4ZVUA

Caspase-7 wild-type bound to the caspase-6 cognate tetrapeptide inhibitor ac-veid-cho
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
139
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zvuA00
5IC4A 4JB8A 4JJEA 4AWAA 4QU0A 4QUDA 2Y0BA 4PS0A 1PYOA 4QTYA 2C2KA 4QUEA 4QULA 2H5JA 3GJQA 2XYGA 1RWPA 4ZVOA 2WDPA 4EHNA 4EJFA 2HBRA 1PAUA 4QUJA 2H51A 3KJFA 1NW9B 3DEKA 2C1EA 1SC3A 2XYHA 3DEIA 4I1RA 1IBCA 3R6LA 1I4EB 3GJTA 3V4LA 4JQZA 2CNKA 1RHUA 2J32A 4D3ZA 4PRYA 4QUHA 3V55A 2QL9A 3H0EA 4HQRA 4JR2A 4N7JA 5I9BA 4ZVRA 3UO8B 4QUGA 5IAJA 2H54A 4QU9A 2FUNB 1RWNA 2H4WA 3NS7A 4JR0A 3NKFA 2Y1LA 1GFWA 1RHQA 3K7EA 1RHKA 1KMCA 4QTXA 2FP3A 2FQQA 3RJMA 3D6HA 5IABA 1RHRA 2H65A 4AWBA 3R5JA 1NMQA 5H0IA 5LU9A 1I3OA 1SHLA 3D6MA 4DCOA 3D6FA 4LSZA 4JJ7A 4JJ8A 2K7ZA 5IAGA 3DEHA 4NOLA 4M9RA 4DCJA 3OD5A 2DKOA 1SC4A 3BIJA 3E4CA 4JR1A 5IBPA 3R7BA 2XZDA 4EHHA 5IANA 3H13A 4JQYA 3V3KA 2J30A 3V4OA 1RE1A 3PD0A 1I51A 4IYRA 4QUBA 1CVRA 4NOMA 4ZVPA 5LUBA 1CP3A 4EHLA 1GQFA 3R7SA 1SC1A 1RWVA 2CNNA 2H5IA 2CNOA 3R7NA 4EHKA 1QX3A 2CJXA 2NN3C 1SHJA 4N5DA 3DEJA 4N6NA 4NBKA 2HBQA 3H11A 4I1PA 5LU8A 2HBZA 5IBRA 4N6OA 3V6MA 4QUIA 2CJYA 3P4UA 4ZVUA 1M72A 1BMQA 3PCXA 3GJSA 2C2ZA 4N7MA 2QLJA 4ZVSA 3SIRA 2AR9A 3S70A 4FDLA 2P2CA 1I4OA 3H11B 2J33A 4D3YA 3PD1A 1NMEA 4ZVTA 1F1JA 4PS1A 1RHJA 1RWKA 2CNLA 3IBFA 4AW9A 5K20A 2QL7A 3ITNA 2J31A 3EDRA 5IAEA 2H4YA 3V6LA 4EHDA 4NOKA 5LUAA 4FXOA 3S8EA 4QUAA 1RWXA 3GJRA 4QU5A 3R6GA 1K88A 4NOJA 5I9TA 1F9EA 4FGUA 4D3XA 3EDQA 4NBLA 3P45A 1RWMA 3QNWA 4ZVQA 1RWOA 3KJQA 2C2MA 4PRZA 4N6GA 1QTNA 3NR2A 3UOAB 3H1PA 2CDRA 1QDUA 5JFTA 1RWWA 2QLBA 4FEAA 3R5KA 1RHMA 5IAKA 3SIPA 4HVAA 4DCPA 1K86A 2QL5A 2HBYA 4IEFB 2C2OA 4EHFA 1NMSA 2H48A 2XZTA 4HQ0A 5IARA 4NBNA 2QLFA 5IASA 1ICEA 3IBCA 1JXQA 4QU8A 5IC6A 2XYPA 4EHAA 5IBCA 3KJNA
chains in the Genus database with same CATH superfamily
1WMAA 2O5RA 1DO2A 5CVEA 4AULA 3UMFA 4FGJA 4Q7QA 3IP8A 4HZGA 4M1TA 3TTVA 1U81A 3VPAA 4XRGA 4E1AA 3ND7A 4HDCA 4FFMA 5J5AA 3WAJA 5EHZA 3SF8B 3UYLA 2Z5GA 1E2BA 5FWDA 4LGMA 2FWMX 1EH5A 3ONFA 4GOND 5DP1A 3W90A 1Z0ZA 1C1XB 3DEKA 1F20A 3HP7A 3I76A 3DT8A 1IOLA 3PQ7A 4JLAA 5ALMA 2A2ZA 4CV3A 3I6YA 4F72A 4BIMA 1NAHA 2X23A 2ZR0A 2J32A 3O94A 3VMMA 3NC1C 1E99A 4JQCA 4PRYA 2A0FA 5EP3A 5REQA 4MOWA 3D3KA 1QO7A 2NXWA 2R751 2RAPA 2JGIA 5JY1A 1CRZA 3CSDA 3L5KA 1L4HA 1EK1A 1U6JA 3PXBA 3CB4A 5DBIA 4DWJA 5JU6A 4G0UA 3F71A 1MVNA 1QKJA 1XA0A 2RDMA 2XCIA 3CPEA 3DFIA 4LJ7A 3Q7SA 4M54A 1A9TA 1NZDA 2QU7A 4UQPA 1I5RA 1JIQA 2G9RA 3CNLA 4X8HA 3ZY6A 1U0EA 1XI2A 4ZU6X 1TUEA 1Z3CA 4KPUA 4CIYA 4HLQB 1ZOPA 2O8EB 5J3JA 1T6BY 1BCSB 5EI5A 4QBIA 2A94A 4INPA 4RGBA 4Y2JA 4YMVA 3B1YA 3G1WA 3I0NA 2IZ7A 2PQMA 5JBIA 2WZDA 2ZRQA 1RLJA 1GN8A 4ZCRA 1ZNWA 5JJKA 2I7XA 3L06A 3Q1KA 4XCXA 4AZTA 2QGFA 2GBLC 2IKQA 1N8KA 2YH2A 3AVQA 3L6EA 3KXPA 5BNWA 2PAFA 1F2DA 1PDWA 3ORSA 4J0IA 3TJRA 3OIWA 5DIZA 3N6RA 3VR6A 2E9SA 2E4VA 1KDZA 4F3RA 2JFHA 2IX9A 3EASA 3TNYA 2C00A 2C4VA 3SQXA 2H1IA 2X8JB 1TM5E 3KEQA 3FDJA 2EFCB 5LCXA 2IT1A 2O7NA 4GH5A 3LKZA 3O4VA 1WDMA 2A14A 1KEVA 2ZIVB 3GT4A 3WYGA 4Z51A 4FZRA 1IN5A 3W77A 2OCIA 4P3NA 4BO4A 1I94B 4LYAA 2JGEA 3P9QA 4NAHA 1PL7A 4N6NA 3A9VA 1G4UR 3JVIA 1M2OA 5A3SA 4AZ3A 2RAVA 5BQXA 2HIGA 2MMGA 3D4PA 3LC0A 3I5YA 5C80A 3DTVA 4ZTBA 2BM0A 4PONA 3WQBA 2O5EA 1JVBA 5JNRA 4YMHA 2NSDA 2P2DA 4UM8B 1JKXA 1KOLA 1W85A 4BLTA 3O3OB 1EA7A 1IPEA 1X3SA 3ESDA 2ZUBA 1WPGA 4KQFA 4YP0A 1Z8NA 4DY6A 2EGUA 3EZ2A 2H29A 4A23A 4ZI2A 4EMSA 4EMBA 1P75A 2OLJA 4Y3UA 4C7XA 4IJVA 1QZUA 2MCFA 4YQYA 5ALGA 1Z38A 4G37A 3TDNA 3B1WA 3UQZA 1BXKA 1U1IA 3CMCO 4LMBA 4MVJI 3RSZA 2NO1A 4MS4A 4ZICA 2TSYB 1G18A 2H1LA 3LKDA 4AY4A 4RU1A 3LZCA 1PLJA 4EA8A 5AIBA 3ZCUA 2WILA 2QP3A 1X38A 4TXMA 4Y9DA 2GR9A 1JAIA 1TKRA 2CLCX 3F74A 3OCJA 1YBMA 4DDHA 1F6BA 1KAHA 1W4RA 2HKIA 3I64A 4IIUA 4WK6A 1UFQA 4DM3A 1G2QA 3LDAA 4RGQA 4UTRA 2I1QA 1CHDA 1Y8QA 521PA 1LZLA 1X9IA 3Q5DA 1BWQA 4RMNA 2WAAA 2Z6UA 4HH4A 1R12A 1HYBA 1H8HA 2XUFA 4XLZA 3OFNA 1SCJA 2WKRA 2GJKA 1YACA 4HBGA 1N3YA 3VZRA 1Y7IA 3DMYA 2ZOSA 4JLPA 4EJ0A 1U5BB 4BRUA 4EY7A 5BMOA 1EFDN 5LJLA 4KKVA 5KNBA 1SKYB 2O2EA 2PT7A 5HFJA 4JJEA 5FAKA 5LQMA 4TUYA 3KQHA 2JI4A 3V4RA 4L57A 4R1MA 5KYYA 2AMFA 3LRXA 3NWOA 4LBZA 5BSVA 2BC9A 3RKRA 3MFQA 1MJGA 1WMBA 4JVMA 1B0AA 5AM2A 2FEXA 3BXZA 3TPFA 3ZHCA 3DMHA 2FG7C 2QTCA 4EP1A 4GU5A 2QXUA 1RHUA 1KO4A 2H4ZA 3DDOA 1TPZA 4D3ZA 2DG2A 3F73A 2NO5A 3NTXA 1AS3A 1ESEA 1FSZA 2FW6A 3KLOA 3UTCA 4EMUA 1PNRA 4Q00A 3AUFA 4BVEA 4X90A 3IKVA 1BGVA 1XLVA 2WQZA 2CFSA 3G1TA 4IFEA 4A0FA 5BSTA 1UT6A 3RROA 5T7BA 3AVVA 1ZPDA 3GRYA 3VU8A 3LSTA 3HZZA 1Q15A 1U9JA 2G4VA 3TTXA 5BV2P 4LK3A 1YFLA 2AK3A 5KWIA 5EZSA 4AUEA 1UWVA 5D01A 2EQBA 2ZI3A 1PJSA 5AVJA 1ZD2P 2VHQA 4ENSA 5AK5A 3V4SA 1SHKA 3KLBA 4UVGA 2NSJA 2QQEA 4RTSA 1U3FA 2Q5JA 5G41A 2JNWA 4A92A 1S4MA 2PKYX 2YHIA 2OYSA 3AGQA 3H6GA 2LV8A 3OD5A 1CUBA 4NAUA 4WNIA 3RYFA 1A9SA 5KWJA 1KY4A 1I8TA 2XH8A 1UMBA 4FVTA 1OROA 1U7OA 1VRVA 2X6TA 4H77A 4IVNA 4YJ3A 1EFHA 2ONYA 3F6PA 5K51A 1G19A 1VP9A 1OXXK 4MR8B 2FSHA 1EZ1A 4J90A 4KBFA 3KQMA 1SC1A 2CNNA 2FW1A 4LV8B 4DYDA 1R4MB 5FWXA 1XTJA 1HMPA 3HUUA 4Z1MD 2YMLA 1L4KA 1U4SA 3A58B 1WMFA 4GC9A 4N3NA 1GDHA 4UHKA 2PGLA 1HFJA 1NVEA 1V6CA 2PT5A 1JJAA 2ZCUA 3OJ0A 2XAUA 5HF8A 1UDRA 3OZSA 1U5CA 1EJBA 2CMKA 2WSYB 5D1HA 4ZARA 4ZAYA 5U4QA 3WV4A 4EUKA 2P1RA 3KLNA 4RMHA 1H05A 4FIDA 4KXXA 5KWSA 1GT6A 3CMMA 1GNPA 5FYQA 1F0NA 3E7FA 5EJ2A 5D51S 3EPKA 3GDOA 2EFGA 4ARUA 2RGXA 2GDZA 1PK8A 2R8RA 1A2KC 3HB4X 3R0VA 1E9BA 3AFOA 1P0MA 2JA2A 1FU8A 2ZAYA 2ID4A 3H5OA 3ICCA 2G67A 1FRQA 2PSDA 4R2WA 2ZSKA 4TKMA 4YWHA 1BDIA 2ERXA 1F9EA 2RE8A 4GEKA 4WLOA 1DC6A 3HRIA 3K1YA 1ZMRA 3CSSA 1JEJA 1GRCA 2PH7A 2EJCA 1PQWA 3QXCA 2WIDA 4DV0B 4WLVA 5DTIA 2E7ZA 2O8FA 1FNBA 4D92A 2RB4A 3REGA 4FN4A 4KHPB 2R2AA 1IZ0A 1NQOA 3CLUC 2RHCA 2ES4A 2IYYA 4MPPA 4RC9A 2FK7A 5HHTA 3KQWA 4B3XA 5EIFA 1K92A 3F4KA 2HJHA 4TZKA 2OVFA 4FHDA 2FR8C 2A1TS 2OHIA 3Q0EA 3QPUA 4FYYA 3TI9A 2I6FA 3WKAA 2QX9A 3JVUA 2QZPA 5INTA 5LFAA 4Z4QA 3FFTA 3ZV4A 1AT1A 1VI2A 3QW4B 4KMSA 3CRZA 2BGKA 4W5OA 3ZZMA 4WCVA 2X5OA 5B1SA 4PZAA 5JQGA 4QA9A 1GZ4A 5FF9A 1BS2A 3ZBUA 3D6UA 5KDDA 3FI0A 3K8YA 4L8LA 4NS1A 3STTA 5AOCA 3TNJA 3A6PC 3ANXA 4KQGA 4BNFA 2PEZA 1QK5A 4B6GA 3FFWA 2I4TA 3RLIA 3RVSA 4BNWA 3M4ZA 3IDOA 3JY6A 3R6LA 1JV2B 2HHJA 2PS1A 2OZEA 5ICSA 4G2TA 5FBLB 1TU4A 1TZCA 4PAWA 2CHGA 2VZLA 2OOKA 4CI0B 4BQRA 1J2EA 2B8NA 3EBLA 2MTBA 1UM9B 2ODWA 3FVVA 3ZZUA 1YHZA 2SNIE 4QT0A 5AM1A 2C8JA 4R83A 4G5OA 3ONNA 4E4TA 2GOYA 4G26A 4KWCA 5KSZA 2AQIA 1YF3A 4GKVA 2W8BB 5LQRA 2QVBA 3ZBQA 2ZPTX 3D43A 3L7AA 5CW2A 4R41A 2PXXA 2PX5A 3S40A 4ER7A 4ZYWA 1OTYA 1UOOA 5AVZA 1O0CA 2GHQA 3SS8A 1SVLA 3R2JA 4R40A 1AH2A 2WA2A 3W5SA 1C8VB 3KEMA 3T3HA 3RU2A 3O2NA 1Y1RA 4S1TA 1DG1G 2IEAA 3ISJA 3LCMA 3PNBA 1SGWA 4MHSA 4EUEA 1KU6A 2BM8A 3BXPA 2RH8A 1I01A 3GF4A 1UMDA 1YH3A 3AESB 4D3FA 6GPBA 5KVAA 1ABFA 1F3OA 1H4QA 3IUJA 3U62A 3AUXA 4EHIA 4IIBA 3C3EA 3L9WA 4JJFA 2CNOA 1YJCA 1DJLA 2C2WA 2YIDA 3PBKA 4ZQCB 1E9CA 3BJMA 3S4YA 2ORWA 4TZ0A 3S6JA 4PG8A 4QOIA 2AFIA 5LP6A 3O6VA 3S5JA 5C7LO 1YZTA 1AKUA 1OHHD 2C5AA 3LGAA 4RF2A 3WHIA 2BE9A 3ESBA 4QQNA 3WLKX 4MB6A 1T8UA 3VV2A 3TMYA 1WZCA 4FILA 4QASA 5HMLA 4UC0A 2H1VA 2IC5A 3E5RA 2ZJ8A 3TW8A 4J2HA 4U2DA 3AM4A 5ALRA 4I50B 4I6GA 3TSCA 3CGWA 3JALB 3R76A 4OHYA 3OPYB 1VKZA 4RQBA 4BUCA 2GTPA 3AJDA 1E1KA 5CXSA 4PZLA 2GUWA 4B44A 1YRYE 3PSAA 3RHSA 3GT7A 3SM9A 4RTPA 3HDGA 4XB6B 5U1PA 1TQ8A 2BDEA 2ODQA 1W9MA 3V46A 4UHDA 4EYOA 3H9JA 3GY0A 5LR6A 5AKKA 2HW8A 4Y0VA 2EKZA 3WOVA 4S1PA 4WVLA 5DYTA 1TZBA 2YXBA 4RVOA 1E5XA 1C1DA 3SJCA 4ARZB 1HG1A 1KH3A 3MT8A 4HVTA 2RBKA 2OD2A 5AXAA 1NKTA 5HM6A 4C22A 1UPUA 2F8LA 3PIIA 1KYZA 2ECQA 2X7JA 3VZPA 1J1UA 4R9UC 1HT0A 3UOWA 3VDXA 3T3IA 2ZJYA 3ZWVA 3IYLW 2O2IA 3IP1A 1ZX1A 5FA8A 1LQ2A 3F5QA 5ELMA 3VOAA 2PLFA 1F8YA 1MU0A 3C4VA 3KJNA 3IXLA 1L4NA 3PKJA 4L0CA 1GR0A 3UFXA 2O0HA 4DV5B 4AMUA 4EY6A 4W5QA 4KRGA 1E60A 1RI2A 3OJOA 1YULA 4ZZIA 4D4KA 5NULA 2ADOA 1KJIA 2JFYA 1H2XA 2HWYA 3JAWA 3O82A 1XVUA 4NU8X 4XB1A 3MMNA 2SKDA 3LUHA 4YREA 3TLYA 1Y48E 2IDMA 1BQEA 1Y82A 4QX6A 5DB4A 4B4OA 5ITZA 2WZCA 1RCUA 1TEVA 1W4LA 2OVBA 5D6NA 1V9LA 5BN4B 4CR7A 4QUHA 5C51B 5C52B 2WNHA 3OKAA 1XQYA 5CVVA 2FFRA 2XWPA 1EEXB 1BC5A 1AN0A 1SKMA 4TVSA 3VAZA 1TYCA 4PLFA 3GLSA 3QMWA 2V4MA 3STUA 1V26A 4MIKA 1DAGA 1RQXA 1Z4OA 5FLYA 1K6JA 4B6JA 3Q9UA 1IXKA 1EG2A 4J16C 1SRRA 1QCZA 4EECA 5I7UA 3GCXA 3VA7A 5JXIA 3CURA 3FYTA 2RGUA 3MF4A 5EIAA 1HDGO 1Z33A 2E5FA 3A6KA 2P5YA 1MXFA 2IUSA 1IQ0A 3C3BA 3AFHA 4V0NA 3E61A 5GWXA 4F21A 3ABQB 3AG6A 1QR2A 3AJEA 3VKWA 4DCOA 4MDEA 4WNAA 4DLXA 1K8YB 1C7ZA 1MENA 3A9TA 3INNA 2NW6A 4DLVA 2JBHA 3L01A 4YCJA 3JVEA 3PDIA 3RRXA 1ZITA 4U3JA 3ZLVA 1HE4A 5KOJB 3HC7A 3CX7A 3VSCA 4GOXA 4CM6A 1C30B 3NTVA 3G2LA 4KPFC 3S2FA 3BMXA 2ZS8A 4BO5A 4D41A 5KB3A 1PT7A 2WLSA 1XKQA 4KQEA 1KQOA 2PD6A 2ZW9A 1S6YA 4WY8A 4CG0A 4HYEA 3KEOA 4WV3A 4WXEA 4FYJA 1LX6A 3F9IA 5AVQA 2HR1A 5EFZA 4Z0TA 3RV4A 2I2CA 1JDBC 4FDVA 3RVMA 3DBHB 3VR2D 2FFQA 3GLIA 5E9JA 1MC1A 2F00A 4TRMA 1W19A 3KELA 1K4YA 3QVKA 5LZ8A 1O9HA 2A1TR 4D8TA 3HN2A 4L5YA 3RT9A 4W7SA 1C2TA 4KN9S 2P0AA 5H16A 1L5KA 3UMRA 3QXXA 4YUYA 4Z7NB 2RIPA 4Z9YA 1XTRA 5JEDA 2D00A 4E3WA 2XHEA 2BH9A 4NP6A 5AYVA 4ZI7F 4GRIA 2QPAA 2BHRA 3OZTA 4PLTA 1SUEA 1LQUA 4CE6A 3WGIA 3DBVO 2N42A 4GOKA 2PG3A 2V7WA 1S8NA 5IRCD 3SOPA 4W5NA 1JR3A 2UYGA 2YCBA 4F6RA 4ZVQA 1RWOA 3GROA 3WYNA 3A2MA 4CMGA 4WEQA 1DEOA 4TSRA 4X91A 2C31A 3PHLA 2WTNA 4P31A 4G0YA 2R1VA 4QYTA 1M0WA 5D3QA 3LQYA 1T9HA 2HSZA 4YJHA 1WMDA 5LMUB 1JSCA 2QD3A 4B3MB 1QFJA 2HFKA 4TL6A 4D79A 4OKSA 1JDBB 4NENA 2H2GA 1U2ZA 3AL3A 3MBKA 3K8QA 3PTZA 3LUPA 1D6MA 1HDIA 2XD9A 4HGQA 1XYVA 2X5KO 3A0RB 1L5FA 3QI7A 4C6RA 2VNJA 4XASA 3NHYA 1Q91A 2X9QA 4ZK6A 1DDGA 2A5JA 2H52A 3M6VA 3HGMA 3RFCA 4GPEA 8ATCA 1GY8A 3NP7A 4O4IF 1YJBA 5DEIA 4BEJA 1K7FB 5GV8A 4AL4A 1JNXX 3DXYA 1DQSA 1TAUA 2PYDA 2H5JA 4Q9KA 3L7MA 1XSEA 5L8VA 1NOIA 3PE3A 3QFFA 3TZKA 1O5IA 1N0IA 1E4EA 5CYGA 5EIHA 4N01A 1TM3E 3BIXA 3O93A 3PNKA 3SNKA 2UZIR 3CG4A 3R1IA 1O08A 2P78A 2WU0A 1OXVA 3OZBA 2Y05A 3B6JA 3QVLA 3HLTA 4UDNA 3CW8X 1JU4A 3BQMB 1DTWA 3A1VA 1DX4A 3HCOA 2Z4SA 1LBSA 3AILA 3NV9A 2WUVA 1UWKA 1Z4PX 2AD1A 2PWBA 2D0DA 2VNAA 2QTWB 1DI0A 1A5TA 2RBGA 2VCHA 3EWNA 3SAJA 3SSAA 1WKBA 2ZSAA 4DIUA 5I7OA 5KS2A 1DPGA 1CEYA 1LRLA 1OZ0A 4V24A 2WZQA 2OMKA 1CD5A 3AY0A 5F9HA 3FVWA 4ZIRB 1RLOA 4G1UC 3RWMB 1E2JA 2CLLB 1U0RA 5LBIA 1W25A 5DYGA 1NQXA 5A6VA 4HN9A 3TQOA 5M3BA 4V2IA 3NAZA 3P2YA 4XE5A 3T15A 1VC2A 3ZK7A 4JI7B 1C4KA 2G4LA 4TMKA 4D0RA 2NQ8A 5KQLA 2O50A 3D8HA 3UV7A 1VHTA 2CXXA 5A4DA 4LRTB 3TMKA 2CJFA 2D13A 2JH3A 2QV7A 1WW3A 1XKXA 3LP6A 4ENTA 2KW5A 2DWCA 5JC8A 3CLTD 3U4GA 1TK2A 1JLMA 5LUBA 1QPZA 3C45A 3C3PA 3OIGA 3V9AA 3VU9A 2EEZA 2BF7A 3H84A 4MWBA 3E7XA 1W1WA 1VKRA 3OIYA 5LDGA 4CTNA 3J81k 2C58A 4DLBA 4N0PA 3ZTTA 2J0UA 4KI7A 5E4FA 3DG9A 1P6QA 2P9CA 3KSRA 4LXXA 3V80A 1XA3A 3R75A 4TZ6A 5DZSA 1PSWA 1BXGA 1MABB 8LDHA 5IYZA 5K0BA 5BWMA 3EXEB 4BZWA 3PCXA 3PUHA 5IK2A 2FWRA 2QNIA 4R1SA 1GGNA 2Q6VA 2UYQA 4I0WB 4AF8A 5ALLA 4ZEMA 2GBCA 1ECPA 3T7IA 3I4FA 3C6KA 1J9GA 2QTNA 4LOLA 1AJEA 2CL5A 3M5CA 3D8UA 1WD5A 1PL6A 3QA9A 1WSWA 3FNBA 4GVLA 4M55A 1NVUQ 3KR2A 1LVHA 2QNRA 4YIKA 1UDBA 3MIIA 3R0JA 3P20A 1N9GB 1XHEA 2EG5A 2J9GA 3G9QA 3UUWA 3V1NA 1WOYA 1SC6A 1GPMA 4I3FA 1RRPA 2B98A 1GUBA 5KX5A 3BTVA 4PRZA 2C5GA 1M6VB 3FRIA 5HFNA 1BE6A 4H7JA 2O7QA 2JDIA 2XBUA 4P33A 1DRJA 2HO5A 1SHZA 2IVFA 3CZRA 4UVHA 2J3JA 4H0NA 4O2AB 3LNTA 4WN9A 1Z8FA 9MHTA 2HZ7A 5IARA 1NE7A 5DTEA 4UASA 4EKNB 3HP1A 3IUNA 1VMIA 2P27A 3H86A 4PSDA 1RAHA 1D2MA 1GEEA 5DKFA 1C3VA 4RFLA 3VPFA 2POCA 4ETMA 4GQIA 1S8AA 4G8CA 1VE5A 3HUDA 1AUPA 1Z5NA 1SHTX 2UZ0A 1O57A 3EY4A 3K8OE 3KAQA 1M8GA 2XT6A 4GXQA 3IIJA 5EQDA 1NI4A 1Z0IA 1QHEA 3SHTA 3SSOA 5FBHA 1JEQB 4LQLA 4UM7A 3K71B 3MRTA 2Z8YM 1FX1A 1MZPA 1R0SA 2OAEA 3DCNA 4OSOA 1QYVA 2ZQYA 1AGXA 1XGKA 1E0AA 2QNBA 1YC5A 4CIBA 3NHJA 4K6HA 1I5EA 3O95A 3MT0A 2VYVA 3NANA 3ZX4A 3L8CA 5I7SA 5A2QA 2C9DA 3VR3D 4LI0A 4RJIA 2Q5QA 3WIDA 2IV2X 2R6ZA 1OA1A 2V6IA 3NJRA 5TC4A 5HQTA 3HNRA 4OQZA 1SG0A 5HIKA 2LRHA 3TO5A 3TUZC 3I0ZA 1O0BA 3A1CA 2H1FA 2AEJA 3ML1A 1U9IA 1VLHA 2RH5A 4OFWA 4LMAA 4JLNA 1MHTA 4J3JA 3MJVA 1NJ6A 3A9UA 3P9ZA 4FQ7A 4RK4A 3MLBA 2FZGA 4LHYA 1GV0A 1YE3A 1QCDA 3NIGB 1CG6A 4ROSA 5BYAA 2XZLA 4ZDIA 1RI4A 4MQ4A 3BMOA 4CTOA 1CSEE 3S8MA 2G0NA 4ERXA 4JODA 2G82A 3PE6A 1TM7E 3QLTA 4RNCA 4WX2B 4I9UA 3LHIA 1QTRA 3VNBA 3ZY3A 3AVUA 4E13A 4W5JA 3C6ZA 1WKCA 2WF9A 3DJFA 1SC4A 4Y1FA 3P26A 1NF8A 3V33A 1ZDMA 3WJAA 1XDWA 5FUXA 1I51A 2CF5A 3EEQA 3M2TA 4KYVA 2R47A 4RMGA 5CTJA 3WG9A 2C2XA 2I33A 3PJEA 4IILA 2BFOA 2I2DA 3RV3A 4JMLA 4IKEA 1BW9B 4ZHQB 5SY9A 1FFHA 1TIPA 4OYHA 4B6OA 1XZFA 4CG1A 3CVWA 3I6MA 4JP3A 4EHBA 2WHRA 4L0DA 4UDOA 4OI0A 4O6VA 3RS9A 2L19A 5KDOA 3PENA 5IXYA 1LC3A 1NP7A 2RMKA 2QEQA 3PNVA 2PUFA 3B1VA 1LD3A 3DE6X 3AG5A 4PQRA 4PNHA 4UHFA 1YIDA 3V7WA 1QH8A 1KO1A 2UZAA 4NBSA 2ZLBA 1EQ2A 4OB8A 5K8CA 1KOGA 1KXJA 2AFRA 1NBHA 1WG8A 1Z16A 3CB2A 4XYEA 5EUBA 4WBXC 3JTEA 1DXQA 3H7IA 2IK8A 3L0OA 3JWIA 2DPMA 1HT2E 4YB8A 1D3AA 1HORA 4ZV7A 3SJZA 2ETXA 4Z1OA 3U5ZB 2AEEA 4YYZA 4W82A 2P9FA 2YVUA 3IELA 5C3MA 1ZVVA 2CLHB 3LVQE 4JL5A 4QYIB 1E6MA 3BCSA 3ISTA 4QTTB 4MIOA 1QO0D 2CV0A 1QV9A 2G1KA 5GTDA 4JUAA 1P2VA 1WZEA 1N6OA 1E9RA 1X13A 3E9YA 4WDRA 2GTHA 2HNAA 1EP1B 2RD2A 1R0LA 2M2IA 3PWTA 3Q9NA 5GZ3A 5ALWA 4FR0A 4QPNA 4E5NA 1H2ZA 3PNSA 3MTDA 3F6CA 3ROQA 1IPFA 1BYUA 3D3QA 2E6UX 4LZLA 4JSTA 4HWPA 4JJIA 2H7XA 1LPOA 4BXOA 3GC6A 4DOMA 1SXJD 4HOYA 4HB4A 4TMXA 3W4JA 4E5KA 2HQRA 4IIJB 3D54D 3WGZA 3FDZB 3MHPA 2CKMA 1UMCB 5E2AA 1V41E 4PTZA 2V8BA 3QXHA 2PKRA 3IESA 4KXYA 2WE8A 1W76A 3N2GA 4CF3A 5I9IA 1F51E 1PFQA 4O2BF 5AJVB 1J49A 1IJKA 3PJGA 2PKQO 1DJNA 1F1BA 4I1YA 4LV5B 4RE5A 2ZBDA 1OIWA 1UDWA 3DJYA 2G72A 2IPAB 3NETA 4RZ3A 2WJ3A 2RG7A 1HTBA 2JJ2D 4I1RA 3ZDEA 1J5PA 3ZDQA 4JVLA 4IDCA 4NDAA 1GTRA 1FRVA 1OFTA 1VSVA 3SR0A 1X92A 2ZYWX 4IRXA 1VYHA 2EIHA 3C7CB 4KX3A 4LZWA 5AO9A 5HGXA 3MJFA 1CBUA 2O05A 2V65A 3DEAA 4MX8A 3RBAA 4CKCB 3DMPA 3FMFA 4EQ6B 4M36A 4QUGA 3S7ZA 5BWOA 1E3TA 1JGTA 2DCMA 3FPCA 2GJ8A 2Y1LA 1G42A 2X7HA 3MS7A 4G85A 5KQRA 3SVLA 1OKKA 1WUYA 3HKDA 1QWOA 1GTJ1 1RI3A 2BDUA 4Q4DA 4GAEA 4BX9A 3QENA 1ANKA 4HXYA 1SXHA 5I7VA 2D1QA 2P2ZA 1GAEO 4QDTA 2R96A 4ZZ3A 4R69A 1Y8ZA 4Q4JB 5HJ5A 3P2OA 2Z56A 5LQAA 1YKGA 3K73O 3BGOS 3WC4A 2A0YA 1QX4A 4DLTA 3GJYA 3NFYA 4QYXA 3LLSA 1JI3A 3X3HA 2I3DA 5TX7A 4A8HA 4DZTA 5FI5A 4GQAA 4QUBA 1H0KA 5E7QA 2GK4A 2GJSA 1QG2A 1BEUB 5B57C 3R44A 1OH5A 3O8BA 1WSAA 2QD5A 3LHKA 4AJPA 4QGGA 4B34A 3VM6A 4DS3A 3KB6A 4ZZ2A 1A5ZA 3HKEA 5G4LA 3B12A 3FYUA 1J2JA 2JVKA 3DZKA 4W1RA 1ODJA 2FRDA 1O9GA 3B6ZA 1CUVA 3BA1A 3FDIA 3ETDA 4ZCMA 2HF9A 2WVGA 2DY1A 3VR4A 5TIIA 5DHTA 3AU8A 3T99A 3EJWA 3QE4A 1U8ZA 4KO4S 3RC2A 3B85A 3B2EA 1AD2A 3RGWS 1FP2A 3KCQA 3U0BA 4BLVA 4X66B 2VHXA 2Q5EA 2ZQ5A 4UAJA 4U2BA 2CSUA 1CR6A 2NUPB 2Z8XA 5MN4A 2GXSA 3CPJB 4ZXFA 1ETUA 3BGWA 4QFCA 5TRTA 3F9CA 5CA1B 1C7IA 3EFHA 3UHAA 5JISA 3RQIA 4O08A 5E6RB 2DFTA 2NOAA 2WICA 1WPXA 3MRXA 3H4TA 3NJ4A 1GFIA 3TR0A 4NATA 5K01A 1QQBA 2QPTA 3QFSA 3VNSA 3B3AA 3D7MA 1O87A 1U9ZA 4FFVA 4JYZA 4IDQA 2VBCA 1VE6A 1UPXA 1Y6ZA 2LKCA 2ZIGA 4KR0A 2QF7A 3H1PA 4ENUA 4WY2A 1NL3A 4KQIA 2QZ4A 4V38A 1P1FA 2ZI9A 4F9TA 3DBIA 2CW5A 3KVYA 3IT2A 1N25A 3I1FA 3LL4A 1MA3A 3V2IA 1VJ0A 1QVVA 1XRPA 2PRYA 4OUDA 2C9BA 2BGWA 2PRIA 4CDNA 5A1JA 2RHGB 2YIMA 2HREA 1ZWKA 1YDMA 4CHTA 2WYOA 2ZIFA 2Z8YA 4LNUB 4D0SA 4RFSB 4HDRB 1YDFA 3DNMA 5JAHA 3JQAB 2OP1A 5D5PA 4MITA 1W46A 5CDYA 3HVHA 3A6LA 3NONA 4LYYA 5GPBA 3WXMA 1XNJA 4DQXA 1RZRA 3EOAI 4BFLA 3I52A 3I53A 1QNLA 4EJFA 3R3UA 4NYMR 3ZHRA 2AA3A 4BZQA 3BDAA 2NU8A 1Q21A 5A4AA 2G80A 2R7KA 3JRNA 3C6MA 2V6JA 3KUCA 1GCGA 4FOTA 4HN2A 1XKTA 1NVMB 1ZD1A 4QXRA 4OB7A 2CN1A 3E8MA 4EL0A 1HF3A 1U3DA 4XGKA 5H83A 2QW8A 4TV8A 3NWEA 1GIAA 2O2SA 4C21A 1ST2A 4CM7A 1DIAA 4PLPA 4DKJA 4JU9A 4YN3A 3ZI0A 5LYJB 4MXDA 1KI4A 3ZWDA 2OD9A 2BGJA 2HK7A 1RHQA 2GWHA 3FOFC 4R8SA 2FMHA 3NHRA 2OV4A 3VR4H 4ZOLA 5JVDB 4E12A 2K2WA 1AN9A 1XDUA 2ZIXB 4D9NA 1CR0A 2H4JA 1GZ7A 4ARVA 2JLAA 3CH6A 3WGTA 1UBEA 2O7SA 4BFCA 4XA8A 1L5GB 4YT4A 3U3XA 1LNZA 2RI0A 2JHFA 3GFOA 4RTNA 4FCCA 3L9XA 5TPWB 1EP9A 3PYMA 3GRRA 4MP6A 3WSWA 4Z5XA 3FN4A 5BUQA 4I4TF 1THGA 2ZRHA 4YCBA 1U2RA 1W36D 2D1FA 4AN1A 4JYMA 2WD7B 1KEWA 2WKPA 3B2QA 5KQSA 3LLCA 1ZFNA 4JI3B 3RIXA 1GU1A 5LNK1 1B23P 3HSSA 2CXQA 5G2OA 5JH7F 2DH5A 1YZFA 2QVXX 1FYXA 1P61B 5L4LA 3OJWA 1HSZA 1AGNA 1LY1A 3TNDA 5TMPA 1NVTA 1XEWY 1QAMA 2ZROA 5E7IA 3TRKA 1ML4A 1V3TA 3I9LA 4JX8A 3T0FA 2RGRA 2NO4A 5CP8A 3MXTA 4AY5A 1W94A 1SB9A 3E2PA 3G17A 4QE3A 2QUHA 4N6OA 1ODFA 3BT7A 3VUFA 5D3MB 2NXJA 3E3LA 3HP4A 3RTBA 4EKIA 1XNQB 2R86A 1AMUA 1YB6A 1IL0A 1QGOA 5CX1A 5AVOA 1UPAA 2EAUA 4MLDA 3FM9A 4LMPA 1YZKA 3ICQB 3WB1A 1GFSA 4DV6B 4OK3A 4N8DA 1KS2A 1XRQA 2GGSA 1AB6A 2H00A 2VDUE 4B87A 3U7QB 2JLXA 3GAMA 4EPWA 4CMIA 2R1UA 4ZOQI 1SY7A 2R6JA 1VPWA 4MDFA 1FFEA 2HHCA 3HCNA 4LMRA 1QV7A 4HN4B 1M34B 4L4UA 3PFIA 2OENG 1E2FA 1XV5A 3D6VA 2Z1DA 5ES3A 5LBUA 4BB5A 5KTMA 1TYBE 4WKCA 5AK6A 1JBKA 1KDOA 2HXGA 3PC7A 4TVBA 1W5FA 1JSXA 1OX6A 4YRDA 2IUUA 1A4XA 1CX9B 1M0TA 1VHWA 2F3TA 1RWWA 3NIDB 5JRDS 2W4MA 3DC7A 3R5KA 5CLGA 1FS4A 1KZYC 2IHKA 2YZNA 2ZSJA 3KWLA 5DGTA 4C7OB 1QH1B 1YDWA 2OFXA 2ESRA 1F14A 4P35A 4DRYA 3HHEA 2XUGA 3AUAA 4O4JA 3HR7A 1A9ZA 2J5RA 4D9EA 5JBNA 1KFBB 2JBAB 5KSOA 1G60A 5A2GA 1JF8A 3CRQA 1M6EX 1QE5A 4JITA 1XF1A 1ST3A 2ZJ2A 3BHJA 2O1EA 3LD9A 1C81A 2WJAA 3G2QA 3GJ8A 1JYFA 2H2IA 3QHQA 1RIIA 4NAVA 4MGYR 1R66A 2GKGA 2Q50A 2IGBA 1P5HA 5FH9A 1P9RA 3FPGA 5T3YA 1Y1PA 1DWPA 2W83A 3A04A 2NT4A 3GJTA 5E0KB 1ZD9A 3TUJC 4F9FA 4DBZA 2ATXA 3N8IA 4OLHA 3OX2A 4XSGA 4DPMA 4AWXA 3H83A 5HUQA 2C3UA 5AK4A 4QPZA 4BB0A 2J0QA 1KAGA 1QYCA 3GZJA 4R71A 4Q4HA 3ZU6A 3LT5A 2XZOA 2V7BA 3CXRA 4ZO8A 3T7RA 2WJWA 5IUNC 2H1OA 3M82A 2QRQA 2AFHA 3RRMA 3WBBA 3OETA 1LPSA 5JD6A 3HN7A 3KFVA 5KQGA 3QELA 2FDCA 2QRGA 2GEVA 2ILTA 4ZDWA 1JFVA 3B1FA 1V1MB 4UBNA 4BGUA 9ATCA 1P4GA 2XRYA 1OA0A 3PNMA 1COWA 3PCTA 3SVZA 3TRFA 4BO3A 2H65A 4Z3OA 1I7DA 4D26A 1PE0A 2D1YA 5U4XA 2X8LA 5TQ0B 4J0KA 5JNWA 1LLFA 1YKSA 2WT9A 2XVXA 2J9YB 1MHPA 2VN8A 1KAEA 2WSSA 4PO3X 2DUJA 3X2FA 5B4VA 1WXQA 1J0DA 5JDCA 2W6CX 2EYQA 3AUKA 1QQTA 4MQ5A 4Y2GA 4EHHA 2Q1SA 1Z35A 4F45A 3N7UA 1E2MA 4G09A 4QBGB 4BNYA 3AL2A 3KZOA 3ZDFA 1EVJA 1J1ZA 3MTAA 5KTRA 3ABIA 1OLUB 3GVHA 4TUYF 3GRKA 2NZUG 2I6UA 4AO7A 4RACA 4RLFA 3RC7A 2XCOA 5AOAA 3R77A 3B2NA 1P5JA 4R84A 1ISPA 5DI3B 1OX4B 4BQFA 5AESA 4KL8S 4AS2A 3O3NB 2CHVA 1JHAA 3M5WA 3V6MA 4CCYB 4DV4B 1YCDA 1RXWA 4RY2A 5AM4A 4YP5A 3K09A 2WWGA 1Q7BA 3GR6A 4G1MB 2Q2WA 1TGVA 1G98A 4FKMA 3CR7A 2CZCA 3DV0B 4GZ5A 4KE8A 4PCUA 3WK5A 1K0FA 2VHTA 1IONA 3U49A 3P8ZA 1NVVQ 4L2IA 5DN9A 3NUGA 4JHLA 1BDMA 1SQ0A 4IEIA 2BFBB 1DU4A 3Q3JB 4JBNA 5K4HA 4C14A 3K1ZA 3WK4A 4PPQA 1FCJA 3MIZA 2A88A 3AOEA 2Z95A 3RODA 3U3OA 2W0SA 1D9ZA 2FPPA 5ESRA 2AOWA 1J1IA 3MPUA 3HO6A 4BFUA 4HAZA 3I23A 3DE3X 2YMPA 3TWOA 4C07A 5LP1A 1EWQA 1XYGA 1QLWA 4DB4A 2WM9B 4U6NA 4FWBA 5DE3A 2IGTA 5F52A 2C3YA 3GUHA 3O9ZA 5J58A 1ZSNA 4F4FA 3UWDA 3B1JA 5HPYB 5KOYA 2FR8A 3EF0A 1L7PA 1U2DA 1WCXA 4Y2HA 5JROA 5JSZA 3OLZA 3O75A 3UA4A 5T67A 1Z2AA 1SXGA 3LX5A 5DM1A 1YI8A 2FR0A 2WZBA 3AX6A 3EGVA 3H9EO 4JYPA 2HRQA 3QPBA 4FNAA 4YJ3F 3VPXA 4ETNA 4TLAA 2PBFA 3FF1A 3AO0B 1XN1A 2HK9A 3I9JA 4OI4A 4O4HB 1G59A 1XFAA 3W34A 3RK4A 3GJ5A 1L4EA 1K9VF 2C7BA 3KO8A 4HD8A 1GUZA 4HVLA 4QECA 3ZWOA 5IDYA 4ARIA 2KSQA 4PS0A 3ER6A 4JJGA 1TE2A 1GPYA 1X87A 3DSRA 4EABA 5A0TA 1D04A 5CYOA 1NC1A 3OOSA 3PFBA 1J07A 1L7AA 2EW2A 2WAOA 3NOOA 2Q3JA 4WESA 1OXMA 2I5PO 1I1NA 1N2ZA 1QC5A 3VHXA 1JFSA 4EEKA 1SK9A 5LYYA 1NY5A 1FSPA 2EYUA 1TUBB 1KKUA 1EVQA 3RK0A 1DG9A 2WAXA 4NZPA 3K31A 1RXSA 3GGCA 3AERA 2BFCB 4MIEA 1VIYA 2V4ZA 1U1GA 2RGEA 3R5TA 4GBED 2H7YA 2HC9A 2BELA 1H8ED 4N7JA 4P4SA 5DVZA 2P6MA 2VLIA 3BKWA 4PLVA 1KEEB 4X95A 2ZWPA 2ODAA 4OLFA 4HDMB 2AMVA 3ZDRA 3OKFA 2FCRA 4A2PA 1GFWA 1G8HA 1Z4NA 5D84A 5IDQA 4Q7KA 3IR6A 3LAWA 2W2PA 3CZCA 3Q3VA 1DKPA 3L0ZA 1GAWA 1GQYA 4A8JC 1CRPA 2F4NA 3NJ8A 3U44A 2X5XA 1OYOA 3R6TA 1T3HA 4I50A 4JYAB 2RHRA 5HS6A 1V5WA 2VBFA 5BPFA 2G1UA 1JDVA 5DN6A 3L6DA 4XD7A 4FYKA 4H59A 1T13A 1XTBA 1YR7A 1AA9A 4XIGS 2Q3BA 4DAOA 3TSOA 1ZOLA 3CY6A 3K94A 1YRHA 3WNBA 1ZN8A 4DCTA 2IX3A 3EEIA 3KUKA 3D81A 3Q2IA 5DWQA 3ICEA 4N1AA 3ZJUA 3UAOA 4HNGA 4BO6A 4BVHA 1JSZA 5CCBA 5D87A 4HDNA 4B9AA 4PHHA 3C97A 3DP7A 4UHHA 1PR2A 5A3VA 3RYCB 2Q1UA 5FJIA 5JQGF 2WJHA 4I8DA 4URHA 1REQB 2QORA 2CVZA 5CLJA 1KEUA 1WB4A 1XCOA 3PVCA 4E1VA 4HNTA 3D9QX 1NMYA 3VPBA 5A7FA 1Y1QA 4BNKA 4DA8A 1HDOA 3AWDA 3EPRA 1DXOA 2CJYA 2Z2YA 4C7VA 3ORYA 3DAYA 4A8JB 3GLUA 3DXFA 4WKOA 4YONB 2Y68A 2QSZA 2C42A 4H18A 1WUKS 1CDDA 1R0KA 4TTIA 4NC9A 1HNWB 1W88B 1TQ6A 4XDYA 4D9HA 3NQ41 1OBCA 4HZUB 3MD0A 5K0LA 2X1HA 3E58A 5CB4A 4RVDA 3U9LA 1NNEA 4ANFA 2HDNB 2GI4A 5BSEA 2JGNA 3LH5A 2JFWA 4JNKA 1E6WA 1CQPA 4HLDA 5EP1A 4IGEA 1IQRA 5KWEA 3GN1A 4IXMA 4FTWA 3M9LA 2QAJA 2D5BA 3NBFA 2JIZD 5BXQC 1RABA 4OHPA 4CEIA 1VL6A 4QBHA 1LPAB 1NN0A 2VRCD 5F7ZA 3N5CA 1J4AA 3N2ZB 4KLZA 1GN9A 4WCFA 5FPSA 2IW3A 2X1MA 3H5LA 2F3UA 3PS9A 4PBTA 1GAJA 2E48A 4XGNA 5I6DA 1M2GA 1WU7A 2PGAA 2D0OB 2H06A 1ORWA 1SMKA 2OGUA 1C3EA 2JW5A 2HRDA 2Q6OA 1VGQA 1E0JA 4HZIA 4DR3B 1NBAA 1NW4A 4U5QA 1XQWA 1C9DB 1VJCA 3IPRA 3D3WB 1R88A 4TKLA 4A15A 3Q2OA 3IBCA 3EPHA 2JAXA 3EYWA 4LRQA 4MV4A 1AZSC 3GZ4A 4F4DA 3KFLA 3IUBA 4A5SA 4XPIB 5AR1A 2O0JA 5EJ5A 2E5WA 1PG0A 4HGZA 2C1XA 2OLEA 2P4SA 1G6Q1 1WHSB 1NNI1 1ZAYA 3LW8A 1H66A 3DQQA 5KTNA 1T25A 1E92A 2XVMA 4PO9A 2JGAA 3V4VB 5KOJA 3PNLA 1IBCA 2PL1A 1NLZA 1XZNA 3CEPB 3QEKA 1B6GA 2QUIA 4FZVA 4JP8A 3VHQA 3CS3A 2VIIA 1O96B 2Q2NA 3F3SA 2OV1A 3RJTA 2PKEA 3H8SA 1DV2A 3OT1B 3C3CA 3BMNA 4JLMA 3ZCVA 4XJXA 1CUCA 1RYHA 4GSKA 1OZHA 4L74A 1OV4A 3GFPA 2OHXA 4J16A 4DEVA 4CN9A 4HQ6A 2RJNA 2CMHA 2W93A 3L0CA 3DBHA 2H1SA 5FFNA 4MARA 3URMA 3KLPX 1EDDA 3UMJA 5BUCA 2ONKA 5HQ3B 2I3GA 3R5JA 2MSLA 2OB2A 3A3OA 5JCJA 1FLDA 4BAUA 2QBYB 2W71A 2ZBQA 2VWPA 2GPTA 3CLSD 3C4QA 1DBVO 1NOJA 2JRLA 1V9CA 2D54A 4DDMA 2VAPA 2IZ0A 4YPVA 5SYAA 4DA9A 1BFUA 4KGDA 2VQEB 1U2GA 3G5TA 1PJCA 3CZPA 5ENVA 4C01A 3KJIA 1U0BB 1ZA2A 4BMCA 4KQXA 3PGXA 4WZAE 1DXHA 3VZCA 4OTZA 1OAOC 3F9RA 5DTMA 1MJ5A 1BZYA 3G2HA 4BU1A 3DZIA 3HYRA 4UJ5A 3RVRA 2IHTA 1V39A 3LFHA 3T0GA 3MWDA 4Q3BA 1ONPA 2JKZA 4DPLA 4G81A 4DTIA 3K1TA 3WRYA 3THYB 3D3EA 4LF4B 3ZWQA 2DQZA 3GFBA 4QXAA 2XTMA 1YBHA 3EXIA 3QWHA 1HNNA 3U2QA 4C3VA 4IW3B 2CF6A 2B94A 4GUAA 2OHHA 3Q8WA 4YR7A 1OFUA 2VDNB 2N1BA 2HQBA 2ZTMA 3IAAA 5TQVA 1Y9DA 5G0UA 3CLUD 4KI0A 2EIXA 2VAWA 4P2GA 5B3JA 4C1BA 4Q3KA 4ND7A 2Q8NA 5P21A 1QG0A 2H5LA 3DEYX 1B1CA 3T52A 1T6XA 3T54A 3AR9A 3OF2A 4H0FA 1JQLB 1NU6A 4C0HA 4EDHA 4YIHA 1L4YA 4GYKA 5AMXA 1XELA 1DMRA 4J3FA 4S2UA 4EGAA 1AB5A 3CJRA 4G1FA 4RORA 1DWQA 4N7RA 5CH3A 5KNDD 2Q4DA 3QNWA 1QP7A 2FPGB 2DR2A 4DLZA 3FDXA 4KNYA 3UXMA 4ETIA 1ZQ1A 1JPVA 1A8QA 1T0IA 3LFTA 1CULC 1P2GA 2FLWA 4B3IA 4NEHB 4QSHA 2CHUA 1EK6A 4C0XA 1P0CA 1XVTA 1PS9A 4C4OA 2OO5C 2DMRA 3TL6A 2WMYA 2JIDA 1EUCB 1W1UA 4PHCA 4UTXA 3UK0A 4R0MA 3ZVKA 3NHAA 4D0GA 3KB2A 1FQWA 2YWHA 2V7QD 3KQPA 3IO5A 1Z4JA 2X0JA 5SICE 4RBNA 1SD2A 4RMJA 3L6OO 5BN1A 2KJQA 4C04A 3CVUA 3H05A 1NXWA 2ACKA 1V25A 2DJ5A 4Q66C 5FOTA 3WZMA 5K0CA 3ET5A 4BRSA 1NYLA 3P52A 4JV5B 5ER9A 2ZRCA 1XXHA 3RAJA 3M9WA 3OOEA 4B7XA 1FP6A 3FUCA 3W2IA 1QGUB 1EGQA 1O8BA 3L1KA 2GAIA 4TQ9A 2IXAA 2JEYA 1J7JA 3SC6A 2CT8A 3ZDDA 5MHTA 5HJEA 3V55A 4QC2A 3EA0A 4LNAA 3CUKA 4GKAA 1I3LA 3O9VA 5BUZA 2C20A 1GU7A 5A9SB 3ZBTA 4LKRA 1MABA 1OFUX 1QS0A 4GGPA 5HF9A 5KTTA 4H2DA 3IURA 2F9MA 3CO5A 4CETA 3L8MA 4BGEA 1PR3A 2KLBA 2ZR8A 2HU7A 4OGFA 2PRJA 3H97A 2IOYA 4OXRA 5TQ2A 4K88A 1SO8A 4QIHA 3PFHA 4IQ8A 4NABA 3ROTA 1TYEB 2IXTA 4H3VA 4D97A 2XODA 4DQLA 4JI0B 1W4BA 4HC4A 5FOQA 1AKNA 1R4ZA 1RXCA 4P80A 1OR8A 2FAXA 5DX8A 3W5DA 3ZZ1A 1WXEA 4PIPA 3DFZA 1HEUA 3PQ8A 4BN5A 1AQYA 3R41A 4BS9A 1KJNA 1N5OX 4WASA 5ITSA 1SKQA 2P65A 3LCRA 3SXUA 5IWCA 1ZU4A 2WVJA 4QO8A 1YZHA 5HOEA 4DXDA 1QJCA 2MT9A 1KHHA 4RD3A 2PRKA 4CQLA 1LNQA 3MK31 1USGA 5CD1A 3RAPR 4B9EA 4O2AA 5FCDA 3ENQA 5HR5A 1LB1B 2XWQA 4H7HA 5MN6A 3BK2A 1ZXXA 2Z1NA 1VA5A 3CH4B 3A2KA 1B00A 1JJ7A 3G5LA 3P7MA 3PI7A 4LRUA 3ULKA 4CPDA 4E15A 2AJCA 3H11B 4HNAB 1FDSA 3WLRA 1H2RS 1C8BA 3C3DA 3KXLA 5BVGB 1X1AA 2A4KA 3BMQB 3D0RA 3U4AA 3N05A 3WMRA 1R15A 2G9ZA 3D6AA 1HSOA 1X1SA 1CJVC 2ZAMA 5LZ9A 4NDNE 2BPOA 3VI3B 3CBGA 4DMHA 2Q07A 4QKQA 3L6RA 4L3VA 1RPTA 4O4LB 1I6WA 1GNVA 3G9UA 4DM7A 5IJ0B 4CEJB 1SBZA 4RIFA 3GU3A 3SZOA 4EEZA 1QKKA 2VL7A 3AEQA 2OZLB 3PX3A 2I22A 2ZTLA 4PYQA 3U48A 3T9DA 4IOLA 4LI3X 1S89A 3ZIAD 3TD2A 1O77A 3LL7A 3IX7A 2WWTA 3KTOA 3PEFA 3HBMA 3MCZA 2HXYA 4GXRA 3T4PA 4DHEA 1V47A 1DBPA 1SXJE 4HYYA 1ZIOA 4RH1A 5BWLA 5I8ZA 3LPDA 3VZBA 2AMJA 3OQJA 3KVRA 5EA2A 3UMGA 5EVCA 1PD1A 1JE1A 4AY6A 3AEXA 2EFHB 3ILHA 5AM3A 2B3TA 1Z0FA 2PVCA 5L3QA 5A05A 1MTOA 2QENA 4M3NA 1PSDA 3HYLA 1P1RA 1HKHA 4FQ8A 1F60A 4DV3B 1E62A 3T5PA 1IG3A 2AEMA 4ZQFA 2F90A 5F3RA 1U4OA 4NG5A 1RZUA 5IYZF 1A97A 5K3CA 4MKXA 4HQFA 2PPVA 5CIQA 2KQUA 3G2JA 2NMVA 3V4LA 1PEYA 2GZRA 2CFRA 2EDCA 2ATCA 2WVHA 3LC1O 4CBVA 1RT9A 2WU3A 4EB6B 3TLMA 4PGMA 3I2FA 1QGZA 1WQ3A 2Z5LA 3INTA 3QPCA 4AO8A 1ESMA 1EFRA 4L6CA 2BP7A 3DLHA 5IKOA 1X42A 1RTKA 3F4LA 3P9XA 3QSGA 1OGIA 4U9HS 3QE9Y 2WTEA 2RCYA 2ISQA 1TO1E 4MKIA 1AKRA 1ETHA 1HOTA 4YC7A 4JOBA 3LKBA 3U31A 2XUDA 2AZTA 3GDWA 1VE7A 1H5NA 1YA8A 2RAFA 2VF2A 2XNHA 3B89A 3JQ8A 2SBTA 3LC2O 4J94A 3TD6A 1E5VA 1BWPA 2EBFX 1YMUA 1NRWA 1X7XB 1ZMOA 3ESAA 5AJZA 5FADA 5C37A 3Q3HA 1G8PA 1H1LA 1EDOA 5AK0A 4EI2A 4Q0MA 4HJXA 2VRBA 3CUVA 1E2KA 2BEUA 4CHGA 1P2BA 2AF4C 2PH3A 3VTZA 1P4SA 3DCIA 3QU2A 3VV3A 1OC2A 3ILVA 2B7CA 3NVDA 2ATVA 1JPUA 3I5MA 4F9GA 1PD0A 4KB5A 5CCEA 4D0NA 1IRXA 2HSJA 5ALZA 2E89A 5HF6A 1SHJA 3ANYB 1LGYA 2AG8A 4YDHB 3FNIA 3LBHA 4EFDA 5HUHA 1A96A 3DFMA 5JJ5A 2QIPA 4WSOA 2A8YA 1US8A 5CFRA 5CT8A 1YGYA 3GP5A 4JEHA 4RHTA 2WWIA 1AURA 4DDVA 3OPMA 3FDZA 2D5IA 3PEWA 3ANNA 2XXJA 2D5CA 2B36A 2GPAA 4ZJYA 1EWYA 5LWHA 3WKEA 3TW6A 5JAOA 3C87A 4QVGA 3N2NA 4HPWA 5D6OA 4PXAA 1M8FA 3OZDA 4EJSA 3VO1A 3KG2A 3L0DA 5IJWA 3CIOA 3MAAC 1GGMA 3D59A 4AKEA 1CY4A 2RI6A 2YNMC 2COKA 3R5XA 4LW8A 3W5JA 2BTEA 2PUWA 4MV3A 4Q16A 4WOCA 3WX0A 1QU2A 4MYDA 5I7RA 3RBVA 2RARA 3JQFC 5TS3A 3R8CA 2PIDA 3CCCA 2NUAB 2CV1A 3QLVA 4OMFG 4XM2A 4ZYXA 1SFRA 4B76A 3LT2A 5CB8A 1YR3A 3B3QA 3I5XA 2CKDA 3OMWA 3QOWA 5IAKA 2VYNA 3E82A 2EJTA 2FWJA 4NV0A 1SG9A 2OO3A 2BGIA 2H57A 2IHVA 2RGAA 3G79A 3BHMA 2B5VA 1Q3HA 1T5IA 3FPSA 5C3UA 4DPKA 5L4SA 2R87A 1GJRA 3CN7A 1Z6AA 4F4HA 4TRRA 2W6QA 2PN1A 4ALLA 1CETA 4OMCA 3X1DA 1EHIA 3DFFA 3OAAD 821PA 4EH1A 4YMLA 1B93A 1PJ8A 2EOAA 3DBRA 4IV0A 1RLTA 1PLKA 2B2CA 1IH8A 3B9QA 2XYGA 2BFEB 3UUGA 5IUJC 3UBTA 1Q7CA 4JJZA 1FJGB 1G9XA 2WPNA 2XE4A 3LRTA 5J59A 5CT9A 3JD2A 1MMFB 1Q0UA 1VCHA 3F7NA 4KAFA 1R74A 3RRYA 3U4QB 1EPUA 2XBMA 4UNQA 1FNMA 4M6WA 4QEDA 2DKNA 4DCVA 2IYOA 1KYTA 1K1EA 3AF1A 1PVDA 3FNFA 3ORQA 3WGNA 3EIOA 1XDDA 2H54A 1FDVA 2P3SA 2A5GA 1N1GA 1Q1NA 1J8DA 1O1YA 3E22A 2BEWB 3DXZA 4I8XA 4K28A 4K9MA 4M4SA 4QHSA 3GA7A 2ZCJA 2IHBA 2NYUA 3DOCA 3KSDO 4RDXA 1Z7YA 3ZGLA 4OXIA 2QA5A 1PUJA 4X3OA 5A0VA 1YDGA 1MJHA 4KJZA 5FXMA 5H82A 1MJFA 1W7AA 3TVYA 5IXSA 1S1MA 3K9FC 3UH0A 3G49A 4HAIA 3Q5GA 2YWGA 5JWOA 1BCRA 1JLHA 2OC9A 4DXHA 5E6RA 5AH0A 1WCV1 3T7JA 2ZBEA 1WL8A 2V0NA 4WPGA 3G3EA 1BX3A 1KI7A 1T1JA 3E9EA 5IBPA 1Z18A 2BUAA 3QGMA 3LS2A 4KRXA 5DW0A 3ZJTA 5T5QA 1ZM4A 2WR8A 1L7QA 4L9AA 3KKLA 3IKMB 1FC0A 3SF0A 4BP1A 2GK7A 3QVJA 4IMRA 1KH2A 2R79A 4MA5A 5AUQA 4DYVA 4KUHA 1RS0A 3F2IA 2BH2A 3GFVA 3TIFA 1XZJA 1H42A 3CEHA 2VSOA 3FWHA 3L1VA 4IKOA 2P69A 2IEGA 2QR5A 4OQEA 2WUFA 1Z2NX 1B0ZA 3EIEA 4OHOA 3TOXA 5C4IA 3DGEC 5CW1A 5FTWA 2C4UA 1R16A 4RFSA 1JRLA 4NJOA 4PZDA 4WXRA 1MIOA 3TYXA 2E4WA 4PSKA 1ECJA 4B6QA 2QTBA 1GOTA 4LY0A 1DQRA 1RADA 5EXTA 4HQNA 5T4EA 5H3CA 1RFGE 2C9MA 3PFNA 3RSCA 4BNGA 2CFIA 1YBAA 2NACA 2Q8PA 3CGGA 3RUIA 4EHDA 1ENZA 3L7NA 4II7A 2N75A 1RWXA 3VVCA 5LPNA 5TF0A 3VO9A 3O84A 3DDHA 3VMFA 1JE0A 1XYYA 4G97A 5FR1A 5A4KA 3K0SA 4BP3A 5JR3A 4NJEA 1HURA 3IBTA 3KL4A 4OV6B 4PVDA 5IH3A 3CWQA 4IO1A 3T3EA 4RTMA 3HDVA 2GCOA 4L95C 4WKBA 4DMKA 1RIFA 4CM9D 2PMWB 3NG1A 4JXKA 5FP0A 4RV9A 3ZY4A 1VL1A 5DX0A 5BT9A 5L3SA 2BFMA 2WF5A 3WDSA 2R8PA 2ZRFA 4Z7QB 4A0RA 5JNUA 2RKOA 1NX6A 3FIJA 1UOEA 1FW6A 2ONJA 2QE7D 5JVDA 1VHJA 4MV8A 3DW1X 3DAOA 5HG0A 3EIFA 3LGXA 1Z15A 3X1YA 1H65A 2FW9A 4X7BA 2IITA 3QVVA 1CVIA 5TPWA 5TF4A 3MCVA 2B34A 2B30A 3RC9A 5I3ZA 4CW7A 4DNPA 3RC1A 3JX9A 4H3KB 4BX8A 3AQIA 1ZK3A 3QU9A 2VNSA 4HEQA 4K6CA 5JNVA 4C78A 2E3JA 1C41A 2WD7A 5F64A 5GJWC 3X43A 4YYEA 5LMZA 3R8FA 3B6MA 2OFWA 3BE4A 1ILWA 4BWVA 3N1UA 1AXRA 1SHUX 4WBNA 2XVYA 3KZMA 3KQLA 1JJVA 1FRZA 2CNKA 2BTQB 1FYWA 3EN0A 3OQHA 4EPRA 2M6KA 2VJLA 4Q9DA 1N5IA 2Z08A 3M0EA 3N58A 5IYZB 3D7SA 1ZC4A 3RTGA 3U80A 1P2DA 1Z88A 1FNNA 4P3PA 3M6XA 3K1AA 2ZBPA 4C0KA 4TTSA 4Z8YA 3VYSB 3NS7A 1V45E 1P1HA 1TXGA 1GKYA 4EMTA 4DGQA 4RW0A 4MYHA 4X92A 2DAPA 4G0QA 4KLNA 1BXRB 3HR4A 4ZO7A 4DGSA 3WK9A 4AKHA 5C1BA 1COZA 1ZRMA 2VOEA 1U6KA 1NMQA 3DNFA 5DTQA 3WI7A 4MYRA 3KSBC 2E82A 5F7OA 3R9XA 5CURA 3B9BA 3ZWWA 4U5XA 3WLAA 3IEXA 1EVYA 4R2IA 1B14A 3ECSA 3ES9A 3HR8A 1W34A 2YR0A 3ICVA 1QRRA 4REQB 1AQJA 4PWYA 4F2WA 4Z53A 1JDSA 1RAAA 2V9CA 1PI3A 4YJFA 4QFDA 2H07A 4LBVA 4IJWA 4ZT2A 1GZ5A 1KIFA 2GFQA 1UBSB 2DLCX 1QO0A 3VNVA 2VDLB 2J30A 4JA0A 5FUWA 2KBEA 4CFZA 3L4BC 4MPTA 2OBYA 2HSDA 3GZTB 4JL6A 1FMLA 1XMXA 1P9NA 1HLFA 1V4NA 4KDRA 3QJYA 1TPYA 1EUDA 5I7EA 4CTJA 1KEKA 1IOWA 1KJYA 4AQ7A 1HDXA 3UK1A 3DE7X 4S12A 5BWCA 4JS0A 1RYBA 1ZXBA 2ADFA 3BB3A 1A9RA 3GJ4A 5J1SB 1TJPB 1SOWA 3MINB 4IJQA 5ALXA 1UPTA 4M49A 5DGXA 2VJBA 4GLOA 4FYMA 2P9JA 4XXHA 3MGKA 1IPHA 3LUAA 4RZUA 4TV8F 4UEWA 1RI1A 1WSBA 2YXDA 3A1TA 3CNOA 3DWFA 2F59A 4CNQA 3OE7A 3DYBA 3KB8A 5K20A 4DM4A 2PUGA 3K2IA 1ZOOA 3AY6A 3WV5A 1YJ5A 2Q45A 2O1SA 1C9NA 4WW0A 1M2VB 3QBEA 1GHTA 4AMGA 1J7KA 2OFOA 4J7CA 5TMEA 3STHA 3H04A 2DWOA 4Q9LA 4A8TA 4DUGA 1YRBA 2KI5A 2YS6A 2HDHA 3FB1A 5ERGB 2FWIA 5TGTA 2WY2D 3SZRA 5L6MB 3K70C 4N6GA 4JXZA 1UBOS 2VJOA 3PZRA 3T5GA 2AZDA 2Q3MA 2J9RA 5HTKA 3RJ5A 3T6KA 1YT5A 1B42A 3LT4A 3AI1A 1E4VA 2YV4A 2X86A 4G4SP 1Z2DA 3I34X 4QNMA 1T8PA 3MJRA 3D3JA 4KXNA 4WA8A 2AOUA 1OD6A 1UK9A 3QG1A 4HMOA 4OBBA 1IK6A 4DEYA 3P1JA 4QOFA 1EQUA 1X8JA 4J1NA 1XTPA 3HY3A 1NUSA 3TDKA 1I3CA 2GAAA 3KFXA 3RUPA 4JB8A 3W5BA 2DR3A 1RR6A 3ZZNA 3L8HA 3THSA 1FA9A 1O95D 3PWSA 2VXOA 4M0EA 3T1VA 2C7GA 1RNLA 4RM2A 3ZI7A 4BKQA 3HB1A 1ZD3A 1C7EA 2BOVA 4U2GA 4UU1A 3KCNA 4BLSA 1DKNA 3LBFA 2Q1TA 5H1YA 4DSTA 4JUIA 1TGYA 3OJXA 4ZYLA 1FNCA 5GP1A 3K70B 1D5CA 3AH8A 5DK6A 2VBIA 4CFYA 1O6ZA 5BQ3A 5I7HA 1WXXA 2GYYA 4YS6A 4YY3B 3M49A 1Q11A 2BI4A 5DI3A 1OAAA 3ELWA 2FWAA 3T5BA 4IVRA 2R44A 2CUNA 1UJMA 3GJ0A 3M4JA 3PITA 4CCYA 4E1BA 4EUHA 3E9CA 1CQWA 3F7OA 2YIVX 3ZKWB 2CEAA 3G8CA 2FVYA 3MRSA 4AG5A 1P9LA 2DSNA 2AT1A 2MU1A 3DLAA 3KPWA 3RJMA 3RT1A 2WOOA 4JK3A 2BKUA 3S0JA 1N1MA 4RX1A 1YASA 2PYZA 1Z5ZA 4GM4A 5EZQA 1I30A 5EYPA 1K97A 4BTLA 4E0BA 2F17A 4R9VA 4QODA 1E5DA 1IHOA 3H1TA 3L7BA 4I14A 3E70C 2VXBA 4TOIA 4ESEA 2E87A 3G0OA 2JASA 1YNSA 4PTLA 5JYCA 1PJZA 3VC2A 4J4TA 4B84A 2WAYA 2XSZA 4PLCA 3U16A 3P0JA 3AQ4A 4KZPA 2G7MC 4LV6A 2WUGA 4GP7A 4N54A 1GL7A 4O4JF 5DYWA 4RWZA 4IZHA 2B9EA 2FZVA 2D74A 2YXNA 2R65A 1XTVA 1N7IA 3N6XA 4RHUA 3O7WA 1W0KA 3JQAD 4II3A 4Q9JA 2XADA 1TT5A 2YUTA 4ZQHA 3SE0A 4ZAFA 4G41A 1K7XB 4UPEA 3ND6A 4GF5A 4IMIB 5CJPA 1FRFS 4FWIB 4OJMX 4OHZA 3BORA 4I4CA 3KD3A 4IQFA 3GUYA 3EFEA 4LZZA 3TBKA 2IS4A 1FMTA 1WXHA 3EFOB 4BNDB 4XVRA 1AHNA 2OCYC 2WWVD 5DSXA 2OZPA 5BY2A 2QN6A 4UAUA 4DB2A 5JI3E 1R4NB 4KQ9A 2HA2A 4OQXA 3U7HB 3T3MB 1PGPA 5C7IO 5EJGA 1I3NA 3B6EA 3OX4A 4INOA 2DLNA 4BNHA 2ATEA 1A8SA 4FSXA 4Q3AA 4CKWB 3WL7A 4BMVA 4BL5A 3REQA 3TQSA 1L5YA 1RQ7A 4A7PA 1TUBA 1JHPA 5KJFA 3WYEA 3ASYA 2QQ5A 1NXXA 1VKJA 4J6FA 4URWR 3R4VA 3X1XA 5JSHA 3R8XA 1E0DA 2HLDA 3NGXA 3OSUA 4Q1DA 1C4WA 5ECYA 4DSUA 3SFTA 2GCEA 2ISSD 1KEEA 2W42A 2GM3A 4Y0AA 5HKKD 5JPCA 2AXQA 3IT3A 1NPTO 1JJIA 2PSFA 3C98A 2EGHA 2ZCVA 4OCZA 4EW1A 5IW8A 1YZLA 4Q12A 5K8JB 4KU4A 2XMDA 4E07A 2FK8A 2B69A 4NMLA 2A84A 3CW9A 4LOHA 4X84A 2XUZA 1JX6A 1LBHA 5CITA 2WWWA 3N86A 2NGRA 4AKIA 4NZZA 1AKVA 3JYOA 4R9NA 3W7BA 5FNVB 3MS2A 2PWYA 3PFFA 2NU9B 1MV8A 1HFEL 1H3NA 3SHOA 4BTVA 4BLOA 1AGPA 3GEIA 5E95A 1S8OA 2P9GA 3BB1A 4BEWA 4FM9A 4PFSA 1STOA 1M6HA 1GKKA 1XDGA 4ZEOA 1KDRA 3TIGA 1M0SA 2H59A 1P7ZA 3RYCA 1H69A 1PCXA 2MSEB 3EQZA 5EMLA 5BN5B 1CB7A 3UGQA 2K7FA 1FYFA 3KVOA 2X14A 3QPAA 3UJHA 3IMFA 2E4AA 2CMDA 3VR5A 3TECE 4HS9A 1Z6PA 4IDBA 1II0A 4E5VA 3O8OA 5EMNA 3K2BA 1T1IA 2YUIA 1UDAA 3OICA 2GLUA 5HEKA 3TB4A 3GRAA 1YS2X 3HBLA 4LJSA 3FWPA 1GPNA 4NK4A 2P5SA 1X1BA 1CDOA 1SVMA 3GPIA 3CX8A 3VDMA 1Y3HA 4IRMA 2BD0A 3KZKA 4MRMB 4NPAA 3RRBA 4CF4A 4AWBA 1J8MF 4FX5A 2D0IA 5CFOA 1ZK4A 3PRJA 1CUYA 3DLTA 1L6RA 2X1LA 3LKVA 4EAQA 1UAAA 4PGFA 3BMCA 3H8WA 2C54A 2YVKA 4JJ7A 4BFZA 4P3OA 4F5ZA 4JI6B 2JG3A 1QDEA 3NX4A 1YI0A 1SUDA 3V34A 3QLUC 5J40A 1JG4A 4YRFA 2W11A 2I8AA 3QVOA 1ZGHA 2GN1A 5DM60 3GLRA 1Z4IA 2OCGA 4QYSA 1F2TA 3A7DA 2MYUA 5DV9A 2FHSA 1MEOA 4XPZA 5FL7D 3ETLA 3S99A 3MWFA 2TYSB 1VPTA 5C53B 1UBLS 1RWVA 1M2WA 1E2GA 3BDVA 1A9XB 3VHLB 2FMIA 3OQ1A 3Q7QA 1DRVA 1LJUA 4Y0NA 4TWZA 3I72A 4AD8A 2GPYA 1ZMBA 2PUVA 4OFXA 5KCMA 1S96A 4A1OA 3CWCA 5ALPA 4J49A 4CF6A 5CU7A 1YBVA 7REQB 4N7MA 5DXJA 4O4IB 2ZSEA 4TYPA 3I04M 2O8CA 4C7BA 1E79D 2A5DA 2PUJA 4BNJA 4ZGWA 5KOHA 1RXIA 2PNFA 4XPIA 5AJHA 3IAFA 3WZLA 5ISMA 2I6QA 4NECA 3HCWA 1ORDA 2BGLA 3ROGA 4KTTE 2VHZA 4ZP1A 3KKOA 5KYWA 4YWJA 3MUNA 4EA9A 4FE4A 5A71A 4YHHB 1S2LA 2R85A 2VCYA 4JLVA 1PGNA 4CM1A 4PZ0A 4XD2A 5CHEA 1ZM9A 1XRLA 4O1MA 2P90A 2QG6A 1V7PC 2VT6A 1BMFA 2O2DA 5LL6P 1QDLB 4FT2A 4I50F 1JFFB 4QGAA 5HNKA 4WJZA 5EXXA 4P5PA 2ZRKA 4EPVA 4EQZA 4X00A 5IF9A 5C8YA 4D43A 4HVAA 1U8EA 3USCS 1AKMA 2XB4A 3K0AB 4X63A 3RKSA 1PDVA 4I55A 2WHYA 1P73A 4LHSA 2BKVA 1A0OA 1QBKC 4LE2A 3AKCA 3D6NB 1YQDA 4AJHA 3U1VA 2QVGA 3OM9A 1N57A 4C4TA 2C95A 1HZJA 1E3WB 1R10A 5E3IA 5CFNA 1VE1A 5IBCA 3QTBA 4WJLA 4Y2XA 3KDSE 2F1OA 2JHPA 3UK6A 1V3VA 2IOFA 1Y4AE 4EY8A 1K75A 1WOMA 3PP8A 5JQWA 4D9FA 5BUSA 3SDBA 3U40A 3WTBA 4LF9B 2IYSA 2QQFA 3PWZA 3WO0A 5DU2A 2J3DA 1L7MA 2SICE 2FN8A 1X80B 2BSXA 4FBGA 3CXUA 3GARA 4XQEA 5F5NA 1VLJA 4UTZA 3VTKA 2M9MA 4C43A 3EVDA 3REFA 2RG1A 1Y3BE 1U02A 1VPEA 2ZT6A 4MVJE 1U3GA 6Q21A 4H4EA 5JS7A 4KRYA 5CB4F 2FJPA 3SYRA 4N5NA 2DFLA 3MB5A 5CXXA 5G3ZA 2F8SA 4Q7EA 3HYTA 4TTVA 2IYUA 4HAOA 1EJ2A 3K9NA 5ALQA 4E14A 5YASA 1PEKE 2P8JA 3RC8A 1Q3TA 4LGYA 4UCQA 2HMSA 4ZREA 3E1SA 1BA3A 4RSGA 3D6HA 5ULLA 3RGGA 3D2BA 4LDAA 4YCSA 2XNDD 4FR5A 2B4TO 5LOVA 3MUOA 3MWYW 5CEFA 3BN3A 2H1RA 4HEHA 2GVDC 2IP1A 1K6IA 2W2LA 2CNWA 3NYRA 2CHEA 1NLMA 4BPRA 3K20A 3TR5A 1VCOA 2C77A 3H5TA 4UCFA 4BRZA 1NC3A 2CLKB 1Z5OA 4UOQA 5F12A 3QRWA 1W73A 4Z49A 4GZ6A 4ZALA 1HDEA 4WA7A 4RKFA 2X6RA 2IXGA 1CP3A 4RHEA 2EDAA 1GPAA 2IUEA 4LF7B 1D6NA 2FGKA 1JECA 2GCPA 2PLAA 2GX6A 4HAWA 2DU8A 5ALVA 1KARA 5CB6A 4BBAA 5IXJA 1MO2A 1QE3A 2EV9A 2IE8A 2XUAA 1PT6A 3K9WA 4N3CA 4EFLA 1LFAA 1T4GA 4OD0A 2ZPUA 2FPOA 4HSEA 4ND1A 4QDZA 4Y6QA 1MD9A 1ISJA 1R6TA 2WD8A 4NH4A 1EFKA 2VYCA 4S1WA 3ORFA 5EG5A 4ARSA 1LPPA 4EO4A 2ZXUA 3N75A 1TADA 1ZC3A 1ZJ5A 1IM2A 1WIWA 2BMFA 4GMDA 4TXJA 5DYIA 3W5IA 1ORTA 4M9CA 3E03A 3UHPA 4BV8A 2EWMA 4L4ZA 3WWOA 2WD9A 3NNSA 3SYLA 3ZVRA 4BV3A 5A5VA 1MW8X 1N1EA 1V1RB 2XTNA 4RYLA 2QTRA 1Y8RB 3LK7A 5J5CA 3HEAA 1ZONA 5CBPB 4NF2A 4B79A 1XHFA 3R3SA 4X54A 2ZE5A 3GGGA 2FX2A 1DAIA 3ETJA 1SWWA 4YAKA 2WFLB 5JAZA 1FVFA 1K5HA 3AV3A 3OZFA 5AJWA 3I39X 3L77A 5JV5A 1GTMA 1LI5A 5G40A 4JIMA 4QQFA 2E37A 3H2KA 4MQEB 1HE2A 2WUWE 3K5PA 2BY4A 4K9DA 3TKAA 1WVIA 2R4UA 3NXSA 1N2CB 2WIFA 1D4AA 3R7WB 4KO1S 1BXZA 1Q1AA 4UKDA 3UMCA 3PE4A 1JIVA 2O4CA 1Z34A 2BM1A 4LX0A 4ZT4A 5A9TA 3DHEA 3PEYA 2EFEB 1FVHA 1MO6A 4UM5A 1QUEA 2HRZA 3D8SA 1N34B 1GNLA 2I4IA 3AVPA 2CL7X 2GN4A 2HQSA 3E35A 5IMBA 1FUIA 3SDZA 3O8LA 1T5OA 4MVJM 2WYUA 1XLTC 4OHMA 3I1YA 2POQX 1TZ2A 4AURA 4JJ4A 5FHRA 3RYTC 2JCYA 3EUWA 4G65A 4ZPJA 1S2NA 3K9CA 3IQXA 3KAPA 4M7OA 1Q1GA 5ARBA 1XHLA 3ABZA 4RXUA 2FEMA 4TLBA 4CQMA 1RJ9B 1LK7A 1RJDA 5EHNA 3SQWA 2WKQA 3QM1A 4FLMA 3KL2A 5HRUA 1Z74A 1UZLA 1FSSA 1WCIA 2HN9A 5LQDA 2OBMA 3OFKA 4M46A 4MO2A 2GD6A 1ZINA 1DBWA 3KBOA 1ZBQA 4LF8B 1GTL1 2OTCA 4P92A 2Q7OE 3V3TA 2XNKA 5HSGA 4QWWA 1K4MA 1I33A 4CKBB 3ITKA 2CFOA 1H2BA 3GA0A 5K3DA 3VYVA 2JS7A 3MCWA 2FQQA 2WMDA 5BR8B 4XIJA 1NVDA 4DUZB 2V03A 3MRVA 4QYMA 4HNAA 1AXGA 1Z07A 1C4OA 3AYXB 3B13B 2YN2A 1Q1QA 4DXAA 1XKLA 1RBYA 4C0LA 5JLJA 4LJRA 2ZYTX 1BAPA 2PMBA 4K46A 1VJDA 2P6OA 2VQFB 1PR9A 2A0XA 2XVAA 3C5WP 2ON6A 3CNQS 3H9GA 3HVUA 4R1PA 5A6SA 5E3JA 1MGPA 4AMBA 2HRRA 5JJIA 1UL1X 1EVIA 5ALNA 4RVCA 1EM8B 5HDQA 1N5JA 3OUUA 5ELLA 4S05A 3TSZA 1U90A 3MGCA 1KMHB 4GOJA 3TQQA 2XW6A 3A1UA 1SIBE 1D2EA 1LSJA 2DTDA 4C0WA 1P9OA 2J3QA 3OUZA 4NXMB 3M81A 2C8LA 3R20A 3TQHA 5BWBA 1P72A 3I04A 1VKOA 3MQ4A 5BSGA 1G20E 5EPUA 4IQGA 1QUFA 3HUEA 5H68A 3CT6A 3HZRA 3KOXA 1GT91 5HP4A 4K6MA 5IZCC 4E5UA 2AJDA 1N2XA 4B17A 4O5OA 4C2TA 1UBHS 1G9SA 2P2YA 4PPNA 2OQVA 3UB4A 5IN4A 5J4HA 4MS1B 4Q7JB 4RF3A 1TVKB 2IDZA 4P2BA 3R4CA 3SKXA 3TLGB 4E88A 1CY1A 3KC2A 1Z45A 4C0AC 1ZGAA 4E31A 4PAGA 4WXPA 5HUJA 3LZDA 3VOBA 1V43A 1F2VA 1F8FA 4IDOA 3WL6A 1JTEA 2XQJA 2AKAB 4IDPA 3W3ZB 3WMWA 3ASVA 2OO7A 4NOKA 3NEYA 4R1TA 5CAEB 2W2KA 3GD5A 3OQBA 4HDSB 2JHCA 4NX2A 4OK5A 3DOJA 5AJYA 5AHOA 4P53A 1M7GA 1IJEA 1X7WA 3WLOA 2QJWA 1U0HC 4PO8A 4TVOA 5H80A 1FMCA 4QWMA 3ZUGA 4C6SA 1NJ2A 5A5FA 1QFXA 2QV0A 1VLMA 4M0UA 2DSTA 2RHTA 1KIAA 2AR0A 1BKDR 3DHVA 3OY7A 3SPXA 3DFUA 3A4IA 1RVDA 1SUCA 2EJUA 3FR8A 2PQ6A 1X7DA 3KTAA 3THRA 2IYFA 1EP2B 2C4NA 1R6XA 5D86A 3VZDA 1QONA 5C4GB 4I2NA 4JT8A 4DC0A 2Z4TA 3KKZA 3V7YA 3MJHA 2LCFA 2ODTX 3QE2A 4ASUD 4F4UA 3EIWA 3ICWA 4OQDA 4FUQA 1Z68A 4RDIA 5TQJA 1MT0A 2F3SA 1H3EA 1S4QA 2I2WA 4AQDA 4KVGA 2R6AA 5EJ7A 1F2UA 4R8KA 1AS2A 1QORA 1JWAB 2FGJA 4O2AF 4R6WA 2JGFA 1HT3A 4S0ZA 4X8LA 4KW7A 3G1UA 4Y9RA 1DCKA 3CG0A 3ZHZA 4ZYYA 4Z9BA 3T7KA 3HA5A 4F2PA 1DAMA 1QIKA 1QQAA 1GTSA 2PUCA 2RIRA 1E1YA 1ORVA 1R2QA 2DHEA 3Q9LA 4FZ5A 4RVFA 1J33A 4TMYA 3W9SA 4DVJA 1GD1O 1RAIA 3RSFA 5BNIA 4YT8A 4BE7B 4C6HA 1YAJA 3VNRA 2B21A 2CJWA 3LPNA 1XPJA 1P9WA 4E5PA 8ABPA 2DB3A 2WM8A 4L5CA 4NBVA 2IHUA 4Z99A 3BD9A 1LK5A 3MBOA 2VPZA 3PXEA 3JQ7A 4MINA 2X0EA 4DMLA 3JQBA 5EHIA 2EBUA 3GIDA 4CTMA 4XR9A 1GG5A 4LTMA 4G5YA 5JSKA 3IO3A 1VYVA 4W9NA 4WAUA 3PDJA 5DIFA 2IP2A 1FTYA 3DO6A 2BKLA 3FVTA 2EF0A 4MMXB 5ES4B 3SJBA 1ONBA 4WY5A 2VDPB 2ARKA 4JUBA 1BD4A 1ZNYA 2XI4A 3FPEA 1T29A 2ZWOA 3SJUA 3FAKA 1A2BA 1YOVB 2DPHA 2VDOB 1KPIA 1V0JA 3D0KA 2WM2A 3S1AB 3GT3A 4B2PA 3KE8A 1OYWA 2GASA 3GGSA 1XMQB 1ZSVA 5B3AA 4XOUA 3ZWKA 4AAYA 4N41A 1MO5A 2IPOA 4BAGA 4EHLA 1U8UA 1YE8A 4DSOA 1ZR4A 1M2HA 1Q0SA 4ZKDA 1NM5A 2QUJA 2D5AA 3TCXB 3ZJVA 3DH0A 3H4MA 2QE6A 2DH6A 1KI6A 1KJQA 2RGYA 5AW2A 4JSRA 1YB1A 2GPNA 1JUDA 1KVUA 2J8ZA 3F6EX 3HH8A 4INAA 3G02A 4ZHQF 5KKAA 1RPNA 2BZGA 3DLIA 5F1YA 3W05A 2HYIC 1E63A 2O3RA 3JZFA 3OX3A 4MHTA 1YAHA 4P98A 2C2BA 2XMQA 1TD9A 1E98A 1QYRA 3AHIA 1TD1A 2RK3A 3BKXA 2EHDA 3UW3A 3ZIDA 2JCVA 2UVQA 2WNIA 3EQ2A 3HJAA 1WTCA 2Q21A 4XIYA 2YNMA 5CVDA 3S29A 5IMSA 4RTKA 1CUJA 4IXNA 3FKSD 5GONA 2R2GA 2JFXA 3ILYA 3KSUA 5FTLA 5JIBA 3G9XA 5DNVA 2VTBA 4CEHA 4KEAA 1ULAA 1W48A 1XD9A 1XVLA 2EC5A 3VTFA 4LCEA 2D5LA 1RC1A 1A8IA 3U4QA 1NBMD 1P1KA 1S3GA 1USWA 4DT1B 1GGKA 1M1YB 4KBGA 4BFXA 2H92A 3GPDG 4ABYA 1ZICA 4JDPA 1PBTA 2VYFA 4P32A 2B1JA 4Y1GA 5K0EA 4FONA 4KMOA 1J2UA 1EIZA 2C1ZA 3TSWA 2VHUA 1E3JA 1QMPA 5K8UA 2PEYA 1WQ4A 1H9CA 5LC1A 1NA5A 1A7JA 4MVJA 2OXEA 2H8GA 1GLVA 2NVUA 3SIPA 4RKQA 4TTAA 1G21A 4ID9A 4PSCA 2BEWA 4PLZA 2W0MA 1V3UA 1H9BA 1GUAA 2C2OA 4KQ6A 1DJOA 2VLBA 5C32A 1T10A 3AB8A 1YTLA 4FSDA 4ZI3A 1CS0B 4G23A 3WLIA 5DLPA 4D9BA 4U7DA 3S2IA 4CDMA 2P1ZA 3IIIA 3MMXA 3W7VA 4KWTA 3W0LB 1T4DA 3H18A 4RCYA 4ZVNA 4RHFA 4N9WA 1ZXLA 1XDSA 2EP8A 2QX6A 3NNNA 1EAYA 3DAPA 3AR8A 4RL6A 1YIAA 2XDQA 2GK6A 3HVIA 4IGFA 3GLKA 1VKNA 5AOVA 3GO4A 5B3KA 3OA2A 3KJGA 2LIVA 4CEJA 5KNDH 2V9PA 1WD7A 3EDCA 3O1IC 4CL8A 2IIVA 5CVTA 2Z09A 2YHBA 3E8XA 5IEBA 2Q28A 5A5DA 1FDUA 2A58A 2B6HA 3RNLA 2AJ8A 1Y3IA 3CPSA 3LMKA 1WX1A 5REQB 1TKAA 2VTKA 3VNQA 2AS0A 2NV0A 4YI5A 4DJTA 2RHLA 3NPAA 1L1FA 4HLNA 4GMKA 4NIMA 3NAQA 3A1EA 1WW8A 1GGHA 4HEA1 4NBWA 2H9YA 3L4SO 5F5XA 5B53A 4KITB 5LZ7A 4I19A 1Q22A 2JCSA 4PIVA 3S8YA 1YWGO 3N5KA 4OYYA 1FJHA 4AROA 5H9WA 4HQLA 5IAGA 4L9WA 4OGKA 4KPUB 1U28C 4QQ8A 3TQIA 2J4FA 1GRRA 3EXG1 4KIJA 3K9GA 4LC9A 5EJAA 1EGMB 3WGVA 1WB9A 1JR4A 2ORYA 3LQKA 1HQYE 2G83A 2WF7A 4I6EA 4BRWA 1PGOA 4UQOA 2NO6A 2FZLA 3FSEA 1XE3A 2AYYA 3FJ1A 1AKEA 3HRHA 4HL6A 1S2GA 1T0UA 3M1YA 1FY2A 1MRSA