4ZVTB

Caspase-7 variant 1 (v1) with reprogrammed substrate specificity due to y230a/w232m/s234n substitutions, bound to veid inhibitor.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
YKIPVEADFLFAYSTVPGYASMRNPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 17
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 4zvtB00
2H65B 1RWKB 3IBCB 3D6MB 1PYOB 2CJYB 2Y0BB 2FQQB 2QL9B 1SC4B 1RWWB 4DCPB 2C2MB 1RHJB 2P2CB 2CNNB 5IC4B 1RHKB 3EDRB 1RWVB 1I51B 2H54B 3RJMB 2C2OB 2H51B 1I3OB 3D6HB 2QLBB 3NS7B 4DCOB 2XYGB 2CNOB 2DKOB 2H48B 1RWPB 4ZVQB 2H4WB 2XZDB 3R7NB 2H4YB 4ZVRB 3R7SB 3D6FB 2QLFB 1RHUB 2XYPB 5IC6B 1IBCB 3GJTB 3KJFB 2CNKB 1RWOB 2CDRB 1RWMB 1QTNB 3QNWB 1F9EB 3IBFB 4ZVOB 3GJSB 3R6LB 1BMQB 2C1EB 3GJRB 3KJQB 4ZVTB 1RWNB 1GFWB 2QL5B 1RHQB 1SC1B 2CJXB 2HBRB 3GJQB 4LSZB 3SIPB 1RE1B 3R6GB 2XZTB 1SC3B 2H5JB 2QLJB 2HBQB 2QL7B 1RWXB 1NMEB 3P45B 3R5JB 4ZVPB 2HBZB 2C2KB 2XYHB 1PAUB 4ZVSB 4JB8B 2H5IB 2C2ZB 1QDUB 2Y1LB 4DCJB 1RHRB 5K20B 2HBYB 1ICEB 3KJNB 3P4UB 2CNLB 3R7BB 3EDQB 1RHMB 4ZVUB
chains in the Genus database with same CATH superfamily
1R8HA 3LOUA 1S6OA 1X4BA 2KJVA 3LP1A 3M2VB 1C2PA 4DR1J 2VBXA 5JUMA 2VICA 3C6TB 3HSGA 4WYWA 5LMNJ 4C0BA 3UDVA 4F0MA 2PI4A 4PYAA 4EWTA 1FKOB 4PAAA 4ALZA 1RTIB 1PO6A 1T94A 2LQ9A 3H42A 1Y11A 3H2LA 2ZJRQ 1TU0B 2DGWA 3RAQA 1N32J 4NEYA 3MFIA 2NPFA 2Z58B 3IBFB 4GVLA 5K5MA 3P49B 2KT5A 3PX0A 2EWHA 2PSZA 3RU0A 1HI8A 2DXEA 3E01A 3CCSS 4PWDA 3KLIB 3MCMA 3GYXB 3AT1B 3MR7A 3CJKA 1DQ8A 1QAJA 2KT2A 3AJDA 3JTNA 2K06A 5KFNA 4JOUA 2MLYA 1Q8KA 2VPWB 4USWA 1WDTA 5KOXA 2BW2A 2DT9A 2EKNA 4ITSA 1KOHA 3EVOA 4FBUA 2CVEA 4KHPF 9RUBA 5KG3A 5I3PA 2VG5A 4LRCA 2HIYA 3CDUA 2J5AA 4G6VB 2ZDPA 2HQGA 3RGIA 4MTPA 5KG5A 3BB5A 5KTQA 4U7UK 5D0HA 1RKIA 4M5MA 3NMAA 2RH3A 3FEXB 3HVTB 2BE7D 5AJ3J 4DUZJ 3KJVA 2BZ2A 4UZBA 1JLQA 2DXFA 1RAIB 3EGVA 4G1IA 3FCVA 4O3PA 5F9NA 4C11A 5C5JA 4YOEA 2KI2A 3MMBA 4PPDA 5IC6B 3BQ2A 4WFAQ 3ETMA 3A8IA 1GMUA 5KFAA 4AL7A 3S1TA 2ZBQA 3J81j 2IFXA 1FI4A 3OLAA 5BYSA 3PVXA 4U9RA 5T41A 3ISND 4GKJF 1R8CA 2CPEA 4UOHA 2EFPA 2H5JB 2WW4A 3MM7B 4C0OC 4LBPA 3R5BA 2BQRA 5HMWA 3GIJA 5DZ7A 4Q7AA 3S7RA 2FVQA 2MQNA 1UWBA 4MIAA 4FPIA 2Y9HA 1T9UA 1Q7YT 4LRDA 4CRJA 1XR7A 1JLEB 3MUMP 3BSOA 1WG1A 6FD1A 1HBNA 2WVBA 3BV8A 3UVJA 5C7PA 2YWHA 4MK8A 4NLWA 2OI2A 4MK7A 3GB0A 2P6SA 2C2NA 3QRQA 1N88A 1Q16B 4I56A 4X4QA 2YKNB 3BSNA 4EYHB 1U0SA 3B54A 1HI0P 1HL6A 3BYPA 1SBRA 4UOCA 1NUEA 5H9EK 1PIEA 1TL4A 4QWBA 2B9EA 1E6YB 4R8UB 5K14A 2W7OA 1N36J 3ETOA 2OPRA 1P27B 5GAEI 2CQHA 2M70A 2B9XA 1VRTA 1PJ5A 2IA6A 1N5QA 4MKVA 2OUGA 3VAHA 2DR5A 2VQFJ 2ZJPQ 4F0HA 2YWEA 2HHHF 1LV5A 2A6OA 5KT2A 4H4KA 2CNLB 2KRRA 1ELOA 1SI9A 2V0NA 1SIWB 3RB3A 3VCDA 3BGLA 2GQ2A 2HFZA 3UWTA 1VQ7S 2OPSA 1HR0J 5DQGA 5KG2A 2OEKA 3FVYA 5E5NA 4RU2A 5LT5A 3J7YI 4NMLA 5DJBA 4C8OA 1EKSA 3PYFA 1SJRA 2ZE2A 1NPRA 3T5HA 2B7CB 1RADB 1HIYA 5D8HB 3FZ2A 4PUOA 2XSFA 3U1NA 2H9ZA 1ITPA 1HMVB 1S1TB 1UEUA 3TA1A 4AQYJ 4JI8J 1UJ6A 3IXQA 2M7SA 1S76D 3MPDA 3PO5A 1FD8A 1NJYA 4ELTA 3CMAS 3SMZA 2IM2A 2RKIB 3VZHA 2JH3A 3HCXA 1HHTP 2AHOB 3O3LA 4LSNB 3DI6B 2OTJS 2RRAA 5B0DA 1RT5A 3VALA 2RHQB 3NCPA 1YJUA 2MGZB 2HBZB 2J6TA 1GXLA 3RAMA 2X3DA 3RR8A 3I4HX 2E1RA 4W92B 3ADAC 5D6GA 4R0EA 2GCFA 4TQSA 4KGKA 4CT9A 3VAMA 2CJ9A 1M5VC 1IJFB 3C6UB 3X3UA 5J2MA 1MWZA 3NNAA 4C4WA 4PQAA 3DM2B 4OMFG 2PGCA 1FESA 3CW2C 3K5MA 2YNGA 3K7RA 4IDKB 2EKYA 2Z57B 2I5JA 4KB7A 2IJFA 2YH0A 2MKJA 1C0TA 3C14A 2VQEF 3IP0A 3LWLA 2J7UA 2QA4S 4FDFA 5IQ6A 3H5SA 2ZH3A 5F8MA 1F9EB 1OSCA 4UQTA 3MI7X 3SDEA 3D2WA 1OQ6A 3FEYB 2GIFA 2ZITA 4R5PB 4PG5A 1K47A 4ZLLA 3CVKA 4ZJOA 2J9DA 1RE1B 2HWTA 4LF8F 4P2XA 3ONQA 2I9SA 3SSSA 3CD6S 4C3LA 4DF4A 1R0CB 1YJVA 2K1RB 3ILJA 4WXWA 4FYYB 1T03A 1TKTB 5HI7A 2QLXA 5L1LA 2LCWA 4Y34A 3GU0A 1B0VA 2HVEA 3D1OA 4LR7A 3BBFA 4DXLA 2ZH9A 2DH7A 1CC7A 3UCGA 3V81A 2HS3A 1B7FA 1WSRA 1Y5NB 3HFZB 2BQ3A 3V6HA 1RHJB 2DHGA 2YQ0A 1Q53A 2DIVA 2QLBB 3BDPA 1D8YA 5LSLA 4P2SA 2KZMA 1A9NB 4X64J 1SCJB 2G1HA 2DNYA 1VFJA 4Q43A 2UUAF 4PZVA 3I56S 3FGVA 3OD2A 2ZH6A 2EC2A 3DXSX 1YSJA 2LVWA 5HN0A 3R27A 1DTQB 4PXCA 2B51A 4DV3F 1RCOB 1SC1B 5DQIA 1AFIA 4XDCA 1UCNA 4ECZA 3BJYA 1DTTA 2WONA 4KGZB 3M8ZA 4DS5A 2XBPA 5I4MA 2RDDA 2C2ZB 5DG8A 2HS4A 1UZHA 2B6AB 4TY8B 3PW7A 2ADCA 2GMHA 2YPYA 1S9GB 4O23A 4FYWB 3MPYA 1KONA 3DHWC 3HX9A 3ZXWA 5ETPA 1HWJA 1NHKL 4KY3A 5DG9A 3AD8C 3NXZA 3MR3A 2J9EA 3I9ZA 1N4LA 3HHLC 1N56A 3LP2A 1U0HA 2YX1A 3DDKA 2DXDA 1WEZA 3GCXP 2IYIA 4DV6F 1PKUA 5BR8F 4ECRA 1UETA 4KHMA 3J7ZT 2FB0A 2QV6A 1YRXA 2NYHA 2GHWA 3OL9A 3RBZA 5J2QA 1HHQA 3HFKA 4KGXB 1U24A 4X62J 2E5JA 1T8EA 4U6PA 2R7SA 2AKWB 3NKYA 1PC4A 3MPWA 2ZHOA 1VQOS 4CLZA 3JAMY 3NBPB 2C3MA 1IJEB 3CE8A 1P9YA 4PCQA 2W4DA 1VYAA 4LQ9A 4ZP9A 2WK4A 3E01B 4PWDB 1T7PA 1J5EF 3G8QA 7FD1A 2YWKA 4RL1A 4CLPA 3CJKB 5H1SV 3P5TL 2VONA 1TZ0A 3BYRA 1RT1B 2ZZMA 4MAKA 4NLPA 4YDXA 2ZC4A 2ZOFA 1TL7A 3KYLA 2MKHA 3RRGA 2JNJA 3BSCA 2DCLA 4Q44A 2ILYA 3PHEA 4LIRA 3HM9A 3L3CA 2LFVA 5FDLA 3UD3P 2VG5B 2C1EB 2PEBA 1PC5A 3IS9A 2ZUAA 3M32A 2YTCA 3G87A 3MR5A 2HHSA 1KQSR 5HAOA 2FVSA 3ZZTA 3KJVB 1O5JA 5I3QA 1RLCL 5F3TA 4K4TA 3WHIA 1QLNA 2AYMA 4C11B 5HATA 2D3O1 3MMBB 1H98A 2W9BA 3CD0A 3T3FA 2LMIA 2BV3A 2FJEB 4P7VA 2GVDA 1C1CA 3FUYA 2FYXA 2CPHA 2Y1IA 1IBLJ 1FRJA 2IRYA 2UXCJ 4M5IA 1M5PC 2NS1B 1TMMA 4F4YA 2J0WA 2JLGA 3JSMA 3I82A 3IWXA 5DO2A 3GV5B 2MJNA 2DGXA 1UWBB 4C8NA 2IIHA 3T19A 5EGYA 4NASA 2FPHX 3PEHA 4NXNJ 2DTJA 1IKWB 3PZPA 4DR4F 3IRXA 4IFYB 2DHXA 4UOGA 2XM3A 4F3OA 1HBNB 4YHHJ 4GC6A 2KFYA 4NA3A 7AT1B 2R7WA 2HGMA 4K2XA 4K0KF 2PI5A 3NAIA 2XY6A 1IXKA 1R0BG 3KLHA 2HLTA 3O8WA 2ZJQQ 4K4VA 3KK3A 2RF2A 3J7AN 1IKXA 4DF8A 5CZXA 1HFEL 3LA0A 1AFJA 3DOMA 4NLDA 1WF1A 1QAXA 1LOUA 4X84A 4LFAF 2EFOA 3EYZA 4I2PA 1EB0A 3V6DA 1M1KT 3F44A 1BD6A 3SSRA 4DL5A 4K5SA 4N8NA 2RQKA 4DSJA 3VGVA 2CQ3A 2OMOA 2V6AA 2RRBA 1XNQJ 1VQSA 3GG0A 3TA2A 1D0EA 1UW9A 3K8WA 3EX7B 2LEAA 1XMOJ 2D1CA 4NLOA 3D9BA 5A2QY 4IH7A 5KFXA 2F5GA 2UV8A 2EXUA 3Q0AA 2QA2A 3UO0A 3M05A 2ZE2B 3I0SA 1U49A 4XPEA 1Q8BA 3GWCA 4PUOB 3UDEA 5HSPA 1CULA 2GC8A 3DU5A 4PXBA 3TOQA 1JB0C 2DD8S 2FZCB 4M5KA 2WSFC 3I5AA 4CDIA 2KZZA 1U25A 4DV2F 4E8UA 1R8BA 4JI2J 2XLKA 5SUHA 4OZ2A 4A8SA 3HSZA 2E9TA 3UFCX 4MH8A 3D6MB 4B3RF 1WD6A 4GKKF 4WCEQ 4DX6A 4OX7A 3RBXA 2KHDA 3ZFVA 1RT5B 2I6WA 1M1HA 1CJKB 4L73A 1W2IA 4Y65A 1NRKA 5AE1A 2ZOGA 1SJQA 2EG2A 5L9NA 1VQ6S 1T9VA 3P8BB 2JEIA 5J2MB 3FBCA 3M9OB 1RTHB 1WHVA 2RE1A 2MQ8A 2X1GA 1S48A 2I38A 1FJGF 5H9FK 3MM9A 2C3OA 4B9TA 3MMJA 2I5JB 3MF5A 4IOBA 3RG6A 3C14B 3ZTQA 3LANA 4YB7A 3QT8A 2DGTA 1RAOA 5HP1B 2KXFA 4UF4A 1Y5IB 2PA3A 3SDEB 3KHHA 5D4OA 3W8GA 1S9EA 3US5A 3HT0A 2VPYB 1DJ0A 4NLGA 2ZUGA 2DPIA 3JAMU 2XLIA 3GYGA 3D67A 2LXFA 2DKOB 4CO4A 1S49A 3JQKA 2NLWA 3M8PA 1FCAA 4C3KA 3CCUS 4R0JA 1RU2A 4FP9A 4A47A 5AXNA 1RT2B 4F4AA 4OQJA 4JI3J 2YWFA 4ED8A 1X4FA 3UCZP 2JVRA 4P72A 4JYAJ 3V81B 3H90A 5F8NA 3K58A 2BJ8A 4NLSA 2JLEA 5KFEA 2UXDJ 5A8RB 3VVUA 2MQPA 2UUWA 1S79A 2CQ2A 2HBQB 2JC0A 2ZH4A 4PXDA 2GNKA 3QO9A 1VISA 3HMJG 2QA4G 2Z8QA 2MXYA 4G65A 2HVZA 1OWXA 2CZ9A 4Y00A 2X1AA 2UUCJ 2RU3A 3DDIA 3DLLQ 4CYUB 1N32F 1FTRA 5J2NB 4ZCIA 1DTTB 1RT7A 2RQ4A 2CFXA 4LF1A 3HSDA 1IKYB 1LFWA 1XTZA 5KT6A 4UW2A 3P96A 3G71S 1IBKJ 4RNOA 4DUTA 2CNKB 1DARA 2MKIA 3IMQJ 1X4AA 2XWXA 3NRBA 3MEKA 4ENOA 1MN7A 1XJWB 1YJNS 5IZHA 3N9UC 2XULA 1Q8LA 1UTAA 3R5CA 5K8PA 4JI6F 3AJ2A 1R31A 3OXGA 1R7IA 2UVVA 2EFVA 5L9XA 1UVLA 2ZD1B 5A8KA 2RNEA 2CZVC 3W63A 4F4KA 3OBIA 4EBEA 2DNMA 3LP2B 1ICEB 4AT1B 1TQLA 2PN6A 5EHHA 4X4UA 1NXIA 1V6HA 5THWA 3CO9A 2BE2A 4EUVA 1F0XA 4GO7X 4QYZK 1SPBP 4A8OA 4NRUA 1HNXJ 3VV2B 3MOZA 3SXLA 4TYAA 2IC3B 3DRSB 3TAQA 3DLBA 4HYKA 1X5PA 3IN5A 1MW7A 4NLQA 1ULRA 3RTVA 1U1MA 3LQVA 3PKYA 5KFOA 4OI6A 4OX9F 2X51A 4I2QA 2IDEA 2FHJA 2XS7A 3KOAA 4C8LA 4Y2CA 4EMDA 3Q89A 1LW2A 1MNEA 2RHSB 3PYGA 4ED3A 2UVWA 4ZS6A 4NLRA 4N76A 3CIMA 4KBIA 2CQDA 2V8HA 4DPTA 2WHOA 1NK0A 3E51A 2QFJA 4RPFA 2DNQA 5A2QU 3CXCR 5IT4A 1TL7B 1KOOA 4DMZA 2Z56B 4BHQA 4CLLA 3OFEA 4KGMA 3O2IA 4X66J 3OTDA 5CYMB 3L95X 2XS5A 4X4VA 2UUBF 4U8VA 3OTOF 1X9WA 4IRCA 4C0HA 4L3KA 1N5YA 5KAKA 4CO0A 4KV8A 4QJVA 2BYCA 3POTB 3KG0A 3I5BA 3M32B 4G1QA 5EDWA 1DHMA 3NGSA 3BDEA 4LR9A 4KFBB 2DR9A 2N4DA 2DHHA 2HFOA 1VC0A 3D6HB 3R8YA 5GAHI 1JX4A 4QIVA 2BJ7A 3T1HJ 1H72C 2H4WB 4M5DA 1FTCA 2EK6A 4DLGA 1RA7A 2C3YA 3VAIA 1X4HA 3OQ2A 4RW7B 3U1MA 3SCLE 3GJSB 2GVDB 4DR3J 3R97A 4DFKA 2CJQA 4WK3A 1XBWA 4EZ9A 2JHEA 2PMHA 2FVPA 4HI2A 1S1WA 2L41A 2VG6A 2YNHA 3NGTA 1RT6A 3H4DA 5T7LA 1ZM2A 4LQ3A 3E3XA 3NEKA 2AD9A 2FD2A 4ELUA 1RK8A 3IRXB 2K7JA 2MMYA 4FS1A 4N7TA 3M9MB 3Q24A 2ALYB 4Y0FA 1OS5A 2ZHBA 4ANEA 5B0CA 2BDPA 2I0XA 2H48B 3KUGA 3FKBA 4EZ6A 3ILIA 5HJYA 3ZZ0A 2ZH1A 4B02A 4LIWA 3KLHB 4J9KA 2MZSA 5GVQA 1UPPA 3Q8YA 1VCTA 3KK3B 2RF2B 1YZ6A 2R2RA 1IKXB 4OZJA 1U1PA 2BKNA 3SFUA 2CQ0A 2HRTA 1SQFA 2CJAA 2X3GA 3IO1A 2HURA 5CZVA 1W26A 5BYQA 1M5OC 3MUTP 3UE2A 1NDKA 4QWAA 1XIQA 5GMKa 3PX4A 1EQ0A 3CDAA 1I94J 4ZVSB 3CMES 4WYLA 4NI2B 1RWUA 3IM8A 3G4SS 3W9JA 1PSDA 3DRRA 4DZDA 3HD2A 3EICA 3U1LA 4K4YA 3CMQA 4IFVA 4F7VA 3K5LA 5FIIA 1A0OB 3HHLA 1QSLA 1RQ0A 4I64A 2K2PA 5MLCV 4JV2A 1J2VA 3TYTA 2HZVA 1E6VB 8RUCA 3ZZUA 3HLUA 2OSQA 2PE8A 4OI0A 3W7BA 3I0SB 3ZZZA 4M5JA 4YR3A 2MPUA 2HRYA 2ZM6J 2DY9A 1XK8A 4A8XA 2V4QA 2XMWA 1EAYC 1YVFA 2W8KA 5IXUA 2FGCA 1GMWA 1WACA 4OZLA 5DS7A 1BUXA 1X4GA 1HBMA 3BKTA 2HK3A 4IUFA 1IR2A 3LPEA 3TA0A 1S1VA 1T0TV 2CQ4A 4L76A 1CS4B 3DCAA 2XMKA 3VWSA 5KFIA 3KWMA 2WRMA 4B9VA 2V2ZA 2BKOA 3AHPA 1N52B 2CG8A 1CEZA 4AYBD 1DRZA 3ZTOA 4MT1A 1GX5A 4DX7A 2V8PA 2VJVA 2JEFA 1O8BA 3QGPA 5E2QA 5AE2A 2DRAA 1JJ4A 2F9JA 2MQQA 2JVOA 4XIUA 3CJ5A 2N7YA 2NYIA 1YG0A 2B9WA 3MM9B 2LDYA 1TTHB 4URSA 1WHXA 3H7HB 1VRQC 4C2MA 3NOCA 4FYVB 1U48A 2HHWA 4Z7CA 1U1NA 2EFGA 4JI7J 3TZZA 1AUDA 1SXLA 3EGWB 4NLUA 4M95A 2E9ZA 2GW8A 1YIJS 2E7VA 3BO4A 5CXTA 1G6BA 1PYTA 1S9EB 3K5PA 2IPOB 4XK8C 2B4PA 1UMJA 2RAQA 4ZVGA 4RWXA 4TQRA 1RHQB 3CJSA 1OQ3A 2OTLS 2KYXA 2GVZA 2HYIB 1YJ7A 2GAGC 2FGOA 1PJ7A 3QQCD 2ACYA 5EWGA 1KHVA 2B4UA 5KFKA 2NQPA 3LP0A 3M6UA 3WDOA 4JV5J 3CDEA 4USTA 1LW0B 2W9AA 3IA0A 2ASJA 1VBXA 4C97A 3CJ3A 2D3OR 3M30A 4Y6IA 1NJWA 5LSOA 3A13A 4B3OA 4CIOA 1SKRA 2UVUA 2AJ0A 1CLFA 2LDIA 2DEIA 2MKKA 1GX6A 4KR0B 2HHQA 1FJEB 1NSPA 2QSFA 1B4SA 3IWNC 5KG1A 4M5LA 3OFHA 2AF6A 1SKWA 4DV4F 1RAFB 1LWCA 3OXFA 1FRIA 3QJJA 4CH0S 2ABYA 5IT9Y 3RRHA 1RTJB 4ES1A 4F3QA 3L7PA 4ECTA 1IVZA 2WSCC 3ULHA 3CCVS 2LA4A 5E3AA 2NSCA 4W98A 3G9CA 4ED4A 1ZM3A 1RT7B 3OSNA 1XMQJ 2D74B 2DGOA 1H2VZ 3VAGA 2IRUA 1BY9A 3D0HE 4MJKA 2VDIA 4LF7J 1WDDA 5HQ8A 2I1RA 4OHWA 5F8JA 4LF5J 4HT5A 3T1YF 4DU8A 2ZVIA 5E41A 2MB0B 2R4FA 2F4VJ 1D1UA 1HPZA 3AXMA 2FQQB 4P52A 4ICLA 5KFHA 4IG0A 4ANCA 5IWAJ 3FRYA 4JI5J 5IV4A 1IM4A 5JVHQ 4FXVA 5JXSA 2GJ2A 5AXLA 2ZDOA 1XEZA 1FX4A 4ZITA 2BJ9A 2AV5A 3WX8A 2MZQA 4GVBA 2VBWA 4HL9A 2RMLA 4P2FA 3J80U 1NH8A 3P5BP 1BMQB 4YUDA 3QAEA 2QC3A 4NXMF 2LQBA 2OMLA 2KM8C 1SKSA 4J9UE 2DH9A 3I0RA 3VVTA 2IBOA 4ZCLA 2DEJA 2WW8A 3O5TB 2CAJA 3HFVA 1D8ZA 3CCTA 1EJ7L 4QWCA 1C1BA 3DLEA 3MMAA 3EVMA 3TEGA 2J9CA 4I2QB 1U1QA 2OGUA 5C25A 3MURP 2D41A 1RWKB 1P1LA 4U8YA 4WF9Q 1WF2A 4LF4J 4J9VA 1HKAA 5KFQA 4HDGA 1S9FA 2DR8A 4YQWA 3PG9A 3THTA 2HVIA 3DLJA 1TK8A 1FKPA 1RT4A 3U27A 3HXMA 4OIXA 4LR8A 4E2FB 2XYPB 2KRBA 1N34F 1N5YB 2DGVA 4O44B 4FKYA 2FHKA 1PAEX 3N5BA 5GAGU 3D3BJ 5E0OA 4ZMMA 1TVRA 4PG4A 3MD1A 1H6KX 3VQTA 5KFVA 4PWUA 6FDRA 5KFJA 4M5DB 2R8HA 3ZNUA 3GTYX 1NKCA 3CJ0A 4OFZA 1FK9B 4C8MA 5KFZA 2MKCA 1KKHA 4DX8H 3RBEA 5DGBA 1OO0B 2M52A 4Y2MA 4ZCMA 1YRTA 1S1WB 4LBIA 2OPQA 4DCPB 3TUJC 1QD1A 2GQCA 2VG6B 3TP2A 1FT8A 1RT6B 2V63A 3GSIA 3HHDA 1VHIA 5T7LB 3GV8B 2YKMB 4CCHA 1B7YB 2XI2A 4OLPA 2V9KA 2E7WA 4YR0A 2E1CA 2ZVSA 3OHAA 3CTRA 2XCAA 3CJTA 4WFNQ 3V4IB 1PYSB 3MEGA 1AZSA 1SJ1A 3A8JA 3OVAA 2EBGA 2K3KA 2XI3A 2AMCB 5B0EA 4KH1B 1P8GA 3H40A 4LRAA 1B64A 3KLFB 3KDOA 4DL0C 1AROP 3GCWP 2WVCA 1G3OA 1U6FA 3MMCA 4HEA9 3OJUA 3NCRA 1MN9A 4NZ6A 1YI2S 3RZAA 2HFNA 1H0HB 1U6ZA 3TJ8A 2WZ1A 2DK2A 4QWEA 3M6VA 2IMWP 3PCOB 1KFDA 3SEOA 3BBCA 2E5HA 4WTYA 3H5YA 4J91A 2ILZA 5DM6Q 5ADZA 3CCQS 2PFDA 3BKFA 4B3SJ 1R3NA 2Q66A 2HRUA 3KK2B 2VBYA 5A8WA 4OZ1A 3G8SA 5H9FJ 4RZRA 1O0PA 1N5SA 1HNZJ 4IYQA 1ZA2B 2BUNA 1U47A 2C28A 1NB7A 1YJTA 5IT9U 3LO3A 1UVMA 2GFFA 1RGVA 3GSDA 1HNWF 4NA1A 4B17A 4HH1A 1CSJA 4DQSA 1NHVA 5HLFA 3HVAA 3VGSA 4OI4A 3DFEA 3D1HA 2RQCA 1JLCA 2VA3A 1S1UB 4QOTA 1WOOA 2AX1A 3DKDA 3M6XA 2GHPA 3BREA 4ZDNA 4U67Q 1AW0A 4YB5A 4NWBA 1HBMB 2YNFA 2UU9J 4QR1A 2GO9A 2P9EA 4V19X 2F65A 4FVCA 1O6XA 2CPJA 5DDOC 3FK4A 2QX0A 5EX0A 5D3GB 1SIZA 4Z2XA 1S12A 5F41A 3R9LA 4HVZA 2G1DA 2AU0A 1ZBTA 2VFVA 1WOPA 3M7VA 4A8WA 3GJTB 4RNFA 3QJLA 3SCIE 2LQ8A 3CPWR 2AEMA 3S01A 3J7Z5 1R0AB 1TAQA 1FERA 4RW8A 3HJVA 4WIIA 2FHMA 3KLGB 5A6PA 3AAWB 3CF5Q 4M5NA 2NREA 2UUCF 4C9DA 5F8LA 1MLAA 1HQEA 3TNVA 4RW9A 3TAMA 4F67A 1LWFA 1JLGB 4O3OA 1HBUB 5GAEU 2FIUA 2XNQA 3DRYA 1L3TA 4OYMA 1T9XA 2QO3A 3CCWA 3MECA 1C0UB 5IM0A 4L3NA 1EETB 3D0GE 3PXGa 4N77A 2IAJA 1LK5A 3CWJA 3FJ2A 1CJUB 3GONA 4OJ3A 2Y0BB 4F26A 2JJ4D 2EI5A 4NPOA 3EDRB 4LFBF 5CYJA 1NKEA 4DCOB 3QIDA 1WHYA 4X65F 1GAOA 3PACA 3MM5A 4PG8A 2HGLA 3FNNA 3W2WA 3M30B 4DLEA 2ACMA 1V5IB 4WFBQ 4LMZA 2CQBA 3ICLA 1S6QA 4A8YA 1HWKA 4O4RA 1J5OA 4NCGA 6AT1B 2M0GB 1Q8IA 2N3LA 3CO0P 3QLHA 1U1RA 1X0PA 2XLJA 3MPVA 5HVGA 1LWCB 4QYZJ 1VLYA 1NPPA 4DUYJ 4RUAA 3M2RA 5LJ5Y 1PGZA 3M6WA 2F8HA 1DLOA 4DV5F 4ER8A 1VR6A 1K73T 1OYEA 1SL1A 2VH7A 1RWWB 1QTMA 2AEFA 4B9UA 3R5GA 1RWVB 3DRPA 4B3MJ 3TO8A 1K0VA 4ED2A 2RRNA 2XCPA 2HZCA 3IFEA 4YN3B 2E1PA 4OV6A 2E5LF 1VOMA 4JI0F 4YY3J 3QWUA 4ILRA 3O1LA 5HBMA 1S99A 1KBRA 2XMAA 4I1TA 2AP6A 2J0XA 1CJVA 3ZTRA 3DOKB 4EK2A 1JQGA 4B9NA 1QVGR 1GXTA 4UUWA 1S10A 5ETLA 1GFWB 4ZIWA 3CB4A 4ICLB 4EI2A 3TJAA 4QPXA 4CLTA 1X4DA 4CO1A 2J8AA 4IOAQ 4MYUA 1WG5A 4A8KA 1R6YA 1S4EA 1KTVA 2MQMA 3LH2S 3DHXA 1QDUB 4ZVFA 3T6JA 4GVBB 3B4MA 3H0PA 5L39A 2Z2LA 1VBKA 3D28A 2GS8A 2J6UA 2KFZA 5E7OB 2YY3A 3KLEA 5G0RB 4RJVA 3FMBA 1WC5A 2VU5A 2VOOA 2LP4A 2PO4A 1KQFB 4WIQA 3X1LB 3T5KA 2ZC3A 2ZH2A 2HFSA 1LK7A 2ROGA 3N6NA 4ZVRB 1C1BB 1S4FA 2XMTA 3DLEB 4RO0A 1U1OA 3IR5B 4OYWA 5KFWA 5KFSA 1QTNB 2B8QA 3TANA 5C25B 1YGYA 3ZZPA 3R6LB 2SXLA 1HD0A 4ZHRA 2IM1A 1L3VA 1GTHA 4KHPJ 3G82A 2HWHA 2KFNA 1F5BA 2HHPA 2OEJA 2NUUG 4PR6A 4U95A 4IRKA 3MTKA 3A3PB 1Q7LB 2VFSA 1TAUA 4HLBA 3OTEA 5J2PA 2VOPA 1PAUB 2CPYA 2ZZNA 3UN2A 2HNZB 1FKPB 1V5VA 1W7WA 3KDNA 1IQTA 5GMDA 4Q5VA 1MWYA 2A6MA 3MHYA 2ZKTA 2IVFB 5DLFA 2KL8A 4TN2A 2HG4A 3N79A 2VZ9A 4FN5A 1N33F 2GMLA 1DFDA 4CNYA 1TVRB 3CJ2A 1U09A 3PRDA 3ITHB 2CADA 5E33A 4GKJJ 2BEFA 2F8MA 4TU9A 3TI0A 2DYAA 3KG4A 3B78A 2CWKA 2KTQA 2W2QP 1ZPWX 1N5TA 2BM0A 2CJKA 3SCJE 2R7RA 4HI1A 4QIEA 4NLYA 4Y2AA 4LSLB 3LWMA 3PV8A 5E3QA 5DETA 1RKJA 3BN4A 2ERRA 2JX2A 5F8IA 2W9CB 3M8SA 5L1KA 1K44A 4WFYA 4FYDA 3EE3A 2W7AA 1IBMJ 2IVYA 3I87A 4BBYA 4B08A 2OPQB 2DY1A 2RB7A 2CDQA 4LSZB 3R6GB 1CJTA 3BBBA 2XZTB 4TVAB 2HQCA 5FLXY 4ECVA 2D69A 2CQGA 4JUZA 1BQXA 2HNYB 2RS2A 1SV5A 3SI8A 5ITHA 3EXYA 4M5HA 4RU9A 2QSWA 2POKA 1AZSB 1MROA 2C22A 2RS8A 2OFGX 4USUA 1G4CA 4DR7J 2Y0SD 1D09B 3AD9C 4LFCF 4DZ6A 4CO5A 4W90B 1S6UA 2G0IA 4KE5A 3LF0A 2OPPA 2KHCA 2LA6A 4O4GB 3NGUA 2CPIA 4KT0C 1Y4ZB 2QN6B 5LMUF 3OUYA 4WZQA 2HHHJ 3Q8RB 2DRBA 4OZ0A 4L72B 1V9OA 3PYEA 4YEAA 1OSDA 4RWWA 1JLBA 4U7CA 4MK9A 1K8AT 1PCAA 4RBTA 3AFGA 2VB6A 4OHVA 3I31A 2Z30B 3G6VA 3HVWA 2FC8A 4EU0A 3GQCA 3AQPA 2FHOB 1T9WA 4CTAA 3S8SA 2DJWA 1G1XA 1YBTA 5IS2A 5I3UB 3NL0A 3AOCA 2R8JA 1PILA 4QPTA 5KT7A 3Q83A 3GE9A 2BABA 2C2RA 2R2SA 2G0JA 3JYTB 3VR1A 2KO1A 5KFMA 4HT7A 4DBQA 3TUZC 1FNOA 3CCRS 1UA0A 2RUSA 1NBEB 2CNNB 4ZJLA 2PEHA 4WPAA 4DN9A 3Q23A 1X4EA 2CVIA 1FHTA 1GQEA 4C7QA 2DNHA 2WOMB 3E8OA 1YK9A 2FUG9 4LBHA 3OJSA 4PKDB 3OW2R 2KB2A 4YDDB 2Y1JA 2AYGA 2RDIA 4J9MA 2VASA 2YNFB 4OX6A 1TL1B 3DGPA 4WWSA 1HD1A 1SB6A 2KYZA 5ETTA 2XSJA 3ENAA 4ZVPB 2F9DA 2JSXA 2DNKA 2HMIA 3HHEA 2VQEJ 2RT3A 1ZTTA 1H2TZ 4L75A 2WBMA 3BR9A 1T05A 1P1TA 3VTIA 1R43A 2YXLA 4ETZA 3WQPA 4RW8B 3KXDA 1NU4A 5KFDA 2KN4A 3WZ0A 4NMXA 4N41A 2W01A 3ET6A 3OTCA 1KVKA 3VAJA 4LF8J 2OSRA 4DV7F 1B0PA 3NGKA 1Q81T 2UXBF 2M5YA 4PRFA 1SL2A 4HHJA 1NHUA 1XMQF 1XR6A 3Q8SB 2KH9A 1D9AA 3MECB 5IM0B 1HQUA 3EZOA 4JI1F 4LF7F 1NDPA 1L3UA 2BJEA 2CWXA 2CJXB 4HKQA 2YX4A 5ETVA 2AJ1A 4C6AA 4E0DA 1WJ9A 9ATCB 1U8WA 3ZZYA 4IOCQ 3P45B 2J7WA 3MM5B 2BACA 2APOA 2DB1A 3KFWX 4Q45A 3BGRA 4C8YA 4F3MA 2V8DA 2KXNB 3N6LA 2GIQA 2OO4A 3M4XA 2UUAJ 1URNA 3QFHA 2COLA 2OFHX 3THVA 3BZQA 4NCGB 5D4PA 3CUNA 4FXWA 1DY3A 3JQMA 3QSYB 2C2MB 4DV3J 4Y2IA 1N0UA 4CWBA 2H54B 2E44A 2P9GA 4KJIA 4ZK7M 2BX6A 5KG7A 3UNGC 3KNGA 2DR6A 2IM3A 1WUUA 1VC5A 4DV1F 3LALA 3G6ES 4CP5A 3KLIA 1NO8A 2V69A 1Y3KA 5C42A 1OPZA 3Q8QB 2RDJA 1T11A 3H5UA 3N01A 3LTOA 2Y1RI 1S0VA 3FC9A 1S6PA 4P71A 3TEHB 1N6QA 1JXEA 3DRPB 3TUPA 1URRA 1JKHB 1YJRA 1UZDA 3TX0A 2ZHAA 5KFLA 3ISNC 3S6EA 1WKLA 4IKAA 2N3OA 2W2NP 4MYTA 2C2KB 3W5XA 1WNEA 4TLQA 4DCJB 3K5NA 1LNQA 1RAJA 4QU7A 3NP5A 2YH1A 1S5ZA 5FD1A 1UP1A 1SKUB 1YTYA 1CJVB 5FLXU 2W1BA 3HVTA 3QT6A 4GO5X 5LL6d 4DV6J 4EFAC 5BR8J 2R8GA 3RW6A 1F3VA 1NJIT 1MU2A 4DR5F 2IJNA 4IR9A 3VAFA 2G2OA 1VK3A 1NK9A 3IR6B 2KJWA 5KFBA 2MLXA 2YKPA 3OT9A 3AXKA 3D5MA 4OI2A 4CLUA 1SL0A 2H5EA 3NS6A 5LSRA 5F8GA 4O3RA 4IO1A 1REGX 3KLEB 3MM8A 2GQQA 3UCUP 1W25A 1HNIB 2QL5B 4KC5A 1FE0A 5L8RC 1J5EJ 4NCAA 1ZTWA 4F02A 3CC7S 2ALZA 3CGIA 4NRTA 4V1Ak 3VGUA 2LXIA 1X5OA 2NZCA 4USMA 3ZZRA 2VA2A 2DNZA 4O3QA 3RBDA 4YB1P 1D9DA 3D3CJ 3FBBA 1VLOA 4JI4F 4ZHRB 1HI1A 2MZRA 4HACB 3G82B 3IBCB 5IFMA 4L6V3 2C3PA 4ES2A 2FLPA 3BPSP 4PWWA 3MEDA 3A12A 3DC2A 1YX2A 3HZGA 1ZZNA 4QWDA 1S7HA 2LQ5A 4H4MA 4OI3A 3AA8A 2WVDA 5DLGA 4U96A 1E6YA 2X7IA 3MR6A 3LP1B 4DFJA 1K0TA 1X7VA 3PW5A 4DN0A 3FZBA 3QZ8A 4ED7A 3DDNA 4O3NA 1GEHA 2R8IA 1K1SA 3M9NB 1JJHA 3DYAA 3RUBL 4DV0F 4WKYA 3C3LA 3W9IA 1VJQA 1RLDA 4JBCA 2G9OA 4EBDA 2VJUA 2G2YA 1FXRA 3BO2A 2D3ZA 5J1NA 2R7XA 5HVFA 1JWWA 1FA0A 1RACB 3HK2A 3JSYA 4RLEA 1A7GE 4UT4A 3M1VA 2V9WA 3O44A 3QSIA 1KQKA 1YBUA 3BGUA 2L3MA 4DR4J 2F3JA 3HDSA 2BRKA 1CVJA 4LF6F 4DPUA 2PT0A 1RHKB 1TK0A 3H2UB 2FTRA 4CO3A 1WC6A 4DWIA 5EWFA 3EGNA 4X2BA 2H4YB 4K0KJ 2RKIA 5GADU 2AT1B 4DR2F 1JXLA 4WFXA 2GV1A 2QGFB 3DI6A 3TUIC 5LM7E 1JLQB 2C2DA 4F36A 4RKUC 2MSTA 2EK1A 4P6QA 3LAMA 1RABB 4YP3A 4LFAJ 2OPPB 3K5OA 3C6UA 2OEMA 3G6XA 2AEJA 3RR7A 1HLWA 3K17A 4IQMA 3HP6A 4HDHA 4J9QA 4ED1A 1XR5A 3Q22A 3SZ2A 1Q0NA 3FSYA 2E7XA 3ZC4A 2XTJP 2QIFA 1CQNA 3WBZA 1WEXA 1F2HA 5L38A 2M2BA 1VBZA 4AXIA 4V19J 4DEZA 5KT4A 1U45A 2R7VA 1S7IA 3GPAA 2AJQA 3KMSA 1L3SA 5B0AA 4Q0BA 3R7SB 1KN6A 4CI0B 1JLFA 3UVJB 3F41A 1RWMB 1N5VA 4DV2J 2B7BB 5GAHU 3FSIA 3ENQA 3RW7A 3CDBA 1KR4A 4KPCA 5L1JA 2K1RA 4B3RJ 4GKKJ 1X0FA 2HNDA 1TKTA 2ZEJA 4LF9F 3M8YA 1RAGB 2GJIA 1MMNA 5E3RA 5LXRA 4TU8A 1RT3A 5K14B 5ETQA 1FJCA 2OPRB 2FZKB 2BJDA 3FBFA 2HAFA 1T9TA 1VRTB 2KG1A 1IKVA 4KQZA 4A4JA 1NNDA 1SJ4P 4B3TF 4CM2A 4QIWD 3UDCA 1XNRF 3DGPB 3I6PA 3AODA 4DL7A 2OD6A 3PKMA 2LYVA 2QL9B 4DFPA 1WELA 3H2VE 3NAHA 1FJGJ 1OY8A 3OL7A 2OIHA 5HMZA 1Q1KA 1TKDA 1EIYB 2HW3A 2OPSB 2HMIB 2PDAA 2JLFA 2DHSA 3QAUA 3EM1A 4J37A 3GIIA 1C4AA 3PR5B 1FXDA 4RBUA 4B9SA 5GAGI 2CXEA 4ZPDA 1ZM4A 4MKYA 1FDNA 4JV0A 2R7QA 5KT3A 3ILLA 1Z2ZA 3EUNA 4BS2A 3ET6B 1FNXH 4TY8A 3QJPA 2WTFA 3CJQA 2CPXA 1DQAA 3Q2SC 3BEGB 1HWIA 2XYHB 4TXSA 3DLKA 3TRGA 2DO0A 1CQMA 4MIBA 3PX6A 2WBRA 3PY8A 1D9FA 2CQCA 1JIHA 3OFGA 3HVRA 3PTWA 1UVKA 4ZLJA 2JEGA 1UVIA 4HR2A 2R2UA 1FFGB 2V50A 1FFWB 4RUBA 3KK1A 1FVQA 2VUGA 2IJRA 3CCJS 3R5AA 3BGRB 5DZ6A 1KQGB 2YNGB 4DR6F 3H59A 1RWOB 4WFZA 1NDCA 4I7FA 2B4VA 1C0TB 2O3DA 1ZZFA 3DN9A 5SZTA 1RWNB 3RB0A 2RILA 2OP5A 1NM2A 1LFPA 4I6YA 2HQ3A 3MCNA 2FLOA 4ZKAA 2BE9B 2QLWA 4N5SA 3NBPA 1SUQA 1Y9OA 4JV1A 4FPRA 1VMBA 2FHJD 2MLZA 4JB8B 4UY8T 1VHFA 1WG4A 3P6YC 3ISZA 1OJ4A 3P4UB 4ES3A 5C42B 2WB1D 3U7JA 2QMXA 1RT1A 5M2PA 2RD5C 2CA9A 1T03B 1S6PB 5DDQC 4RNMA 1N6QB 4JI6J 2JL9A 1HARA 4LJMA 3WIUA 4DQQA 1IWGA 4DSEA 4FKXA 4NLTA 1RXOB 3QBCA 5D0RA 1CG2A 4KHRA 2DO4A 3MAHA 1RHUB 1H7WA 2B56A 1X4CA 3QGHA 2RUGA 3G8TA 5C2CA 2GX8A 4I0WA 1MSWD 1QJHA 4CH1A 2UUTA 3EPGA 3V6JA 4DR1F 2MHNA 1YQHA 1MU2B 1QSYA 2DITA 3C19A 4B9LA 2FLNA 5LMNF 1J27A 3TWZA 2MKSA 2A2DA 5D78A 3FMWA 1Y5LB 1RAHB 3R5JB 3CJ4A 1EKRA 3L4BC 1NSAA 2LKZA 3QIPA 4LREA 2BW7A 1KLMA 3W66A 3R5DA 2J7KA 5K20B 3W9HA 5K8MA 3KJNB 2WONB 2IM0A 5T14A 1U1LA 4OX9J 4O3SA 5EX3A 3QZ7A 3KMQA 5ETOA 1N48A 1AUSL 3MM8B 3QMQA 5HQLA 3PJXA 1NSKL 1LXJA 2HVDA 2R9LA 4X4TA 4OJHA 1WC1A 2B4OA 3GLJA 1UWAA 2WCXA 1WKJA 1IBMF 1IKWA 3T5LA 4IFYA 2ZZTA 3D68A 3R3TA 2YKAA 1UVJA 4KH0B 4RW4A 1H2UX 2FDNA 1WEYA 2P6TA 3BQ0A 2UUBJ 3OTOJ 3F0NA 5J1PA 3MEDB 2HHTA 1U0HB 2VG7A 2G4BA 5AJ3F 4XDDA 4DUZF 3CSKA 4H4MB 1YZ7A 4WP9A 1KEKA 2V2KA 3CT9A 2KKHA 5KFRA 4DR7F 4HHHA 2MZTA 1F9FA 1C4CA 5J2QB 2D9OA 2CZ4A 5HMXA 2A3JA 3GIRA 2GA7A 3DYAB 2HGNA 1UL3A 2M8HA 3I32A 2J8SA 3HO1A 2Z0GA 2BVZA 4F4ZA 2Y8YA 2JWNA 1VJWA 1I3OB 2XC9A 2FY8A 2NXUA 2Y8WA 3HHLD 5IV3A 2LU2A 3N4WA 2MQOA 4ANDA 3D6FB 5KG6A 4P9SA 2WSEC 4OZ3A 1HW9A 3M1VB 4ZCKA 4BC9A 1TP7A 2E29A 4C98A 3QNWB 1NJXA 2VODA 1Q86T 4KYZA 4AE5A 3IC1A 1DQ9A 4PXEA 3ZNJ1 4ID8A 1U2CA 4ZPCA 5A76A 3PEJA 5FDLB 1SC3B 3RB4A 2XMMA 2QL7B 1RTDA 1GMWD 1R27B 4CNZA 3W62A 4QW9A 1X8DA 5JVGQ 3IS9B 5GMEA 1ZM9A 4WU3A 1RBAA 5H9EJ 1RHRB 1WWHA 1YHQS 2GAHC 1AYEA 1WI6A 4K50A 3PYDA 1N36F 2AYBA 1S72S 1KWMA 1CJKA 3B82A 3OVBA 3IWLA 1XQIA 1UJ4A 1I1GA 3GILA 4F2SA 3LGMA 1RP5A 4ZN1A 2W9BB 2H1YA 3HKWA 2UP1A 4OI1A 3RJMB 4A8MP 4IRDA 2VQFF 4OYOA 1C1CB 5EN1A 3R7NB 2W2OP 3R1HA 3THPA 1TUWA 3MCSA 1RTHA 3CC4S 2V68A 4OYAA 3AB2B 4Q2MA 1NK4A 4Y28C 4M94A 3JSMB 2E1MC 4ZP6A 1HR0F 2BRLA 2W2MP 3FSXA 2XGQA 1MG7A 3WC0A 5ETNA 3OPKA 1V3ZA 5HP1A 2E1AA 1JJCB 1Q5VA 3MPUB 4MIWA 3KTQA 2O66A 4Q0BB 1FWPA 1T3NA 4KPYA 1HW8A 2NCKL 1AA1B 1JLFB 1OY6A 4ZPWR 5KFFA 4AQYF 2U2FA 4JI8F 3DRXA 2C3UA 2ZKUA 3BSAA 3HHKA 3AQOA 2E9RX 1KC8T 2OKQA 5K9FA 3BGFA 4DSLA 4TLRA 2HNDB 4N8OA 2VC0A 1NDLA 2PD1A 1BHNA 1GXUA 2RU9A 1RT2A 1RT3B 2F8EX 1VIOA 1VQYA 2Z2ZA 1KP6A 4DG1A 3DOMB 4X4OA 2XZDB 1H3DA 4RW6A 2M9KA 1H74A 3I55S 2P5VA 2ZBPA 1IKVB 2FJBB 2HHXA 3PM9A 2Y3YA 1F9HA 4I2PB 2B3TB 5A8RA 3V6DB 1TFWA 4KIAA 2W2PP 1ZS6A 1PJ6A 3KLVA 4F0KA 4BLGA 3JS9A 5CAAA 2MYFA 4USJC 3D66A 1LQ9A 4DI6A 2HZAA 3HZEA 2PA8D 5RUBA 3GV7B 2YKQA 3N6MA 3QRRA 3W5ZA 4DDFA 1H38A 4CYUA 5J2NA 2Q1LA 3PW0A 3N5FA 2RQMA 1VS3A 2XQCA 1B3TA 1IKYA 1KLNA 1S77D 1YDLA 3VHQA 4WU2A 2LXUA 1FWLA 2XHWA 1CULB 4TY9A 4PQUA 4YS2A 1BLUA 2QT7A 1BGXT 3QT7A 2Q43A 1SH3A 3SV3A 1RDRA 1KRPA 4YMEA 4ZVQB 1NCLA 3MM6A 1VC6A 3NOGA 4K4XA 3DLKB 4NE9C 3BO3A 2MDAA 1YRUA 5HO4A 2ZD1A 3EPIA 3IGNA 4NCBA 1HYSA 2QRRA 4EBCA 5L1IA 2XGPA 4AUKA 3BM7A 5M2RA 2ZBRA 2ZOMA 1UW4A 1VQ4S 3KK1B 4ZOSA 2Q6BA 1RBLA 2IA0A 1RA6A 1Y0HA 3V2UC 1N54B 1TUGB 3JQJA 4X64F 1M90T 3AH6A 2NXNA 4DV4J 3JB9k 3ENWA 2X1FA 2VPZB 4OV1A 1ZAWA 4P73A 3KNAA 1L5UA 2ZNYA 2IC3A 1V3RA 3DRSA 4WK1A 3MAQA 4I7FB 2CRLA 3QPIA 4NA2A 4ETXA 4FZVA 3TARA 1PYOB 1TKXA 4I6WA 1B0TA 1U26A 1IUJA 4P74A 3CCES 4KGVB 1PBUA 1FVSA 2DR7A 3W64A 2XO6A 2GGPA 3L7UA 1SUQB 2M8DB 2AWZA 3HKZD 2XZWA 2PMWA 4FF2A 3MWBA 1QUVA 4J9SA 3CIZA 1N0VC 2BANA 1BE4A 3IR7B 2QE5A 4ZVOB 3T1YJ 2MSSA 3KKFA 3M8PB 5D0EA 1HNVA 4EO8A 3GFYA 1YWXA 1NSQA 1RJJA 1RCXB 3D7SB 5CYQA 2BMBA 3OR2A 5CYMA 1TELA 5LXYA 5B0FA 1LWXA 3TZWA 3C15A 3EXCX 3POTA 1QM9A 1WF0A 3A1YG 3TW0A 1DBDA 1LXNA 4KFBA 5CABA 4FYXB 4WE1A 1NZ8A 3QO9B 1U1KA 2I2YA 3V4MA 1FRHA 4NXMJ 2DNLA 5HVHA 3UI3A 1UA1A 4LVOP 1R8PA 2MZJA 4CLSA 4MKBA 3W8PA 2FJWA 3GG1A 4RW7A 1QSSA 2CNOB 4X62F 3C66A 4P75A 3FCWA 1EX8A 3QIPB 1KLMB 2DRDA 3R2CJ 2DGQA 5CH7B 1HQ2A 1B70B 3FCHA 2BXJA 1BWVA 4WP8A 2CDRB 2NR0A 4A8FA 4ERDA 4K4ZA 4C8KA 4DU7A 3KHGA 4M5GA 1FKAF 3W2VA 1UVNA 5KOWA 2A0FB 1FO1A 1A6LA 1KFSA 4KKOA 4DOZA 3O6QA 1CPZA 2C42A 1Y7PA 2WAQD 4UTGA 3C16A 3H4BA 3TQ1A 1BWEA 3AJ1A 1SH2A 3B6BA 4RW4B 3PRBA 5A8KB 3SBMA 3SCKE 1N34J 1I5OB 5JMNA 1M1GA 5A0YA 3CD5A 2DPJA 4KTQA 3NLCA 4ED6A 3NNHA 2K3IA 3CJ8A 2VG7B 4TNOA 3VQSA 2YWWA 4ECQA 2BE2B 3MEEA 2XG8A 1VDHA 2A10A 2UVRA 2R3VA 2BR0A 2Z2YB 4NYZA 4QR2A 4K7QA 3MXHP 2NZ4A 4DJBA 2JFKA 3HI9A 4HHUA 1ZETA 2VD3A 1TUVA 1IBLF 4CT8A 2ZH7A 4NI2A 3IAM9 3A8KA 2UXCF 4AL5A 3W65A 4RNHA 3A4TA 3G2XA 1H7XA 1NMEB 1REVA 3A3NB 4OJGA 1TK5A 1LW2B 3EVWA 1UPMB 4JP8A 4P10A 2UZAA 3VZIA 1VRUA 1KTQA 4P2MA 3K2YA 1E6VA 4NXNF 4F2RA 3D1QA 4G1PA 1Z4UA 2DBBA 2PMZD 2RJZA 4Y2KA 1RB0A 5C2GA 1TFYA 2AW0A 4YHHF 4GRSA 2V34A 2F7VA 2IRXA 1RTDB 1K9MT 4LUBA 4KV8B 3BH7B 3HPOA 3UDLA 1VI7A 5D4NA 4G1QB 2IDLA 2FVCA 1IM6A 2V4JA 1CS4A 1X31C 1WTBA 2NPIA 2XMVA 2DCUB 3TQEA 5D0GA 2VKRA 3F56A 2FJXA 2D3UA 1JMTA 1RU1A 1FDBA 4DX5A 3P3DA 3KJQB 1RI7A 4NEZA 3UN5A 2R8KA 1Q4RA 2MZ1A 2MEWA 2IBKA 1MWQA 4FNIA 3FRZA 1NPKA 1BQMA 3IG1A 4C48A 2KT3A 4MMOA 1FE4A 1XNQF 3AD7C 4QW8A 2O67A 2YNIA 3DLHA 1FRLA 4CH7A 2YNHB 2CQIA 3DU6A 1Q5YA 4ZP7A 3QT5A 1XMOF 4CQ1A 4N47A 2CQPA 1QE1A 3PDNA 4DSIA 2CJYB 4NLXA 2YVSA 4H4OA 2W4PA 1IWAA 3HT3A 2OAUA 3ELHA 2ZWOA 3FFIA 2K7KA 3TX8A 3E2EA 1HNWJ 2XMJA 2MKYA 2MY8A 1FRXA 3IBWA 1EP4A 5KG4A 4RUCA 1T3OA 4A46A 3CCMS 2JEJA 1XERA 1UFKA 4JI2F 3QATA 2DH8A 3HD1A 4FNHA 2VHGA 5ETMA 3H8YA 4KRWA 2V4RA 5KFYA 1UFWA 1WHWA 4QU6A 4ZIVA 1WTFA 4OYXA 2YWGA 3K0JA 1LW0A 4WKRA 4OX8A 2HFVA 2GJFA 2CYYA 3WC2A 3HHNB 3TAPA 2AJFE 2BA9A 4DG1B 2VBZA 4RW6B 2BJ1A 4NZ0A 2FY1A 3H25A 2J0QD 1S0NA 2QG9B 3I5CA 2QJ3A 4ZVUB 2IHR1 2Q6CA 4BWMA 2OLWA 1HWUA 1FEEA 3DRRB 4KAIA 2BOAA 1XC9A 2JOQA 4IFVB 3EMTA 3OFFA 4TYBA 4IO9Q 3HHLB 3I9V9 1HBOA 1M0SA 1RTJA 1OY9A 1BQNA 2F1FA 4QYRA 3U02A 2BOPA 2R42A 4FBTA 2QYCA 3HF5A 2G2ZA 2GIRA 4F50A 3MUVP 5CD4H 1F5CA 2FVRA 5HK4A 1HHSA 1KNZA 2ZFHA 4PQUB 3DGVA 3G96A 2UV8G 3NY0A 2M3DA 4DPYA 3CJRA 3CD7A 4YFUA 3WX4A 3VF0B 1JNRB 4EO6A 3NGRA 3NS5A 4MFBA 4LFBJ 3QYYA 1T9YA 2BKPA 1TV6A 2NSBA 4F25A 3MM6B 1S1VB 4X65J 2O5DA 1UEVA 2P8IA 1WKKA 1W2BR 3PO4A 2YX7A 3FQKA 4JI3F 3FQLA 3TVYA 1FJ7A 3C8YA 2N4CA 4JYAF 5EUHA 1HYSB 5KFTA 4CLFA 2LEPA 4MKAA 2GMJA 3GP9A 2UXDF 1R8AA 4WBFA 2L9WA 3NS7B 1VQ9S 1GK8A 2ZBCA 4ZPVR 4NX9A 5B09A 1GNKA 1S97A 4IR1A 5GADI 4WJBA 1OYDA 4FVMA 3RYLA 2YBVA 2JRSA 3TJ9A 4DV5J 3MGJA 2Q3PA 3Q86A 2GZOA 3RAXA 2HAIA 5DRKA 5HROA 4ILMA 1TKXB 3PFOA 3SIPB 1Q95G 1SVDA 3FDSA 4LVNP 3WIVA 2GGPB 4EYIB 2HLUA 1WSVA 4IH5A 2AX0A 4RX6A 3T1AA 1IBKF 3B4DA 4CM0A 4J9LA 2GVZB 3AY0A 1SJ3P 4WZMA 4KSEB 4EGLA 3LGNA 3LW5C 2EFQA 2E5LJ 1JLAA 2BANB 4D3HA 3LAKA 3K57A 2VDHA 2HKEA 4JI0J 3M8QA 4CZCA 3LP0B 1HNVB 2VFTA 3KUEA 5KFPA 4F4WA 2QMUB 3SYZA 2XY5A 3LUYA 2LU1A 1SQEA 5CYQB 5F8HA 4DS4A 3OR2B 4L74A 1OPIA 2AIRB 4B3OB 5CHCB 2L48A 3J7YU 1M5HA 1AT1B 1NKBA 4O44A 1K1QA 4XTTA 3C15B 1X9MA 3M2UA 1ZYQA 4YR2A 1NEEA 1NJZA 5IQQA 1M5KC 2HQFA 5IT0A 1YJWS 4E98A 4GMKA 3CCZA 4WE1B 1GTEA 2XEXA 1LWEA 3PJWA 3UN3A 3MAAA 1GMVA 1RISA 4AXJA 1KSPA 2XS2A 5FJ4A 1Y00A 5F9LA 1HNXF 1LEOA 1GH8A 4DL4A 2HBRB 1WOSA 3NG8A 4A8QA 4QR0A 4Y3CA 3ENVA 2ZWPA 2VPXB 1FK9A 5DDPC 2R7OA 2MJUA 2BM1A 3GFHA 2A2CA 1APSA 3T9ZA 2AJ2A 3R7BB 1YKWA 1RHMB 3NCQA 1X60A 2KDOA 3IM9A 3W2VB 3NWGA 4DPWA 2VF3A 2AZ1A 3CULA 2YKMA 2HFUA 4KKOB 1RBOB 3C2PA 4GC7A 3AOAA 1NB2A 1SJFA 3EZUA 1DAXA 3C16B 1HPZB 4OYPA 1U8SA 3V4IA 2XWYA 4X66F 2CUYA 4WXOA 4IG0B 5CA5A 3M8RA 4LT6A 2KVQE 4OZ5A 2XMUA 3RB6A 1U02A 3KLFA 1FRKA 4I67A 2PFFB 4DHVA 3J80Y 2QMWA 4OYIA 5A0YB 1FX2A 1N33J 3K59A 4USIA 2W7PA 3GJQB 2QLJB 3T1HF 3T41A 1NK8A 3GR0A 3MEEB 3BR8A 3OV7A 2R7UA 2QZ8A 5I42A 1VQLS 2QFIA 3I0RB 4ECUA 1KD1T 4DR3F 1RYRA 4XPCA 2JDJA 2DNNA 2E5IA 3KK2A 4X4PA 4NLVA 2DNRA 3MMAB 2D9PA 1SC4B 4ZP8A 2EFNA 4DSFA 3T6BA 2ASLA 2DHAA 1GT8A 1I51B 4HH0A 3GR1A 4CLYA 4WTOB 1REVB 1NLKL 5C24A 1G2EA 4USHA 2NXJA 1RSCA 5EWEA 3MTJA 1VRUB 4J9RA 4K2JA 3PRVA 4K8RA 3LGHA 2NXCA 1IR0A 1S0OA 1RAAB 3MR2A 5IOLA 2OHDA 1RTZA 3DOLA 3HSJA 1FFSB 1RT4B 4BDPA 4J9OA 1SQGA 1S1UA 3OLBA 1OIAA 2L9NA 3BF4A 3FEZA 2EBEA 4LFCJ 1P6TA 3D4JA 2EG1A 1LKZA 2V4JB 5U47A 4UOFA 1JK9B 5AXKA 4X4NA 3SV4A 2ASYA 2KVIA 4KO0A 5LMUJ 3SQGA 1FWKA 4QQBA 3TVZA 5D3GA 3TVKA 4O0IA 2HS0A 3KHLA 2BQUA 3J81Y 1XN9A 1BQMB 1TL3A 2VIHA 3IG1B 1I94F 3OTBA 3L9ZA 4XAKA 4IG3A 2B0GA 1BC6A 1U2RA 1R0AA 4ATNA 3B8HA 2YNIB 3KLGA 2I8EA 4K5RA 1EZZB 4URQU 1FDDA 3DLGA 1QE1B 1FD2A 3RRKA 1Y10A 1QUPA 3LPYA 4H4OB 1U7LA 5F0WA 3FFIB 4RNNA 1JLGA 1HBUA 3I4PA 1ZOTA 3MEGB 2OELA 2ZM6F 4F8RA 4UY85 1BXNA 5ETKA 4U7UD 1C0UA 1EP4B 1EETA 2B8PA 2Y1LB 1SH0A 4M8LA 1CJUA 1S1XA 2JZ5A 2OD4A 1OMSA 5B7WA 5HANA 3MMCB 2V5HG 4M63A 3EWGA 1X5SA 5B08A 4OHZA 3CNQP 3ZO7A 4DPXA 4ECXA 2W4CA 2XO7A 2VL1A 2IYGA 4YB6A 3L09A 2YQ1A 1QY7A 2EW9A 3AB4B 2A1BA 2LECA 3ILOA 3MFHA 4J9PA 3AA9A 2J0SD 2HWIA 1WC0A 3C46A 4UQGA 2B9YA 5F0UA 5A8WB 1EARA 4P7TA 1VIXA 1X5TA 2GHVC 2O01C 4Q2LA 4O0NA 2FJVA 3W61A 1NAQA 1U4BA 1NK5A 1WORA 1HBOB 3K89A 2VV5A 1NH7A 1N8RT 1BQNB 1RWXB 4BC7A 4JI7F 1Y3JA 1ZA1B 1TR0A 4OYZA 4DV7J 4PEOA 4ID5A 3NNCA 2UXBJ 2HBYB 3A8EA 1R89A 4UZCA 2L08A 5HLFB 2ZH8A 2V94A 4DL3A 1JLCB 2B5JA 4C3MA 4FS2A 2DNOA 3PW2A 4JI1J 1PG5B 4J7CA 2P2CB 3OR1A 4B9MA 5L46A 1U6BA 4MFBB 4RR5A 2NXEA 1TV6B 2XYGB 4JV5F 5CQGA 1YLXA 3DOKA 2BJ3A 2GO8A 3QGGA 4HTIA 2QLFB 4RUHA 3T5JA 2HHVA 5CCLA 1Q78A 2CPFA 1JJ2R 1UFLA 5AXMA 4X4RA 2PIIA 2FJDB 3BH6B 1U2FA 4NYPA 4ILLA 3MZIA 4ED5A 1WC4A 2ZNZA 5DQHA 1TKZA 3G86A 4PG6A 2J76E 4NOHA 4DL2A 2H5IB 2IY5B 2FJAB 3UQSA 2DVIA 4C8ZA 5G0RA 3N28A 3EJMA 4I6AA 5LJ3Y 3QGIA 4DV1J 3N0VA 2P9CA 3OXLA 4ZVEA 3QRPA 2L9DA 1HQEB 5MAOA 3NGDA 5HROB 1RUSA 1NK6A 5DG7A 4RW9B 4NL5A 3GMGA 3TAMB 1LWFB 5J1EA 4ZLPA 2H3EB 4K59A 3PIPQ 3R1LA 1VQ8S 4LF2A 2IAJB 4FF4A 2LEBA 4DQRA 3DMJA 3HULA 2O1PA 3G6YA 4H4KC 4LF5F 1IR1A 2W8LA 1JLAB 1IBCB 4QIFA 2F4FA 3M8QB 1S59A 4K4WA 4ECSA 3KG1A 2F4VF 1F1BB 4AD6A 4NZ7A 1CC8A 3GJRB 3H20A 3W2WB 4ZVTB 5B0BA 5HJXA 2HNZA 3M2VA 1MMLA 5IWAF 5M2UA 3C6TA 1XMBA 4DR5J 4JI5F 1G7CB 1UEKA 1S6QB 5HQMA 3GZ7A 2VFRA 1FKOA 1J5OB 3M2UB 1RTIA 2BBEA 3QLHB 2DGSA 3W3SA 3H98A 2F40A 2EEYA 3ITHA 2ZH5A 1D3WA 3MOJB 1LWEB 3D0IE 2HIQA 3UPFA 3MAAB 2WVFA 5AT1B 3V5RA 3Q2TC 3M2RB 2XHCA 2PC6A 4LSLA 1DLOB 3L7OA 4OZNA 5AE3A 4A48A 2QA1A 2CPZA 2HEKA 2C2OB 2W9CA 3BQ1A 2Q79A 1VGYA 4USKA 1ROFA 1AXQA 3PNIA 2YQ3A 3J81U 3JSRA 2QEXS 1VBYA 4Z7YA 4HTJA 1PBAA 3TZXA 1VQNS 3BGOP 2XY7A 3OSPA 4JI4J 5KG0A 4ECYA 4LF4F 2Z2MA 1MMDA 3VAKA 1Z2LA 4FXDA 5HBMB 3D54A 2HNYA 3W1YC 4IQXA 1HA1A 1T02A 2E5GA 4K4UA 1QAIA 5HMYA 2F63A 3QFWA 4OLOA 2ATLA 2VFUA 2YPZA 2MTLA 2AGQA 4EEYA 2AQ4A 4I68A 3UR0A 3PJ9A 4ZPTR 4TKTA 1YJ9S 3IAS9 3JSBA 3UD5A 4ZJQA 3GIMA 2ROEA 4O4GA 4DV0J 2CKWA 2XNRA 2H51B 1KHWA 2CJBA 4PPZA 4F4XA 4D3GA 3MM7A 2EC0A 4DQPA 3ZTPA 2VKZG 4DSKA 5I42B 1S57A 3JTOA 1L3KA 1ZPVA 4J9NA 2OH2A 5BXIA 2JC1A 4I69A 2A18A 4RBVA 1TL5A 3SQOP 1VQMS 4H54A 2X1BA 4DQIA 1JLEA 3W60A 5JJBA 5B0GA 5I3UA 1RAEB 5C24B 3KHRA 4LF6J 5ETSA 3VGTA 2D7SA 3CDWA 4LRFA 3SSQA 1UJ5A 4FF3A 1FDAA 3JYTA 4USVA 2YKNA 4UUXA 2AGOA 2IMOA 2ASDA 3HJFA 2ATCB 3KUHA 3V6KA 1VQPS 3UNYA 4DR2J 2C2EA 3DOLB 5J2PB 2HQIA 2K8GA 3OVSA 4R8UA 1F2GA 1YITS 1KVIA 3AOBA 2WOMA 1DURA 8ATCB 3DNCA 4ZPBA 4XO0A 1ACMB 1QVFR 1VQKS 2QYGA 3T9NA 2FC9A 4ZA1A 1TL1A 1F5AA 1KS2A 5KT5A 1F3FA 3KJFB 1QAYA 5KFGA 3D6TB 2AZ3A 4KO0B 1IQZA 2HHUA 1ZH5A 1FXLA 4Q8EA 3SQGB 3MCOA 4AFFA 1ZAXA 3JXOA 1FNMA 2EPIA 2DNPA 1NZAA 2ZBIA 3ZZOA 3QWPA 2AJ4A 2MQLA 2MY7A 4DFMA 2E66A 3EZ5A 4B3SF 2NUHA 4Q8FA 1TL3B 4LRBA 1F6TA 1IN0A 4ELVA 2FLLA 4QZVB 4ED0A 4IG3B 1KDNA 2RSQA 1I6JA 2V8VA 1CJTB 3A3OB 1HNZF 4URGA 1HMVA 1O51A 1S1TA 4QIGA 3MD3A 4J5OA 3UD4P 1X9SA 3OL6A 1RYSA 3CCLS 4N56A 4PYDA 1T95A 4CO2A 1WI8A 3PIOQ 3DLGB 4BWJA 3JTPA 4AL6A 4F04B 5E3PA 4K4SA 1JNZB 1H73A 3BPDA 5F3ZA 1SV5B 2Z4PA 1F60B 3CEDA 2V8GA 3MDFA 4LSNA 3W5YA 2QTWA 4LF9J 4OHYA 1MROB 5BJRA 2MGZA 1VK8A 2DNGA 2RIJA 3TZYA 1S1XB 2FZGB 3PFEA 1XWLA 3ZTSA 1V3SA 4X4SA 2UU9F 3NMRA 1YBAA 2HPUA 2ROPA 1Z1ZA 3PR4A 1EQMA 1UAWA 4B3TJ 4DL6A 3BN7A 1XNRJ 2J6SA 4ZVHA 5CD4A 2OJ3A 1FF2A 3OUYB 3GIKA 3DM2A 1P9QC 5CCMA 3Q8PB 4ZPAA 2DISA 4IDKA 1CBKA 4ZN3A 2RVJA 4IH6A 2N82B 4ZLNA 4QCLA 1ZAVA 3GYNA 1JLBB 5D15A 1Q79A 2CPDA 3J7A1 1B99A 2KG0A 2DIUA 5K8NA 4Z37A 5K8OA 3I96A 5DM7Q 4CTAB 4CLKA 1DZ5A 2LQJA 2CQ1A 5KFCA 3FBEA 2HQDA 2JFDA 2KXHA 2V2VA 2W24A 5D77A 4R5PA 2DGUA 3PHTA 3H5XA 5IC4B 3BKUA 2HVHA 3K8VA 2CG4A 4S0MA 1RWPB 2WVEA 3Q8VA 4OL8A 4ID5B 2M88A 3UR3C 2WB4A 4G3IA 5DGAA 4BCAA 2KM8B 4PG7A 3EGZA 3TR5A 4PABA 4OHXA 4DPOA 1JKHA 4TU7A 2N7CA 2G13A 2B5JB 4R25A 5BYRA 2J9DE 5E3CA 5DDRC 1JXVA 4W4MA 1WC3A 2KU7A 4FF1A 4OYBA 1TMJA 3UW1A 5HL7Q 1S0MA 3OR1B 2IVMA 2W25A 3BS9A 2R7TA 4CLWA 3GFZA 3SFGA 5KFUA 2EVZA 1R6VA 4I4BA 2AGPA 1FEHA 2G0CA 2XSJB 4QBUA 3GFXA 5ETRA 4DR6J 2H65B 1AB8A 7FDRA 2V67A 2B43A 2VC1A 2AYEA 1DTQA 3IGVA 3CC2S 2XB2D 4ECWA 3PW4A 1T05B 1FRMA 5G4DA 2MHEA 1TKZB 2CIMA 1RZMA 1HWLA 3Q8UA 2HSEB 1UKUA 4DUYF 3M8WA 2LLZA 2V2QA 1HNIA 3OL8A 3DXBA 2U1AA 3NWRA 2ADBA 2B6AA 5D4LA 3R2DJ 1EHWA 3IRWP 1NK7A 2M4MA 2YKOA 1SC6A 1M5SA 5J1EB 1S9GA 4B3MF 1KVJA 5LOQA 4OJ1A 4J90A 2R2TA 1VQ5S 3F73A 1HQUB 1Q82T 3DMJB 5A6WA 2HK2A 4HACA 4NYOA 4YY3F 3OHBA 8AT1B 4WP3A 4M1KA 3EDQB
chains in the Genus database with same CATH topology
2H65B 1RWKB 3IBCB 3D6MB 1PYOB 2CJYB 2Y0BB 2FQQB 2QL9B 1SC4B 1RWWB 4DCPB 2C2MB 1RHJB 2P2CB 2CNNB 5IC4B 1RHKB 3EDRB 1RWVB 1I51B 2H54B 3RJMB 2C2OB 2H51B 1I3OB 3D6HB 2QLBB 3NS7B 4DCOB 2XYGB 2CNOB 2DKOB 2H48B 1RWPB 4ZVQB 2H4WB 2XZDB 3R7NB 2H4YB 4ZVRB 3R7SB 3D6FB 2QLFB 1RHUB 2XYPB 5IC6B 1IBCB 3GJTB 3KJFB 2CNKB 1RWOB 2CDRB 1RWMB 1QTNB 3QNWB 1F9EB 3IBFB 4ZVOB 3GJSB 3R6LB 1BMQB 2C1EB 3GJRB 3KJQB 4ZVTB 1RWNB 1GFWB 2QL5B 1RHQB 1SC1B 2CJXB 2HBRB 3GJQB 4LSZB 3SIPB 1RE1B 3R6GB 2XZTB 1SC3B 2H5JB 2QLJB 2HBQB 2QL7B 1RWXB 1NMEB 3P45B 3R5JB 4ZVPB 2HBZB 2C2KB 2XYHB 1PAUB 4ZVSB 4JB8B 2H5IB 2C2ZB 1QDUB 2Y1LB 4DCJB 1RHRB 5K20B 2HBYB 1ICEB 3KJNB 3P4UB 2CNLB 3R7BB 3EDQB 1RHMB 4ZVUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H65 B;  1RWK B;  3IBC B;  3D6M B;  1PYO B;  2CJY B;  2Y0B B;  2FQQ B;  2QL9 B;  1SC4 B;  1RWW B;  4DCP B;  2C2M B;  1RHJ B;  2P2C B;  2CNN B;  5IC4 B;  1RHK B;  3EDR B;  1RWV B;  1I51 B;  2H54 B;  3RJM B;  2C2O B;  2H51 B;  1I3O B;  3D6H B;  2QLB B;  3NS7 B;  4DCO B;  2XYG B;  2CNO B;  2DKO B;  2H48 B;  1RWP B;  4ZVQ B;  2H4W B;  2XZD B;  3R7N B;  2H4Y B;  4ZVR B;  3R7S B;  3D6F B;  2QLF B;  1RHU B;  2XYP B;  5IC6 B;  1IBC B;  3GJT B;  3KJF B;  2CNK B;  1RWO B;  2CDR B;  1RWM B;  1QTN B;  3QNW B;  1F9E B;  3IBF B;  4ZVO B;  3GJS B;  3R6L B;  1BMQ B;  2C1E B;  3GJR B;  3KJQ B;  4ZVT B;  1RWN B;  1GFW B;  2QL5 B;  1RHQ B;  1SC1 B;  2CJX B;  2HBR B;  3GJQ B;  4LSZ B;  3SIP B;  1RE1 B;  3R6G B;  2XZT B;  1SC3 B;  2H5J B;  2QLJ B;  2HBQ B;  2QL7 B;  1RWX B;  1NME B;  3P45 B;  3R5J B;  4ZVP B;  2HBZ B;  2C2K B;  2XYH B;  1PAU B;  4ZVS B;  4JB8 B;  2H5I B;  2C2Z B;  1QDU B;  2Y1L B;  4DCJ B;  1RHR B;  5K20 B;  2HBY B;  1ICE B;  3KJN B;  3P4U B;  2CNL B;  3R7B B;  3EDQ B;  1RHM B;  4ZVU B; 
#chains in the Genus database with same CATH topology
 1R8H A;  3LOU A;  1S6O A;  1X4B A;  2KJV A;  3LP1 A;  3M2V B;  1C2P A;  4DR1 J;  2VBX A;  5JUM A;  2VIC A;  3C6T B;  3HSG A;  4WYW A;  5LMN J;  4C0B A;  3UDV A;  4F0M A;  2PI4 A;  4PYA A;  4EWT A;  1FKO B;  4PAA A;  4ALZ A;  1RTI B;  1PO6 A;  1T94 A;  2LQ9 A;  3H42 A;  1Y11 A;  3H2L A;  2ZJR Q;  1TU0 B;  2DGW A;  3RAQ A;  1N32 J;  4NEY A;  3MFI A;  2NPF A;  2Z58 B;  3IBF B;  4GVL A;  5K5M A;  3P49 B;  2KT5 A;  3PX0 A;  2EWH A;  2PSZ A;  3RU0 A;  1HI8 A;  2DXE A;  3E01 A;  3CCS S;  4PWD A;  3KLI B;  3MCM A;  3GYX B;  3AT1 B;  3MR7 A;  3CJK A;  1DQ8 A;  1QAJ A;  2KT2 A;  3AJD A;  3JTN A;  2K06 A;  5KFN A;  4JOU A;  2MLY A;  1Q8K A;  2VPW B;  4USW A;  1WDT A;  5KOX A;  2BW2 A;  2DT9 A;  2EKN A;  4ITS A;  1KOH A;  3EVO A;  4FBU A;  2CVE A;  4KHP F;  9RUB A;  5KG3 A;  5I3P A;  2VG5 A;  4LRC A;  2HIY A;  3CDU A;  2J5A A;  4G6V B;  2ZDP A;  2HQG A;  3RGI A;  4MTP A;  5KG5 A;  3BB5 A;  5KTQ A;  4U7U K;  5D0H A;  1RKI A;  4M5M A;  3NMA A;  2RH3 A;  3FEX B;  3HVT B;  2BE7 D;  5AJ3 J;  4DUZ J;  3KJV A;  2BZ2 A;  4UZB A;  1JLQ A;  2DXF A;  1RAI B;  3EGV A;  4G1I A;  3FCV A;  4O3P A;  5F9N A;  4C11 A;  5C5J A;  4YOE A;  2KI2 A;  3MMB A;  4PPD A;  5IC6 B;  3BQ2 A;  4WFA Q;  3ETM A;  3A8I A;  1GMU A;  5KFA A;  4AL7 A;  3S1T A;  2ZBQ A;  3J81 j;  2IFX A;  1FI4 A;  3OLA A;  5BYS A;  3PVX A;  4U9R A;  5T41 A;  3ISN D;  4GKJ F;  1R8C A;  2CPE A;  4UOH A;  2EFP A;  2H5J B;  2WW4 A;  3MM7 B;  4C0O C;  4LBP A;  3R5B A;  2BQR A;  5HMW A;  3GIJ A;  5DZ7 A;  4Q7A A;  3S7R A;  2FVQ A;  2MQN A;  1UWB A;  4MIA A;  4FPI A;  2Y9H A;  1T9U A;  1Q7Y T;  4LRD A;  4CRJ A;  1XR7 A;  1JLE B;  3MUM P;  3BSO A;  1WG1 A;  6FD1 A;  1HBN A;  2WVB A;  3BV8 A;  3UVJ A;  5C7P A;  2YWH A;  4MK8 A;  4NLW A;  2OI2 A;  4MK7 A;  3GB0 A;  2P6S A;  2C2N A;  3QRQ A;  1N88 A;  1Q16 B;  4I56 A;  4X4Q A;  2YKN B;  3BSN A;  4EYH B;  1U0S A;  3B54 A;  1HI0 P;  1HL6 A;  3BYP A;  1SBR A;  4UOC A;  1NUE A;  5H9E K;  1PIE A;  1TL4 A;  4QWB A;  2B9E A;  1E6Y B;  4R8U B;  5K14 A;  2W7O A;  1N36 J;  3ETO A;  2OPR A;  1P27 B;  5GAE I;  2CQH A;  2M70 A;  2B9X A;  1VRT A;  1PJ5 A;  2IA6 A;  1N5Q A;  4MKV A;  2OUG A;  3VAH A;  2DR5 A;  2VQF J;  2ZJP Q;  4F0H A;  2YWE A;  2HHH F;  1LV5 A;  2A6O A;  5KT2 A;  4H4K A;  2CNL B;  2KRR A;  1ELO A;  1SI9 A;  2V0N A;  1SIW B;  3RB3 A;  3VCD A;  3BGL A;  2GQ2 A;  2HFZ A;  3UWT A;  1VQ7 S;  2OPS A;  1HR0 J;  5DQG A;  5KG2 A;  2OEK A;  3FVY A;  5E5N A;  4RU2 A;  5LT5 A;  3J7Y I;  4NML A;  5DJB A;  4C8O A;  1EKS A;  3PYF A;  1SJR A;  2ZE2 A;  1NPR A;  3T5H A;  2B7C B;  1RAD B;  1HIY A;  5D8H B;  3FZ2 A;  4PUO A;  2XSF A;  3U1N A;  2H9Z A;  1ITP A;  1HMV B;  1S1T B;  1UEU A;  3TA1 A;  4AQY J;  4JI8 J;  1UJ6 A;  3IXQ A;  2M7S A;  1S76 D;  3MPD A;  3PO5 A;  1FD8 A;  1NJY A;  4ELT A;  3CMA S;  3SMZ A;  2IM2 A;  2RKI B;  3VZH A;  2JH3 A;  3HCX A;  1HHT P;  2AHO B;  3O3L A;  4LSN B;  3DI6 B;  2OTJ S;  2RRA A;  5B0D A;  1RT5 A;  3VAL A;  2RHQ B;  3NCP A;  1YJU A;  2MGZ B;  2HBZ B;  2J6T A;  1GXL A;  3RAM A;  2X3D A;  3RR8 A;  3I4H X;  2E1R A;  4W92 B;  3ADA C;  5D6G A;  4R0E A;  2GCF A;  4TQS A;  4KGK A;  4CT9 A;  3VAM A;  2CJ9 A;  1M5V C;  1IJF B;  3C6U B;  3X3U A;  5J2M A;  1MWZ A;  3NNA A;  4C4W A;  4PQA A;  3DM2 B;  4OMF G;  2PGC A;  1FES A;  3CW2 C;  3K5M A;  2YNG A;  3K7R A;  4IDK B;  2EKY A;  2Z57 B;  2I5J A;  4KB7 A;  2IJF A;  2YH0 A;  2MKJ A;  1C0T A;  3C14 A;  2VQE F;  3IP0 A;  3LWL A;  2J7U A;  2QA4 S;  4FDF A;  5IQ6 A;  3H5S A;  2ZH3 A;  5F8M A;  1F9E B;  1OSC A;  4UQT A;  3MI7 X;  3SDE A;  3D2W A;  1OQ6 A;  3FEY B;  2GIF A;  2ZIT A;  4R5P B;  4PG5 A;  1K47 A;  4ZLL A;  3CVK A;  4ZJO A;  2J9D A;  1RE1 B;  2HWT A;  4LF8 F;  4P2X A;  3ONQ A;  2I9S A;  3SSS A;  3CD6 S;  4C3L A;  4DF4 A;  1R0C B;  1YJV A;  2K1R B;  3ILJ A;  4WXW A;  4FYY B;  1T03 A;  1TKT B;  5HI7 A;  2QLX A;  5L1L A;  2LCW A;  4Y34 A;  3GU0 A;  1B0V A;  2HVE A;  3D1O A;  4LR7 A;  3BBF A;  4DXL A;  2ZH9 A;  2DH7 A;  1CC7 A;  3UCG A;  3V81 A;  2HS3 A;  1B7F A;  1WSR A;  1Y5N B;  3HFZ B;  2BQ3 A;  3V6H A;  1RHJ B;  2DHG A;  2YQ0 A;  1Q53 A;  2DIV A;  2QLB B;  3BDP A;  1D8Y A;  5LSL A;  4P2S A;  2KZM A;  1A9N B;  4X64 J;  1SCJ B;  2G1H A;  2DNY A;  1VFJ A;  4Q43 A;  2UUA F;  4PZV A;  3I56 S;  3FGV A;  3OD2 A;  2ZH6 A;  2EC2 A;  3DXS X;  1YSJ A;  2LVW A;  5HN0 A;  3R27 A;  1DTQ B;  4PXC A;  2B51 A;  4DV3 F;  1RCO B;  1SC1 B;  5DQI A;  1AFI A;  4XDC A;  1UCN A;  4ECZ A;  3BJY A;  1DTT A;  2WON A;  4KGZ B;  3M8Z A;  4DS5 A;  2XBP A;  5I4M A;  2RDD A;  2C2Z B;  5DG8 A;  2HS4 A;  1UZH A;  2B6A B;  4TY8 B;  3PW7 A;  2ADC A;  2GMH A;  2YPY A;  1S9G B;  4O23 A;  4FYW B;  3MPY A;  1KON A;  3DHW C;  3HX9 A;  3ZXW A;  5ETP A;  1HWJ A;  1NHK L;  4KY3 A;  5DG9 A;  3AD8 C;  3NXZ A;  3MR3 A;  2J9E A;  3I9Z A;  1N4L A;  3HHL C;  1N56 A;  3LP2 A;  1U0H A;  2YX1 A;  3DDK A;  2DXD A;  1WEZ A;  3GCX P;  2IYI A;  4DV6 F;  1PKU A;  5BR8 F;  4ECR A;  1UET A;  4KHM A;  3J7Z T;  2FB0 A;  2QV6 A;  1YRX A;  2NYH A;  2GHW A;  3OL9 A;  3RBZ A;  5J2Q A;  1HHQ A;  3HFK A;  4KGX B;  1U24 A;  4X62 J;  2E5J A;  1T8E A;  4U6P A;  2R7S A;  2AKW B;  3NKY A;  1PC4 A;  3MPW A;  2ZHO A;  1VQO S;  4CLZ A;  3JAM Y;  3NBP B;  2C3M A;  1IJE B;  3CE8 A;  1P9Y A;  4PCQ A;  2W4D A;  1VYA A;  4LQ9 A;  4ZP9 A;  2WK4 A;  3E01 B;  4PWD B;  1T7P A;  1J5E F;  3G8Q A;  7FD1 A;  2YWK A;  4RL1 A;  4CLP A;  3CJK B;  5H1S V;  3P5T L;  2VON A;  1TZ0 A;  3BYR A;  1RT1 B;  2ZZM A;  4MAK A;  4NLP A;  4YDX A;  2ZC4 A;  2ZOF A;  1TL7 A;  3KYL A;  2MKH A;  3RRG A;  2JNJ A;  3BSC A;  2DCL A;  4Q44 A;  2ILY A;  3PHE A;  4LIR A;  3HM9 A;  3L3C A;  2LFV A;  5FDL A;  3UD3 P;  2VG5 B;  2C1E B;  2PEB A;  1PC5 A;  3IS9 A;  2ZUA A;  3M32 A;  2YTC A;  3G87 A;  3MR5 A;  2HHS A;  1KQS R;  5HAO A;  2FVS A;  3ZZT A;  3KJV B;  1O5J A;  5I3Q A;  1RLC L;  5F3T A;  4K4T A;  3WHI A;  1QLN A;  2AYM A;  4C11 B;  5HAT A;  2D3O 1;  3MMB B;  1H98 A;  2W9B A;  3CD0 A;  3T3F A;  2LMI A;  2BV3 A;  2FJE B;  4P7V A;  2GVD A;  1C1C A;  3FUY A;  2FYX A;  2CPH A;  2Y1I A;  1IBL J;  1FRJ A;  2IRY A;  2UXC J;  4M5I A;  1M5P C;  2NS1 B;  1TMM A;  4F4Y A;  2J0W A;  2JLG A;  3JSM A;  3I82 A;  3IWX A;  5DO2 A;  3GV5 B;  2MJN A;  2DGX A;  1UWB B;  4C8N A;  2IIH A;  3T19 A;  5EGY A;  4NAS A;  2FPH X;  3PEH A;  4NXN J;  2DTJ A;  1IKW B;  3PZP A;  4DR4 F;  3IRX A;  4IFY B;  2DHX A;  4UOG A;  2XM3 A;  4F3O A;  1HBN B;  4YHH J;  4GC6 A;  2KFY A;  4NA3 A;  7AT1 B;  2R7W A;  2HGM A;  4K2X A;  4K0K F;  2PI5 A;  3NAI A;  2XY6 A;  1IXK A;  1R0B G;  3KLH A;  2HLT A;  3O8W A;  2ZJQ Q;  4K4V A;  3KK3 A;  2RF2 A;  3J7A N;  1IKX A;  4DF8 A;  5CZX A;  1HFE L;  3LA0 A;  1AFJ A;  3DOM A;  4NLD A;  1WF1 A;  1QAX A;  1LOU A;  4X84 A;  4LFA F;  2EFO A;  3EYZ A;  4I2P A;  1EB0 A;  3V6D A;  1M1K T;  3F44 A;  1BD6 A;  3SSR A;  4DL5 A;  4K5S A;  4N8N A;  2RQK A;  4DSJ A;  3VGV A;  2CQ3 A;  2OMO A;  2V6A A;  2RRB A;  1XNQ J;  1VQS A;  3GG0 A;  3TA2 A;  1D0E A;  1UW9 A;  3K8W A;  3EX7 B;  2LEA A;  1XMO J;  2D1C A;  4NLO A;  3D9B A;  5A2Q Y;  4IH7 A;  5KFX A;  2F5G A;  2UV8 A;  2EXU A;  3Q0A A;  2QA2 A;  3UO0 A;  3M05 A;  2ZE2 B;  3I0S A;  1U49 A;  4XPE A;  1Q8B A;  3GWC A;  4PUO B;  3UDE A;  5HSP A;  1CUL A;  2GC8 A;  3DU5 A;  4PXB A;  3TOQ A;  1JB0 C;  2DD8 S;  2FZC B;  4M5K A;  2WSF C;  3I5A A;  4CDI A;  2KZZ A;  1U25 A;  4DV2 F;  4E8U A;  1R8B A;  4JI2 J;  2XLK A;  5SUH A;  4OZ2 A;  4A8S A;  3HSZ A;  2E9T A;  3UFC X;  4MH8 A;  3D6M B;  4B3R F;  1WD6 A;  4GKK F;  4WCE Q;  4DX6 A;  4OX7 A;  3RBX A;  2KHD A;  3ZFV A;  1RT5 B;  2I6W A;  1M1H A;  1CJK B;  4L73 A;  1W2I A;  4Y65 A;  1NRK A;  5AE1 A;  2ZOG A;  1SJQ A;  2EG2 A;  5L9N A;  1VQ6 S;  1T9V A;  3P8B B;  2JEI A;  5J2M B;  3FBC A;  3M9O B;  1RTH B;  1WHV A;  2RE1 A;  2MQ8 A;  2X1G A;  1S48 A;  2I38 A;  1FJG F;  5H9F K;  3MM9 A;  2C3O A;  4B9T A;  3MMJ A;  2I5J B;  3MF5 A;  4IOB A;  3RG6 A;  3C14 B;  3ZTQ A;  3LAN A;  4YB7 A;  3QT8 A;  2DGT A;  1RAO A;  5HP1 B;  2KXF A;  4UF4 A;  1Y5I B;  2PA3 A;  3SDE B;  3KHH A;  5D4O A;  3W8G A;  1S9E A;  3US5 A;  3HT0 A;  2VPY B;  1DJ0 A;  4NLG A;  2ZUG A;  2DPI A;  3JAM U;  2XLI A;  3GYG A;  3D67 A;  2LXF A;  2DKO B;  4CO4 A;  1S49 A;  3JQK A;  2NLW A;  3M8P A;  1FCA A;  4C3K A;  3CCU S;  4R0J A;  1RU2 A;  4FP9 A;  4A47 A;  5AXN A;  1RT2 B;  4F4A A;  4OQJ A;  4JI3 J;  2YWF A;  4ED8 A;  1X4F A;  3UCZ P;  2JVR A;  4P72 A;  4JYA J;  3V81 B;  3H90 A;  5F8N A;  3K58 A;  2BJ8 A;  4NLS A;  2JLE A;  5KFE A;  2UXD J;  5A8R B;  3VVU A;  2MQP A;  2UUW A;  1S79 A;  2CQ2 A;  2HBQ B;  2JC0 A;  2ZH4 A;  4PXD A;  2GNK A;  3QO9 A;  1VIS A;  3HMJ G;  2QA4 G;  2Z8Q A;  2MXY A;  4G65 A;  2HVZ A;  1OWX A;  2CZ9 A;  4Y00 A;  2X1A A;  2UUC J;  2RU3 A;  3DDI A;  3DLL Q;  4CYU B;  1N32 F;  1FTR A;  5J2N B;  4ZCI A;  1DTT B;  1RT7 A;  2RQ4 A;  2CFX A;  4LF1 A;  3HSD A;  1IKY B;  1LFW A;  1XTZ A;  5KT6 A;  4UW2 A;  3P96 A;  3G71 S;  1IBK J;  4RNO A;  4DUT A;  2CNK B;  1DAR A;  2MKI A;  3IMQ J;  1X4A A;  2XWX A;  3NRB A;  3MEK A;  4ENO A;  1MN7 A;  1XJW B;  1YJN S;  5IZH A;  3N9U C;  2XUL A;  1Q8L A;  1UTA A;  3R5C A;  5K8P A;  4JI6 F;  3AJ2 A;  1R31 A;  3OXG A;  1R7I A;  2UVV A;  2EFV A;  5L9X A;  1UVL A;  2ZD1 B;  5A8K A;  2RNE A;  2CZV C;  3W63 A;  4F4K A;  3OBI A;  4EBE A;  2DNM A;  3LP2 B;  1ICE B;  4AT1 B;  1TQL A;  2PN6 A;  5EHH A;  4X4U A;  1NXI A;  1V6H A;  5THW A;  3CO9 A;  2BE2 A;  4EUV A;  1F0X A;  4GO7 X;  4QYZ K;  1SPB P;  4A8O A;  4NRU A;  1HNX J;  3VV2 B;  3MOZ A;  3SXL A;  4TYA A;  2IC3 B;  3DRS B;  3TAQ A;  3DLB A;  4HYK A;  1X5P A;  3IN5 A;  1MW7 A;  4NLQ A;  1ULR A;  3RTV A;  1U1M A;  3LQV A;  3PKY A;  5KFO A;  4OI6 A;  4OX9 F;  2X51 A;  4I2Q A;  2IDE A;  2FHJ A;  2XS7 A;  3KOA A;  4C8L A;  4Y2C A;  4EMD A;  3Q89 A;  1LW2 A;  1MNE A;  2RHS B;  3PYG A;  4ED3 A;  2UVW A;  4ZS6 A;  4NLR A;  4N76 A;  3CIM A;  4KBI A;  2CQD A;  2V8H A;  4DPT A;  2WHO A;  1NK0 A;  3E51 A;  2QFJ A;  4RPF A;  2DNQ A;  5A2Q U;  3CXC R;  5IT4 A;  1TL7 B;  1KOO A;  4DMZ A;  2Z56 B;  4BHQ A;  4CLL A;  3OFE A;  4KGM A;  3O2I A;  4X66 J;  3OTD A;  5CYM B;  3L95 X;  2XS5 A;  4X4V A;  2UUB F;  4U8V A;  3OTO F;  1X9W A;  4IRC A;  4C0H A;  4L3K A;  1N5Y A;  5KAK A;  4CO0 A;  4KV8 A;  4QJV A;  2BYC A;  3POT B;  3KG0 A;  3I5B A;  3M32 B;  4G1Q A;  5EDW A;  1DHM A;  3NGS A;  3BDE A;  4LR9 A;  4KFB B;  2DR9 A;  2N4D A;  2DHH A;  2HFO A;  1VC0 A;  3D6H B;  3R8Y A;  5GAH I;  1JX4 A;  4QIV A;  2BJ7 A;  3T1H J;  1H72 C;  2H4W B;  4M5D A;  1FTC A;  2EK6 A;  4DLG A;  1RA7 A;  2C3Y A;  3VAI A;  1X4H A;  3OQ2 A;  4RW7 B;  3U1M A;  3SCL E;  3GJS B;  2GVD B;  4DR3 J;  3R97 A;  4DFK A;  2CJQ A;  4WK3 A;  1XBW A;  4EZ9 A;  2JHE A;  2PMH A;  2FVP A;  4HI2 A;  1S1W A;  2L41 A;  2VG6 A;  2YNH A;  3NGT A;  1RT6 A;  3H4D A;  5T7L A;  1ZM2 A;  4LQ3 A;  3E3X A;  3NEK A;  2AD9 A;  2FD2 A;  4ELU A;  1RK8 A;  3IRX B;  2K7J A;  2MMY A;  4FS1 A;  4N7T A;  3M9M B;  3Q24 A;  2ALY B;  4Y0F A;  1OS5 A;  2ZHB A;  4ANE A;  5B0C A;  2BDP A;  2I0X A;  2H48 B;  3KUG A;  3FKB A;  4EZ6 A;  3ILI A;  5HJY A;  3ZZ0 A;  2ZH1 A;  4B02 A;  4LIW A;  3KLH B;  4J9K A;  2MZS A;  5GVQ A;  1UPP A;  3Q8Y A;  1VCT A;  3KK3 B;  2RF2 B;  1YZ6 A;  2R2R A;  1IKX B;  4OZJ A;  1U1P A;  2BKN A;  3SFU A;  2CQ0 A;  2HRT A;  1SQF A;  2CJA A;  2X3G A;  3IO1 A;  2HUR A;  5CZV A;  1W26 A;  5BYQ A;  1M5O C;  3MUT P;  3UE2 A;  1NDK A;  4QWA A;  1XIQ A;  5GMK a;  3PX4 A;  1EQ0 A;  3CDA A;  1I94 J;  4ZVS B;  3CME S;  4WYL A;  4NI2 B;  1RWU A;  3IM8 A;  3G4S S;  3W9J A;  1PSD A;  3DRR A;  4DZD A;  3HD2 A;  3EIC A;  3U1L A;  4K4Y A;  3CMQ A;  4IFV A;  4F7V A;  3K5L A;  5FII A;  1A0O B;  3HHL A;  1QSL A;  1RQ0 A;  4I64 A;  2K2P A;  5MLC V;  4JV2 A;  1J2V A;  3TYT A;  2HZV A;  1E6V B;  8RUC A;  3ZZU A;  3HLU A;  2OSQ A;  2PE8 A;  4OI0 A;  3W7B A;  3I0S B;  3ZZZ A;  4M5J A;  4YR3 A;  2MPU A;  2HRY A;  2ZM6 J;  2DY9 A;  1XK8 A;  4A8X A;  2V4Q A;  2XMW A;  1EAY C;  1YVF A;  2W8K A;  5IXU A;  2FGC A;  1GMW A;  1WAC A;  4OZL A;  5DS7 A;  1BUX A;  1X4G A;  1HBM A;  3BKT A;  2HK3 A;  4IUF A;  1IR2 A;  3LPE A;  3TA0 A;  1S1V A;  1T0T V;  2CQ4 A;  4L76 A;  1CS4 B;  3DCA A;  2XMK A;  3VWS A;  5KFI A;  3KWM A;  2WRM A;  4B9V A;  2V2Z A;  2BKO A;  3AHP A;  1N52 B;  2CG8 A;  1CEZ A;  4AYB D;  1DRZ A;  3ZTO A;  4MT1 A;  1GX5 A;  4DX7 A;  2V8P A;  2VJV A;  2JEF A;  1O8B A;  3QGP A;  5E2Q A;  5AE2 A;  2DRA A;  1JJ4 A;  2F9J A;  2MQQ A;  2JVO A;  4XIU A;  3CJ5 A;  2N7Y A;  2NYI A;  1YG0 A;  2B9W A;  3MM9 B;  2LDY A;  1TTH B;  4URS A;  1WHX A;  3H7H B;  1VRQ C;  4C2M A;  3NOC A;  4FYV B;  1U48 A;  2HHW A;  4Z7C A;  1U1N A;  2EFG A;  4JI7 J;  3TZZ A;  1AUD A;  1SXL A;  3EGW B;  4NLU A;  4M95 A;  2E9Z A;  2GW8 A;  1YIJ S;  2E7V A;  3BO4 A;  5CXT A;  1G6B A;  1PYT A;  1S9E B;  3K5P A;  2IPO B;  4XK8 C;  2B4P A;  1UMJ A;  2RAQ A;  4ZVG A;  4RWX A;  4TQR A;  1RHQ B;  3CJS A;  1OQ3 A;  2OTL S;  2KYX A;  2GVZ A;  2HYI B;  1YJ7 A;  2GAG C;  2FGO A;  1PJ7 A;  3QQC D;  2ACY A;  5EWG A;  1KHV A;  2B4U A;  5KFK A;  2NQP A;  3LP0 A;  3M6U A;  3WDO A;  4JV5 J;  3CDE A;  4UST A;  1LW0 B;  2W9A A;  3IA0 A;  2ASJ A;  1VBX A;  4C97 A;  3CJ3 A;  2D3O R;  3M30 A;  4Y6I A;  1NJW A;  5LSO A;  3A13 A;  4B3O A;  4CIO A;  1SKR A;  2UVU A;  2AJ0 A;  1CLF A;  2LDI A;  2DEI A;  2MKK A;  1GX6 A;  4KR0 B;  2HHQ A;  1FJE B;  1NSP A;  2QSF A;  1B4S A;  3IWN C;  5KG1 A;  4M5L A;  3OFH A;  2AF6 A;  1SKW A;  4DV4 F;  1RAF B;  1LWC A;  3OXF A;  1FRI A;  3QJJ A;  4CH0 S;  2ABY A;  5IT9 Y;  3RRH A;  1RTJ B;  4ES1 A;  4F3Q A;  3L7P A;  4ECT A;  1IVZ A;  2WSC C;  3ULH A;  3CCV S;  2LA4 A;  5E3A A;  2NSC A;  4W98 A;  3G9C A;  4ED4 A;  1ZM3 A;  1RT7 B;  3OSN A;  1XMQ J;  2D74 B;  2DGO A;  1H2V Z;  3VAG A;  2IRU A;  1BY9 A;  3D0H E;  4MJK A;  2VDI A;  4LF7 J;  1WDD A;  5HQ8 A;  2I1R A;  4OHW A;  5F8J A;  4LF5 J;  4HT5 A;  3T1Y F;  4DU8 A;  2ZVI A;  5E41 A;  2MB0 B;  2R4F A;  2F4V J;  1D1U A;  1HPZ A;  3AXM A;  2FQQ B;  4P52 A;  4ICL A;  5KFH A;  4IG0 A;  4ANC A;  5IWA J;  3FRY A;  4JI5 J;  5IV4 A;  1IM4 A;  5JVH Q;  4FXV A;  5JXS A;  2GJ2 A;  5AXL A;  2ZDO A;  1XEZ A;  1FX4 A;  4ZIT A;  2BJ9 A;  2AV5 A;  3WX8 A;  2MZQ A;  4GVB A;  2VBW A;  4HL9 A;  2RML A;  4P2F A;  3J80 U;  1NH8 A;  3P5B P;  1BMQ B;  4YUD A;  3QAE A;  2QC3 A;  4NXM F;  2LQB A;  2OML A;  2KM8 C;  1SKS A;  4J9U E;  2DH9 A;  3I0R A;  3VVT A;  2IBO A;  4ZCL A;  2DEJ A;  2WW8 A;  3O5T B;  2CAJ A;  3HFV A;  1D8Z A;  3CCT A;  1EJ7 L;  4QWC A;  1C1B A;  3DLE A;  3MMA A;  3EVM A;  3TEG A;  2J9C A;  4I2Q B;  1U1Q A;  2OGU A;  5C25 A;  3MUR P;  2D41 A;  1RWK B;  1P1L A;  4U8Y A;  4WF9 Q;  1WF2 A;  4LF4 J;  4J9V A;  1HKA A;  5KFQ A;  4HDG A;  1S9F A;  2DR8 A;  4YQW A;  3PG9 A;  3THT A;  2HVI A;  3DLJ A;  1TK8 A;  1FKP A;  1RT4 A;  3U27 A;  3HXM A;  4OIX A;  4LR8 A;  4E2F B;  2XYP B;  2KRB A;  1N34 F;  1N5Y B;  2DGV A;  4O44 B;  4FKY A;  2FHK A;  1PAE X;  3N5B A;  5GAG U;  3D3B J;  5E0O A;  4ZMM A;  1TVR A;  4PG4 A;  3MD1 A;  1H6K X;  3VQT A;  5KFV A;  4PWU A;  6FDR A;  5KFJ A;  4M5D B;  2R8H A;  3ZNU A;  3GTY X;  1NKC A;  3CJ0 A;  4OFZ A;  1FK9 B;  4C8M A;  5KFZ A;  2MKC A;  1KKH A;  4DX8 H;  3RBE A;  5DGB A;  1OO0 B;  2M52 A;  4Y2M A;  4ZCM A;  1YRT A;  1S1W B;  4LBI A;  2OPQ A;  4DCP B;  3TUJ C;  1QD1 A;  2GQC A;  2VG6 B;  3TP2 A;  1FT8 A;  1RT6 B;  2V63 A;  3GSI A;  3HHD A;  1VHI A;  5T7L B;  3GV8 B;  2YKM B;  4CCH A;  1B7Y B;  2XI2 A;  4OLP A;  2V9K A;  2E7W A;  4YR0 A;  2E1C A;  2ZVS A;  3OHA A;  3CTR A;  2XCA A;  3CJT A;  4WFN Q;  3V4I B;  1PYS B;  3MEG A;  1AZS A;  1SJ1 A;  3A8J A;  3OVA A;  2EBG A;  2K3K A;  2XI3 A;  2AMC B;  5B0E A;  4KH1 B;  1P8G A;  3H40 A;  4LRA A;  1B64 A;  3KLF B;  3KDO A;  4DL0 C;  1ARO P;  3GCW P;  2WVC A;  1G3O A;  1U6F A;  3MMC A;  4HEA 9;  3OJU A;  3NCR A;  1MN9 A;  4NZ6 A;  1YI2 S;  3RZA A;  2HFN A;  1H0H B;  1U6Z A;  3TJ8 A;  2WZ1 A;  2DK2 A;  4QWE A;  3M6V A;  2IMW P;  3PCO B;  1KFD A;  3SEO A;  3BBC A;  2E5H A;  4WTY A;  3H5Y A;  4J91 A;  2ILZ A;  5DM6 Q;  5ADZ A;  3CCQ S;  2PFD A;  3BKF A;  4B3S J;  1R3N A;  2Q66 A;  2HRU A;  3KK2 B;  2VBY A;  5A8W A;  4OZ1 A;  3G8S A;  5H9F J;  4RZR A;  1O0P A;  1N5S A;  1HNZ J;  4IYQ A;  1ZA2 B;  2BUN A;  1U47 A;  2C28 A;  1NB7 A;  1YJT A;  5IT9 U;  3LO3 A;  1UVM A;  2GFF A;  1RGV A;  3GSD A;  1HNW F;  4NA1 A;  4B17 A;  4HH1 A;  1CSJ A;  4DQS A;  1NHV A;  5HLF A;  3HVA A;  3VGS A;  4OI4 A;  3DFE A;  3D1H A;  2RQC A;  1JLC A;  2VA3 A;  1S1U B;  4QOT A;  1WOO A;  2AX1 A;  3DKD A;  3M6X A;  2GHP A;  3BRE A;  4ZDN A;  4U67 Q;  1AW0 A;  4YB5 A;  4NWB A;  1HBM B;  2YNF A;  2UU9 J;  4QR1 A;  2GO9 A;  2P9E A;  4V19 X;  2F65 A;  4FVC A;  1O6X A;  2CPJ A;  5DDO C;  3FK4 A;  2QX0 A;  5EX0 A;  5D3G B;  1SIZ A;  4Z2X A;  1S12 A;  5F41 A;  3R9L A;  4HVZ A;  2G1D A;  2AU0 A;  1ZBT A;  2VFV A;  1WOP A;  3M7V A;  4A8W A;  3GJT B;  4RNF A;  3QJL A;  3SCI E;  2LQ8 A;  3CPW R;  2AEM A;  3S01 A;  3J7Z 5;  1R0A B;  1TAQ A;  1FER A;  4RW8 A;  3HJV A;  4WII A;  2FHM A;  3KLG B;  5A6P A;  3AAW B;  3CF5 Q;  4M5N A;  2NRE A;  2UUC F;  4C9D A;  5F8L A;  1MLA A;  1HQE A;  3TNV A;  4RW9 A;  3TAM A;  4F67 A;  1LWF A;  1JLG B;  4O3O A;  1HBU B;  5GAE U;  2FIU A;  2XNQ A;  3DRY A;  1L3T A;  4OYM A;  1T9X A;  2QO3 A;  3CCW A;  3MEC A;  1C0U B;  5IM0 A;  4L3N A;  1EET B;  3D0G E;  3PXG a;  4N77 A;  2IAJ A;  1LK5 A;  3CWJ A;  3FJ2 A;  1CJU B;  3GON A;  4OJ3 A;  2Y0B B;  4F26 A;  2JJ4 D;  2EI5 A;  4NPO A;  3EDR B;  4LFB F;  5CYJ A;  1NKE A;  4DCO B;  3QID A;  1WHY A;  4X65 F;  1GAO A;  3PAC A;  3MM5 A;  4PG8 A;  2HGL A;  3FNN A;  3W2W A;  3M30 B;  4DLE A;  2ACM A;  1V5I B;  4WFB Q;  4LMZ A;  2CQB A;  3ICL A;  1S6Q A;  4A8Y A;  1HWK A;  4O4R A;  1J5O A;  4NCG A;  6AT1 B;  2M0G B;  1Q8I A;  2N3L A;  3CO0 P;  3QLH A;  1U1R A;  1X0P A;  2XLJ A;  3MPV A;  5HVG A;  1LWC B;  4QYZ J;  1VLY A;  1NPP A;  4DUY J;  4RUA A;  3M2R A;  5LJ5 Y;  1PGZ A;  3M6W A;  2F8H A;  1DLO A;  4DV5 F;  4ER8 A;  1VR6 A;  1K73 T;  1OYE A;  1SL1 A;  2VH7 A;  1RWW B;  1QTM A;  2AEF A;  4B9U A;  3R5G A;  1RWV B;  3DRP A;  4B3M J;  3TO8 A;  1K0V A;  4ED2 A;  2RRN A;  2XCP A;  2HZC A;  3IFE A;  4YN3 B;  2E1P A;  4OV6 A;  2E5L F;  1VOM A;  4JI0 F;  4YY3 J;  3QWU A;  4ILR A;  3O1L A;  5HBM A;  1S99 A;  1KBR A;  2XMA A;  4I1T A;  2AP6 A;  2J0X A;  1CJV A;  3ZTR A;  3DOK B;  4EK2 A;  1JQG A;  4B9N A;  1QVG R;  1GXT A;  4UUW A;  1S10 A;  5ETL A;  1GFW B;  4ZIW A;  3CB4 A;  4ICL B;  4EI2 A;  3TJA A;  4QPX A;  4CLT A;  1X4D A;  4CO1 A;  2J8A A;  4IOA Q;  4MYU A;  1WG5 A;  4A8K A;  1R6Y A;  1S4E A;  1KTV A;  2MQM A;  3LH2 S;  3DHX A;  1QDU B;  4ZVF A;  3T6J A;  4GVB B;  3B4M A;  3H0P A;  5L39 A;  2Z2L A;  1VBK A;  3D28 A;  2GS8 A;  2J6U A;  2KFZ A;  5E7O B;  2YY3 A;  3KLE A;  5G0R B;  4RJV A;  3FMB A;  1WC5 A;  2VU5 A;  2VOO A;  2LP4 A;  2PO4 A;  1KQF B;  4WIQ A;  3X1L B;  3T5K A;  2ZC3 A;  2ZH2 A;  2HFS A;  1LK7 A;  2ROG A;  3N6N A;  4ZVR B;  1C1B B;  1S4F A;  2XMT A;  3DLE B;  4RO0 A;  1U1O A;  3IR5 B;  4OYW A;  5KFW A;  5KFS A;  1QTN B;  2B8Q A;  3TAN A;  5C25 B;  1YGY A;  3ZZP A;  3R6L B;  2SXL A;  1HD0 A;  4ZHR A;  2IM1 A;  1L3V A;  1GTH A;  4KHP J;  3G82 A;  2HWH A;  2KFN A;  1F5B A;  2HHP A;  2OEJ A;  2NUU G;  4PR6 A;  4U95 A;  4IRK A;  3MTK A;  3A3P B;  1Q7L B;  2VFS A;  1TAU A;  4HLB A;  3OTE A;  5J2P A;  2VOP A;  1PAU B;  2CPY A;  2ZZN A;  3UN2 A;  2HNZ B;  1FKP B;  1V5V A;  1W7W A;  3KDN A;  1IQT A;  5GMD A;  4Q5V A;  1MWY A;  2A6M A;  3MHY A;  2ZKT A;  2IVF B;  5DLF A;  2KL8 A;  4TN2 A;  2HG4 A;  3N79 A;  2VZ9 A;  4FN5 A;  1N33 F;  2GML A;  1DFD A;  4CNY A;  1TVR B;  3CJ2 A;  1U09 A;  3PRD A;  3ITH B;  2CAD A;  5E33 A;  4GKJ J;  2BEF A;  2F8M A;  4TU9 A;  3TI0 A;  2DYA A;  3KG4 A;  3B78 A;  2CWK A;  2KTQ A;  2W2Q P;  1ZPW X;  1N5T A;  2BM0 A;  2CJK A;  3SCJ E;  2R7R A;  4HI1 A;  4QIE A;  4NLY A;  4Y2A A;  4LSL B;  3LWM A;  3PV8 A;  5E3Q A;  5DET A;  1RKJ A;  3BN4 A;  2ERR A;  2JX2 A;  5F8I A;  2W9C B;  3M8S A;  5L1K A;  1K44 A;  4WFY A;  4FYD A;  3EE3 A;  2W7A A;  1IBM J;  2IVY A;  3I87 A;  4BBY A;  4B08 A;  2OPQ B;  2DY1 A;  2RB7 A;  2CDQ A;  4LSZ B;  3R6G B;  1CJT A;  3BBB A;  2XZT B;  4TVA B;  2HQC A;  5FLX Y;  4ECV A;  2D69 A;  2CQG A;  4JUZ A;  1BQX A;  2HNY B;  2RS2 A;  1SV5 A;  3SI8 A;  5ITH A;  3EXY A;  4M5H A;  4RU9 A;  2QSW A;  2POK A;  1AZS B;  1MRO A;  2C22 A;  2RS8 A;  2OFG X;  4USU A;  1G4C A;  4DR7 J;  2Y0S D;  1D09 B;  3AD9 C;  4LFC F;  4DZ6 A;  4CO5 A;  4W90 B;  1S6U A;  2G0I A;  4KE5 A;  3LF0 A;  2OPP A;  2KHC A;  2LA6 A;  4O4G B;  3NGU A;  2CPI A;  4KT0 C;  1Y4Z B;  2QN6 B;  5LMU F;  3OUY A;  4WZQ A;  2HHH J;  3Q8R B;  2DRB A;  4OZ0 A;  4L72 B;  1V9O A;  3PYE A;  4YEA A;  1OSD A;  4RWW A;  1JLB A;  4U7C A;  4MK9 A;  1K8A T;  1PCA A;  4RBT A;  3AFG A;  2VB6 A;  4OHV A;  3I31 A;  2Z30 B;  3G6V A;  3HVW A;  2FC8 A;  4EU0 A;  3GQC A;  3AQP A;  2FHO B;  1T9W A;  4CTA A;  3S8S A;  2DJW A;  1G1X A;  1YBT A;  5IS2 A;  5I3U B;  3NL0 A;  3AOC A;  2R8J A;  1PIL A;  4QPT A;  5KT7 A;  3Q83 A;  3GE9 A;  2BAB A;  2C2R A;  2R2S A;  2G0J A;  3JYT B;  3VR1 A;  2KO1 A;  5KFM A;  4HT7 A;  4DBQ A;  3TUZ C;  1FNO A;  3CCR S;  1UA0 A;  2RUS A;  1NBE B;  2CNN B;  4ZJL A;  2PEH A;  4WPA A;  4DN9 A;  3Q23 A;  1X4E A;  2CVI A;  1FHT A;  1GQE A;  4C7Q A;  2DNH A;  2WOM B;  3E8O A;  1YK9 A;  2FUG 9;  4LBH A;  3OJS A;  4PKD B;  3OW2 R;  2KB2 A;  4YDD B;  2Y1J A;  2AYG A;  2RDI A;  4J9M A;  2VAS A;  2YNF B;  4OX6 A;  1TL1 B;  3DGP A;  4WWS A;  1HD1 A;  1SB6 A;  2KYZ A;  5ETT A;  2XSJ A;  3ENA A;  4ZVP B;  2F9D A;  2JSX A;  2DNK A;  2HMI A;  3HHE A;  2VQE J;  2RT3 A;  1ZTT A;  1H2T Z;  4L75 A;  2WBM A;  3BR9 A;  1T05 A;  1P1T A;  3VTI A;  1R43 A;  2YXL A;  4ETZ A;  3WQP A;  4RW8 B;  3KXD A;  1NU4 A;  5KFD A;  2KN4 A;  3WZ0 A;  4NMX A;  4N41 A;  2W01 A;  3ET6 A;  3OTC A;  1KVK A;  3VAJ A;  4LF8 J;  2OSR A;  4DV7 F;  1B0P A;  3NGK A;  1Q81 T;  2UXB F;  2M5Y A;  4PRF A;  1SL2 A;  4HHJ A;  1NHU A;  1XMQ F;  1XR6 A;  3Q8S B;  2KH9 A;  1D9A A;  3MEC B;  5IM0 B;  1HQU A;  3EZO A;  4JI1 F;  4LF7 F;  1NDP A;  1L3U A;  2BJE A;  2CWX A;  2CJX B;  4HKQ A;  2YX4 A;  5ETV A;  2AJ1 A;  4C6A A;  4E0D A;  1WJ9 A;  9ATC B;  1U8W A;  3ZZY A;  4IOC Q;  3P45 B;  2J7W A;  3MM5 B;  2BAC A;  2APO A;  2DB1 A;  3KFW X;  4Q45 A;  3BGR A;  4C8Y A;  4F3M A;  2V8D A;  2KXN B;  3N6L A;  2GIQ A;  2OO4 A;  3M4X A;  2UUA J;  1URN A;  3QFH A;  2COL A;  2OFH X;  3THV A;  3BZQ A;  4NCG B;  5D4P A;  3CUN A;  4FXW A;  1DY3 A;  3JQM A;  3QSY B;  2C2M B;  4DV3 J;  4Y2I A;  1N0U A;  4CWB A;  2H54 B;  2E44 A;  2P9G A;  4KJI A;  4ZK7 M;  2BX6 A;  5KG7 A;  3UNG C;  3KNG A;  2DR6 A;  2IM3 A;  1WUU A;  1VC5 A;  4DV1 F;  3LAL A;  3G6E S;  4CP5 A;  3KLI A;  1NO8 A;  2V69 A;  1Y3K A;  5C42 A;  1OPZ A;  3Q8Q B;  2RDJ A;  1T11 A;  3H5U A;  3N01 A;  3LTO A;  2Y1R I;  1S0V A;  3FC9 A;  1S6P A;  4P71 A;  3TEH B;  1N6Q A;  1JXE A;  3DRP B;  3TUP A;  1URR A;  1JKH B;  1YJR A;  1UZD A;  3TX0 A;  2ZHA A;  5KFL A;  3ISN C;  3S6E A;  1WKL A;  4IKA A;  2N3O A;  2W2N P;  4MYT A;  2C2K B;  3W5X A;  1WNE A;  4TLQ A;  4DCJ B;  3K5N A;  1LNQ A;  1RAJ A;  4QU7 A;  3NP5 A;  2YH1 A;  1S5Z A;  5FD1 A;  1UP1 A;  1SKU B;  1YTY A;  1CJV B;  5FLX U;  2W1B A;  3HVT A;  3QT6 A;  4GO5 X;  5LL6 d;  4DV6 J;  4EFA C;  5BR8 J;  2R8G A;  3RW6 A;  1F3V A;  1NJI T;  1MU2 A;  4DR5 F;  2IJN A;  4IR9 A;  3VAF A;  2G2O A;  1VK3 A;  1NK9 A;  3IR6 B;  2KJW A;  5KFB A;  2MLX A;  2YKP A;  3OT9 A;  3AXK A;  3D5M A;  4OI2 A;  4CLU A;  1SL0 A;  2H5E A;  3NS6 A;  5LSR A;  5F8G A;  4O3R A;  4IO1 A;  1REG X;  3KLE B;  3MM8 A;  2GQQ A;  3UCU P;  1W25 A;  1HNI B;  2QL5 B;  4KC5 A;  1FE0 A;  5L8R C;  1J5E J;  4NCA A;  1ZTW A;  4F02 A;  3CC7 S;  2ALZ A;  3CGI A;  4NRT A;  4V1A k;  3VGU A;  2LXI A;  1X5O A;  2NZC A;  4USM A;  3ZZR A;  2VA2 A;  2DNZ A;  4O3Q A;  3RBD A;  4YB1 P;  1D9D A;  3D3C J;  3FBB A;  1VLO A;  4JI4 F;  4ZHR B;  1HI1 A;  2MZR A;  4HAC B;  3G82 B;  3IBC B;  5IFM A;  4L6V 3;  2C3P A;  4ES2 A;  2FLP A;  3BPS P;  4PWW A;  3MED A;  3A12 A;  3DC2 A;  1YX2 A;  3HZG A;  1ZZN A;  4QWD A;  1S7H A;  2LQ5 A;  4H4M A;  4OI3 A;  3AA8 A;  2WVD A;  5DLG A;  4U96 A;  1E6Y A;  2X7I A;  3MR6 A;  3LP1 B;  4DFJ A;  1K0T A;  1X7V A;  3PW5 A;  4DN0 A;  3FZB A;  3QZ8 A;  4ED7 A;  3DDN A;  4O3N A;  1GEH A;  2R8I A;  1K1S A;  3M9N B;  1JJH A;  3DYA A;  3RUB L;  4DV0 F;  4WKY A;  3C3L A;  3W9I A;  1VJQ A;  1RLD A;  4JBC A;  2G9O A;  4EBD A;  2VJU A;  2G2Y A;  1FXR A;  3BO2 A;  2D3Z A;  5J1N A;  2R7X A;  5HVF A;  1JWW A;  1FA0 A;  1RAC B;  3HK2 A;  3JSY A;  4RLE A;  1A7G E;  4UT4 A;  3M1V A;  2V9W A;  3O44 A;  3QSI A;  1KQK A;  1YBU A;  3BGU A;  2L3M A;  4DR4 J;  2F3J A;  3HDS A;  2BRK A;  1CVJ A;  4LF6 F;  4DPU A;  2PT0 A;  1RHK B;  1TK0 A;  3H2U B;  2FTR A;  4CO3 A;  1WC6 A;  4DWI A;  5EWF A;  3EGN A;  4X2B A;  2H4Y B;  4K0K J;  2RKI A;  5GAD U;  2AT1 B;  4DR2 F;  1JXL A;  4WFX A;  2GV1 A;  2QGF B;  3DI6 A;  3TUI C;  5LM7 E;  1JLQ B;  2C2D A;  4F36 A;  4RKU C;  2MST A;  2EK1 A;  4P6Q A;  3LAM A;  1RAB B;  4YP3 A;  4LFA J;  2OPP B;  3K5O A;  3C6U A;  2OEM A;  3G6X A;  2AEJ A;  3RR7 A;  1HLW A;  3K17 A;  4IQM A;  3HP6 A;  4HDH A;  4J9Q A;  4ED1 A;  1XR5 A;  3Q22 A;  3SZ2 A;  1Q0N A;  3FSY A;  2E7X A;  3ZC4 A;  2XTJ P;  2QIF A;  1CQN A;  3WBZ A;  1WEX A;  1F2H A;  5L38 A;  2M2B A;  1VBZ A;  4AXI A;  4V19 J;  4DEZ A;  5KT4 A;  1U45 A;  2R7V A;  1S7I A;  3GPA A;  2AJQ A;  3KMS A;  1L3S A;  5B0A A;  4Q0B A;  3R7S B;  1KN6 A;  4CI0 B;  1JLF A;  3UVJ B;  3F41 A;  1RWM B;  1N5V A;  4DV2 J;  2B7B B;  5GAH U;  3FSI A;  3ENQ A;  3RW7 A;  3CDB A;  1KR4 A;  4KPC A;  5L1J A;  2K1R A;  4B3R J;  4GKK J;  1X0F A;  2HND A;  1TKT A;  2ZEJ A;  4LF9 F;  3M8Y A;  1RAG B;  2GJI A;  1MMN A;  5E3R A;  5LXR A;  4TU8 A;  1RT3 A;  5K14 B;  5ETQ A;  1FJC A;  2OPR B;  2FZK B;  2BJD A;  3FBF A;  2HAF A;  1T9T A;  1VRT B;  2KG1 A;  1IKV A;  4KQZ A;  4A4J A;  1NND A;  1SJ4 P;  4B3T F;  4CM2 A;  4QIW D;  3UDC A;  1XNR F;  3DGP B;  3I6P A;  3AOD A;  4DL7 A;  2OD6 A;  3PKM A;  2LYV A;  2QL9 B;  4DFP A;  1WEL A;  3H2V E;  3NAH A;  1FJG J;  1OY8 A;  3OL7 A;  2OIH A;  5HMZ A;  1Q1K A;  1TKD A;  1EIY B;  2HW3 A;  2OPS B;  2HMI B;  2PDA A;  2JLF A;  2DHS A;  3QAU A;  3EM1 A;  4J37 A;  3GII A;  1C4A A;  3PR5 B;  1FXD A;  4RBU A;  4B9S A;  5GAG I;  2CXE A;  4ZPD A;  1ZM4 A;  4MKY A;  1FDN A;  4JV0 A;  2R7Q A;  5KT3 A;  3ILL A;  1Z2Z A;  3EUN A;  4BS2 A;  3ET6 B;  1FNX H;  4TY8 A;  3QJP A;  2WTF A;  3CJQ A;  2CPX A;  1DQA A;  3Q2S C;  3BEG B;  1HWI A;  2XYH B;  4TXS A;  3DLK A;  3TRG A;  2DO0 A;  1CQM A;  4MIB A;  3PX6 A;  2WBR A;  3PY8 A;  1D9F A;  2CQC A;  1JIH A;  3OFG A;  3HVR A;  3PTW A;  1UVK A;  4ZLJ A;  2JEG A;  1UVI A;  4HR2 A;  2R2U A;  1FFG B;  2V50 A;  1FFW B;  4RUB A;  3KK1 A;  1FVQ A;  2VUG A;  2IJR A;  3CCJ S;  3R5A A;  3BGR B;  5DZ6 A;  1KQG B;  2YNG B;  4DR6 F;  3H59 A;  1RWO B;  4WFZ A;  1NDC A;  4I7F A;  2B4V A;  1C0T B;  2O3D A;  1ZZF A;  3DN9 A;  5SZT A;  1RWN B;  3RB0 A;  2RIL A;  2OP5 A;  1NM2 A;  1LFP A;  4I6Y A;  2HQ3 A;  3MCN A;  2FLO A;  4ZKA A;  2BE9 B;  2QLW A;  4N5S A;  3NBP A;  1SUQ A;  1Y9O A;  4JV1 A;  4FPR A;  1VMB A;  2FHJ D;  2MLZ A;  4JB8 B;  4UY8 T;  1VHF A;  1WG4 A;  3P6Y C;  3ISZ A;  1OJ4 A;  3P4U B;  4ES3 A;  5C42 B;  2WB1 D;  3U7J A;  2QMX A;  1RT1 A;  5M2P A;  2RD5 C;  2CA9 A;  1T03 B;  1S6P B;  5DDQ C;  4RNM A;  1N6Q B;  4JI6 J;  2JL9 A;  1HAR A;  4LJM A;  3WIU A;  4DQQ A;  1IWG A;  4DSE A;  4FKX A;  4NLT A;  1RXO B;  3QBC A;  5D0R A;  1CG2 A;  4KHR A;  2DO4 A;  3MAH A;  1RHU B;  1H7W A;  2B56 A;  1X4C A;  3QGH A;  2RUG A;  3G8T A;  5C2C A;  2GX8 A;  4I0W A;  1MSW D;  1QJH A;  4CH1 A;  2UUT A;  3EPG A;  3V6J A;  4DR1 F;  2MHN A;  1YQH A;  1MU2 B;  1QSY A;  2DIT A;  3C19 A;  4B9L A;  2FLN A;  5LMN F;  1J27 A;  3TWZ A;  2MKS A;  2A2D A;  5D78 A;  3FMW A;  1Y5L B;  1RAH B;  3R5J B;  3CJ4 A;  1EKR A;  3L4B C;  1NSA A;  2LKZ A;  3QIP A;  4LRE A;  2BW7 A;  1KLM A;  3W66 A;  3R5D A;  2J7K A;  5K20 B;  3W9H A;  5K8M A;  3KJN B;  2WON B;  2IM0 A;  5T14 A;  1U1L A;  4OX9 J;  4O3S A;  5EX3 A;  3QZ7 A;  3KMQ A;  5ETO A;  1N48 A;  1AUS L;  3MM8 B;  3QMQ A;  5HQL A;  3PJX A;  1NSK L;  1LXJ A;  2HVD A;  2R9L A;  4X4T A;  4OJH A;  1WC1 A;  2B4O A;  3GLJ A;  1UWA A;  2WCX A;  1WKJ A;  1IBM F;  1IKW A;  3T5L A;  4IFY A;  2ZZT A;  3D68 A;  3R3T A;  2YKA A;  1UVJ A;  4KH0 B;  4RW4 A;  1H2U X;  2FDN A;  1WEY A;  2P6T A;  3BQ0 A;  2UUB J;  3OTO J;  3F0N A;  5J1P A;  3MED B;  2HHT A;  1U0H B;  2VG7 A;  2G4B A;  5AJ3 F;  4XDD A;  4DUZ F;  3CSK A;  4H4M B;  1YZ7 A;  4WP9 A;  1KEK A;  2V2K A;  3CT9 A;  2KKH A;  5KFR A;  4DR7 F;  4HHH A;  2MZT A;  1F9F A;  1C4C A;  5J2Q B;  2D9O A;  2CZ4 A;  5HMX A;  2A3J A;  3GIR A;  2GA7 A;  3DYA B;  2HGN A;  1UL3 A;  2M8H A;  3I32 A;  2J8S A;  3HO1 A;  2Z0G A;  2BVZ A;  4F4Z A;  2Y8Y A;  2JWN A;  1VJW A;  1I3O B;  2XC9 A;  2FY8 A;  2NXU A;  2Y8W A;  3HHL D;  5IV3 A;  2LU2 A;  3N4W A;  2MQO A;  4AND A;  3D6F B;  5KG6 A;  4P9S A;  2WSE C;  4OZ3 A;  1HW9 A;  3M1V B;  4ZCK A;  4BC9 A;  1TP7 A;  2E29 A;  4C98 A;  3QNW B;  1NJX A;  2VOD A;  1Q86 T;  4KYZ A;  4AE5 A;  3IC1 A;  1DQ9 A;  4PXE A;  3ZNJ 1;  4ID8 A;  1U2C A;  4ZPC A;  5A76 A;  3PEJ A;  5FDL B;  1SC3 B;  3RB4 A;  2XMM A;  2QL7 B;  1RTD A;  1GMW D;  1R27 B;  4CNZ A;  3W62 A;  4QW9 A;  1X8D A;  5JVG Q;  3IS9 B;  5GME A;  1ZM9 A;  4WU3 A;  1RBA A;  5H9E J;  1RHR B;  1WWH A;  1YHQ S;  2GAH C;  1AYE A;  1WI6 A;  4K50 A;  3PYD A;  1N36 F;  2AYB A;  1S72 S;  1KWM A;  1CJK A;  3B82 A;  3OVB A;  3IWL A;  1XQI A;  1UJ4 A;  1I1G A;  3GIL A;  4F2S A;  3LGM A;  1RP5 A;  4ZN1 A;  2W9B B;  2H1Y A;  3HKW A;  2UP1 A;  4OI1 A;  3RJM B;  4A8M P;  4IRD A;  2VQF F;  4OYO A;  1C1C B;  5EN1 A;  3R7N B;  2W2O P;  3R1H A;  3THP A;  1TUW A;  3MCS A;  1RTH A;  3CC4 S;  2V68 A;  4OYA A;  3AB2 B;  4Q2M A;  1NK4 A;  4Y28 C;  4M94 A;  3JSM B;  2E1M C;  4ZP6 A;  1HR0 F;  2BRL A;  2W2M P;  3FSX A;  2XGQ A;  1MG7 A;  3WC0 A;  5ETN A;  3OPK A;  1V3Z A;  5HP1 A;  2E1A A;  1JJC B;  1Q5V A;  3MPU B;  4MIW A;  3KTQ A;  2O66 A;  4Q0B B;  1FWP A;  1T3N A;  4KPY A;  1HW8 A;  2NCK L;  1AA1 B;  1JLF B;  1OY6 A;  4ZPW R;  5KFF A;  4AQY F;  2U2F A;  4JI8 F;  3DRX A;  2C3U A;  2ZKU A;  3BSA A;  3HHK A;  3AQO A;  2E9R X;  1KC8 T;  2OKQ A;  5K9F A;  3BGF A;  4DSL A;  4TLR A;  2HND B;  4N8O A;  2VC0 A;  1NDL A;  2PD1 A;  1BHN A;  1GXU A;  2RU9 A;  1RT2 A;  1RT3 B;  2F8E X;  1VIO A;  1VQY A;  2Z2Z A;  1KP6 A;  4DG1 A;  3DOM B;  4X4O A;  2XZD B;  1H3D A;  4RW6 A;  2M9K A;  1H74 A;  3I55 S;  2P5V A;  2ZBP A;  1IKV B;  2FJB B;  2HHX A;  3PM9 A;  2Y3Y A;  1F9H A;  4I2P B;  2B3T B;  5A8R A;  3V6D B;  1TFW A;  4KIA A;  2W2P P;  1ZS6 A;  1PJ6 A;  3KLV A;  4F0K A;  4BLG A;  3JS9 A;  5CAA A;  2MYF A;  4USJ C;  3D66 A;  1LQ9 A;  4DI6 A;  2HZA A;  3HZE A;  2PA8 D;  5RUB A;  3GV7 B;  2YKQ A;  3N6M A;  3QRR A;  3W5Z A;  4DDF A;  1H38 A;  4CYU A;  5J2N A;  2Q1L A;  3PW0 A;  3N5F A;  2RQM A;  1VS3 A;  2XQC A;  1B3T A;  1IKY A;  1KLN A;  1S77 D;  1YDL A;  3VHQ A;  4WU2 A;  2LXU A;  1FWL A;  2XHW A;  1CUL B;  4TY9 A;  4PQU A;  4YS2 A;  1BLU A;  2QT7 A;  1BGX T;  3QT7 A;  2Q43 A;  1SH3 A;  3SV3 A;  1RDR A;  1KRP A;  4YME A;  4ZVQ B;  1NCL A;  3MM6 A;  1VC6 A;  3NOG A;  4K4X A;  3DLK B;  4NE9 C;  3BO3 A;  2MDA A;  1YRU A;  5HO4 A;  2ZD1 A;  3EPI A;  3IGN A;  4NCB A;  1HYS A;  2QRR A;  4EBC A;  5L1I A;  2XGP A;  4AUK A;  3BM7 A;  5M2R A;  2ZBR A;  2ZOM A;  1UW4 A;  1VQ4 S;  3KK1 B;  4ZOS A;  2Q6B A;  1RBL A;  2IA0 A;  1RA6 A;  1Y0H A;  3V2U C;  1N54 B;  1TUG B;  3JQJ A;  4X64 F;  1M90 T;  3AH6 A;  2NXN A;  4DV4 J;  3JB9 k;  3ENW A;  2X1F A;  2VPZ B;  4OV1 A;  1ZAW A;  4P73 A;  3KNA A;  1L5U A;  2ZNY A;  2IC3 A;  1V3R A;  3DRS A;  4WK1 A;  3MAQ A;  4I7F B;  2CRL A;  3QPI A;  4NA2 A;  4ETX A;  4FZV A;  3TAR A;  1PYO B;  1TKX A;  4I6W A;  1B0T A;  1U26 A;  1IUJ A;  4P74 A;  3CCE S;  4KGV B;  1PBU A;  1FVS A;  2DR7 A;  3W64 A;  2XO6 A;  2GGP A;  3L7U A;  1SUQ B;  2M8D B;  2AWZ A;  3HKZ D;  2XZW A;  2PMW A;  4FF2 A;  3MWB A;  1QUV A;  4J9S A;  3CIZ A;  1N0V C;  2BAN A;  1BE4 A;  3IR7 B;  2QE5 A;  4ZVO B;  3T1Y J;  2MSS A;  3KKF A;  3M8P B;  5D0E A;  1HNV A;  4EO8 A;  3GFY A;  1YWX A;  1NSQ A;  1RJJ A;  1RCX B;  3D7S B;  5CYQ A;  2BMB A;  3OR2 A;  5CYM A;  1TEL A;  5LXY A;  5B0F A;  1LWX A;  3TZW A;  3C15 A;  3EXC X;  3POT A;  1QM9 A;  1WF0 A;  3A1Y G;  3TW0 A;  1DBD A;  1LXN A;  4KFB A;  5CAB A;  4FYX B;  4WE1 A;  1NZ8 A;  3QO9 B;  1U1K A;  2I2Y A;  3V4M A;  1FRH A;  4NXM J;  2DNL A;  5HVH A;  3UI3 A;  1UA1 A;  4LVO P;  1R8P A;  2MZJ A;  4CLS A;  4MKB A;  3W8P A;  2FJW A;  3GG1 A;  4RW7 A;  1QSS A;  2CNO B;  4X62 F;  3C66 A;  4P75 A;  3FCW A;  1EX8 A;  3QIP B;  1KLM B;  2DRD A;  3R2C J;  2DGQ A;  5CH7 B;  1HQ2 A;  1B70 B;  3FCH A;  2BXJ A;  1BWV A;  4WP8 A;  2CDR B;  2NR0 A;  4A8F A;  4ERD A;  4K4Z A;  4C8K A;  4DU7 A;  3KHG A;  4M5G A;  1FKA F;  3W2V A;  1UVN A;  5KOW A;  2A0F B;  1FO1 A;  1A6L A;  1KFS A;  4KKO A;  4DOZ A;  3O6Q A;  1CPZ A;  2C42 A;  1Y7P A;  2WAQ D;  4UTG A;  3C16 A;  3H4B A;  3TQ1 A;  1BWE A;  3AJ1 A;  1SH2 A;  3B6B A;  4RW4 B;  3PRB A;  5A8K B;  3SBM A;  3SCK E;  1N34 J;  1I5O B;  5JMN A;  1M1G A;  5A0Y A;  3CD5 A;  2DPJ A;  4KTQ A;  3NLC A;  4ED6 A;  3NNH A;  2K3I A;  3CJ8 A;  2VG7 B;  4TNO A;  3VQS A;  2YWW A;  4ECQ A;  2BE2 B;  3MEE A;  2XG8 A;  1VDH A;  2A10 A;  2UVR A;  2R3V A;  2BR0 A;  2Z2Y B;  4NYZ A;  4QR2 A;  4K7Q A;  3MXH P;  2NZ4 A;  4DJB A;  2JFK A;  3HI9 A;  4HHU A;  1ZET A;  2VD3 A;  1TUV A;  1IBL F;  4CT8 A;  2ZH7 A;  4NI2 A;  3IAM 9;  3A8K A;  2UXC F;  4AL5 A;  3W65 A;  4RNH A;  3A4T A;  3G2X A;  1H7X A;  1NME B;  1REV A;  3A3N B;  4OJG A;  1TK5 A;  1LW2 B;  3EVW A;  1UPM B;  4JP8 A;  4P10 A;  2UZA A;  3VZI A;  1VRU A;  1KTQ A;  4P2M A;  3K2Y A;  1E6V A;  4NXN F;  4F2R A;  3D1Q A;  4G1P A;  1Z4U A;  2DBB A;  2PMZ D;  2RJZ A;  4Y2K A;  1RB0 A;  5C2G A;  1TFY A;  2AW0 A;  4YHH F;  4GRS A;  2V34 A;  2F7V A;  2IRX A;  1RTD B;  1K9M T;  4LUB A;  4KV8 B;  3BH7 B;  3HPO A;  3UDL A;  1VI7 A;  5D4N A;  4G1Q B;  2IDL A;  2FVC A;  1IM6 A;  2V4J A;  1CS4 A;  1X31 C;  1WTB A;  2NPI A;  2XMV A;  2DCU B;  3TQE A;  5D0G A;  2VKR A;  3F56 A;  2FJX A;  2D3U A;  1JMT A;  1RU1 A;  1FDB A;  4DX5 A;  3P3D A;  3KJQ B;  1RI7 A;  4NEZ A;  3UN5 A;  2R8K A;  1Q4R A;  2MZ1 A;  2MEW A;  2IBK A;  1MWQ A;  4FNI A;  3FRZ A;  1NPK A;  1BQM A;  3IG1 A;  4C48 A;  2KT3 A;  4MMO A;  1FE4 A;  1XNQ F;  3AD7 C;  4QW8 A;  2O67 A;  2YNI A;  3DLH A;  1FRL A;  4CH7 A;  2YNH B;  2CQI A;  3DU6 A;  1Q5Y A;  4ZP7 A;  3QT5 A;  1XMO F;  4CQ1 A;  4N47 A;  2CQP A;  1QE1 A;  3PDN A;  4DSI A;  2CJY B;  4NLX A;  2YVS A;  4H4O A;  2W4P A;  1IWA A;  3HT3 A;  2OAU A;  3ELH A;  2ZWO A;  3FFI A;  2K7K A;  3TX8 A;  3E2E A;  1HNW J;  2XMJ A;  2MKY A;  2MY8 A;  1FRX A;  3IBW A;  1EP4 A;  5KG4 A;  4RUC A;  1T3O A;  4A46 A;  3CCM S;  2JEJ A;  1XER A;  1UFK A;  4JI2 F;  3QAT A;  2DH8 A;  3HD1 A;  4FNH A;  2VHG A;  5ETM A;  3H8Y A;  4KRW A;  2V4R A;  5KFY A;  1UFW A;  1WHW A;  4QU6 A;  4ZIV A;  1WTF A;  4OYX A;  2YWG A;  3K0J A;  1LW0 A;  4WKR A;  4OX8 A;  2HFV A;  2GJF A;  2CYY A;  3WC2 A;  3HHN B;  3TAP A;  2AJF E;  2BA9 A;  4DG1 B;  2VBZ A;  4RW6 B;  2BJ1 A;  4NZ0 A;  2FY1 A;  3H25 A;  2J0Q D;  1S0N A;  2QG9 B;  3I5C A;  2QJ3 A;  4ZVU B;  2IHR 1;  2Q6C A;  4BWM A;  2OLW A;  1HWU A;  1FEE A;  3DRR B;  4KAI A;  2BOA A;  1XC9 A;  2JOQ A;  4IFV B;  3EMT A;  3OFF A;  4TYB A;  4IO9 Q;  3HHL B;  3I9V 9;  1HBO A;  1M0S A;  1RTJ A;  1OY9 A;  1BQN A;  2F1F A;  4QYR A;  3U02 A;  2BOP A;  2R42 A;  4FBT A;  2QYC A;  3HF5 A;  2G2Z A;  2GIR A;  4F50 A;  3MUV P;  5CD4 H;  1F5C A;  2FVR A;  5HK4 A;  1HHS A;  1KNZ A;  2ZFH A;  4PQU B;  3DGV A;  3G96 A;  2UV8 G;  3NY0 A;  2M3D A;  4DPY A;  3CJR A;  3CD7 A;  4YFU A;  3WX4 A;  3VF0 B;  1JNR B;  4EO6 A;  3NGR A;  3NS5 A;  4MFB A;  4LFB J;  3QYY A;  1T9Y A;  2BKP A;  1TV6 A;  2NSB A;  4F25 A;  3MM6 B;  1S1V B;  4X65 J;  2O5D A;  1UEV A;  2P8I A;  1WKK A;  1W2B R;  3PO4 A;  2YX7 A;  3FQK A;  4JI3 F;  3FQL A;  3TVY A;  1FJ7 A;  3C8Y A;  2N4C A;  4JYA F;  5EUH A;  1HYS B;  5KFT A;  4CLF A;  2LEP A;  4MKA A;  2GMJ A;  3GP9 A;  2UXD F;  1R8A A;  4WBF A;  2L9W A;  3NS7 B;  1VQ9 S;  1GK8 A;  2ZBC A;  4ZPV R;  4NX9 A;  5B09 A;  1GNK A;  1S97 A;  4IR1 A;  5GAD I;  4WJB A;  1OYD A;  4FVM A;  3RYL A;  2YBV A;  2JRS A;  3TJ9 A;  4DV5 J;  3MGJ A;  2Q3P A;  3Q86 A;  2GZO A;  3RAX A;  2HAI A;  5DRK A;  5HRO A;  4ILM A;  1TKX B;  3PFO A;  3SIP B;  1Q95 G;  1SVD A;  3FDS A;  4LVN P;  3WIV A;  2GGP B;  4EYI B;  2HLU A;  1WSV A;  4IH5 A;  2AX0 A;  4RX6 A;  3T1A A;  1IBK F;  3B4D A;  4CM0 A;  4J9L A;  2GVZ B;  3AY0 A;  1SJ3 P;  4WZM A;  4KSE B;  4EGL A;  3LGN A;  3LW5 C;  2EFQ A;  2E5L J;  1JLA A;  2BAN B;  4D3H A;  3LAK A;  3K57 A;  2VDH A;  2HKE A;  4JI0 J;  3M8Q A;  4CZC A;  3LP0 B;  1HNV B;  2VFT A;  3KUE A;  5KFP A;  4F4W A;  2QMU B;  3SYZ A;  2XY5 A;  3LUY A;  2LU1 A;  1SQE A;  5CYQ B;  5F8H A;  4DS4 A;  3OR2 B;  4L74 A;  1OPI A;  2AIR B;  4B3O B;  5CHC B;  2L48 A;  3J7Y U;  1M5H A;  1AT1 B;  1NKB A;  4O44 A;  1K1Q A;  4XTT A;  3C15 B;  1X9M A;  3M2U A;  1ZYQ A;  4YR2 A;  1NEE A;  1NJZ A;  5IQQ A;  1M5K C;  2HQF A;  5IT0 A;  1YJW S;  4E98 A;  4GMK A;  3CCZ A;  4WE1 B;  1GTE A;  2XEX A;  1LWE A;  3PJW A;  3UN3 A;  3MAA A;  1GMV A;  1RIS A;  4AXJ A;  1KSP A;  2XS2 A;  5FJ4 A;  1Y00 A;  5F9L A;  1HNX F;  1LEO A;  1GH8 A;  4DL4 A;  2HBR B;  1WOS A;  3NG8 A;  4A8Q A;  4QR0 A;  4Y3C A;  3ENV A;  2ZWP A;  2VPX B;  1FK9 A;  5DDP C;  2R7O A;  2MJU A;  2BM1 A;  3GFH A;  2A2C A;  1APS A;  3T9Z A;  2AJ2 A;  3R7B B;  1YKW A;  1RHM B;  3NCQ A;  1X60 A;  2KDO A;  3IM9 A;  3W2V B;  3NWG A;  4DPW A;  2VF3 A;  2AZ1 A;  3CUL A;  2YKM A;  2HFU A;  4KKO B;  1RBO B;  3C2P A;  4GC7 A;  3AOA A;  1NB2 A;  1SJF A;  3EZU A;  1DAX A;  3C16 B;  1HPZ B;  4OYP A;  1U8S A;  3V4I A;  2XWY A;  4X66 F;  2CUY A;  4WXO A;  4IG0 B;  5CA5 A;  3M8R A;  4LT6 A;  2KVQ E;  4OZ5 A;  2XMU A;  3RB6 A;  1U02 A;  3KLF A;  1FRK A;  4I67 A;  2PFF B;  4DHV A;  3J80 Y;  2QMW A;  4OYI A;  5A0Y B;  1FX2 A;  1N33 J;  3K59 A;  4USI A;  2W7P A;  3GJQ B;  2QLJ B;  3T1H F;  3T41 A;  1NK8 A;  3GR0 A;  3MEE B;  3BR8 A;  3OV7 A;  2R7U A;  2QZ8 A;  5I42 A;  1VQL S;  2QFI A;  3I0R B;  4ECU A;  1KD1 T;  4DR3 F;  1RYR A;  4XPC A;  2JDJ A;  2DNN A;  2E5I A;  3KK2 A;  4X4P A;  4NLV A;  2DNR A;  3MMA B;  2D9P A;  1SC4 B;  4ZP8 A;  2EFN A;  4DSF A;  3T6B A;  2ASL A;  2DHA A;  1GT8 A;  1I51 B;  4HH0 A;  3GR1 A;  4CLY A;  4WTO B;  1REV B;  1NLK L;  5C24 A;  1G2E A;  4USH A;  2NXJ A;  1RSC A;  5EWE A;  3MTJ A;  1VRU B;  4J9R A;  4K2J A;  3PRV A;  4K8R A;  3LGH A;  2NXC A;  1IR0 A;  1S0O A;  1RAA B;  3MR2 A;  5IOL A;  2OHD A;  1RTZ A;  3DOL A;  3HSJ A;  1FFS B;  1RT4 B;  4BDP A;  4J9O A;  1SQG A;  1S1U A;  3OLB A;  1OIA A;  2L9N A;  3BF4 A;  3FEZ A;  2EBE A;  4LFC J;  1P6T A;  3D4J A;  2EG1 A;  1LKZ A;  2V4J B;  5U47 A;  4UOF A;  1JK9 B;  5AXK A;  4X4N A;  3SV4 A;  2ASY A;  2KVI A;  4KO0 A;  5LMU J;  3SQG A;  1FWK A;  4QQB A;  3TVZ A;  5D3G A;  3TVK A;  4O0I A;  2HS0 A;  3KHL A;  2BQU A;  3J81 Y;  1XN9 A;  1BQM B;  1TL3 A;  2VIH A;  3IG1 B;  1I94 F;  3OTB A;  3L9Z A;  4XAK A;  4IG3 A;  2B0G A;  1BC6 A;  1U2R A;  1R0A A;  4ATN A;  3B8H A;  2YNI B;  3KLG A;  2I8E A;  4K5R A;  1EZZ B;  4URQ U;  1FDD A;  3DLG A;  1QE1 B;  1FD2 A;  3RRK A;  1Y10 A;  1QUP A;  3LPY A;  4H4O B;  1U7L A;  5F0W A;  3FFI B;  4RNN A;  1JLG A;  1HBU A;  3I4P A;  1ZOT A;  3MEG B;  2OEL A;  2ZM6 F;  4F8R A;  4UY8 5;  1BXN A;  5ETK A;  4U7U D;  1C0U A;  1EP4 B;  1EET A;  2B8P A;  2Y1L B;  1SH0 A;  4M8L A;  1CJU A;  1S1X A;  2JZ5 A;  2OD4 A;  1OMS A;  5B7W A;  5HAN A;  3MMC B;  2V5H G;  4M63 A;  3EWG A;  1X5S A;  5B08 A;  4OHZ A;  3CNQ P;  3ZO7 A;  4DPX A;  4ECX A;  2W4C A;  2XO7 A;  2VL1 A;  2IYG A;  4YB6 A;  3L09 A;  2YQ1 A;  1QY7 A;  2EW9 A;  3AB4 B;  2A1B A;  2LEC A;  3ILO A;  3MFH A;  4J9P A;  3AA9 A;  2J0S D;  2HWI A;  1WC0 A;  3C46 A;  4UQG A;  2B9Y A;  5F0U A;  5A8W B;  1EAR A;  4P7T A;  1VIX A;  1X5T A;  2GHV C;  2O01 C;  4Q2L A;  4O0N A;  2FJV A;  3W61 A;  1NAQ A;  1U4B A;  1NK5 A;  1WOR A;  1HBO B;  3K89 A;  2VV5 A;  1NH7 A;  1N8R T;  1BQN B;  1RWX B;  4BC7 A;  4JI7 F;  1Y3J A;  1ZA1 B;  1TR0 A;  4OYZ A;  4DV7 J;  4PEO A;  4ID5 A;  3NNC A;  2UXB J;  2HBY B;  3A8E A;  1R89 A;  4UZC A;  2L08 A;  5HLF B;  2ZH8 A;  2V94 A;  4DL3 A;  1JLC B;  2B5J A;  4C3M A;  4FS2 A;  2DNO A;  3PW2 A;  4JI1 J;  1PG5 B;  4J7C A;  2P2C B;  3OR1 A;  4B9M A;  5L46 A;  1U6B A;  4MFB B;  4RR5 A;  2NXE A;  1TV6 B;  2XYG B;  4JV5 F;  5CQG A;  1YLX A;  3DOK A;  2BJ3 A;  2GO8 A;  3QGG A;  4HTI A;  2QLF B;  4RUH A;  3T5J A;  2HHV A;  5CCL A;  1Q78 A;  2CPF A;  1JJ2 R;  1UFL A;  5AXM A;  4X4R A;  2PII A;  2FJD B;  3BH6 B;  1U2F A;  4NYP A;  4ILL A;  3MZI A;  4ED5 A;  1WC4 A;  2ZNZ A;  5DQH A;  1TKZ A;  3G86 A;  4PG6 A;  2J76 E;  4NOH A;  4DL2 A;  2H5I B;  2IY5 B;  2FJA B;  3UQS A;  2DVI A;  4C8Z A;  5G0R A;  3N28 A;  3EJM A;  4I6A A;  5LJ3 Y;  3QGI A;  4DV1 J;  3N0V A;  2P9C A;  3OXL A;  4ZVE A;  3QRP A;  2L9D A;  1HQE B;  5MAO A;  3NGD A;  5HRO B;  1RUS A;  1NK6 A;  5DG7 A;  4RW9 B;  4NL5 A;  3GMG A;  3TAM B;  1LWF B;  5J1E A;  4ZLP A;  2H3E B;  4K59 A;  3PIP Q;  3R1L A;  1VQ8 S;  4LF2 A;  2IAJ B;  4FF4 A;  2LEB A;  4DQR A;  3DMJ A;  3HUL A;  2O1P A;  3G6Y A;  4H4K C;  4LF5 F;  1IR1 A;  2W8L A;  1JLA B;  1IBC B;  4QIF A;  2F4F A;  3M8Q B;  1S59 A;  4K4W A;  4ECS A;  3KG1 A;  2F4V F;  1F1B B;  4AD6 A;  4NZ7 A;  1CC8 A;  3GJR B;  3H20 A;  3W2W B;  4ZVT B;  5B0B A;  5HJX A;  2HNZ A;  3M2V A;  1MML A;  5IWA F;  5M2U A;  3C6T A;  1XMB A;  4DR5 J;  4JI5 F;  1G7C B;  1UEK A;  1S6Q B;  5HQM A;  3GZ7 A;  2VFR A;  1FKO A;  1J5O B;  3M2U B;  1RTI A;  2BBE A;  3QLH B;  2DGS A;  3W3S A;  3H98 A;  2F40 A;  2EEY A;  3ITH A;  2ZH5 A;  1D3W A;  3MOJ B;  1LWE B;  3D0I E;  2HIQ A;  3UPF A;  3MAA B;  2WVF A;  5AT1 B;  3V5R A;  3Q2T C;  3M2R B;  2XHC A;  2PC6 A;  4LSL A;  1DLO B;  3L7O A;  4OZN A;  5AE3 A;  4A48 A;  2QA1 A;  2CPZ A;  2HEK A;  2C2O B;  2W9C A;  3BQ1 A;  2Q79 A;  1VGY A;  4USK A;  1ROF A;  1AXQ A;  3PNI A;  2YQ3 A;  3J81 U;  3JSR A;  2QEX S;  1VBY A;  4Z7Y A;  4HTJ A;  1PBA A;  3TZX A;  1VQN S;  3BGO P;  2XY7 A;  3OSP A;  4JI4 J;  5KG0 A;  4ECY A;  4LF4 F;  2Z2M A;  1MMD A;  3VAK A;  1Z2L A;  4FXD A;  5HBM B;  3D54 A;  2HNY A;  3W1Y C;  4IQX A;  1HA1 A;  1T02 A;  2E5G A;  4K4U A;  1QAI A;  5HMY A;  2F63 A;  3QFW A;  4OLO A;  2ATL A;  2VFU A;  2YPZ A;  2MTL A;  2AGQ A;  4EEY A;  2AQ4 A;  4I68 A;  3UR0 A;  3PJ9 A;  4ZPT R;  4TKT A;  1YJ9 S;  3IAS 9;  3JSB A;  3UD5 A;  4ZJQ A;  3GIM A;  2ROE A;  4O4G A;  4DV0 J;  2CKW A;  2XNR A;  2H51 B;  1KHW A;  2CJB A;  4PPZ A;  4F4X A;  4D3G A;  3MM7 A;  2EC0 A;  4DQP A;  3ZTP A;  2VKZ G;  4DSK A;  5I42 B;  1S57 A;  3JTO A;  1L3K A;  1ZPV A;  4J9N A;  2OH2 A;  5BXI A;  2JC1 A;  4I69 A;  2A18 A;  4RBV A;  1TL5 A;  3SQO P;  1VQM S;  4H54 A;  2X1B A;  4DQI A;  1JLE A;  3W60 A;  5JJB A;  5B0G A;  5I3U A;  1RAE B;  5C24 B;  3KHR A;  4LF6 J;  5ETS A;  3VGT A;  2D7S A;  3CDW A;  4LRF A;  3SSQ A;  1UJ5 A;  4FF3 A;  1FDA A;  3JYT A;  4USV A;  2YKN A;  4UUX A;  2AGO A;  2IMO A;  2ASD A;  3HJF A;  2ATC B;  3KUH A;  3V6K A;  1VQP S;  3UNY A;  4DR2 J;  2C2E A;  3DOL B;  5J2P B;  2HQI A;  2K8G A;  3OVS A;  4R8U A;  1F2G A;  1YIT S;  1KVI A;  3AOB A;  2WOM A;  1DUR A;  8ATC B;  3DNC A;  4ZPB A;  4XO0 A;  1ACM B;  1QVF R;  1VQK S;  2QYG A;  3T9N A;  2FC9 A;  4ZA1 A;  1TL1 A;  1F5A A;  1KS2 A;  5KT5 A;  1F3F A;  3KJF B;  1QAY A;  5KFG A;  3D6T B;  2AZ3 A;  4KO0 B;  1IQZ A;  2HHU A;  1ZH5 A;  1FXL A;  4Q8E A;  3SQG B;  3MCO A;  4AFF A;  1ZAX A;  3JXO A;  1FNM A;  2EPI A;  2DNP A;  1NZA A;  2ZBI A;  3ZZO A;  3QWP A;  2AJ4 A;  2MQL A;  2MY7 A;  4DFM A;  2E66 A;  3EZ5 A;  4B3S F;  2NUH A;  4Q8F A;  1TL3 B;  4LRB A;  1F6T A;  1IN0 A;  4ELV A;  2FLL A;  4QZV B;  4ED0 A;  4IG3 B;  1KDN A;  2RSQ A;  1I6J A;  2V8V A;  1CJT B;  3A3O B;  1HNZ F;  4URG A;  1HMV A;  1O51 A;  1S1T A;  4QIG A;  3MD3 A;  4J5O A;  3UD4 P;  1X9S A;  3OL6 A;  1RYS A;  3CCL S;  4N56 A;  4PYD A;  1T95 A;  4CO2 A;  1WI8 A;  3PIO Q;  3DLG B;  4BWJ A;  3JTP A;  4AL6 A;  4F04 B;  5E3P A;  4K4S A;  1JNZ B;  1H73 A;  3BPD A;  5F3Z A;  1SV5 B;  2Z4P A;  1F60 B;  3CED A;  2V8G A;  3MDF A;  4LSN A;  3W5Y A;  2QTW A;  4LF9 J;  4OHY A;  1MRO B;  5BJR A;  2MGZ A;  1VK8 A;  2DNG A;  2RIJ A;  3TZY A;  1S1X B;  2FZG B;  3PFE A;  1XWL A;  3ZTS A;  1V3S A;  4X4S A;  2UU9 F;  3NMR A;  1YBA A;  2HPU A;  2ROP A;  1Z1Z A;  3PR4 A;  1EQM A;  1UAW A;  4B3T J;  4DL6 A;  3BN7 A;  1XNR J;  2J6S A;  4ZVH A;  5CD4 A;  2OJ3 A;  1FF2 A;  3OUY B;  3GIK A;  3DM2 A;  1P9Q C;  5CCM A;  3Q8P B;  4ZPA A;  2DIS A;  4IDK A;  1CBK A;  4ZN3 A;  2RVJ A;  4IH6 A;  2N82 B;  4ZLN A;  4QCL A;  1ZAV A;  3GYN A;  1JLB B;  5D15 A;  1Q79 A;  2CPD A;  3J7A 1;  1B99 A;  2KG0 A;  2DIU A;  5K8N A;  4Z37 A;  5K8O A;  3I96 A;  5DM7 Q;  4CTA B;  4CLK A;  1DZ5 A;  2LQJ A;  2CQ1 A;  5KFC A;  3FBE A;  2HQD A;  2JFD A;  2KXH A;  2V2V A;  2W24 A;  5D77 A;  4R5P A;  2DGU A;  3PHT A;  3H5X A;  5IC4 B;  3BKU A;  2HVH A;  3K8V A;  2CG4 A;  4S0M A;  1RWP B;  2WVE A;  3Q8V A;  4OL8 A;  4ID5 B;  2M88 A;  3UR3 C;  2WB4 A;  4G3I A;  5DGA A;  4BCA A;  2KM8 B;  4PG7 A;  3EGZ A;  3TR5 A;  4PAB A;  4OHX A;  4DPO A;  1JKH A;  4TU7 A;  2N7C A;  2G13 A;  2B5J B;  4R25 A;  5BYR A;  2J9D E;  5E3C A;  5DDR C;  1JXV A;  4W4M A;  1WC3 A;  2KU7 A;  4FF1 A;  4OYB A;  1TMJ A;  3UW1 A;  5HL7 Q;  1S0M A;  3OR1 B;  2IVM A;  2W25 A;  3BS9 A;  2R7T A;  4CLW A;  3GFZ A;  3SFG A;  5KFU A;  2EVZ A;  1R6V A;  4I4B A;  2AGP A;  1FEH A;  2G0C A;  2XSJ B;  4QBU A;  3GFX A;  5ETR A;  4DR6 J;  2H65 B;  1AB8 A;  7FDR A;  2V67 A;  2B43 A;  2VC1 A;  2AYE A;  1DTQ A;  3IGV A;  3CC2 S;  2XB2 D;  4ECW A;  3PW4 A;  1T05 B;  1FRM A;  5G4D A;  2MHE A;  1TKZ B;  2CIM A;  1RZM A;  1HWL A;  3Q8U A;  2HSE B;  1UKU A;  4DUY F;  3M8W A;  2LLZ A;  2V2Q A;  1HNI A;  3OL8 A;  3DXB A;  2U1A A;  3NWR A;  2ADB A;  2B6A A;  5D4L A;  3R2D J;  1EHW A;  3IRW P;  1NK7 A;  2M4M A;  2YKO A;  1SC6 A;  1M5S A;  5J1E B;  1S9G A;  4B3M F;  1KVJ A;  5LOQ A;  4OJ1 A;  4J90 A;  2R2T A;  1VQ5 S;  3F73 A;  1HQU B;  1Q82 T;  3DMJ B;  5A6W A;  2HK2 A;  4HAC A;  4NYO A;  4YY3 F;  3OHB A;  8AT1 B;  4WP3 A;  4M1K A;  3EDQ B; 
#chains in the Genus database with same CATH homology
 2H65 B;  1RWK B;  3IBC B;  3D6M B;  1PYO B;  2CJY B;  2Y0B B;  2FQQ B;  2QL9 B;  1SC4 B;  1RWW B;  4DCP B;  2C2M B;  1RHJ B;  2P2C B;  2CNN B;  5IC4 B;  1RHK B;  3EDR B;  1RWV B;  1I51 B;  2H54 B;  3RJM B;  2C2O B;  2H51 B;  1I3O B;  3D6H B;  2QLB B;  3NS7 B;  4DCO B;  2XYG B;  2CNO B;  2DKO B;  2H48 B;  1RWP B;  4ZVQ B;  2H4W B;  2XZD B;  3R7N B;  2H4Y B;  4ZVR B;  3R7S B;  3D6F B;  2QLF B;  1RHU B;  2XYP B;  5IC6 B;  1IBC B;  3GJT B;  3KJF B;  2CNK B;  1RWO B;  2CDR B;  1RWM B;  1QTN B;  3QNW B;  1F9E B;  3IBF B;  4ZVO B;  3GJS B;  3R6L B;  1BMQ B;  2C1E B;  3GJR B;  3KJQ B;  4ZVT B;  1RWN B;  1GFW B;  2QL5 B;  1RHQ B;  1SC1 B;  2CJX B;  2HBR B;  3GJQ B;  4LSZ B;  3SIP B;  1RE1 B;  3R6G B;  2XZT B;  1SC3 B;  2H5J B;  2QLJ B;  2HBQ B;  2QL7 B;  1RWX B;  1NME B;  3P45 B;  3R5J B;  4ZVP B;  2HBZ B;  2C2K B;  2XYH B;  1PAU B;  4ZVS B;  4JB8 B;  2H5I B;  2C2Z B;  1QDU B;  2Y1L B;  4DCJ B;  1RHR B;  5K20 B;  2HBY B;  1ICE B;  3KJN B;  3P4U B;  2CNL B;  3R7B B;  3EDQ B;  1RHM B;  4ZVU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...