA 2PFFB 4B9NA 3NXZA 1C0TB 3NOGA 3VVUA 3GV7B 1J2VA 3T41A 3VF0B 5G0RB 2XWYA 5C25B 3T5HA 2MEWA 1ZM2A 3DMJB 3G4SS 3OTOJ 4DV7J 5GMEA 4JI2F 4OHVA 4DL3A 5K8NA 1P8GA 4MT1A 3MCNA 3FMBA 3R97A 1JLEB 4DQRA 2V4QA 4PG7A 2PMHA 2VASA 4BBYA 4GVLA 4YEAA 2W4PA 2MY8A 3FCVA 1FXDA 4DS4A 1SH0A 5CD4H 2B9EA 5GAGU 2FZGB 3EZ5A 2KFNA 2C2RA 4ENOA 5EN1A
chains in the Genus database with same CATH topology
3SIPB 5IC4B 4ZVSB 1PAUB 1RWXB 2Y1LB 5IC6B 3KJQB 2XYHB 2QL7B 1BMQB 1RWPB 2H65B 1QDUB 2QLJB 1RHUB 3QNWB 4ZVQB 1RHRB 2CDRB 2DKOB 2FQQB 3P45B 2C2ZB 2H5IB 4ZVUB 1RWKB 2C1EB 1IBCB 2H54B 2HBZB 3GJTB 1F9EB 2CNLB 1RHMB 5K20B 2QL5B 2XYGB 2Y0BB 2HBQB 3EDQB 3D6HB 4DCPB 2XZTB 4JB8B 4LSZB 2HBRB 3R7NB 2H5JB 1RWVB 2CJXB 3KJNB 3IBCB 2C2MB 1SC4B 3NS7B 1RHJB 4ZVPB 2HBYB 1RHKB 3KJFB 1RWWB 4DCOB 1RWOB 3RJMB 3R7BB 2H4YB 3EDRB 3GJQB 2C2KB 1PYOB 4ZVOB 3P4UB 1RHQB 2XZDB 2CNNB 3GJSB 3R7SB 3D6FB 3GJRB 3IBFB 1RE1B 1RWMB 2H48B 3R6GB 1QTNB 3R5JB 1NMEB 2CNOB 4ZVTB 2H4WB 1ICEB 1RWNB 2H51B 2QL9B 4DCJB 2XYPB 1I51B 2CJYB 4ZVRB 2QLFB 1I3OB 3D6MB 1SC3B 2C2OB 1SC1B 2P2CB 2QLBB 1GFWB 3R6LB 2CNKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIP B;  5IC4 B;  4ZVS B;  1PAU B;  1RWX B;  2Y1L B;  5IC6 B;  3KJQ B;  2XYH B;  2QL7 B;  1BMQ B;  1RWP B;  2H65 B;  1QDU B;  2QLJ B;  1RHU B;  3QNW B;  4ZVQ B;  1RHR B;  2CDR B;  2DKO B;  2FQQ B;  3P45 B;  2C2Z B;  2H5I B;  4ZVU B;  1RWK B;  2C1E B;  1IBC B;  2H54 B;  2HBZ B;  3GJT B;  1F9E B;  2CNL B;  1RHM B;  5K20 B;  2QL5 B;  2XYG B;  2Y0B B;  2HBQ B;  3EDQ B;  3D6H B;  4DCP B;  2XZT B;  4JB8 B;  4LSZ B;  2HBR B;  3R7N B;  2H5J B;  1RWV B;  2CJX B;  3KJN B;  3IBC B;  2C2M B;  1SC4 B;  3NS7 B;  1RHJ B;  4ZVP B;  2HBY B;  1RHK B;  3KJF B;  1RWW B;  4DCO B;  1RWO B;  3RJM B;  3R7B B;  2H4Y B;  3EDR B;  3GJQ B;  2C2K B;  1PYO B;  4ZVO B;  3P4U B;  1RHQ B;  2XZD B;  2CNN B;  3GJS B;  3R7S B;  3D6F B;  3GJR B;  3IBF B;  1RE1 B;  1RWM B;  2H48 B;  3R6G B;  1QTN B;  3R5J B;  1NME B;  2CNO B;  4ZVT B;  2H4W B;  1ICE B;  1RWN B;  2H51 B;  2QL9 B;  4DCJ B;  2XYP B;  1I51 B;  2CJY B;  4ZVR B;  2QLF B;  1I3O B;  3D6M B;  1SC3 B;  2C2O B;  1SC1 B;  2P2C B;  2QLB B;  1GFW B;  3R6L B;  2CNK B; 
#chains in the Genus database with same CATH topology
 3O5T B;  1DLO A;  2HQ3 A;  3A8I A;  4L74 A;  1JLE A;  3HKZ D;  3LTO A;  5I3P A;  2ALZ A;  2LU1 A;  4PXD A;  2BQU A;  1S10 A;  1Y3J A;  4WFB Q;  4B9L A;  4DR3 J;  1S97 A;  4BLG A;  2XS5 A;  1YJV A;  2QEX S;  4J9L A;  2CNL B;  4Y2K A;  2QA4 S;  5D77 A;  2UP1 A;  1KWM A;  1XMQ J;  3MAA B;  1CS4 B;  2HFZ A;  2DB1 A;  3TYT A;  4B3O A;  5BXI A;  1SC4 B;  3GYX B;  1RGV A;  4J9V A;  5KTQ A;  4LF1 A;  4CTA A;  1LW0 B;  3ITH A;  4TU7 A;  1S6U A;  2HHU A;  3R5J B;  3FSY A;  4WXO A;  3K0J A;  4ETZ A;  2QV6 A;  1ICE B;  1KRP A;  1XTZ A;  2AHO B;  2IM3 A;  3MR6 A;  4A48 A;  3M2R A;  4E2F B;  4K4V A;  1KTV A;  1FKP B;  5IS2 A;  1XC9 A;  2YQ1 A;  2AIR B;  2HGM A;  1REV A;  4TXS A;  2UUC J;  2FJX A;  2QE5 A;  3T1H F;  4NMX A;  4OIX A;  2DNG A;  4ZN1 A;  3A8E A;  3TAQ A;  2ALY B;  3KHL A;  2B5J B;  2MKK A;  4KKO A;  2OEL A;  4DS5 A;  1VBX A;  4RNM A;  1VQ8 S;  2H5E A;  4NEZ A;  2ZUG A;  3U27 A;  4DCP B;  1T3O A;  2EFG A;  4DV6 J;  3IG1 B;  4LFA J;  3NL0 A;  4C8Z A;  3MMA A;  3PKY A;  4DUT A;  1GMW A;  5D4L A;  1X4D A;  2KRB A;  4X65 F;  2DNH A;  5HVF A;  2C3O A;  4OZ3 A;  2ZBQ A;  4ED7 A;  1KVK A;  1A9N B;  1FWK A;  1KOH A;  4CCH A;  4ZN3 A;  2C2D A;  3S1T A;  1NK9 A;  4EUV A;  3E01 B;  4I69 A;  5KOX A;  2VJV A;  1K47 A;  2HAF A;  2KVQ E;  4MMO A;  4G65 A;  3PAC A;  4OYA A;  3CDE A;  3R8Y A;  5JVG Q;  2EBE A;  2KXF A;  4OV6 A;  1NB2 A;  3K7R A;  3J7Z 5;  2B0G A;  4X84 A;  2UXC F;  5HSP A;  5ETN A;  2UU9 F;  4FS2 A;  1KON A;  3BB5 A;  1SKR A;  1HPZ A;  3PHT A;  1VRQ C;  4I67 A;  3WBZ A;  3MM6 A;  4KHP J;  2RB7 A;  4DZD A;  3CC4 S;  1TL7 B;  4CYU A;  1S59 A;  5DLF A;  2Z2Y B;  2MDA A;  3RBX A;  3M32 B;  2BZ2 A;  2KT2 A;  1C4C A;  3GYG A;  4OYP A;  5KFT A;  2DPI A;  1JJ2 R;  1WOR A;  2FZK B;  1EIY B;  3CSK A;  2CDQ A;  3QO9 A;  2HHX A;  1H73 A;  1F5C A;  4WE1 A;  1X5P A;  3QGG A;  3Q86 A;  1MWZ A;  2Z8Q A;  3MMB A;  1XMB A;  1JMT A;  5HQ8 A;  4KBI A;  1U6Z A;  4UOG A;  1ZZF A;  1D9A A;  4LF9 J;  3AOB A;  2FVQ A;  5D6G A;  5K14 B;  2HWT A;  4CLT A;  4DFP A;  2FD2 A;  3SCI E;  3KG0 A;  1HBO B;  3I0S B;  1JXV A;  4UTG A;  3GII A;  2OO4 A;  3ZZZ A;  2N3L A;  1BLU A;  3I9Z A;  1OO0 B;  4LVN P;  5L1L A;  3TUP A;  3R6L B;  2ZDP A;  4JV2 A;  2X1G A;  4X66 J;  4J9S A;  3MUR P;  4HTI A;  2CQI A;  3Q89 A;  4YS2 A;  4GRS A;  3EVO A;  2UUW A;  4J91 A;  4WFY A;  3M8Q A;  4FKX A;  3DHX A;  4W90 B;  4OYZ A;  1W7W A;  1BHN A;  3R5D A;  2ZIT A;  2IM0 A;  1TKD A;  3CDB A;  5CAB A;  4H4O B;  1YZ6 A;  4HI2 A;  2D9P A;  2JNJ A;  2XHC A;  2WVF A;  2KN4 A;  1KVJ A;  3MCO A;  3TZX A;  3D1O A;  3AA9 A;  4B02 A;  3FZ2 A;  1KVI A;  2XZD B;  3C14 B;  1D9D A;  2LKZ A;  2ZOG A;  1NK7 A;  1FHT A;  4PYD A;  1V6H A;  1WKK A;  1WOO A;  4FYV B;  4HYK A;  5KT5 A;  2FLL A;  3KYL A;  4MIB A;  5EGY A;  1S7I A;  2HIQ A;  1H74 A;  1S0M A;  3W2V B;  2AGQ A;  5L1I A;  2P9G A;  4UUX A;  2FVR A;  1H38 A;  2VBZ A;  3MPU B;  2C28 A;  1B3T A;  3SIP B;  3MM9 A;  2GZO A;  1PAU B;  4JI1 J;  4DR7 J;  1TK8 A;  3QWU A;  4RJV A;  1VGY A;  1OSC A;  3BH7 B;  3UI3 A;  4ID5 B;  5K5M A;  4WK1 A;  3SCL E;  3HHE A;  1LEO A;  3N5F A;  4NXN F;  2V34 A;  5CYQ A;  3VQS A;  2ZD1 B;  3W2V A;  4HVZ A;  1KTQ A;  3BJY A;  1U47 A;  2XSJ A;  4DV0 J;  2OSR A;  4OMF G;  3TX0 A;  3IC1 A;  4JBC A;  2J9C A;  2OAU A;  4GVB A;  5BJR A;  3CD0 A;  2RHQ B;  4JYA J;  1YJ9 S;  5L38 A;  1KQF B;  4LVO P;  4U95 A;  1V9O A;  3FCH A;  3V6D B;  2PFD A;  3NOC A;  4M1K A;  2YQ0 A;  4LF4 J;  1Q4R A;  5E0O A;  5D15 A;  1S0O A;  3GIL A;  2RF2 B;  5DDR C;  1JLG A;  2AEM A;  5D0R A;  4N76 A;  2G0J A;  4PWW A;  2IC3 B;  3MTJ A;  4IOA Q;  1F9H A;  1LWX A;  3I31 A;  2RJZ A;  1L3T A;  4WU3 A;  1CJU A;  2MPU A;  3LGH A;  3L7U A;  1RHU B;  3ZZY A;  2GMJ A;  3I32 A;  2DNN A;  1SCJ B;  5KG7 A;  4YR0 A;  5E3R A;  4CLU A;  3JSY A;  3DKD A;  3FJ2 A;  2Q43 A;  2GMH A;  3H20 A;  3EPI A;  2W8K A;  1FD2 A;  1RT1 B;  4G1Q A;  4C8K A;  5J1E B;  4DPX A;  1YJR A;  4RW6 B;  2IPO B;  2MQN A;  3Q23 A;  1Y11 A;  2YY3 A;  1KNZ A;  2LEB A;  2QO3 A;  2M9K A;  3BR8 A;  3QWP A;  1VHI A;  2N82 B;  3IWX A;  2U1A A;  2YWW A;  2X7I A;  1DTQ B;  2CZV C;  2CG4 A;  4F3O A;  4DEZ A;  3HO1 A;  1SKW A;  2F65 A;  3ZTS A;  1FK9 B;  5KFY A;  3TEG A;  3DI6 B;  1JNZ B;  1UPM B;  2K7K A;  3CE8 A;  2RS2 A;  4O23 A;  4WZM A;  3HFV A;  2E29 A;  3H2L A;  5BYS A;  3KUE A;  3FC9 A;  4OJH A;  4EEY A;  1ZM4 A;  2BV3 A;  2JEG A;  2Q6C A;  2XMT A;  4M63 A;  3JQJ A;  4B3T J;  4A46 A;  2MZJ A;  4JUZ A;  2BE9 B;  4O3S A;  1CJV B;  2NR0 A;  1NHV A;  1G1X A;  4FP9 A;  1S9E B;  4CNY A;  4TVA B;  2I9S A;  4ATN A;  2OLW A;  2IAJ B;  3D67 A;  3VAJ A;  4RKU C;  5HRO A;  2OI2 A;  2ZBR A;  4JI5 F;  2K2P A;  2YNG B;  2CZ9 A;  4QBU A;  2UUT A;  4CLK A;  1HNZ J;  1GH8 A;  3PKM A;  4TU8 A;  2ZE2 B;  4A8Y A;  1DTT A;  1KLM A;  3QT6 A;  1EP4 A;  4OJG A;  1SJR A;  2J0X A;  1GTH A;  4OYB A;  1N32 J;  3KFW X;  4ICL A;  3CVK A;  2GGP B;  2P2C B;  2YNG A;  5IV4 A;  1S12 A;  5IC4 B;  1V3S A;  3M8P A;  3NCQ A;  1IBK J;  4NRU A;  3PX4 A;  2JC0 A;  1HL6 A;  3TZZ A;  2QYC A;  1K0T A;  3K17 A;  2L48 A;  3P96 A;  4OYW A;  1RTI B;  4H4M A;  3RZA A;  3HHN B;  2V94 A;  3ZTR A;  4ZPV R;  3UN2 A;  5I3U B;  1HI0 P;  4WYW A;  3L95 X;  4C48 A;  1SBR A;  1HQE B;  3K89 A;  1NHK L;  2EBG A;  2N4C A;  1M5O C;  3HT3 A;  3EPG A;  1HAR A;  5E7O B;  2KXH A;  2JVR A;  1S6Q A;  5CXT A;  2DNO A;  4JI3 J;  3AA8 A;  2DRD A;  2E1M C;  3PG9 A;  3OR1 A;  1JJ4 A;  4TY9 A;  2BRL A;  5AE3 A;  2V2K A;  2ZHO A;  1KHW A;  2HHH J;  4O0I A;  2VPZ B;  1VRT A;  3WHI A;  4NI2 A;  1VQP S;  3HKW A;  1NKC A;  2OD6 A;  5KG5 A;  2C2O B;  3CNQ P;  4IR9 A;  2VD3 A;  4KY3 A;  1J5E J;  5CCM A;  4WK3 A;  3IS9 B;  4W4M A;  2PI4 A;  4QYR A;  3U1M A;  3KXD A;  3RB6 A;  1LWF B;  3DU6 A;  4IOB A;  1VLO A;  3CDW A;  4ZVU B;  1RT3 B;  2RAQ A;  2H54 B;  2JH3 A;  3CCQ S;  5JVH Q;  3R9L A;  3V2U C;  2DCL A;  3MFI A;  3MFH A;  3T5J A;  3KDN A;  4M8L A;  5HAN A;  1TL5 A;  4OFZ A;  1PO6 A;  4AUK A;  3RJM B;  3R7B B;  4DSK A;  3MTK A;  1X4F A;  4CLW A;  2OGU A;  3R7S B;  2LLZ A;  2WVB A;  1DQ9 A;  1JNR B;  2DBB A;  2ILZ A;  4HHH A;  1AUD A;  2QZ8 A;  2BM0 A;  2GO8 A;  1JLF A;  4I1T A;  2M70 A;  2LFV A;  2LDY A;  4NCB A;  2EC0 A;  3H4B A;  3MR5 A;  2N7Y A;  4JI7 J;  4QZV B;  4P2S A;  5GMD A;  2R7T A;  5HQM A;  1N52 B;  3M9M B;  1NK6 A;  4AQY F;  3KUH A;  2RVJ A;  3QJL A;  4DFK A;  4FF4 A;  3QAT A;  3QNW B;  3D0G E;  2YPY A;  3GG0 A;  2MQO A;  3CJK B;  5I4M A;  1VC5 A;  4BHQ A;  4OZL A;  3OTE A;  2M0G B;  1R27 B;  3AB2 B;  1U1O A;  3S8S A;  1H0H B;  1ZYQ A;  4YME A;  1XIQ A;  5J1N A;  4DR1 J;  1MML A;  1SVD A;  1U2F A;  3IMQ J;  1TU0 B;  3F0N A;  3KK1 A;  2P8I A;  1HMV B;  3T6B A;  4DR2 J;  1B7Y B;  2AJ0 A;  1WI6 A;  4RZR A;  4ED4 A;  2MGZ A;  4EFA C;  3EWG A;  4OV1 A;  4DPO A;  2KM8 C;  4N41 A;  3CJK A;  3HHL C;  2VPW B;  1QTN B;  3ISN C;  3OL7 A;  5F3Z A;  2CQ4 A;  4ECY A;  1K1Q A;  1M1H A;  2KJW A;  2ABY A;  2W7A A;  2UUA J;  2G13 A;  4NA3 A;  4DSJ A;  5KFM A;  2YKM B;  3C15 B;  1KFD A;  3OUY A;  3HHL D;  2NYH A;  2V9K A;  3CCU S;  4C7Q A;  3J7Z T;  2M2B A;  1H3D A;  2H3E B;  3LWM A;  4EBC A;  2VL1 A;  5FLX U;  3NNA A;  2MKC A;  2QL5 B;  4AFF A;  4DX7 A;  3DC2 A;  3CJQ A;  1EQ0 A;  4W98 A;  2L41 A;  4MKV A;  1RAJ A;  1LWC B;  3MWB A;  5FII A;  1VQY A;  1S76 D;  1C2P A;  3HVA A;  3J7A 1;  5L1K A;  4O44 B;  2EKN A;  1IVZ A;  3H7H B;  4TY8 A;  2ZWO A;  1R43 A;  2YBV A;  2W2P P;  2YWK A;  5EDW A;  3MPY A;  1Z4U A;  4ZP7 A;  5IQQ A;  3N01 A;  4ZCI A;  1K44 A;  1SQF A;  2XNR A;  1IUJ A;  2JZ5 A;  2VH7 A;  4NYZ A;  4IG0 B;  1R8B A;  5AXM A;  3Q22 A;  1LWC A;  3T1A A;  1Q79 A;  4JI0 J;  1HHS A;  5KFA A;  4ZVF A;  1JLQ B;  3CCV S;  2AQ4 A;  4C3M A;  5H9E K;  4L73 A;  4DJB A;  4NLX A;  3C6U A;  1NO8 A;  1G2E A;  3P6Y C;  2EFO A;  4L76 A;  4EO6 A;  5F8H A;  4I68 A;  3HPO A;  1UWB A;  3KLE B;  4O4G A;  5ADZ A;  3KLG A;  3DLG B;  2FB0 A;  2W2O P;  1QSS A;  3KLF B;  4C0H A;  3V5R A;  1GQE A;  3GJT B;  3VHQ A;  2KHC A;  3ILL A;  3W8G A;  4L6V 3;  5KFS A;  3DOK B;  3KLH A;  3Q83 A;  4L3K A;  2PE8 A;  4MKY A;  4LSL B;  1Q7Y T;  2KFY A;  2E1R A;  4OHW A;  2BAN A;  3LP1 B;  3PW0 A;  3KLI A;  4KAI A;  3EGZ A;  2VJU A;  1UW4 A;  3B4D A;  3I55 S;  3VWS A;  2BAC A;  1BQX A;  3SCK E;  1Q8K A;  1RYR A;  3MEE A;  3GJS B;  1EET B;  1UEK A;  3HFZ B;  2RML A;  3CUL A;  4EK2 A;  3D28 A;  1RIS A;  3KJV B;  1S4E A;  4I64 A;  5D0G A;  4CM0 A;  5EWE A;  5F8L A;  2OML A;  3C8Y A;  3CED A;  4C11 A;  5ITH A;  3DOM B;  3QYY A;  1MN9 A;  4WFA Q;  3ZTQ A;  3FEZ A;  2NPI A;  1FKO B;  1RTD B;  1QY7 A;  4LFC J;  4DOZ A;  3D0I E;  2KT5 A;  3M2U A;  3TP2 A;  1M1G A;  2XMK A;  1R3N A;  1WDT A;  4J9K A;  4ECR A;  3QBC A;  5M2R A;  1RK8 A;  1Q78 A;  1HHT P;  1U48 A;  5J2M A;  3M05 A;  1RT2 A;  3ZNJ 1;  3DOM A;  4CO4 A;  2F9D A;  5GAE U;  4ED8 A;  4PUO A;  2W8L A;  2X3D A;  3OFF A;  1YSJ A;  1FA0 A;  2CFX A;  2HBR B;  2K1R B;  3AFG A;  2V2V A;  4DU8 A;  3EE3 A;  1GEH A;  4ZKA A;  1RWW B;  3AJ2 A;  4FXW A;  1VBK A;  2NS1 B;  1IQT A;  2D41 A;  4LT6 A;  1NK8 A;  2CJQ A;  4PG5 A;  5CAA A;  4UQT A;  1GT8 A;  2Y1J A;  2AYG A;  3HLU A;  4F3M A;  2QJ3 A;  2NCK L;  1Y0H A;  4PAA A;  1TR0 A;  2Z57 B;  1CPZ A;  4WFZ A;  5C24 B;  2GX8 A;  3W66 A;  1HQU B;  1IBL J;  2MQP A;  2QLX A;  2LEP A;  2YNF B;  2Y0S D;  5B09 A;  2IRY A;  3D6T B;  1JJC B;  2QMW A;  2ROP A;  1Q82 T;  1SL2 A;  5EUH A;  2HNZ A;  1WG4 A;  3I87 A;  5GAD U;  1WSV A;  2RQC A;  3E3X A;  3UWT A;  4M94 A;  3Q2S C;  2HQI A;  1IKX A;  3G2X A;  3KK3 A;  2MKH A;  3L4B C;  2FQQ B;  1SI9 A;  2C2Z B;  1C1C A;  4M5G A;  5BYQ A;  3U1N A;  3M7V A;  4LR9 A;  2VFT A;  1SH2 A;  3RAQ A;  1RT5 B;  1MG7 A;  1UZD A;  1H6K X;  2VU5 A;  3W1Y C;  4X64 J;  7FDR A;  3KHH A;  5LT5 A;  3SXL A;  2IHR 1;  3M6U A;  4NRT A;  3T1Y J;  5GAG I;  4YHH J;  3FVY A;  3MUV P;  1LXJ A;  2AWZ A;  3MM8 A;  1WC6 A;  2W4D A;  3SBM A;  2ZZT A;  2HPU A;  5A8R B;  3T19 A;  3V6H A;  1R31 A;  1DUR A;  3CJ4 A;  1S0V A;  3V4I A;  4DHV A;  4ECT A;  2V6A A;  2GQ2 A;  4PXE A;  2XI3 A;  5ETL A;  1UVI A;  1BQN B;  4C8M A;  1S1W B;  5C7P A;  3NEK A;  4ZP6 A;  3QLH A;  3IR7 B;  1TFY A;  1YK9 A;  3MD1 A;  2BOP A;  3M8Y A;  4EU0 A;  1M0S A;  1BXN A;  4TNO A;  4S0M A;  5JMN A;  3HVR A;  1NSP A;  3O2I A;  5HI7 A;  4OI4 A;  4YB6 A;  1N4L A;  3Q8Q B;  2HHS A;  1S1W A;  2FGO A;  3THT A;  2QMU B;  2BJD A;  3O1L A;  2RKI A;  5F8M A;  1CUL B;  5HMW A;  2CPJ A;  1MLA A;  3TQ1 A;  2GJ2 A;  5DG9 A;  3CTR A;  2NXN A;  3BDP A;  3CT9 A;  1K9M T;  1VMB A;  3HHD A;  1XNR J;  4U96 A;  1OY8 A;  1WC1 A;  4U6P A;  2IDL A;  2GHV C;  1I51 B;  2HMI B;  2KG1 A;  3OVS A;  3S6E A;  5LSO A;  2NXE A;  4LF7 J;  3ICL A;  1RZM A;  3NY0 A;  4NLD A;  1VQO S;  4ZA1 A;  2IJF A;  1X4C A;  3E8O A;  1RA7 A;  3OR2 B;  1RTH A;  2HNY B;  2ZH3 A;  3ZTO A;  1TKZ B;  3VAK A;  4MH8 A;  4YP3 A;  1VQ5 S;  3PIP Q;  2HMI A;  4KC5 A;  1S77 D;  5I3Q A;  4QWE A;  3HVW A;  3MCS A;  1WHX A;  1XNQ J;  4P72 A;  5CYM B;  3QT5 A;  4F4K A;  3K58 A;  2FLO A;  2DGX A;  3FBB A;  4F2R A;  2Q79 A;  4EBD A;  1ZA1 B;  2AJ2 A;  2AYE A;  1RBO B;  2RE1 A;  2U2F A;  4WU2 A;  2CZ4 A;  3AOC A;  5F9N A;  4PYA A;  1FFW B;  2B9X A;  2DXD A;  1Q5Y A;  4WP3 A;  2ZH1 A;  4FYW B;  1E6Y B;  1UAW A;  5ETV A;  3AD9 C;  4ZLJ A;  4ECZ A;  3JS9 A;  5EWF A;  1TKX B;  5DZ7 A;  1X4A A;  2R7W A;  3MDF A;  2E7X A;  2HUR A;  3N6M A;  4CDI A;  2RRB A;  4PWU A;  2ZM6 F;  3I0R A;  3LGM A;  1IKW B;  2QSW A;  2PN6 A;  2G0C A;  4NPO A;  3B78 A;  1CC8 A;  1VJW A;  4K4X A;  1TMJ A;  4CH7 A;  3LPE A;  4IH7 A;  2Z4P A;  1TV6 A;  1B99 A;  1QDU B;  2QA4 G;  1E6Y A;  4ED2 A;  2CVI A;  1CJK B;  8RUC A;  4U9R A;  2E44 A;  4P73 A;  1S1V B;  1TKX A;  2O1P A;  2MB0 B;  1U1Q A;  3UR0 A;  3W62 A;  5T41 A;  2R7X A;  2RQK A;  2N4D A;  4J9R A;  3PW2 A;  2VOP A;  4LFB J;  3CMQ A;  4LRD A;  5IWA J;  3MPD A;  3OVA A;  2AJQ A;  1RKI A;  3W2W A;  1NND A;  1BGX T;  3ILO A;  1HNX F;  2YTC A;  1GX5 A;  4MK9 A;  3N4W A;  2YPZ A;  1FJG F;  3OVB A;  1RT6 B;  3AB4 B;  2DXE A;  4OI1 A;  1QE1 B;  2YWH A;  4I56 A;  4L75 A;  3VGU A;  2ZJQ Q;  5A2Q Y;  1RAA B;  2QA2 A;  2H51 B;  3TAM B;  1FFS B;  4AD6 A;  2IBK A;  3QT7 A;  3G82 A;  1JLA A;  4UT4 A;  1B0V A;  2QSF A;  4OYX A;  2CNK B;  1CJT A;  3UO0 A;  4GO7 X;  3MM5 B;  1WOS A;  1TP7 A;  4K5R A;  2F5G A;  3TWZ A;  1NKB A;  5HO4 A;  2GVD A;  3CCL S;  2FUG 9;  2XNQ A;  3W7B A;  4O3P A;  4DV4 F;  4K50 A;  2BE7 D;  2UV8 A;  4ZJO A;  1X4E A;  1I94 J;  4NXM J;  1URR A;  5L1J A;  3LP2 B;  5FD1 A;  4LRE A;  4Y65 A;  5IM0 A;  2DR8 A;  2BKO A;  1M90 T;  2ASD A;  4DX8 H;  1B7F A;  4ALZ A;  2AT1 B;  3KUG A;  4KTQ A;  1SJ4 P;  2MY7 A;  3J80 U;  2OEK A;  1R8A A;  1Q7L B;  2VB6 A;  3LAL A;  2HRY A;  3OFG A;  1RAH B;  1ZA2 B;  2D9O A;  4KIA A;  3B6B A;  4DR4 J;  1XK8 A;  4ZVH A;  3F73 A;  4RWW A;  2POK A;  2KYX A;  1WDD A;  1LXN A;  5AXN A;  1RAE B;  2XYP B;  1I1G A;  3DGP A;  1JLB A;  2J0S D;  4MFB B;  1IBM J;  3K59 A;  5M2P A;  3RG6 A;  2IVM A;  4F4Z A;  3JSB A;  2J76 E;  3CF5 Q;  2R8H A;  4PKD B;  3DRR A;  4UOC A;  4OX9 J;  3QT8 A;  1VC6 A;  3K57 A;  1NK5 A;  1OS5 A;  1RWK B;  3G86 A;  1WKJ A;  4Y6I A;  3IWN C;  2UUB F;  1FF2 A;  2GW8 A;  3UR3 C;  1NDC A;  3SMZ A;  3GP9 A;  1LQ9 A;  1N6Q A;  5LMU J;  3I5C A;  1SXL A;  1CC7 A;  3OBI A;  1L3V A;  4ETX A;  2W2N P;  2WB4 A;  3IBW A;  3NBP B;  3Q8S B;  4ECV A;  4OLP A;  2RIJ A;  3QPI A;  1NLK L;  3BPS P;  4IG3 B;  3OHA A;  3LW5 C;  4RW8 B;  1HBU B;  1CQN A;  1SPB P;  3GFH A;  1O6X A;  2MZ1 A;  5F41 A;  4RW7 A;  1VIS A;  1RTJ B;  1RAB B;  2J9D E;  4ZVT B;  3T5K A;  3MCM A;  4RW4 B;  3K5N A;  3T9Z A;  3EIC A;  2PEH A;  4FZV A;  1X5S A;  4QPT A;  4OYO A;  1QAX A;  1RWU A;  5E33 A;  2XO7 A;  3MPV A;  3QJJ A;  4DR6 J;  2M5Y A;  2B9Y A;  2MHE A;  4WBF A;  2M7S A;  5A0Y B;  3BYP A;  3POT B;  2BBE A;  1S1T A;  4LIW A;  3KOA A;  1D1U A;  3MR2 A;  3PO4 A;  2GIR A;  4RW4 A;  1RSC A;  3MHY A;  1RB0 A;  1XJW B;  1NSK L;  3UCZ P;  1CG2 A;  2FJD B;  2HW3 A;  1SV5 A;  1JKH A;  1TL4 A;  4DG1 B;  1YQH A;  4USI A;  2GCF A;  3PZP A;  4DCO B;  3H90 A;  1U8S A;  3POT A;  1P9Y A;  4OZ5 A;  2CNN B;  1U0H B;  3AY0 A;  4DN0 A;  4F0H A;  4RNN A;  1TQL A;  1Y9O A;  2JHE A;  1X9M A;  3N5B A;  2A3J A;  1U6F A;  4DQI A;  5AJ3 J;  2NXC A;  1KC8 T;  5KFG A;  2RHS B;  1FCA A;  2V8D A;  3V4M A;  2YWF A;  3IM9 A;  5C42 A;  4LUB A;  2RNE A;  1N0U A;  1SC3 B;  3W5Z A;  1JLC B;  5KFI A;  2QLW A;  3R1H A;  2EKY A;  4CWB A;  4F8R A;  5KFF A;  2W2M P;  4F4A A;  4RL1 A;  3ZNU A;  4ZDN A;  3TEH B;  2MJU A;  3ZTP A;  2CQ0 A;  1GNK A;  3CJ2 A;  2F3J A;  2MQQ A;  1S1X B;  4RBV A;  1RAD B;  1IKV A;  4HHJ A;  2G4B A;  4QYZ J;  4QR2 A;  2KT3 A;  2KO1 A;  4IR1 A;  4J9N A;  3FRZ A;  5H9F K;  5GMK a;  2ZJR Q;  4DV2 F;  1AZS B;  3DM2 B;  3M8W A;  3LP0 A;  1M5V C;  4DV5 J;  1SL1 A;  3EXY A;  4PQU B;  2H5J B;  1ZTW A;  4DFJ A;  4B3M F;  4A8X A;  5HP1 A;  1SJ1 A;  1CBK A;  2OJ3 A;  4IRK A;  3EDR B;  2ZHB A;  2E5G A;  3KG1 A;  2CRL A;  2A6M A;  4OHZ A;  1CVJ A;  4FF1 A;  1VS3 A;  2D1C A;  4X4Q A;  3GG1 A;  1R0B G;  3PJX A;  1FX4 A;  3ENQ A;  3AQO A;  1HNW J;  4X4R A;  1W2B R;  3DLE B;  2OUG A;  3B4M A;  2HND B;  4KT0 C;  4FYX B;  2B4U A;  4Q43 A;  3GV8 B;  4CO3 A;  2UXD F;  3LAN A;  2DIU A;  5GAH U;  4DV3 F;  2ZNY A;  1GX6 A;  3CC2 S;  2IBO A;  4ZVR B;  4JI6 F;  1QAI A;  4P75 A;  1KHV A;  4USJ C;  4Y34 A;  3TNV A;  4YDX A;  3BGR B;  4PPZ A;  2EFQ A;  5A8K B;  5J2N B;  4ECQ A;  3UDV A;  2CAJ A;  3FCW A;  3K2Y A;  4HT7 A;  3M1V B;  3C3L A;  4X62 F;  4B9T A;  2JLG A;  1S4F A;  3KNA A;  4NE9 C;  1DHM A;  4F7V A;  1YWX A;  4JP8 A;  1UZH A;  2YH0 A;  1S9G B;  3NP5 A;  1VRU A;  2JC1 A;  4ZP8 A;  2LQ9 A;  3FBF A;  2RIL A;  2OPQ A;  3U02 A;  1Q8L A;  1UWA A;  2NLW A;  4WPA A;  4URS A;  2MQL A;  2HFV A;  4K2X A;  2R4F A;  4HTJ A;  1LFW A;  2VIH A;  4CP5 A;  4ZJL A;  2WSF C;  4WF9 Q;  4X4U A;  1FXR A;  3SSS A;  2V63 A;  3SFU A;  2M3D A;  2LA4 A;  2FVS A;  3OXL A;  2NSB A;  4C98 A;  4LR7 A;  3VGT A;  2HLT A;  4NX9 A;  2OEM A;  4USM A;  1I3O B;  1T9X A;  4B08 A;  3G8Q A;  2PT0 A;  4IQM A;  4QWB A;  1WAC A;  3FFI A;  3HZG A;  2V69 A;  1O51 A;  3W5X A;  1NDK A;  4P2X A;  2L9N A;  2NSC A;  1UEU A;  3O3L A;  2GAG C;  1SL0 A;  4K0K J;  2VFV A;  4OYM A;  2FY8 A;  1ZAX A;  2B4P A;  4N5S A;  2HK2 A;  3MMC B;  3IO1 A;  3KG4 A;  4CM2 A;  4F50 A;  3DLK A;  1RI7 A;  1ZAV A;  2FJB B;  2IMO A;  2QGF B;  3NAH A;  1IM6 A;  1MWQ A;  2FC8 A;  3DCA A;  2RSQ A;  1R89 A;  3NS7 B;  2CUY A;  3ET6 B;  3RRH A;  3FNN A;  2Y8Y A;  1RWO B;  4DPY A;  4PG6 A;  2JWN A;  2BM1 A;  1WF2 A;  4LQ9 A;  3MMC A;  3BYR A;  3FSI A;  1GXU A;  1ELO A;  3PTW A;  2YKO A;  4Q8E A;  5HJY A;  2R7R A;  3T3F A;  1FWP A;  3EGN A;  2WB1 D;  2CQH A;  4CQ1 A;  2UXB F;  3FMW A;  2YNI A;  1QJH A;  5J2Q B;  2V2Q A;  4EYH B;  4V19 X;  1IR1 A;  2EVZ A;  1T03 A;  1P9Q C;  2HSE B;  4Y3C A;  1OYE A;  3UD5 A;  3TUI C;  1F60 B;  2DT9 A;  4DSE A;  3HT0 A;  1VQM S;  1YIT S;  1FI4 A;  1KDN A;  3HDS A;  4ITS A;  4BCA A;  4RW9 B;  4N8O A;  2FHJ D;  4ZPD A;  3HVT B;  3M2V A;  1S6O A;  3BEG B;  1BQM B;  2LXI A;  3CCT A;  4V1A k;  3DDI A;  3H59 A;  2H1Y A;  4FPI A;  4X4O A;  4AL7 A;  2ASJ A;  3A8K A;  3BN4 A;  1AW0 A;  1OPI A;  2J7K A;  3IBC B;  5ETO A;  4U7U D;  5KFL A;  3P49 B;  4RW9 A;  4JV5 J;  4DR5 J;  2ERR A;  4LF5 F;  2CPI A;  2AGO A;  2IY5 B;  1NSQ A;  2J0Q D;  1JB0 C;  4KR0 B;  3BGF A;  2DHX A;  1YRU A;  2DR9 A;  1NH7 A;  2R7U A;  3DRS B;  4NWB A;  3PCO B;  2FIU A;  1Z2Z A;  1Q86 T;  4H54 A;  5BR8 J;  3WZ0 A;  1SUQ B;  3HHK A;  2W9B B;  4LF8 J;  2FJA B;  3GLJ A;  4CLZ A;  5CA5 A;  1F2H A;  4LSN A;  1TTH B;  5EX3 A;  3CJ5 A;  4WP8 A;  5A8W A;  2B8P A;  2YXL A;  1FJC A;  4J9P A;  1FVQ A;  2CQC A;  3SSR A;  4QWA A;  3OL9 A;  1GMV A;  5C2G A;  2BEF A;  2V4J B;  3PR5 B;  1HW9 A;  4PPD A;  1YRT A;  3H5X A;  1RT4 B;  5RUB A;  2GNK A;  1FES A;  1S6P B;  1HD0 A;  3NGS A;  3DLH A;  4CIO A;  3WX4 A;  3R27 A;  3SDE B;  3MM7 B;  4GKK J;  3DU5 A;  3ZZU A;  2VQF J;  4TLQ A;  2XLJ A;  2DO0 A;  2XB2 D;  2VON A;  2C2K B;  1YJT A;  2OPR B;  1YVF A;  1RKJ A;  2SXL A;  7AT1 B;  5F8I A;  2XS2 A;  4N56 A;  2ZFH A;  5HBM A;  3MEC A;  1S1U B;  3H42 A;  1WF1 A;  1UVN A;  1L3S A;  2WOM B;  4DCJ B;  1AFJ A;  3RGI A;  4QJV A;  3ZC4 A;  2RQM A;  5E5N A;  4WFX A;  2E5L F;  3JTP A;  1XER A;  3P5B P;  4O0N A;  5A6W A;  1S49 A;  1U26 A;  1E6V B;  4OI0 A;  1XR5 A;  1DQA A;  4O4R A;  3RW7 A;  3FBE A;  3BN7 A;  2W7O A;  1PAE X;  3KHR A;  1FO1 A;  2EK1 A;  2VPX B;  3BM7 A;  4I7F B;  2WON A;  2WOM A;  1VHF A;  3EZU A;  1KP6 A;  3QFW A;  2HVH A;  2B6A A;  2HHV A;  4HEA 9;  4O3O A;  4C9D A;  2P6S A;  2DH9 A;  1T7P A;  2VKZ G;  2C2N A;  1VQN S;  3VAH A;  1J5O A;  4TQS A;  2CPD A;  1SKU B;  2XMU A;  2CJB A;  1C0U A;  1XMO J;  1NJI T;  1E6V A;  1GAO A;  2PMZ D;  5E3C A;  3DRP B;  3H4D A;  1XR6 A;  4FVM A;  4I2Q B;  4C3L A;  4BC7 A;  5J2P B;  5LJ3 Y;  2BJ8 A;  1DAR A;  1G7C B;  1VQ4 S;  2UZA A;  3BPD A;  2WZ1 A;  2RT3 A;  4USK A;  1TKT B;  4P52 A;  4DLE A;  3BBF A;  5HLF B;  4OX8 A;  1YBA A;  4ZPA A;  4L72 B;  3AD8 C;  1HI1 A;  3TJA A;  5GAE I;  4LF6 J;  1U24 A;  3PYD A;  1GFW B;  1SIW B;  1NH8 A;  3TI0 A;  2JL9 A;  4FNI A;  4I2Q A;  4KHR A;  1D09 B;  3PEJ A;  2WW4 A;  2DR7 A;  2BJ1 A;  1RQ0 A;  4DSF A;  1DZ5 A;  1HR0 F;  1YKW A;  4DBQ A;  4ZHR A;  2GIQ A;  1HWK A;  4B9M A;  4UOF A;  3MOJ B;  4NLQ A;  1N5Y A;  2WVC A;  5ETK A;  5KG0 A;  2ZZM A;  4ZK7 M;  2Z2Z A;  4DV1 J;  4PAB A;  4ZPC A;  1HI8 A;  3SQG A;  1XN9 A;  1NXI A;  4M5D A;  4UZB A;  5IT9 Y;  2DYA A;  1TL1 A;  1M5P C;  1MMD A;  1BD6 A;  3X3U A;  2IRU A;  4M5H A;  2ADC A;  1C0T A;  4XDC A;  1U2R A;  5GAD I;  5G0R A;  2VC0 A;  5C25 A;  2WHO A;  2H48 B;  2QIF A;  4HT5 A;  1LV5 A;  3DMJ A;  2G2Z A;  3TZY A;  4M5M A;  4GKJ F;  4J9U E;  3J81 Y;  2EG2 A;  3DYA B;  2J8A A;  4LRF A;  4XPC A;  2ZH7 A;  4HDG A;  1FJE B;  1PYS B;  3DRY A;  3CB4 A;  4PR6 A;  5K8M A;  4GC6 A;  3TOQ A;  3OL8 A;  3QFH A;  2DNM A;  1ZZN A;  1MNE A;  3RW6 A;  4KO0 B;  4I0W A;  3VAI A;  1D0E A;  4OYI A;  1D8Y A;  5D0H A;  2DHA A;  3K5O A;  3LOU A;  4N8N A;  2HBQ B;  3UQS A;  4ANC A;  2KZZ A;  2YWG A;  5T7L B;  2P9E A;  3TUJ C;  1NRK A;  3B82 A;  2JDJ A;  2VG7 B;  3NWG A;  3IWL A;  4UY8 T;  2H4Y B;  3MAA A;  1CS4 A;  2R9L A;  3QIP B;  2DCU B;  4YB7 A;  4DXL A;  3CO9 A;  1Y00 A;  4NCG B;  4EZ9 A;  3DXB A;  1TUV A;  2VG6 B;  1LW0 A;  1R8C A;  4IDK B;  2K3I A;  2OH2 A;  1QUP A;  3DXS X;  2YNH B;  2W9A A;  3A8J A;  5E3Q A;  4ANE A;  4ZPW R;  4NCG A;  1D8Z A;  2FHO B;  4ZVS B;  5LXY A;  3ETO A;  4KRW A;  1UKU A;  3KJQ B;  4CNZ A;  2HVE A;  2Y9H A;  1C1B B;  2B8Q A;  4YY3 F;  1HBM B;  1FKP A;  3KTQ A;  5F0U A;  1H2T Z;  2PC6 A;  1TK5 A;  4ES1 A;  1A7G E;  4NLV A;  3D54 A;  4TQR A;  2B43 A;  4M5K A;  4ZIT A;  3GB0 A;  3PV8 A;  2PSZ A;  2NQP A;  3PYE A;  2DNL A;  5KT6 A;  1FNM A;  3DDK A;  2B5J A;  3HD2 A;  1HLW A;  3AD7 C;  3AHP A;  2F7V A;  4OI6 A;  3IG1 A;  1SIZ A;  1HBM A;  4JI8 J;  5FDL B;  4LIR A;  2G2O A;  2VOO A;  2XCP A;  5KFH A;  1QVG R;  4YR3 A;  5LXR A;  1JX4 A;  1WEX A;  1SH3 A;  1NDL A;  4DUY J;  2CPZ A;  2B4V A;  1UFK A;  5KFX A;  2BDP A;  5CH7 B;  2VIC A;  3BV8 A;  3Q8U A;  2KVI A;  1T05 B;  1WWH A;  4C0O C;  1Z2L A;  2IYG A;  4K4S A;  2Z58 B;  1M5S A;  8AT1 B;  4JI4 F;  3E01 A;  2KM8 B;  1X4B A;  1F0X A;  1YZ7 A;  4KGV B;  3LPY A;  4ZP9 A;  3HHL B;  3LUY A;  1ZTT A;  1RWX B;  4U7C A;  3OTB A;  3ADA C;  1RWP B;  2MKI A;  4ED1 A;  2OFH X;  2ZVS A;  4Q2L A;  4P74 A;  1N33 F;  5T14 A;  3UVJ B;  2K8G A;  2FVP A;  1JJH A;  3Q8V A;  4KGM A;  2HQD A;  4MIA A;  2XZW A;  2K7J A;  2L08 A;  1QD1 A;  3HJV A;  5C5J A;  2OEJ A;  5LMN F;  4USU A;  3MEG B;  4ED0 A;  1DQ8 A;  3CGI A;  5AXK A;  2G9O A;  3GSD A;  3UPF A;  1TL7 A;  4ZCL A;  4NYP A;  2MLZ A;  4G6V B;  4DUZ F;  2ATC B;  3H5Y A;  1P1L A;  4HLB A;  2XMV A;  1EAR A;  5KFQ A;  3G6V A;  4P7T A;  4IQX A;  3CO0 P;  3RBZ A;  2Q6B A;  3EUN A;  4URQ U;  3M32 A;  2CQD A;  2VQE J;  3AXK A;  3QAE A;  2CJK A;  3G9C A;  3VTI A;  3QGH A;  3DN9 A;  2GJF A;  3F44 A;  5LSR A;  2D3O R;  2I5J B;  1SQG A;  2XY7 A;  2JX2 A;  2CKW A;  3N79 A;  1RDR A;  1DFD A;  4XO0 A;  1N36 J;  1M1K T;  2VOD A;  3TA2 A;  1VBY A;  3C46 A;  5K14 A;  2JEF A;  1PKU A;  1WHV A;  1HBO A;  3C19 A;  3I0S A;  1X0P A;  4PCQ A;  3RB3 A;  4GMK A;  4CLL A;  4D3H A;  2I5J A;  1A6L A;  3N9U C;  1L3U A;  5KG6 A;  2DKO B;  1NPP A;  4R5P B;  2IDE A;  3W9J A;  2UVW A;  4P9S A;  4F4X A;  4KFB B;  1RAI B;  4UF4 A;  3HJF A;  3A3N B;  2DEJ A;  2HFO A;  2DRB A;  3P5T L;  3GMG A;  2AKW B;  3HF5 A;  4F25 A;  2F40 A;  4I2P B;  5KFO A;  4B3R F;  4H4O A;  3A1Y G;  1TL3 B;  3PJ9 A;  2GVZ B;  2ZH2 A;  3DLB A;  3DOL B;  3GFZ A;  1R0A B;  1UL3 A;  3UDC A;  2YKA A;  2EFV A;  3C14 A;  1UPP A;  3QQC D;  2J7U A;  3VAG A;  4ES2 A;  2PA3 A;  1YBT A;  1FX2 A;  3TRG A;  1X60 A;  1R8P A;  3HX9 A;  2HZV A;  2W1B A;  4USH A;  3N28 A;  4JI2 J;  3GON A;  1F5B A;  1TMM A;  5THW A;  2Q1L A;  3ELH A;  1PC5 A;  1N34 F;  5B7W A;  2D3Z A;  4RUB A;  2MMY A;  2EPI A;  3M8Z A;  3PFE A;  2CDR B;  2KHD A;  3OD2 A;  4ZPT R;  1WUU A;  2HBZ B;  3CJ3 A;  4IFY B;  4ID5 A;  4KPC A;  3M30 B;  3PHE A;  3GTY X;  4OI2 A;  3TAP A;  5KFB A;  1F2G A;  3KMS A;  1WEL A;  3UW1 A;  1N88 A;  3GR1 A;  2ZD1 A;  4MKB A;  4PWD B;  3CD6 S;  1U1N A;  2WTF A;  2MLX A;  1REG X;  1RP5 A;  4KGK A;  3BZQ A;  2XMW A;  2RUS A;  1Z1Z A;  1FTR A;  1NUE A;  4AL5 A;  2ZKT A;  2BW2 A;  2F4V F;  1M5H A;  1F5A A;  4DF4 A;  4ELV A;  3C6T B;  2LQB A;  2V0N A;  4MKA A;  3V6D A;  4WII A;  2UVV A;  1WJ9 A;  3M6X A;  5G4D A;  4MK7 A;  4M5J A;  4Q0B B;  2DK2 A;  1IKY B;  3NNC A;  2IA6 A;  2ROE A;  4OQJ A;  2I0X A;  5D3G B;  2FHJ A;  2EI5 A;  2RF2 A;  4B3S F;  3X1L B;  5LSL A;  2GML A;  5KT7 A;  2IC3 A;  2EC2 A;  2C3U A;  2PO4 A;  5IT0 A;  4ECU A;  4QCL A;  2HK3 A;  2HLU A;  1O5J A;  1MSW D;  5EX0 A;  2GA7 A;  2PD1 A;  2ZEJ A;  2HHW A;  3CUN A;  2J6U A;  3LH2 S;  3OTO F;  4DV7 F;  2CJA A;  1U25 A;  2HS4 A;  1WC0 A;  3I9V 9;  3NG8 A;  3T1H J;  9RUB A;  1QLN A;  3JAM U;  1HYS B;  1RT1 A;  4RLE A;  2O5D A;  5J1E A;  1RCO B;  4ER8 A;  1RBA A;  2HQF A;  4RW6 A;  2MZR A;  4LBH A;  2V8V A;  1RWM B;  1EJ7 L;  2J8S A;  2V8P A;  4ECW A;  4YDD B;  3NRB A;  2MHN A;  1FRM A;  4OJ1 A;  2F8H A;  2E9T A;  3OTC A;  3FQL A;  1BUX A;  3BR9 A;  2V8G A;  2DHG A;  3IR5 B;  1DTQ A;  3AQP A;  4DR3 F;  2CQG A;  4X65 J;  1ZH5 A;  3D6M B;  2LEC A;  1HNI B;  4C8L A;  1FK9 A;  1TVR B;  3N6N A;  1U1K A;  3DI6 A;  1XMQ F;  5KFV A;  2CA9 A;  1IQZ A;  4WTO B;  3OLA A;  2QLJ B;  1Y4Z B;  1I5O B;  1RLD A;  1UP1 A;  1UFW A;  1JK9 B;  3KDO A;  3J7A N;  3ZZT A;  1U1M A;  4MYT A;  5ETM A;  3M8R A;  4WKR A;  4OHX A;  1WG1 A;  2BE2 B;  1F6T A;  2CQ3 A;  2Y0B B;  2KDO A;  3IRW P;  2UXC J;  5B0F A;  2DEI A;  1YLX A;  3R7N B;  2UU9 J;  3QJP A;  5LM7 E;  2IYI A;  1RJJ A;  1CJV A;  3VVT A;  2CAD A;  1PC4 A;  1V5I B;  3GSI A;  1S9E A;  2KTQ A;  5DDP C;  2GC8 A;  2IAJ A;  5HMX A;  3BS9 A;  4E98 A;  1KOO A;  1RE1 B;  2IFX A;  2HHT A;  4RBU A;  1X7V A;  3NGT A;  5FJ4 A;  1AT1 B;  2XLK A;  4RWX A;  2KJV A;  1PBA A;  2UUC F;  2QL9 B;  4B9U A;  2XHW A;  3C66 A;  2ZE2 A;  5LMN J;  5ETQ A;  3E2E A;  4KYZ A;  3M8S A;  3A4T A;  3CCJ S;  3HSZ A;  1HFE L;  2GGP A;  3Q24 A;  1WHW A;  4DV6 F;  1TFW A;  4LFA F;  2R2S A;  4K4W A;  4XDD A;  4M5N A;  2ILY A;  2DY1 A;  2W25 A;  3UDE A;  4O3R A;  3D6H B;  2I1R A;  1RXO B;  1WTB A;  5GAH I;  2X3G A;  3HZE A;  4UZC A;  3I5B A;  4DL0 C;  1RTI A;  4KH0 B;  4PEO A;  2HRT A;  1FE4 A;  2OPP B;  1MU2 B;  3DHW C;  5LOQ A;  5I3U A;  2LXU A;  3KK2 B;  4CH0 S;  4QU6 A;  4EBE A;  3L3C A;  1HQE A;  5IT4 A;  4YQW A;  1UVJ A;  4YB1 P;  3TZW A;  4C0B A;  1K8A T;  2DH7 A;  5HL7 Q;  1HBN B;  3ENV A;  3CPW R;  5AE1 A;  3BO3 A;  3DGV A;  2YVS A;  3NNH A;  2W01 A;  4HAC B;  2BRK A;  2QLF B;  2HHP A;  1IWG A;  2HG4 A;  4KHP F;  2BKN A;  1S7H A;  4KSE B;  2CPE A;  3G6X A;  2XY6 A;  1NJX A;  1NJZ A;  1HIY A;  5B0B A;  2J6T A;  5KG1 A;  3QID A;  1W26 A;  2O01 C;  4OJ3 A;  1T9T A;  3JYT B;  2A0F B;  3IS9 A;  2KH9 A;  1HNV B;  1N48 A;  2YX4 A;  3MI7 X;  5KFD A;  4E0D A;  1LWF A;  4IH6 A;  4CT9 A;  1RT3 A;  2XSF A;  1H7W A;  4WXW A;  3IRX B;  3T5L A;  3W8P A;  4LF9 F;  2CQB A;  4UUW A;  3HCX A;  1RAC B;  2AEJ A;  4NXN J;  5D78 A;  4USV A;  1KQS R;  3UN5 A;  1FT8 A;  4AT1 B;  1LWE B;  4KV8 B;  2J7W A;  3KNG A;  4IO9 Q;  1VQ7 S;  4KQZ A;  1PJ6 A;  1QAY A;  4XPE A;  3G96 A;  4DQP A;  2ZH6 A;  5L46 A;  1FJ7 A;  1XQI A;  1LW2 B;  1T3N A;  3K5L A;  4V19 J;  1EZZ B;  3BGL A;  1DBD A;  1FE0 A;  1NCL A;  3GYN A;  3FEX B;  1NBE B;  4OL8 A;  1DAX A;  2C3Y A;  4IYQ A;  4CH1 A;  1U6B A;  4DU7 A;  3CJ8 A;  2HIY A;  2Y1L B;  4M5L A;  4DZ6 A;  3M9N B;  2QL7 B;  2J9E A;  1NZA A;  2FPH X;  2LQJ A;  1G4C A;  4NEY A;  3W63 A;  4AND A;  1TAQ A;  2VC1 A;  2F8E X;  5KFN A;  2KZM A;  3MPW A;  4OZ1 A;  1WG5 A;  3MAH A;  4WIQ A;  3D9B A;  3LA0 A;  4RNO A;  2KXN B;  2DHH A;  3CXC R;  3BBC A;  4ZMM A;  2NXJ A;  3UDL A;  3DLL Q;  3EM1 A;  4FXD A;  1S99 A;  3IR6 B;  1HMV A;  4OZ2 A;  2EXU A;  3D6F B;  4QIW D;  1YIJ S;  2GQQ A;  2N3O A;  4LBI A;  1NHU A;  1OWX A;  1WF0 A;  2ASY A;  4JI1 F;  4DR7 F;  1Y7P A;  2NZ4 A;  2HS0 A;  2ZNZ A;  3M4X A;  1F3F A;  3HSJ A;  5DM6 Q;  1DLO B;  4FDF A;  4LRA A;  3RYL A;  1WHY A;  3JSM B;  2CPF A;  3VR1 A;  1TAU A;  4UW2 A;  1HQ2 A;  5B08 A;  1PCA A;  1RYS A;  4DV0 F;  1U49 A;  2YKM A;  2YKP A;  2AZ1 A;  4F4W A;  2F8M A;  3C15 A;  4JYA F;  1X8D A;  3CJT A;  3UCG A;  4B3O B;  2VBW A;  2NUH A;  1N5S A;  2ZBP A;  2XZT B;  3JSM A;  4LF2 A;  4CTA B;  2XC9 A;  4LF4 F;  3ITH B;  3OFE A;  1I6J A;  3GJQ B;  2ZZN A;  2O66 A;  2DJW A;  2LXF A;  1TEL A;  3GU0 A;  4EGL A;  2XLI A;  5KT4 A;  4RNF A;  4HH0 A;  3AOD A;  2GHW A;  1RBL A;  4KB7 A;  2MXY A;  2RU9 A;  3M2R B;  2RH3 A;  4O44 A;  2CNO B;  4G1P A;  2EW9 A;  4QW8 A;  1RWN B;  3IA0 A;  4JV0 A;  2GHP A;  1R7I A;  1HD1 A;  4JI5 J;  2E7W A;  1UVL A;  3NLC A;  2QLB B;  4IG0 A;  1REV B;  4O3Q A;  2EFN A;  2DNP A;  1FEH A;  2BKP A;  1KKH A;  4ZLL A;  2Y3Y A;  3SI8 A;  4DQS A;  5IC6 B;  3E51 A;  1FRI A;  1V3R A;  1JLQ A;  3OTD A;  5CZX A;  4KKO B;  2H5I B;  4N47 A;  2A6O A;  3RU0 A;  2Y8W A;  2HKE A;  3KLE A;  3DLG A;  3MMA B;  1ZET A;  1OPZ A;  3KLF A;  3BKF A;  2AX1 A;  4Y2I A;  2YH1 A;  5JXS A;  2AV5 A;  2CJX B;  3DOK A;  1U1R A;  4X4T A;  4P2F A;  5HAT A;  3AOA A;  2PGC A;  4ZVO B;  4LSL A;  2LMI A;  2WRM A;  3JSR A;  1VQ9 S;  1IJE B;  3PYG A;  2VFU A;  4XK8 C;  5B0A A;  3ZZR A;  5B0G A;  3LP1 A;  3I56 S;  1EET A;  8ATC B;  1G3O A;  3GWC A;  3UD4 P;  3FSX A;  2XGQ A;  5A76 A;  2DGS A;  2RRA A;  2H4W B;  3ULH A;  4WTY A;  5F0W A;  4LR8 A;  4K4Z A;  3QRQ A;  2HVI A;  3KJV A;  3BO2 A;  4TN2 A;  2YKN B;  2AU0 A;  4B3T F;  3WIV A;  1HPZ B;  1N54 B;  4HDH A;  4NLG A;  3MM6 B;  2BX6 A;  1FKO A;  1RTD A;  1N56 A;  4C4W A;  1LKZ A;  3RB0 A;  4CYU B;  3CIZ A;  3R2C J;  1KQG B;  2RU3 A;  3HXM A;  2OKQ A;  3ZZO A;  1YHQ S;  5MAO A;  3QO9 B;  4DL7 A;  1SJQ A;  1JWW A;  4WE1 B;  2YKN A;  4NZ0 A;  3TUZ C;  2QC3 A;  1HNZ F;  4KHM A;  3MMB B;  3GFX A;  4BS2 A;  1ZPW X;  2WAQ D;  1LNQ A;  2K1R A;  1N32 F;  3TO8 A;  4K4Y A;  2AJF E;  4NZ7 A;  2VDH A;  2WVE A;  1XEZ A;  3MD3 A;  3JTO A;  4K4U A;  2E9Z A;  1IBK F;  4GC7 A;  1IN0 A;  3IXQ A;  5DG8 A;  2R3V A;  1N5T A;  3OJS A;  4ELT A;  4KGZ B;  2BR0 A;  2AGP A;  3MXH P;  2QFI A;  1NPK A;  5C24 A;  2IIH A;  2RRN A;  3NGU A;  3M8Q B;  3PFO A;  1HQU A;  5K8O A;  4DQQ A;  5CHC B;  3B54 A;  5HK4 A;  2ADB A;  2J5A A;  2YNF A;  3HSD A;  3P45 B;  1KFS A;  1WI8 A;  5FLX Y;  3VQT A;  3AJ1 A;  1NJW A;  2MKS A;  4JI3 F;  3NS5 A;  2BOA A;  4AQY J;  4A4J A;  4OZN A;  3WIU A;  2R7S A;  2PA8 D;  4PXB A;  2F9J A;  1JXL A;  2RDJ A;  3D2W A;  1RT5 A;  1B0T A;  2WSC C;  1RA6 A;  2HHH F;  4A8F A;  4HKQ A;  3IFE A;  2BMB A;  1PYO B;  3MMJ A;  4XAK A;  2LVW A;  1PIE A;  4NLT A;  4CLP A;  2UV8 G;  2MSS A;  2J0W A;  4NL5 A;  1R6V A;  1J5E F;  2VA3 A;  4IKA A;  4M5I A;  2LEA A;  5B0E A;  4NCA A;  3D5M A;  2DPJ A;  3PRD A;  5A8R A;  3MM9 B;  3R5G A;  2EWH A;  1FKA F;  3SV3 A;  5DRK A;  5D0E A;  1N5V A;  2HZC A;  3OJU A;  2KYZ A;  3HK2 A;  1BQN A;  4K4T A;  4KH1 B;  1MW7 A;  1VJQ A;  3FK4 A;  5CYQ B;  5DG7 A;  2BQR A;  3ZZP A;  3W5Y A;  2XSJ B;  2ZDO A;  2MST A;  2I8E A;  2Z0G A;  4NAS A;  5KFW A;  3EGW B;  4CO1 A;  3H2V E;  2DGQ A;  4GVB B;  4LSZ B;  1HWI A;  3R5B A;  1FDB A;  1YX2 A;  4DSI A;  1HWU A;  3GIM A;  1ACM B;  4Q5V A;  5J1P A;  5AE2 A;  2L9W A;  1F9F A;  4JI7 F;  2DY9 A;  4DX5 A;  2VBY A;  3EMT A;  3Q2T C;  3VZH A;  2IMW P;  1CUL A;  5CQG A;  2Z2L A;  1JLG B;  2CYY A;  2XS7 A;  4FN5 A;  4H4K A;  3DLJ A;  2HQG A;  1IM4 A;  4ILM A;  3O6Q A;  1CJU B;  2HFN A;  4X4S A;  1QUV A;  3H0P A;  5DQH A;  2YX7 A;  2D3U A;  1WC4 A;  2ZBC A;  1L3K A;  1ZOT A;  3QSY B;  2V67 A;  4DR1 F;  3W65 A;  2C2E A;  2OP5 A;  3EJM A;  2VUG A;  4ZVQ B;  3MOZ A;  4DR2 F;  3CDU A;  1BWV A;  1FEE A;  3H8Y A;  3CCS S;  5ETP A;  4G1Q B;  1S57 A;  2B51 A;  3IM8 A;  2DNQ A;  3ILI A;  2B56 A;  3OR2 A;  2HNY A;  5LL6 d;  5H1S V;  4Q44 A;  3N0V A;  1TKZ A;  2BW7 A;  2ZOM A;  3H40 A;  5DGA A;  5E3A A;  5CYM A;  5F8J A;  4QQB A;  4CLS A;  3I4H X;  3D3C J;  3PVX A;  4X4P A;  5CZV A;  2Y1I A;  2UUA F;  2DNZ A;  1X9S A;  2E1C A;  2KI2 A;  2CIM A;  4EZ6 A;  4RPF A;  1VIO A;  3TJ9 A;  4FYY B;  4ED6 A;  5F3T A;  1U09 A;  3OFH A;  1IKW A;  4P7V A;  4TYA A;  1U02 A;  2WBM A;  4RUA A;  2B4O A;  1F9E B;  4OHY A;  4B9V A;  3WDO A;  1CJK A;  3OXG A;  1OSD A;  4L3N A;  5HRO B;  2XGP A;  1S1V A;  4J9Q A;  2I38 A;  3CJR A;  4R0E A;  2MZT A;  2C2M B;  1FDN A;  2ZKU A;  2JSX A;  3G71 S;  1WEZ A;  4KGX B;  4QYZ K;  1V3Z A;  4JI0 F;  4QWD A;  2P6T A;  2JJ4 D;  1DTT B;  1KLM B;  3G6Y A;  1EP4 B;  2BVZ A;  4NA1 A;  1AUS L;  1RT6 A;  2XMA A;  4LRC A;  3LO3 A;  1KSP A;  2L9D A;  4MTP A;  4ICL B;  5KT2 A;  1HA1 A;  2XWX A;  2OFG X;  3TW0 A;  2AEF A;  1QE1 A;  1T02 A;  3JQM A;  4A8Q A;  2D3O 1;  2VA2 A;  3M8P B;  1SC1 B;  3G6E S;  2W24 A;  1H2U X;  3TAM A;  1AA1 B;  3K8V A;  2EEY A;  4HL9 A;  4BDP A;  3C2P A;  1C4A A;  5HJX A;  2QA1 A;  2AD9 A;  2OD4 A;  1ZM9 A;  3MM5 A;  4H4M B;  5KFU A;  1ARO P;  1YRX A;  4EWT A;  4NLR A;  4I6A A;  3CCM S;  1RHM B;  2XYG B;  2M4M A;  1Y10 A;  3GCW P;  1S6Q B;  3BDE A;  1J27 A;  4ZVG A;  3OR1 B;  1D3W A;  1X5O A;  1EB0 A;  3LP2 A;  3OSN A;  2ZJP Q;  3CCZ A;  4LJM A;  4DMZ A;  1CLF A;  2D74 B;  2R7O A;  3R5C A;  4R8U B;  3R6G B;  1VRT B;  4LFC F;  4NI2 B;  2I6W A;  2DGO A;  4QW9 A;  3F56 A;  2FHM A;  3OL6 A;  2QN6 B;  4GO5 X;  2AP6 A;  4X2B A;  4ZJQ A;  1YTY A;  4MFB A;  4FKY A;  2ZBI A;  2JRS A;  2M88 A;  4R8U A;  1KS2 A;  3GIJ A;  4RU9 A;  3QGP A;  2I2Y A;  3H5U A;  3NS6 A;  2DR5 A;  4ZVE A;  5HMZ A;  3BSO A;  2R8J A;  3H5S A;  1VR6 A;  1WC5 A;  4YOE A;  1QAJ A;  3RAX A;  3KLV A;  3PIO Q;  2AZ3 A;  5DQG A;  3EGV A;  4JB8 B;  3WC2 A;  2HQC A;  2ZVI A;  3C16 B;  2X1A A;  1AB8 A;  2R7Q A;  3GPA A;  4DDF A;  3FKB A;  1JLF B;  1PJ5 A;  5F9L A;  2AJ4 A;  3BQ0 A;  4C8Y A;  3NBP A;  3PNI A;  2C3M A;  1IBL F;  2K06 A;  1NK0 A;  4IG3 A;  4F67 A;  3GQC A;  1KR4 A;  4YN3 B;  1UJ4 A;  4MAK A;  4RW8 A;  1HBU A;  4NLW A;  2HWI A;  2IJR A;  4NYO A;  2R8I A;  4ZLP A;  2HGN A;  3C16 A;  3T9N A;  1RTJ A;  4ZS6 A;  3MZI A;  2HZA A;  2WSE C;  4F3Q A;  2BYC A;  4Y2C A;  4IH5 A;  5KAK A;  3K5P A;  4FNH A;  3W61 A;  3LGN A;  3OXF A;  2VG5 B;  2NUU G;  2LQ8 A;  2R2R A;  4X64 F;  4ZIW A;  2E1P A;  5E41 A;  2JLF A;  5DDQ C;  5DET A;  2CQ2 A;  1QSY A;  3T1Y F;  5KOW A;  4YHH F;  5A0Y A;  2BAB A;  3KK1 B;  5I42 B;  1VLY A;  2IM1 A;  3CW2 C;  3BQ2 A;  2MGZ B;  1SJ3 P;  1IWA A;  3PX6 A;  1EX8 A;  3WQP A;  1PSD A;  2VG5 A;  3FDS A;  3LQV A;  3PW5 A;  1P1T A;  1PBU A;  2D69 A;  3L7P A;  4DG1 A;  1R0C B;  4F04 B;  3PM9 A;  3BSA A;  4I4B A;  3O44 A;  1U1P A;  5I42 A;  4OI3 A;  1UJ5 A;  2VV5 A;  5HAO A;  1U0H A;  1TZ0 A;  2JFD A;  4EO8 A;  2QMX A;  3BRE A;  3MUM P;  3TX8 A;  2GO9 A;  3TVY A;  3MGJ A;  2EK6 A;  3OUY B;  1NDP A;  2OTL S;  3BGO P;  2EFP A;  4QIG A;  5DS7 A;  3H2U B;  1JLC A;  2UVU A;  4J9M A;  2R8K A;  1RAG B;  2NRE A;  2QG9 B;  5DJB A;  2ZM6 J;  1FTC A;  1H72 C;  1U2C A;  3SSQ A;  4QU7 A;  3FBC A;  3U7J A;  4CO2 A;  4XTT A;  1S1X A;  3VAM A;  2COL A;  4ED3 A;  1OIA A;  3TJ8 A;  3LF0 A;  4A47 A;  4K59 A;  3KJN B;  5D8H B;  3ISN D;  1XNR F;  1AZS A;  3DM2 A;  4A8M P;  4TY8 B;  3J80 Y;  5IZH A;  1X4G A;  1APS A;  4PQU A;  2V2Z A;  5F8G A;  1UA0 A;  2PII A;  3I82 A;  3SYZ A;  4WJB A;  1FRH A;  1S9F A;  5KG2 A;  3WC0 A;  4E8U A;  1HNX J;  3UD3 P;  2X1F A;  1FVS A;  4X4N A;  1FJG J;  4LF7 F;  3UNG C;  1Y3K A;  1NJY A;  3DLE A;  2HND A;  4OX6 A;  4NLO A;  3C6U B;  1BE4 A;  4AXJ A;  2CWK A;  1UWB B;  4O4G B;  4AYB D;  3KLG B;  1QVF R;  1YJU A;  1MMN A;  3BGR A;  5IQ6 A;  4IO1 A;  5A8K A;  1KQK A;  3S7R A;  1XNQ F;  3KLH B;  5J2N A;  3BKU A;  4CO0 A;  1AYE A;  3PW7 A;  2P9C A;  3M1V A;  4NLY A;  1MRO B;  2XCA A;  5L8R C;  2O3D A;  4JOU A;  2BAN B;  2MYF A;  2NYI A;  5K20 B;  4PRF A;  2R8G A;  3KLI B;  2VPY B;  3NCR A;  3PXG a;  1VIX A;  1S9G A;  1F3V A;  5DDO C;  3MEE B;  2W7P A;  3D68 A;  5DQI A;  4G3I A;  4DV4 J;  4F36 A;  3CME S;  3PEH A;  4RUH A;  5ETS A;  3GZ7 A;  1YJN S;  3V6K A;  2X1B A;  2JLE A;  1MRO A;  5IOL A;  3NWR A;  1MN7 A;  4QIE A;  3RR8 A;  3BKT A;  3O8W A;  4C11 B;  3RRG A;  2ZH5 A;  1YI2 S;  4A8S A;  1ZM3 A;  1FD8 A;  4U8Y A;  3I6P A;  2RDD A;  3TQE A;  3HFK A;  3W64 A;  2CPY A;  2GFF A;  2VZ9 A;  1T94 A;  3M2U B;  3NAI A;  2WK4 A;  3CCW A;  2Z56 B;  4A8K A;  2JFK A;  4IOC Q;  4ES3 A;  5J2M B;  4B17 A;  3AT1 B;  1H7X A;  1L5U A;  4LFB F;  1RT2 B;  2AF6 A;  4YB5 A;  5IWA F;  3VAF A;  2QRR A;  1IBC B;  4PUO B;  3I4P A;  5ETR A;  5CCL A;  3FUY A;  2RDI A;  5L9N A;  3FEY B;  1Y5N B;  5DZ6 A;  3J7Y U;  4Y00 A;  2DTJ A;  2MZS A;  2PMW A;  4CT8 A;  2CPX A;  2HBY B;  1OQ6 A;  4NZ6 A;  2UUB J;  3ETM A;  4Q45 A;  1VDH A;  4NOH A;  1ZPV A;  4NLS A;  3SV4 A;  1T9U A;  3ET6 A;  3TR5 A;  3VGS A;  2V50 A;  2JEI A;  1DJ0 A;  4UST A;  5AT1 B;  2G1D A;  2GV1 A;  1VQK S;  2VFR A;  3VCD A;  2R42 A;  5E2Q A;  2HNZ B;  1R8H A;  2A2D A;  1S72 S;  1IKX B;  3KK3 B;  4EYI B;  1I94 F;  4YFU A;  4NXM F;  4WKY A;  1C1C B;  2V8H A;  2VHG A;  5J2Q A;  2H65 B;  4CO5 A;  2DR6 A;  1TUW A;  2XG8 A;  3G87 A;  2KG0 A;  4NML A;  4OLO A;  4PG8 A;  4BWM A;  7FD1 A;  3HVT A;  1ZAW A;  1W2I A;  3EDQ B;  4QPX A;  4B9S A;  1BQM A;  1FXL A;  2MZQ A;  3MM8 B;  1H98 A;  4DR4 F;  4ZVP B;  3KJF B;  1YG0 A;  1HW8 A;  2HHQ A;  1RHQ B;  2ZOF A;  2KL8 A;  1IBM F;  2IJN A;  3V4I B;  3GCX P;  1GK8 A;  4OZJ A;  3OPK A;  5KFC A;  2AYB A;  2MJN A;  1U8W A;  3D1Q A;  4OX9 F;  4PZV A;  3ENW A;  3MF5 A;  3EXC X;  5A2Q U;  1O0P A;  3W9I A;  3QLH B;  1UFL A;  4KPY A;  3DRS A;  2HEK A;  3FQK A;  2JOQ A;  3A12 A;  2C3P A;  4DPW A;  3THP A;  5LMU F;  4F26 A;  2XI2 A;  3CD7 A;  3CCR S;  3RUB L;  5F8N A;  2F1F A;  5HMY A;  1SUQ A;  1CQM A;  2W9B A;  1UA1 A;  3KWM A;  1BC6 A;  2C1E B;  4FBT A;  4J5O A;  5L9X A;  2XMM A;  1T9Y A;  3TAN A;  2J9D A;  3NCP A;  4N7T A;  2GS8 A;  2PI5 A;  4KJI A;  2HS3 A;  5B0C A;  4Y0F A;  1JXE A;  2E5H A;  3GIR A;  1DY3 A;  2V4J A;  2RKI B;  3TVK A;  4F02 A;  1RT4 A;  1SKS A;  1S6P A;  2A2C A;  4IFV B;  1WTF A;  4F4Y A;  3SDE A;  2FDN A;  3MM7 A;  1B70 B;  2IVF B;  3BBB A;  2ZH4 A;  5CD4 A;  4DV2 J;  1U1L A;  2AW0 A;  5H9E J;  1LOU A;  1OQ3 A;  1K73 T;  1KLN A;  2OPR A;  1Q95 G;  4B3M J;  4DR6 F;  2V9W A;  1EHW A;  3ILJ A;  1CEZ A;  1K0V A;  1Q8I A;  2XQC A;  3M6V A;  2XO6 A;  3L9Z A;  5DM7 Q;  4LRB A;  4IFV A;  4WZQ A;  3D0H E;  1S1U A;  1VK8 A;  3HM9 A;  5SZT A;  2YX1 A;  1LK5 A;  5B0D A;  4RX6 A;  5HQL A;  4JV1 A;  5KG4 A;  2UXD J;  5ETT A;  2AYM A;  1RTH B;  4DV3 J;  2HFS A;  2CQ1 A;  3OHB A;  1NEE A;  3UE2 A;  4DPT A;  1KBR A;  4JI6 J;  1SJF A;  1TK0 A;  3FGV A;  4MYU A;  1N8R T;  1LK7 A;  1BY9 A;  3MEK A;  3PR4 A;  4X62 J;  4I7F A;  5HN0 A;  1WEY A;  4P6Q A;  3TA0 A;  2F63 A;  5AJ3 F;  2DIS A;  1NZ8 A;  2CWX A;  3CIM A;  3GE9 A;  2DHS A;  6FD1 A;  1EKS A;  3D1H A;  3IBF B;  4WWS A;  4BC9 A;  1RT7 B;  3DRP A;  3I0R B;  3EYZ A;  1H2V Z;  5J2P A;  3MAQ A;  4Z37 A;  4FF3 A;  2MQM A;  4U7U K;  3PRB A;  3GIK A;  4RBT A;  1TKT A;  3Q8R B;  4WYL A;  2OSQ A;  1TV6 B;  1NM2 A;  5HLF A;  1YDL A;  1S48 A;  1VQL S;  3BSC A;  3UCU P;  2DGW A;  4C3K A;  4TYB A;  4DV5 F;  1WC3 A;  4C8N A;  1UET A;  4ZOS A;  1QTM A;  1RT7 A;  3NGK A;  2Z30 B;  3PDN A;  4OZ0 A;  2LYV A;  1DRZ A;  3D3B J;  3H25 A;  1UEV A;  3MED B;  1RAO A;  5BYR A;  3K5M A;  3W2W B;  1YJW S;  2C42 A;  4R25 A;  1HNW F;  4DL2 A;  4QIV A;  3V81 B;  4ID8 A;  1Q0N A;  5KFE A;  1SQE A;  3DDN A;  3R2D J;  4LMZ A;  3MED A;  1NPR A;  3SQO P;  4RNH A;  1FDA A;  3G82 B;  4FYD A;  2Q3P A;  1JLA B;  2E9R X;  2EG1 A;  3W60 A;  3S01 A;  1CJT B;  5IV3 A;  1X4H A;  1O8B A;  1FNX H;  2DH8 A;  4R0J A;  2A18 A;  3V81 A;  3CMA S;  2BJ7 A;  2KRR A;  1FFG B;  2NZC A;  5LJ5 Y;  3BQ1 A;  3KKF A;  2GVD B;  2NXU A;  5DGB A;  2XBP A;  2Y1R I;  3DYA A;  3WX8 A;  1D9F A;  3BH6 B;  4RR5 A;  3JB9 k;  1EKR A;  1BMQ B;  2QTW A;  3A3P B;  4CLF A;  1VI7 A;  2QFJ A;  3IP0 A;  2UXB J;  2VFS A;  2KKH A;  1RCX B;  4PXC A;  3SEO A;  3H98 A;  5IM0 B;  3GFY A;  2LQ5 A;  4F2S A;  4LQ3 A;  1RLC L;  1VC0 A;  4KO0 A;  2ZUA A;  2QYG A;  3N6L A;  2B3T B;  2DNK A;  2MKY A;  2B7B B;  5T7L A;  2HWH A;  2VG7 A;  5JUM A;  3QZ8 A;  2A1B A;  3QIP A;  4ILR A;  3DGP B;  1JLB B;  3G8T A;  2GAH C;  2VG6 A;  3W9H A;  4K0K F;  5KT3 A;  4LF5 J;  3VV2 B;  3GR0 A;  4G1I A;  4IDK A;  3DRR B;  2FYX A;  2VBX A;  2GIF A;  2W2Q P;  5KG3 A;  2YNH A;  2FGC A;  1IR0 A;  4J90 A;  4NLP A;  4F0K A;  1VFJ A;  1RHR B;  4CRJ A;  1ROF A;  1N6Q B;  1C1B A;  4DF8 A;  3PJW A;  3US5 A;  3NMA A;  9ATC B;  5KFZ A;  3HI9 A;  4Q8F A;  3U1L A;  2ZWP A;  5KFK A;  3R3T A;  1UJ6 A;  2ACY A;  1VQ6 S;  3KMQ A;  2X51 A;  4I6W A;  1KEK A;  4RW7 B;  4URG A;  3OLB A;  2A10 A;  4PQA A;  4ZPB A;  2E66 A;  1RAF B;  3V6J A;  3FRY A;  2APO A;  3IAM 9;  1PIL A;  2E5I A;  4DWI A;  2RS8 A;  5FDL A;  2R2U A;  2BJ3 A;  3AH6 A;  2HYI B;  1UVM A;  5EHH A;  2FC9 A;  2DIV A;  2AMC B;  1A0O B;  4FPR A;  4FS1 A;  2VKR A;  4TLR A;  4DL5 A;  1T05 A;  4RUC A;  2J6S A;  3HSG A;  1UCN A;  6AT1 B;  1VOM A;  1IXK A;  1S1T B;  1XWL A;  3D66 A;  3DRX A;  1HHQ A;  2CVE A;  3BSN A;  2OIH A;  1X9W A;  2DGT A;  4XIU A;  2N7C A;  3M9O B;  3UN3 A;  3HHL A;  4D3G A;  5IXU A;  1YGY A;  2ROG A;  3RR7 A;  1SV5 B;  2MLY A;  4YUD A;  1JKH B;  4CZC A;  2E5L J;  4JV5 F;  4DR5 F;  3LAK A;  3UVJ A;  4K7Q A;  1WD6 A;  1RU1 A;  3AJD A;  2IVY A;  4FXV A;  3ZO7 A;  4U67 Q;  4CLY A;  4DL6 A;  1X31 C;  2FTR A;  1OJ4 A;  4LBP A;  3VAL A;  3MEG A;  3MR3 A;  2G0I A;  1T11 A;  2P5V A;  2BJE A;  3L7O A;  4UY8 5;  6FDR A;  5BR8 F;  3QRP A;  1NAQ A;  3P8B B;  2OTJ S;  4Q7A A;  3DFE A;  4LF8 F;  5C42 B;  4HR2 A;  4WCE Q;  2HRU A;  1GMW D;  3CCE S;  3OV7 A;  4USW A;  3ZZ0 A;  3SCJ E;  4Z7C A;  1PGZ A;  1XBW A;  5E3P A;  2NPF A;  4BWJ A;  2WVD A;  5KFR A;  1QSL A;  1YBU A;  1WNE A;  1K1S A;  1IKV B;  4DI6 A;  4GKK F;  3D7S B;  2DO4 A;  3TAR A;  1NB7 A;  2VQF F;  4CI0 B;  3LP0 B;  4FVC A;  2MQ8 A;  1RTZ A;  3MR7 A;  1UW9 A;  3J81 j;  1U7L A;  2XEX A;  2CG8 A;  1UMJ A;  4K5S A;  2DGV A;  2KFZ A;  5HVG A;  5HP1 B;  4R5P A;  3VGV A;  3RBD A;  1OY6 A;  4DX6 A;  2G2Y A;  2WW8 A;  1RWV B;  1VK3 A;  2JVO A;  4KFB A;  2XTJ P;  1U45 A;  1HR0 J;  3Q8P B;  3CD5 A;  1GXL A;  1FRJ A;  3P4U B;  2OPS B;  2ZH8 A;  1N0V C;  3IAS 9;  4I2P A;  4QOT A;  2FJE B;  2ZC4 A;  1TL3 A;  2GVZ A;  3DOL A;  2FLN A;  3T6J A;  4C8O A;  4YR2 A;  4DSL A;  1GTE A;  1CSJ A;  2HVZ A;  3RBE A;  4HHU A;  3ENA A;  1R0A A;  3CJS A;  4DLG A;  3BO4 A;  3DNC A;  3UFC X;  4FF2 A;  2OPS A;  2DNR A;  3BGU A;  1UTA A;  1Q16 B;  4ZIV A;  1P6T A;  1U0S A;  4GKJ J;  1SB6 A;  1VRU B;  2ASL A;  2FHK A;  2ZH9 A;  3LWL A;  2FZC B;  2OPQ B;  1XMO F;  1IJF B;  4ELU A;  1BWE A;  1T9W A;  1HWJ A;  4MIW A;  3SZ2 A;  5A6P A;  2V4R A;  4TKT A;  4IFY A;  3IGN A;  2V5H G;  2PDA A;  2DXF A;  4J7C A;  3M30 A;  5D4O A;  1PJ7 A;  3VZI A;  2M8D B;  1S0N A;  3CC7 S;  3QGI A;  1EAY C;  4AE5 A;  1VBZ A;  2B9W A;  2KU7 A;  2O67 A;  4PWD A;  1JQG A;  4LF6 F;  3M6W A;  4U8V A;  4PG4 A;  4MK8 A;  1NU4 A;  1PG5 B;  4FBU A;  2D7S A;  3FFI B;  5GVQ A;  2PEB A;  2FLP A;  3C6T A;  3I96 A;  1MWY A;  5D4P A;  4J37 A;  2AX0 A;  3D4J A;  2Z2M A;  5CYJ A;  1RU2 A;  1S5Z A;  3CDA A;  4Q0B A;  1IKY A;  2XM3 A;  3BF4 A;  1WSR A;  1VYA A;  5D3G A;  4UQG A;  4DPU A;  4DV1 F;  3Q8Y A;  1NSA A;  1VQS A;  1XR7 A;  3DLK B;  2YWE A;  3QMQ A;  1P27 B;  4W92 B;  1ULR A;  3CWJ A;  1WKL A;  1NK4 A;  2JEJ A;  4H4K C;  3PX0 A;  4WFN Q;  2G1H A;  5KFP A;  2HGL A;  3RB4 A;  4RO0 A;  3UNY A;  4F0M A;  2ACM A;  4YY3 J;  4A8O A;  1RHJ B;  2QT7 A;  1TUG B;  1S79 A;  4RU2 A;  2IRX A;  2W9C B;  3MUT P;  4Q2M A;  2LP4 A;  3OW2 R;  1HYS A;  3QZ7 A;  2ZC3 A;  4AL6 A;  1M5K C;  2LDI A;  4QR0 A;  3PY8 A;  3A3O B;  4P10 A;  2YNI B;  4N77 A;  4P71 A;  1OYD A;  4IRD A;  4IUF A;  1T03 B;  1V5V A;  3JTN A;  2VF3 A;  2BXJ A;  2CJY B;  4Y2M A;  2LU2 A;  2F4F A;  4O3N A;  2FJV A;  3NGD A;  1YJ7 A;  3ZXW A;  2W9C A;  2HAI A;  3JQK A;  3L09 A;  1OY9 A;  2W4C A;  2DNY A;  1FER A;  5C2C A;  2YKQ A;  2OMO A;  3M2V B;  2BUN A;  3HP6 A;  3AXM A;  1HNI A;  5K9F A;  1Q5V A;  1FWL A;  2GJI A;  5L39 A;  5M2U A;  1TVR A;  4ECX A;  3B8H A;  5DO2 A;  1FRK A;  4JI4 J;  3NGR A;  1FNO A;  3EX7 B;  5EWG A;  4DL4 A;  1KD1 T;  2M52 A;  2ZHA A;  1Y5I B;  1T9V A;  4DFM A;  1N33 J;  5K8P A;  2BE2 A;  3OSP A;  1ZBT A;  2L3M A;  5IT9 U;  3RRK A;  2GQC A;  3ISZ A;  2CJ9 A;  3I5A A;  4A8W A;  2RQ4 A;  3ONQ A;  2AJ1 A;  3G8S A;  3IN5 A;  4ECS A;  4Z7Y A;  2LA6 A;  3ZFV A;  1X0F A;  2XY5 A;  2DRA A;  3QSI A;  5AXL A;  4DUZ J;  4HI1 A;  4QIF A;  2C22 A;  2OHD A;  4K8R A;  2DD8 S;  2WBR A;  1KN6 A;  3HD1 A;  3TA1 A;  3QRR A;  5JJB A;  2IA0 A;  4C2M A;  2CPH A;  4LSN B;  2MTL A;  3J81 U;  2KB2 A;  5H9F J;  1AXQ A;  2MKJ A;  4HH1 A;  3R1L A;  5A8W B;  3HMJ G;  3PYF A;  2XUL A;  2E7V A;  3OT9 A;  1AFI A;  5U47 A;  1T0T V;  2QX0 A;  1N5Q A;  3R5A A;  4C97 A;  2B7C B;  3NMR A;  4JI8 F;  1G6B A;  2UVR A;  3IGV A;  2R2T A;  3SFG A;  4DUY F;  4WP9 A;  2FJW A;  5DLG A;  3P3D A;  4Y28 C;  2DIT A;  4C6A A;  5IFM A;  2V68 A;  3TVZ A;  4ERD A;  1FRX A;  1FDD A;  2WCX A;  4EI2 A;  1IR2 A;  1ITP A;  2OPP A;  5HBM B;  3MEC B;  5D4N A;  3GJR B;  1MU2 A;  2ATL A;  1W25 A;  2BJ9 A;  4K2J A;  4NLU A;  3CJ0 A;  1T8E A;  3KK2 A;  2BQ3 A;  5HVH A;  2E1A A;  4P2M A;  4QWC A;  1NME B;  3PW4 A;  4B3R J;  3HUL A;  4I6Y A;  1WOP A;  2IM2 A;  2RD5 C;  1Q81 T;  1JIH A;  2CQP A;  3PO5 A;  1HWL A;  4X4V A;  2HVD A;  1HBN A;  4M95 A;  3RTV A;  3THV A;  2VDI A;  3JXO A;  1QM9 A;  3LAM A;  1FRL A;  1NKE A;  4HAC A;  1B4S A;  1Q1K A;  2RUG A;  1ZS6 A;  2K3K A;  5SUH A;  4UOH A;  1X5T A;  2XYH B;  1GMU A;  2WON B;  1EQM A;  5MLC V;  1B0P A;  1B64 A;  2B6A B;  2YQ3 A;  3AAW B;  2Q66 A;  4OX7 A;  2DGU A;  2VQE F;  1N34 J;  3JYT A;  4DN9 A;  1J5O B;  1HNV A;  4QR1 A;  3W3S A;  2M8H A;  1C0U B;  4ILL A;  1RUS A;  4Y2A A;  3EVW A;  3JAM Y;  3QAU A;  4X66 F;  4AXI A;  1RHK B;  3EZO A;  2CXE A;  1N36 F;  1URN A;  3IRX A;  1PYT A;  2FY1 A;  3KHG A;  3K8W A;  4MJK A;  3GV5 B;  3RAM A;  2DVI A;  3PRV A;  5KFJ A;  4ED5 A;  3FZB A;  1OMS A;  1LWE A;  4KV8 A;  4KE5 A;  3F41 A;  1HKA A;  2E5J A;  2H9Z A;  2XMJ A;  4TU9 A;  1U4B A;  2F4V J;  4J9O A;  3J7Y I;  1Y5L B;  4EMD A;  1R6Y A;  1LW2 A;  4NA2 A;  4ZLN A;  2FVC A;  4ZHR B;  2LCW A;  1T95 A;  4ZCK A;  4IRC A;  3OQ2 A;  3EVM A;  3NKY A;  2BA9 A;  1N5Y B;  1Q53 A;  3Q0A A;  4Z2X A;  2HFU A;  1GXT A;  1SC6 A;  2R7V A;  4B3S J;  3A13 A;  3SQG B;  4M5D B;  1F1B B;  1UVK A;  4ZCM A;  1TL1 B;  1Q8B A;  1VCT A;  1LFP A;  2PFF B;  4B9N A;  3NXZ A;  1C0T B;  3NOG A;  3VVU A;  3GV7 B;  1J2V A;  3T41 A;  3VF0 B;  5G0R B;  2XWY A;  5C25 B;  3T5H A;  2MEW A;  1ZM2 A;  3DMJ B;  3G4S S;  3OTO J;  4DV7 J;  5GME A;  4JI2 F;  4OHV A;  4DL3 A;  5K8N A;  1P8G A;  4MT1 A;  3MCN A;  3FMB A;  3R97 A;  1JLE B;  4DQR A;  2V4Q A;  4PG7 A;  2PMH A;  2VAS A;  4BBY A;  4GVL A;  4YEA A;  2W4P A;  2MY8 A;  3FCV A;  1FXD A;  4DS4 A;  1SH0 A;  5CD4 H;  2B9E A;  5GAG U;  2FZG B;  3EZ5 A;  2KFN A;  2C2R A;  4ENO A;  5EN1 A; 
#chains in the Genus database with same CATH homology
 3SIP B;  5IC4 B;  4ZVS B;  1PAU B;  1RWX B;  2Y1L B;  5IC6 B;  3KJQ B;  2XYH B;  2QL7 B;  1BMQ B;  1RWP B;  2H65 B;  1QDU B;  2QLJ B;  1RHU B;  3QNW B;  4ZVQ B;  1RHR B;  2CDR B;  2DKO B;  2FQQ B;  3P45 B;  2C2Z B;  2H5I B;  4ZVU B;  1RWK B;  2C1E B;  1IBC B;  2H54 B;  2HBZ B;  3GJT B;  1F9E B;  2CNL B;  1RHM B;  5K20 B;  2QL5 B;  2XYG B;  2Y0B B;  2HBQ B;  3EDQ B;  3D6H B;  4DCP B;  2XZT B;  4JB8 B;  4LSZ B;  2HBR B;  3R7N B;  2H5J B;  1RWV B;  2CJX B;  3KJN B;  3IBC B;  2C2M B;  1SC4 B;  3NS7 B;  1RHJ B;  4ZVP B;  2HBY B;  1RHK B;  3KJF B;  1RWW B;  4DCO B;  1RWO B;  3RJM B;  3R7B B;  2H4Y B;  3EDR B;  3GJQ B;  2C2K B;  1PYO B;  4ZVO B;  3P4U B;  1RHQ B;  2XZD B;  2CNN B;  3GJS B;  3R7S B;  3D6F B;  3GJR B;  3IBF B;  1RE1 B;  1RWM B;  2H48 B;  3R6G B;  1QTN B;  3R5J B;  1NME B;  2CNO B;  4ZVT B;  2H4W B;  1ICE B;  1RWN B;  2H51 B;  2QL9 B;  4DCJ B;  2XYP B;  1I51 B;  2CJY B;  4ZVR B;  2QLF B;  1I3O B;  3D6M B;  1SC3 B;  2C2O B;  1SC1 B;  2P2C B;  2QLB B;  1GFW B;  3R6L B;  2CNK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...