4ZVUA

Caspase-7 wild-type bound to the caspase-6 cognate tetrapeptide inhibitor ac-veid-cho
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
139
structure length
139
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
molecule keywords Caspase-7
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 49
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zvuA00
2HBZA 2QL7A 3SIPA 2H51A 4HQ0A 1RWMA 4QUHA 4AWAA 4QTYA 4NOMA 4QUGA 1ICEA 3H13A 1RHUA 2J31A 3H11A 2QLJA 4EHLA 4NBKA 5IAKA 2CNOA 4QUIA 2H5JA 4N6OA 3P4UA 4D3YA 4JJ7A 4DCPA 4QU9A 3R7NA 4DCOA 4QTXA 1SC3A 3DEKA 3EDRA 3OD5A 1CVRA 3H0EA 3IBCA 4IEFB 2QLFA 1SHJA 3D6HA 4EHNA 4EHFA 4AWBA 1NMSA 3H11B 2CNKA 3PCXA 3PD1A 1RHQA 4ZVRA 4ZVQA 3KJQA 2DKOA 2Y0BA 4EHAA 4QULA 3D6FA 4D3ZA 2J33A 5LUAA 2Y1LA 5IAJA 3V6LA 3NR2A 3R7BA 3IBFA 3ITNA 3V3KA 1RHRA 4FGUA 4N6GA 4QUJA 1RWPA 4EHHA 2WDPA 4JQYA 1M72A 3S70A 3SIRA 2XYHA 2CJYA 1RHKA 1PAUA 3R5JA 3V4LA 4JR1A 1RHMA 4D3XA 4NOKA 4ZVSA 1PYOA 1QX3A 5I9BA 2CNLA 4NOJA 1GQFA 5IAEA 2H4WA 4DCJA 2C2OA 4IYRA 4QUDA 2CDRA 2H48A 4QU8A 4ZVOA 5IAGA 2QLBA 1RHJA 2QL5A 4N5DA 4PRZA 3D6MA 3GJSA 3R5KA 2FUNB 3DEJA 4QU0A 3H1PA 4HVAA 3DEHA 4QUBA 1RWKA 3KJNA 1RWNA 3GJRA 1NMEA 3NS7A 5IANA 2QL9A 1KMCA 2C2KA 4NBNA 2NN3C 4ZVUA 2K7ZA 1K88A 2C2ZA 1GFWA 5IABA 2J32A 2XZDA 4EHDA 2FQQA 3E4CA 3KJFA 1NMQA 2C2MA 3R6GA 1I3OA 1I4EB 2HBRA 1RWWA 4QU5A 4ZVTA 5IBPA 5IBCA 1CP3A 4FXOA 1SC4A 4QUAA 3V4OA 5LU9A 5H0IA 1RWOA 3R7SA 3RJMA 5IC6A 2CJXA 4FDLA 1QDUA 4LSZA 4I1PA 1IBCA 4NOLA 4ZVPA 5K20A 4JJEA 1NW9B 1RE1A 2P2CA 3R6LA 1I51A 4AW9A 5IC4A 1JXQA 3QNWA 2H5IA 4QUEA 2C1EA 2H54A 3P45A 4EHKA 5IASA 4N7JA 1RWVA 2XYGA 3UO8B 1QTNA 4EJFA 2H65A 2XZTA 3NKFA 1SHLA 3K7EA 2H4YA 5IBRA 1I4OA 4N6NA 3PD0A 3GJQA 5LU8A 1BMQA 4JB8A 4PS1A 3S8EA 5JFTA 4M9RA 3DEIA 4NBLA 4FEAA 4JR2A 4JQZA 2CNNA 2J30A 5I9TA 4PRYA 2HBQA 3V6MA 4HQRA 3GJTA 4JJ8A 4I1RA 1RWXA 2XYPA 3EDQA 1K86A 3BIJA 4JR0A 2AR9A 1F9EA 2FP3A 5LUBA 3UOAB 1F1JA 4N7MA 4PS0A 3V55A 5IARA 1SC1A 2HBYA
chains in the Genus database with same CATH superfamily
3RHZA 1BGWA 3WGIA 4LC1A 3WIOA 2WUEA 1YT5A 3IXQA 1SUFA 1G2OA 1SG6A 1N8TA 2D5BA 3L40A 3T5CA 1ORHA 2YWBA 1Z6XA 2NLOA 3AW8A 2C5HA 3DMPA 1G2PA 3OJXA 3UWPA 1U9IC 4IVQA 5MGNA 1P8AA 1PZFA 3AT1A 3DO6A 5A03A 1VL5A 2OHVA 5EI5A 5EZQA 3E7DA 2F4VB 2ZRAA 5J4VA 4JJ7A 3P8ZA 2J3QA 1OAOC 2Z30A 1GTVA 4OHOA 3AUFA 3K30A 4CCYA 5A04A 5JECA 5GIPE 2YFYA 1H9CA 3Q85A 4JI5B 3Q4GA 1BH2A 5JASA 1PNQA 4Q15A 1JALA 2WJ4A 5C8ZA 1U6JA 4RIEA 3NTOA 4R2HA 3DQQA 4MSUA 3LL7A 2PUAA 3AL0C 5CRIA 3ZWPA 5C18A 4Q05A 4QGBA 2BKXA 5AKIA 5ALKA 1SCIA 5FTKA 4KDFA 5DYWA 2G04A 2WG0A 5J4KA 1AKRA 4WVLA 2WIKA 1M2OA 3W5UA 2Y1LA 4HYQA 1NUHA 4JA2A 3QKSA 4QJIA 3NLLA 4U5QA 2Q3CA 2QM3A 5D1HA 1M72A 1U31A 5K8LA 1AN0A 4EG8A 5HK9A 2NTJA 5ED4A 3TLEA 2VKQA 1PV4A 4JR1A 4ZYZA 1VIDA 1YXMA 1FS6A 4MV8A 4EB3A 5CDUA 1V25A 1KSHA 1T2DA 3BBLA 2XKAA 3RYHA 3R9WA 1J0AA 3T0FA 1ZD4A 1X1TA 4OQYA 4WLVA 1Z5OA 1R0WA 3GVXA 2RARA 4IDPA 5ADHA 1MAWA 4QU0A 5BQOA 5EP4A 1Z08A 1DU4A 1DO0A 3DCIA 2IBSA 4FFBB 5KNDD 1NN3A 4DA0A 3FXAA 2ON6A 5EZYA 1NFQA 4TMYA 1LV8A 1OFHA 2QQ0A 3EA4A 2AYZA 4NH4A 1E89A 4BVKA 2XHZA 1Q21A 3HKEA 3PSAA 3LLUA 1N5DA 1ORIA 2ARKA 4JROA 3D3QA 5AK0A 4ZJZA 3EYAA 5DF1A 4A1OA 3R7SA 2HSEA 1J09A 3CLRC 3L6RA 4AUKA 1R9GA 2ZIXA 4EG7A 5SYNA 1EWVA 1P4RA 1Z0UA 1DLJA 2EX1A 2JIRA 4L0CA 5DHAA 3T3GA 4Q7QA 3FCYA 1I2BA 1UWVA 2I65A 2IDJA 1D6SA 2OGUA 1ENOA 2QR2A 5IJXA 4L7QA 2AFHB 3LUHA 5BOVA 2VUUA 4BNLA 3EXHA 3BTOA 3VGPA 2CMKA 4MVYA 3WGGA 1SCUB 3IOBA 4A7PA 3ABZA 2R8PA 2O7RA 4KJXA 3QJ5A 1WDKA 1JL3A 3FYUC 3Q3JB 4UHFA 2XZPA 4U2KA 5ALUA 1DJLA 1E6LA 3WLFA 4BU1A 5FR1A 5LL6P 1DTSA 2BE7A 2O07A 2Y99A 5CT8A 5I01A 3CY6A 4XWOA 4L9SA 2VEDA 4O1HA 2AZMA 4PRLA 1UWKA 1B7GO 1SD5A 3P27A 2HMAA 1GR0A 3FOZA 4KWCA 4ARBA 2VUHB 3AQIA 3EE6A 4DC0A 1FSGA 1YBAA 2JHAA 1Y5RA 2W2NA 4KQKA 5EXXA 5C51B 1SWVA 1VXOA 4ID3A 4GOLD 3BMQB 3TOZA 1EGQA 4XLTA 1ZUD1 3CN7A 1C0IA 4HMPA 6REQB 3OPVA 1EJ6A 1P6QA 1MG5A 1C4OA 1EDOA 1ORTA 1S2GA 3RC3A 1SD2A 1ZINA 2VQ6A 1EBBA 2D2XA 5G02A 1SM4A 4DJJA 4Y2RA 4U7PB 1EX6A 4M0PA 3PFCA 3H5NA 4PX9A 3IKJA 2B6NA 3N2EA 1CZOA 3T9FA 2PSHA 3BH6A 1MIOB 3BWVA 3MYYA 1USKA 4KI7A 3FYTA 4U7FA 3L4SO 3OLYA 3Q10A 1MV8A 3JPYA 5CDHA 4UW9A 1YFZA 3LU1A 1TGYA 1VYUA 3F3MA 1PR1A 3NHSA 3VC7A 4TVSA 5IVHA 1TTQB 2I6XA 3H0EA 4OHUA 2IWHA 2X4IA 4CL8A 3C98A 2YS6A 1SKQA 1ZIOA 3Q5DA 4P22A 3JAMA 1FXWA 5M7EA 1PHPA 1YR1A 2W6IA 5REQB 2ZWAA 1X7ZB 1J2TA 3RBVA 3SC2B 5E0OA 4EHBA 4M9QA 1GAQA 2FU5C 4F96A 2SECE 5I6DA 4JI6B 4QAQA 2JCVA 3O8CA 1CDZA 1DG1G 1GTL1 3O82A 5KU1A 5HJEA 3IUBA 3C6ZA 3KPJA 3NIFB 4NICA 1UUFA 3ED1A 5CIQA 5ALZA 2ERCA 2H2IA 3PF9A 2FRVA 4EYEA 4NCXA 1RKUA 1K9VF 1JDPA 2XYHA 3I9V1 4TVOA 1EQUA 4Z0TA 4M21A 3ZD9A 1JTFA 2TMYA 3DBRB 5TPZA 3NGXA 5C8YA 5J23A 3J80A 5IAEA 4ER7A 1PLKA 4R41A 2IYYA 1NX9A 3IUJA 3QKRB 3GCZA 4GF5A 2VHWA 4OSPA 1H85A 1REQA 3NUZA 4E03A 1JBQA 3EG5A 4ZTZB 4FYYA 3RWBA 1LH0A 1IPEA 3BTUA 5LQCA 2PMFA 1P45A 1FNCA 4JVNA 2BMFA 3B3AA 1GGMA 3PNMA 1KWKA 2WF8A 1C3VA 1L7BA 4DJFC 2BUBA 1NWCA 1ZD5A 4RH3A 3AV3A 3ZLTA 4BNDA 2XYQA 5HA5A 1T3SA 1PG2A 1PG0A 2Y2VA 3B1XA 3C5HA 4XRRA 5ER6A 1UAAA 4RSGA 4QU5A 2AW5A 3KAJA 2ONJA 4E4RA 3GJ7A 3VH3A 4JL5A 4FXOA 4B3XA 1OIVA 1QP0A 2IEDA 1QMPA 1XI2A 4EL0A 4CYMA 1K5DA 4U3JA 3RS5A 4LMPA 1HETA 3OO1A 2G9UA 4UQPA 2VBIA 3N28A 1O95D 2M6KA 2QN8A 2PXHA 3F8SA 3KO8A 3K3PA 4NOLA 1FX0A 3S8MA 4YV1A 4B3GA 3KHKA 2Z2JA 3ESRA 1EU1A 4UEJA 3AVWA 5ALGA 2DLDA 2HK8A 4HAXA 4UVEA 4RS4A 1DKMA 1AO0A 1YZVA 4QOEA 5KTSA 4TMTA 4TMVA 2XJ9A 1QV6A 3CVWA 2FW8A 2I1WA 4OBEA 5G0UA 4WERA 3RGWS 2XMZA 1Q20A 2OENG 4MRAA 4LC0A 2PH1A 4WOPA 2XCTB 2B7CA 1D6JA 3ROTA 1ZH4A 1R74A 2L69A 1JAIA 3WA6A 4PLYA 4KTTE 4IH1A 2AUNA 3K73O 2BP7B 2H1CA 2GCGA 2W6MA 2WU3A 3HBAA 3G59A 4KDRA 4HAZA 3T95A 4C0BA 5AVXA 1XXHE 2JD2A 3A4IA 5E1OA 3RTBA 3VO1A 3RT1A 3E7WA 1BROA 1R7RA 2JLBA 2O20A 2PBZA 2ZSEA 2ISSD 3HGMA 3ZTTA 5BV7A 4JFRA 5C4GB 5BVGB 5F7OA 4W8HA 3ZDRA 1NYRA 1QWOA 3W3ZB 4RJTA 1TLLA 4EI9A 5K0ZA 2JVIA 1C7QA 3RE1A 1AVTA 3G1UA 1L8OA 2B1GA 5AI9A 4YBZA 2WUFA 4A6EA 2Q3EA 2X6TA 4F2PA 3L0BA 4GT1A 3GLGB 4DPMA 3ZJVA 3T99A 1E0AA 4K88A 3IAFA 3UWMA 4C5BA 2P3OA 1ETHA 3LLCA 1X7YA 4KGZA 2DF8A 1BVUA 2JAUA 3HKBA 5AIAA 5LVAA 1I94B 3C7DB 4LZPA 3DTNA 3O84A 1U1DA 1X92A 3GU3A 3ABSB 3PVSA 3F90A 3M1YA 3MXOA 1UBGA 1SHJA 4B3IA 2D7DA 5B12A 3DE2X 4R3UC 5A1JA 4YJFA 3INNA 3TMYA 1CNFA 5BQPA 1UPXA 3Q7SA 1FDIA 5IDVA 1U2EA 1L7NA 2FW1A 2RFLA 2ZAYA 4NFHA 2GPSA 4B7UA 2IHZA 1J2JA 4YRFA 5FEUA 2VBCA 4OHRA 5AOAA 3VJLA 2C54A 3H1FA 5U1PA 1YB4A 3N6XA 4KO8A 2YV4A 1BCRA 2M9MA 3ITNA 2DGDA 2OHJA 3CYFA 4TSFD 5CFNA 1P0QA 4D2IA 5HW0A 2PXAA 2Q9AA 3OCYA 1XAIA 1M83A 3GZ4A 4G0QA 1JV2B 1TO1E 4NYJR 4QGAA 4CM9A 4BRUA 3GLFB 3U0BA 2HDNB 4OK3A 3FUXA 1BE0A 2W83A 3EBLA 3IQIX 3NNNA 3PGA1 1JTVA 1LSJA 1FS5A 1MORA 2YRFA 3G0OA 4LBZA 4C6TA 2R00C 2H4WA 2IEGA 1ZR4A 4BLQA 2HJSA 4QBFA 2WQ6A 2DFDA 4JB0A 1ML3A 2VJNA 1LX6A 1MIHA 3VO2A 3G9QA 5K0CA 2AWNA 4Z7OB 1GPAA 2ZJ4A 3IBGA 3SJ7A 4JZKA 4BWFB 4EF4A 1L9KA 1VL2A 2BGGA 1G8MA 3G68A 5KEIA 2JAHA 3DWFA 2D1SA 2QL9A 4I1YA 3HPRA 4ZVUA 4KL8S 3ZGLA 3R41A 2MSKA 1EGVB 2OGTA 4FNMA 4C4ZA 1X19A 1E7WA 2EIXA 4JJKA 4IVNA 3L4BA 3EGWA 2VZEA 1EVEA 2GF2A 2I7VA 3IQHX 1SC4A 4DJTA 4NIMA 1IQPA 5LU9A 4B2PA 1CY7A 4YIKA 4LOIA 3ZD8A 4ARCA 5C46F 2WJIA 3C14C 2VVTA 3FHTA 2HHJA 1A4IA 1JLHA 1V0JA 3L7OA 4MKRA 3WOVA 3U4QA 4ZKEA 1SU8A 5DXAA 2IU0A 3UKDA 3WB1A 1NXWA 4GFDA 3IURA 1KAHA 4MDEA 3AF0A 2V65A 4CZ2A 1MV5A 3AU9A 4BB5A 1T35A 5L8VA 3DAGA 1QTNA 4JT9A 5LYJB 3N2KB 1YHZA 4U7TB 5KZMB 1OFGA 3OT1A 1NFFA 2PUTA 4JOSA 5J5VA 1P75A 1U2DA 2XZOA 3O91A 3ACCA 4BO8A 1SA0B 5LU8A 2NG1A 1XVAA 2HV8A 5COQA 2HJRA 3RIYA 1Q5PA 4FCCA 4YRKA 4DXHA 1MB4A 3JAKB 3ESZA 1AMNA 5YASA 3KETA 1NNSA 3Q8MA 1MFZA 1ZMXA 4B71A 3PE6A 2B78A 3AESB 4XOIA 3UAZA 2HOQA 1TQHA 2QI9C 3OZTA 3G2HA 3QX8A 4JJFA 4EFNA 3DLHA 1BA2A 1NF3A 2EGGA 2R1TA 3CWQA 4J91A 1M1NA 1UT6A 3EEIA 1V95A 1B8UA 3ZEIA 1K0UA 3GGPA 2CBZA 3RC7A 1EK6A 5JYBA 1HT0A 2AOWA 2D5LA 2H1SA 3BB3A 1TVCA 3OBBA 2O4CA 4ZT6A 5IDYA 4ER5A 1C1YA 5D51S 3OIVA 1FYDA 4JXZA 2ZK7A 3WGZA 4XGNA 3NVDA 1LF5A 3QVTA 2IV7A 3O92A 5EIOA 2HDHA 3RC8A 1J99A 2OBFA 1GR1A 2VDUE 3DBIA 4I55A 4P5DA 1U0RA 1ZI9A 1MBZA 3E15A 1W4LA 2C9CA 5EIHA 1H05A 2YW2A 4DLLA 3QUBA 1A8SA 5C2JB 4HAVA 5BN4B 1H65A 4NNOA 3RYFB 5K0SA 3KXDA 1KS2A 3RKRA 1H2YA 1SZDA 1XMXA 2W6ZA 3KYJB 3MFYA 4FE4A 3SICE 1LZLA 5GOZA 1OI3A 1DWQA 1LWOA 3Q1KA 1QQ6A 1X9IA 3D3JA 3OPYB 1CLUA 2QQEA 3GVCA 5AQ1A 3JQBC 1IBRA 1LLCA 4HWSA 1SH7A 3PQCA 5FA5A 2OO5A 3BVPA 2YJTD 5ICFA 4Z7NB 2IGTA 3N7UA 5K3FA 4K05A 5I4KA 3PHIA 4PSAA 1UC4B 3HRKA 4MQEA 1GITA 4WXHA 4OYLA 3WL5A 1NXOA 4QVKA 3OPQA 2WAAA 5CFMA 1DJOA 1RU3A 4R8RA 1IH8A 1HRDA 5GV7A 2GK4A 3IJEB 4KR6A 1TVKA 4OBXA 3AM4A 4DQXA 2PE5A 3GEDA 3ZU2A 4PXSA 5AKHA 5JLAA 1GJRA 4N5DA 1RXEA 2EJWA 4GECA 3IYLW 3RNOA 5JYCA 2AK3A 3QMPA 2VKTA 2ZYUX 1A69A 2C92A 2DHQA 3MWGA 5AW0A 4PFJA 4AZ3B 4C14A 1G20B 4KLAA 1LBTA 3IP6A 1FDRA 1WMFA 1KZ4A 3KJEA 2ZTLA 5LIRA 5D6OA 1X2BA 4LVNA 2WT4A 4HD8A 4E1AA 4E08A 3K70C 3U56A 3LY5A 4PQRA 4UTOA 4WLNA 5F1KA 2RBGA 4E0BA 3I04A 3VH4A 1NVWQ 3AZOA 1G98A 1E7SA 3JU3A 1N32B 1KK1A 1E8MA 3LWZA 4G97A 3NTUA 4WESA 3DZ8A 1VLMA 4DREA 4DA4A 4DIBA 2ZTUA 2GEFA 2W0SA 2DKNA 2WFMA 2YHUA 1P9OA 5LP6C 3WAKA 4OOEA 4R1PA 1KVRA 2W90A 3HR7A 4ZJUA 1MVLA 4WXPA 5D86A 1MO3A 3PEWA 4WW0A 3PEFA 2OILA 3G2LA 3MELA 2EZTA 3RKSA 3NXKA 2LV8A 2SHKA 1L4LA 1GSIA 3V34A 4CF5A 4H15A 1HNZB 2C57A 3H5IA 1U3TA 2DZDA 1E2HA 1O8CA 1M74A 1Z8DA 4HXEB 4MA4A 2J0UB 4UQOA 5BV0A 5FIUA 4PC6A 1QNFA 3CSSA 3LDAA 3L7CA 4QXMA 2B92A 2D8MA 2I4LA 4S1WA 2B4AA 1OA0A 3DEIA 3YASA 4ZZ0A 2W42A 3EWIA 3E27A 3PNPA 3WADA 1EFVB 1BXKA 3OQNA 5FUWA 1ESNA 3R76A 1TMYA 2XTZA 4W7IA 4BVJA 5MN6A 2VBFA 4MQ4A 1BXZA 1J7KA 1PQPA 2GUWA 4L0DA 3NDIA 2D2EA 1IHXA 4WK6A 1JMKC 1Z35A 3RIGA 2XNJA 3O4RA 3LC2O 4YHBA 2RHBA 4LUCA 4MRRA 3RIEA 1FNDA 1JT2A 2EW8A 2N46A 3MWDA 1DP4A 3FDFA 3E5HA 1YS1X 3LPCA 3VMMA 3ZWAA 4IZOA 1Q1ZA 4BPBA 2ZI3A 4JS0A 3B7WA 3KHUA 2R6FA 1YQEA 2VPPA 3DL0A 2B94A 2FMKA 2QRLA 2ZAMA 3MJFA 2F8TA 1CR4A 1XCBA 3IIMA 1PT5A 3OOWA 4UUOA 2O1EA 3TS1A 2ZRLA 3AEKA 1B2RA 3L8DA 3EGVA 1OC4A 2VTDA 1SUIA 3I45A 2W2XA 4J4HA 5EHIA 2QKYA 3NHAA 1QIGA 4LKOA 4IUBS 3IUEA 2OMKA 4WFKA 1N6RA 2YIDA 4QWWA 2DKOA 1D03A 2MSNA 5H80A 4KXFB 4QULA 3O8QA 4J07A 2VNHA 4XR9A 3HKCA 2FPSA 3OFJA 1H1DA 3OFKA 1KQGA 2QYHA 2HCRA 4BIMA 4G2TA 2JGFA 5KDDA 2NSDA 4OQMA 3SX2A 4O33A 2BFBB 3AFNA 4E51A 5B4UA 4OJNA 3KHSA 4RNCA 2QD4A 3INYA 3ND8A 1VP3A 2REQA 3GAMA 3O21A 4LBWA 4O4JA 3LFUA 5HOQA 1RVV1 4OUKX 5DFAA 3NT4A 2ZRHA 4IJVA 1JJ7A 4M1MA 4JB3A 4JUBA 4EATA 4R1MA 1O3YA 3ZHZA 4EQ6A 1L7OA 3IGFA 2QP9X 3A1SA 3Q2IA 2ZYRA 4IHQA 1Z6ZA 2BUAA 1OWLA 1L5ZA 1EE2A 1V7CA 2YBDA 3IR6A 4FTWA 4ZVOA 1Y3DE 1WV1A 1KU0A 1WS6A 4J8PA 2E4YA 4Y6PA 4EB8A 1PN3A 3N76A 1L5KA 2G88A 3OQPA 1CDDA 4G1UC 3UFBA 2A14A 2XCOA 2DQ4A 3CBQA 3P2JA 4JXKA 2GRJA 2VYFA 1UQRA 3D1VA 4IJUA 2WF6A 3T1NA 3WI7A 2OZEA 3TTVA 4YA6A 4Y8VA 4RGVA 4CMBA 3NJ8A 1F0YA 4GHWA 1BD3A 3PFIA 1CZLA 4N5IX 4L6CA 3FMGA 4CIDA 4UM7A 5GADl 2OXFA 1OVGA 3HU5A 1KE2A 2F48A 3RT9A 4O5OA 3HK2A 3MTIA 3D6TB 3IIIA 1WY5A 4TV9B 4AY6A 4AMUA 1MGPA 3D2LA 1FYXA 5JRDS 2EKZA 3MB5A 1CUCA 1XTUA 1B0PA 2GN4A 4FW9A 5TQJA 3ZU4A 2H4HA 1ZITA 4EB6B 3DGFC 3TIXB 3WLMA 3JQAB 1JXQA 3L77A 2WJVA 1QQ7A 3TZ6A 2C8VA 5LA6A 1VHTA 3PFBA 1A76A 4FQ5A 5FBQB 3PP8A 4X63A 2QLMA 1GHTA 1SUAA 1Z88A 3AJAA 3FTPA 1NI3A 3T52A 1YZFA 4DC9A 2IX9A 1DV1A 4YACA 2D2VA 2XMBA 2NUBA 1QQTA 1V45E 2P6UA 3X1JA 5E9JA 3L8MA 4NBLA 4CR7A 3H6HA 2XSZD 4DCMA 3GOHA 4EW3A 1KKLA 4JT2A 3V6MA 3FZEA 1A50B 2OCDA 3C1OA 3IKTA 4JBWA 1YAJA 5HEKA 2Q9UA 2AI3A 4ZOAA 2ODBA 2ZAIA 4LV5B 5JSKA 1US8A 4KE8A 4C0AC 4CIVA 4D6PA 2HBYA 2G71A 2VF8A 3DVRX 2X13A 3GDHA 1HBJA 3ICVA 1TKCA 3QFSA 4LZWA 3DNFA 4XIGS 4BRZA 1I3CA 2IPLA 4YJ2A 4TL9A 3RHTA 2RSLA 4IJ6A 3HDQA 2PG3A 4CLXA 3DYVA 4B3TB 5FJIA 2EFJA 2FETA 4G56A 3AVVA 3HO6A 4NCNA 2Y66A 1U7OA 3ZGXA 2OE2A 3A9VA 2P78A 5DW0A 3SZGA 2FG6C 3WWCA 2XUJA 9ATCA 1QYWA 2GFQA 5DEIA 4P83A 3A6HA 5FPQA 2MMGA 3H1AA 2HXSA 4C29A 1P9LA 2JJYA 4P3KA 3E7XA 4E22A 2VJMB 1PGNA 2PQMA 5C7YA 1V1RB 1SCNE 4H7JA 5B1YA 5KYNA 2K7FA 4A0SA 1OKKD 4C3OB 4CDGA 4MR9B 3FF1A 3B3FA 4QT4A 1CUUA 3O3MB 3R3ZA 4XWAA 3PIIA 2X1LA 4QQ8A 3RJZA 1C9EA 2D5IA 4JUCA 4QQKA 3QE0A 3KWLA 3P9CA 5DBGA 3UBMA 4RIHA 3E7FA 4MW5A 2HA7A 4DT1A 1E6KA 1SVIA 4QBGB 3N2ZB 5KSPA 1OH6A 5JUWA 1E6MA 1SBQA 2ODPA 2AYYA 4BLRA 1PJ2A 3C39A 1EE9A 4JC8A 4LHSA 1L4KA 2W5UA 3KT0A 1CRPA 1BS2A 4BX2A 5AVVA 2Q8PA 2MSLA 4FONA 4DSUA 5K6RA 3MBIA 4MA0A 5J3JA 4OH7A 1GSOA 3LZCA 1DKPA 1EXMA 3GRKA 4QPJC 2Y9PB 3DMRA 1L6IA 3QFCA 3K9HA 2I03A 2Y05A 4J7UA 5DV9A 1RYEA 3ZH9B 4A23A 2FZKA 4GWKA 4BMOB 1W1WA 2Y1WA 5DNVA 1DEXA 3BXEA 3ZD6A 1T36B 2Q6VA 4JCCA 3VNBA 2I99A 1NZDA 4KMRA 2VWGA 3OH8A 1G19A 4QUBA 2P2SA 1NN0A 3IDQA 5EEHA 2CHEA 3UAGA 1ECPA 1F60A 3AEQB 4X91A 5D6NA 3B2QA 3H3JA 4TXNA 4BO6A 3OTQA 1CUHA 3PQ8A 3SR4A 1M8GA 3CF4A 1BZYA 1HE1C 3DOOA 1A7AA 1KYZA 1K08A 4JVMA 2RH9B 1GA6A 3ZV4A 1FFAA 4TV9F 4C4RA 4LSMA 3LFTA 3EZLA 2ZJ7A 2PQ0A 1MUUA 4BNZA 1DAGA 1L7RA 4UM9D 1NKTA 4S2UA 4MVJI 3GA7A 3PIRA 1S2DA 1ITZA 4TYYA 4QFMA 2BI4A 3B51X 1FFHA 3FROA 4CM7A 1HEIA 3AKYA 3LQQA 1YDGA 1EFPA 1KJQA 2O8VA 3DDSA 1XCLA 3OJOA 1YASA 4NABA 4E5DA 2N42A 3U5ZB 1XTTA 2PKQP 3UQZA 2CFOA 2HIAA 1AGXA 1R3DA 3P0RA 3OCZA 1T15A 4AFNA 4JYCA 1UBFA 4FYHA 5IW8A 5JROA 2OFXA 4A82A 1YRAA 3DL7A 4RTQA 5GQSA 5FULA 2QYOA 3ZVNA 5KOHA 5AI8A 1YNSA 1O8BA 2G0AA 1Y1TA 4TM7A 1MRZA 2OCGA 1TU3A 5JISA 3VPSA 1KYXA 5CVUA 3B3JA 3AIOA 5EUMA 4R1SA 1AKNA 3R3HA 2IPXA 2GXQA 1EWYA 3L06A 1EM8B 3UOAB 2C1ZA 2WKPA 1G7SA 2F8LA 3JZFA 3LYLA 4M38A 3ZJUA 1VIVA 2PFSA 4KQHA 3FCSB 3THYA 2YTZA 4JI1B 2P9HA 3U7EB 1PR3A 3FAKA 4YCNA 4OB6A 1LC0A 1O7JA 1XLUA 2QUJA 3PDIA 1S2IA 4J0QA 4MUKA 5F23A 3S0JA 1FFDA 2ZPUA 1U04A 2YHSA 2IYZA 4JEIA 4E2WA 4JFAA 4FJ2A 3DHWC 4YQFA 1SULA 1W29A 1AZLA 4JLVA 2A0XA 3BK1A 2ISCA 3R5FA 3RUPA 1UM9B 4O59O 5KJ6A 3RJ9A 3AETB 3U6BA 4CGZA 4RZ3A 4UULA 3SQOA 2BSQA 3FMFA 2GNAA 2W48A 1Z74A 1U3CA 4R71A 3AVOA 4M1QA 5E9WA 1H4SA 2DOKA 4RVDA 3GFSA 3H65A 3IBCA 4G0WA 3KTOA 2Q2VA 5TF0A 4AS3A 3WYAA 5FOTA 1SBTA 4EHNA 5CNKA 3LHIA 2ZBQA 2FMTA 1HTTA 2PRYA 4MVJA 2QAGA 4DDHA 5KIAA 3K32A 2YJ4A 2X40A 3MBOA 4FFWA 4HWKA 1PO7A 1OFVA 3FMIA 3JZAA 4P3YA 4UE6A 4YRZA 3WOHA 4DRXB 4AX8A 2A5FA 2HIMA 3GDWA 3A32A 4Q3NA 4CEIB 3ETCA 1Z8HA 4UBOA 2QMUA 2ZB8A 1J7JA 1Y4SA 3V00A 1T1IA 5KAMA 4CJXA 2XDQB 3PYXA 3RUEA 4MPRA 2CDAA 3CZQA 3QTTA 1Q6ZA 1FRFS 4GU5A 4RKFA 3I9JA 3O4IA 2GYWA 1MB0A 4HZUA 1G7TA 4K9RA 4GOOD 1YVDA 2YRWA 3WLSA 4D6XA 5B36A 4Q1BA 4OI1A 3MJEA 3GARA 4MS1A 4LOAA 1UQUA 4C0LA 2CLIB 5SZHB 3OI7A 5KNCD 1RAIA 4HHEA 2G5GX 4H4CA 4BFUA 4XB1A 2RC6A 4LYJA 1S3FA 1SXJD 4C1BA 4X64B 1L5YA 1I1HA 2VG8A 3NRJA 4HNAB 3QPWA 4WY2A 2ZRPA 3HGQA 4MO2A 3G2JA 1G8SA 1M66A 1JBEA 3QFHA 2RKBA 3KQPA 3OESA 3QUAA 4ND8B 4WL0A 3IMEA 5MGBA 2AJLI 2GEBA 5F3RA 2X42A 2XZDA 2H57A 1QYXA 2G5TA 2IOHA 4XPIA 4UOQA 1R6VA 2ZANA 4W5HA 1QHGA 1EVYA 2XT6A 4J0FA 1N77A 2AKYA 3U0VA 5HZGA 1M2JA 1IN8A 1FMCA 1KGDA 4LX8A 4R01A 3GHHA 3EEYA 5G0SA 3VU9B 2DUMA 5C8XA 4P31A 1O0CA 3KAPA 2JRCA 4I14A 1PV1A 2QSJA 1XZQA 4FD3A 2GYYA 1KR5A 4HLQB 1E5VA 4IFIA 4IDCA 1V11A 1P7VA 2H7VA 4JODA 3T5MA 4AW9A 4GP6A 4JIGA 2H54A 3S27A 1IJEA 1D8TA 3V46A 4H1WA 4L3WA 2A1TS 3C1TA 1X15A 2XDAA 2ZAOA 4NCIA 5D5QA 2OFOA 2IXTA 2JANA 3OEYA 4NVRA 5DXJA 4WASA 4C89A 1UBEA 2R8RA 1Q16A 4XQ9A 3DP9A 3G5LA 4B82A 1PVOA 3RAFC 4MVXA 5DHUA 3GO4A 4GLJA 4RMHA 3QWIA 3CU5A 3K6SA 1MAVA 4FHFA 5I3ZA 1H6BA 2PBLA 4NAHA 3QUSA 1RQRA 3G49A 1SVMA 2E7ZA 3PI7A 2ZZNA 2O3UA 2X8JB 1N1EA 1NSFA 4IL5A 5B58T 4BMNA 1RWBA 1NSYA 1GUAA 1NP6A 4DLBA 3TLKA 3QEJA 2W70A 4CGYA 4F8JA 1HURA 2EX0A 1JEOA 2G82A 4HLDA 3TM5A 1ZC3A 3QFTA 3TNLA 1Y5LA 5KNDH 2FZGA 4QTYA 1EDDA 2Z8ZA 3AW9A 1QOQB 1Y5MA 8LDHA 2WFLB 3NBMA 4R68A 1T2UA 3FN4A 3PFKA 4Y6GB 4LV6A 2I2XB 3C7CB 4N5MA 5CW1A 2EXXA 4FFLA 4K9LA 2VDWA 5FORA 3BT7A 4F84A 2ILTA 1DC3A 1II9A 3DS8A 5FWNA 5JBIA 4N3GA 3EOAI 3FNGA 4DVJA 1HO3A 5BSTA 1S7CA 2WPDD 3VR5D 5CCBA 1PR9A 5M34A 4QVGA 3IXLA 3A4LA 3B20A 2FE1A 3K53A 5KVCA 3M5PA 4EHFA 3FWYA 2O8EB 1Q0LA 4LY6A 1A9XA 1J39A 2W2MA 2C4HA 1X1DA 4Q12A 1UZLA 2QMYA 1Z4MA 3I42A 3VYUB 2OCXA 2V0GA 1ENZA 1EDZA 4OOFA 4W6ZA 4HATA 4W1RA 2I6FA 1NJ1A 4S24A 3TCXB 4W5NA 1S2OA 1XTZA 4XKJA 3PXDA 3LJKA 4RTRA 4N6GA 2NGRA 2UZ1B 3A4VA 3KOWA 2ZETA 4Q4CA 4PSUA 2J9YB 2VBGA 2GBLA 1FTWA 3KZCA 2B5VA 4AG3A 3B9PA 3QE4A 4OHBA 4E07A 4D4GA 5A0TA 2IU6A 1SVLA 2PV0A 4F9GA 3ILHA 3F67A 3UMJA 4DTCA 3BGDA 3H2SA 2QRPA 4X85A 4WVFA 2X7JA 4YUZA 1DPFA 1XE3A 2KWIA 4TL7A 4YR9A 1JZTA 5FOWA 4ZU3A 4JNKA 5KTOA 3HKDA 2HRQA 2CBXA 2CNWD 1Z83A 2OFPA 3JRXA 4U7WA 3UW1A 5HQTA 5K3DA 3DYBA 1PVDA 2ZVJA 2PO5A 3C0KA 4MRMA 2A9VA 1JKIA 5FJJA 2DTXA 2P7IA 5D5PA 4LQ4A 5TMPA 5CXUA 4HDAA 2OHXA 2K5UA 1W88A 3RKUA 1RT9A 3D3EA 1CUIA 2CVQA 4YMHA 1NN5A 3IPXA 3PQ2A 4MCHA 4RL6A 5THQA 2FN8A 3E84A 2B1QA 2SCUA 1T29A 4K6HA 3WV5A 4BRSA 4R2XA 1CUZA 1LK0A 3QU7A 1J90A 2JGLA 4XWKA 1QGOA 1Y8CA 2OC4A 3OOEA 4WOCA 5JCOC 4RK1A 2OOSA 2IH5A 5JOQA 1FUUA 4L74A 1YTUA 5B6PA 4WLFA 4OKNA 3WGHA 1TTTA 1QLWA 1OBOA 3BKXA 4RY8A 2UUPA 2ZE5A 3FFBA 4J3JA 4IZIA 5TGTA 4NR0A 4CQMD 1DIRA 3JQ8B 2BRUC 4HADA 1EVJA 1LPAB 4KLZA 2ZB7A 4HGRA 4JLPA 4YRIA 5J2TA 3T6KA 3PVCA 4M1TA 3DTVA 1CJKC 3BAFA 4QHTA 1J0XO 5I7VA 2W37A 4H4DA 3L8ZA 4BVBA 4DLWA 4BO0A 2BEJA 1PR4A 3SJCA 3C87A 4J3FA 1UOOA 1XZEA 2OLKA 4RF4A 4HLCA 1FFEA 1G8KA 2QDXA 3NHMA 4LXTA 5I7AA 3V8VA 2XNDA 1M1YE 2DCMA 3IAS6 4QOIA 4BECA 2FSVA 3FNBA 2AQIA 2IP1A 2HF8A 2IYUA 2O05A 4KPUA 4RM2A 2DBVO 4MROA 3H3XA 4YI5A 1DWPA 1NZFA 1XJQA 4QBKA 5TNXA 1HZJA 2GA8A 2VPXA 3N8IA 3Q0EA 5HZKA 4BCDA 2XUFA 3PR2B 2FG5A 2FZCA 4KZPA 2Y1GA 3SKVA 1RPZA 4M0FA 3ICEA 3HR8A 4LXGA 3FSEA 1UKZA 3I9OA 4ZGBA 5HS4A 1QPGA 2HU8A 1AB5A 3D6HA 4UNRA 1NW7A 3N75A 4JKIA 4KMMA 4OHKA 5FL3A 3TSZA 3U81A 1U7XA 4Z2YA 3V1TC 3F8TA 5IJ9B 1ZAYA 1UMBB 4OKSA 3FCAA 3DV0A 2BPOA 1UFVA 5ICEA 1G41A 2Y0BA 2BFEB 3DEFA 2QPAA 3EASA 1ZBQA 2QE6A 3L0SA 4CPDA 4FW8A 1JG1A 3AF1A 3CKYA 4YT5A 1BVHA 3I5YA 1U6IA 2FE4A 4LCEA 1JLLB 5HIIA 4YV0A 1IMOA 1OPXA 3LNCA 1AXEA 1D0SA 4BFLA 2QZ9A 2QTFA 5JJKA 5HXAA 2YY6A 4RY0A 4GNRA 4ND5A 2C2YA 4OQEA 3AUXA 1AGNA 1UKVY 1UXJA 4K9MA 5CHYA 4BTEA 4ZKDA 1HDZA 1T5HX 3KB1A 3UZUA 2VOEA 5JAUA 1YB1A 2I34A 1OX4A 3DHYA 3KELA 3K2BA 3LX6A 2UZAA 4KUEA 1NXQA 1N57A 1RHJA 5BNIA 3PA6A 5TSDA 3QVKA 4K8OA 1GQRA 2P0AA 1V48A 2QTNA 1XXHB 3A1FA 4XD7D 1DRJA 4PWYA 2A7QA 1QH0A 4JENA 3MHPA 2GZAA 1U7ZA 4M7RA 1NSTA 5IPFA 3DTTA 4KN9S 2JFFA 5JDCC 1DXQA 4XH9B 1X86B 5ALXA 1GGJA 1NE2A 1WTAA 1SELA 2FQQA 3D3NA 4YAKA 3ZDAA 3SX4A 1I4EB 2JL1A 3V8BA 3BTSA 2R7MA 3BH7A 2XCQA 4P81A 2NXNA 3WK6A 2NXJA 1UFKA 4X00A 3KT6A 2IIQA 2QNRA 1CE8B 4AF6A 2QJRA 4BPRA 3F4KA 3ZUPA 4K0KB 4MUEA 3OURA 4IDNA 1RRPA 3NQ41 3OOYA 1X87A 1YMVA 1CUWA 3FWPA 4J76A 1HA3A 5I7EA 3RU9A 3GLUA 4C7BA 2AYXA 3E8SA 4NKRA 5IASA 4MS4A 3S2EA 1ZESA 1T8YA 2EVWX 2QLTA 1BC5A 3H2BA 2FHPA 3NKFA 1ZNYA 2NTYC 3WRXA 4DR2B 4W8OA 3H1GA 4K9OA 3COWA 1FW6A 5KBYA 3T4XA 5EWLA 1SC9A 1FVFA 3LY8A 3SZRA 3JYLA 3W3AH 3H0CA 3X1YA 1JEAA 4BKMA 4Y1RB 1ODLA 1NONA 1SOWA 3MMXA 5DSZA 4PLCA 3SYMA 4AO6A 1OZ0A 3MNFA 4W9NC 4JOCA 4B3JA 2RK4A 1L7VC 5B4TA 1CR0A 1G3MA 2XMCA 3H7AA 5KAPA 3CRQA 1ZJYA 1XZBA 2R79A 4KOAA 2RMKA 4QRHA 4R81A 5AJHA 3SQXA 3RROA 2P0EA 1DC6A 3DE6X 4HQ0A 3KM0A 3FFTA 3IAXA 4NOMA 2DEUA 4MV0A 1KMQA 3R9XB 3GJ6A 2AI1A 4M1ZA 1XLTC 2JKYA 2Q1WA 3DCYA 3R20A 2PGDA 4GP7A 1NIJA 1L1RA 3C8MA 3VI4B 1FP7A 4H4EA 2H1WA 1HLFA 3DO5A 1EFCA 2YVKA 3V8PA 4F4IA 2XMGA 5KNDA 1Z12A 3T94A 5HGJA 4LWOA 3NC4A 5FOUA 3UQYS 2GM4A 4FR2A 2V97A 5CA1A 1NF8A 1SCQA 3TVDA 2AX3A 3QRWA 4FSDA 2GXAA 5CFRA 5BSHA 1TIBA 2QLNA 3GQBB 1NLYA 2R7LA 3WRYC 1IY9A 4LVCA 3QLEA 1VPLA 1I80A 4ZVRA 1HFEL 4W5QA 1AUPA 1LC3A 1A8PA 1JIXA 2WMOB 3TVTA 4A5SA 2RGRA 3PKIA 3V4ZA 3UM9A 1DLIA 3GLIA 1DTWA 3KQSA 5A06A 3SM3A 4ZHQA 3I2KA 4CEJA 2ONCA 2ZU0C 1XD2A 2O6LA 2C5AA 1Y5NA 2PCLA 3AY7A 3JAWB 5AJWA 4PFSA 3TIIA 2NUAA 4ALIA 1ZQ1A 1X7HA 1SEVA 1W6RA 5LOVA 2G77B 3DM9B 5DM1A 1RJWA 4DSTA 1YI1A 2R6R1 1CYEA 5LNK6 3IH5A 4OQNA 3DVAB 1KZ7B 1QX3A 2X23A 5FA8A 2ZE6A 1R00A 2CVOA 3BG5A 2Q3JA 4KG7A 5G0WA 4ZWNA 2QD2A 3EODA 3JALB 2P3QA 2XDYA 1RM5A 1YE8A 5LDDC 2LDXA 2P2NA 3OWHA 4WKOA 1DRVA 4ZDWA 1J1UA 1YRWA 3THOA 3F6SA 4B6PA 1Y1QA 4HVAA 1P1KA 2WIBA 2XR1A 3BEDA 1U2PA 3RASA 1ISJA 5IBQA 2PBRA 2Q6KA 3REQB 1YUMA 2R5NA 3FWHA 4P86A 4GMDA 1R0KA 1KHHA 2FOXA 3NIBA 3IP1A 2Q4RA 3MSCA 3PC8C 5HSGA 3ZWNA 4UZSA 3T3NA 3SQDA 2PU7A 4R1QA 4V3CA 2OBLA 2UXBB 4C7OA 3KEOA 5BQ3A 1KI6B 3K15A 5B4VA 1JDBB 2BEUB 1G66A 1DAKA 1GL3A 1KGSA 3PV0A 4IO1A 2IH4A 1IXZA 3TZKA 5H8WA 2OP0A 2ZIVB 4US2R 4ARVA 3X1ZA 2D0IA 5TY0A 4DA8A 1QYVA 1HE5A 4D9NA 2AF3C 3VPGA 4XVRA 3WIUA 2NZXA 3IELA 1VHJA 4DANA 3LLMA 5KTPA 5JAPA 1UFQA 3JZMA 4D0NA 1ACMA 1VDZA 1NJ6A 1G3QA 4XDHA 3MIZA 2NYUA 4X6LA 5DZSA 3D1LA 1UBJS 3F3KA 1QXSA 4L8VA 3BFPA 3E81A 5JCJD 1L5QA 3FCCA 3TR5A 2IHVA 4C3VA 2PT7A 4KIUA 1QC5B 1M2FA 2SKEA 5C1OA 1JSRA 5ESXA 1R5BA 1DQZA 5ICMA 4HTAA 3VR2D 3TGLA 3U3XA 1CIPA 2UVDA 2ZIAA 2VAWA 1JYFA 4PQEA 3HJUA 3UK1A 1PI3A 2MMCA 3GF4A 5K03A 1N33B 4GBMA 4EYKA 3J7TA 1NNLA 5EUCA 1P2TA 4EX7A 1DAEA 4M0EA 4ZMRA 1N8SA 3MW8A 1U4SA 2QGFA 3IIEA 2R66A 1UKCA 3SI7A 3UJBA 4CDMA 2CLLB 1WCXA 2IHTA 2P9CA 2QJTA 1ZN2A 4V0RA 4L4SA 5GWXA 1K4MA 1NJSA 4JI4B 1NQTA 3KT8A 3P4UA 3BIOA 1YFKA 3HCFA 3EUFA 5AM2A 4EITA 3ADCA 3NBAA 4BQEA 4NJEA 1X38A 2ORVA 2RAUA 4JEHA 4KQGA 1DT3A 4W1QA 4CLRB 1OJLA 1XZGA 2GT1A 3LPLA 4RESA 2C4TA 2XJ4A 1RR6A 2EP8A 3SG0A 1QANA 3COVA 1LPBB 1VRVA 4WOKA 2CV1A 4FEEA 3SBOA 4BS9A 2PR2A 2WMDA 1M2EA 2O0JA 4GS5A 4HWPA 4YDRA 4CKWA 5KCZA 2XBLA 3BE6A 5LZ9A 1SQ5A 1AHHA 3HJAA 3IA2A 3CBGA 3LP8A 4Q1AA 3V2IA 2MSDB 3LHFA 3F3SA 4PTZA 4LQDA 4OM7A 1RLJA 4ECEA 3NUQA 4P0QB 5MFPA 1A8QA 1DIHA 3O8OA 3P2KA 2C98A 5DNYB 3TQIA 4ZYVA 2Q5IA 4GL2A 1RHKA 2C3YA 4EA9A 3JQFA 1WE2A 3IP9A 4EVSA 1TUGA 4R83A 1JR6A 4Q1FA 3M6FA 2EW2A 2XMPA 3JQGB 4US1R 1LPSA 2H0AA 1VYHA 2J5QA 4UDXX 1XWWA 1JWLA 3AYXB 3FWZA 3OM1A 4LE1A 5AVOA 1HT3A 2A5GA 1C0LA 1XZNA 1Y7PA 4IDHA 3O83A 4BKOA 1UINA 5F9MA 2G08A 4BMSA 5J2UF 4Z4FA 4WFQA 2PH3A 2QVXX 1JEJA 3P0FA 4DIKA 5AW1A 4WCVA 2A0YA 5FTLA 3H9JA 5JZBA 1KC3A 4EEXA 1T4GA 2UKDA 4FHCA 3FUWA 2NTEA 3URMA 1RZVA 1XEXB 2ONZA 2PLWA 5JQGA 2FUG6 1V4BA 3RJ5A 1EFHA 2A0FA 4DRZA 4F3CA 4KBGA 3PQ3A 3TQRA 1NU6A 2PJUA 5H0IA 4O08A 1QK4A 4Q9JA 5H59A 1EXDA 3V1UA 3QOXA 4EHJA 2ORWA 2Q1SA 3ILXA 2H7XA 4G36A 3TL3A 1TVEA 3TGPA 5DXFA 5INTA 3ZDDA 3RVSA 1I51A 3R3SA 4ZYLA 4PSKA 4H27A 2Z5GA 4CMHA 1C4KA 2FGJA 3CNEA 3H42B 4L78A 1MF7A 5FPSA 3DQPA 4CU2A 2F00A 3HB9A 2JG3A 2IH2A 3JD2A 4L28A 1YQDA 4R9RA 3WLNA 4EJMA 3W5VA 5CFZA 2H4XA 4X8OA 1OXKB 3TOXA 4OLHA 1ZM9A 3EMDA 2JZNA 1LK5A 4ZU1X 4IIVA 3RS8A 4BKRA 2OLJA 4NP6A 4KK4A 4DIFA 3E18A 4I4TB 4FNOA 5EKTA 2DH6A 3TSCA 5FWXB 1IZ7A 1DXOA 2FCRA 2IHYA 3Q12A 4O25A 3HTXA 1Z6PA 1T8PA 3AGPA 4RDHA 4TKUB 4R7TA 4DCUA 5FWYA 1KYIA 1CIJA 3K0KA 2LIVA 2FMUA 2IEZA 1M2NA 2FJPA 3IVXA 3L7NA 1EFDN 4BQSA 3A37A 3GI1A 4I5EA 3C3PA 3CZCA 2I66A 4WCFC 3ZI7A 3KWMA 4FUQA 1OGJA 2ID8A 5IARA 2ZDHA 3IQGX 5BMOA 4TMWA 2FWJA 3QBVA 5C5DA 3O7WA 4I1VA 3NHPA 1QAQA 3NRBA 5K7SA 4ZEWA 1U94A 4WMLA 1BEZA 4EKNB 1RI3A 2R25B 2B8JA 1ZNZA 4FR0A 4MVCA 4L2IA 3TLJA 3O8RA 3ZW8A 1BG6A 2IZ6A 2HA5A 1DC4A 3N3AC 5KOYA 3IVCA 3HUDA 4MDYA 3UMRA 3UXEA 2C2GA 4PO9A 2VO1A 3ESQA 3NH9A 2CV2A 2I4NA 4G1FA 1EFUA 2PXXA 3PGLA 3ZG6A 1Y4ZA 2WWHA 1XRQA 2VP4A 1AOXA 1DOHA 1Z0IA 2GHIA 2JAPA 4RGYA 4IFEA 3OQIB 2VNSA 4Q1CA 4EOGA 1L5NA 4ZI2A 1X8LA 4X41A 4E5SA 3MQ4A 3PUIA 2QQ5A 1WXWA 1EP3B 2GCEA 2Q2QA 3H0KA 4UVIA 1X1BA 3PJEA 4BFZA 1E7QA 1SB9A 3EFOA 4NCKA 3RFVA 4B8YA 1BU8A 2ZBVA 1SK9A 3TRFA 3P52A 3I8OA 2CZCA 1SHUX 3M3HA 3ONEA 1A9QA 1BWSA 1G59A 2OO7A 5AVSA 3QE2A 1E3IA 1FVXA 1H8HD 1VE7A 2B4TO 1TZBA 2ZYAA 4YDSA 5JANA 3ZI0A 4G1CA 4WBXC 1HM5A 3ORHA 5CCEA 1WKVA 3B70A 4GI3A 4AY5A 4E4YA 3CSDA 3U1BA 4X62B 1TQ4A 2QTLA 3EZ7A 4E5NA 3THXA 4GG1A 3ZDCA 4M8LA 4FEYA 2GPWA 3A4MA 3F7OA 3GYBA 3L1IA 3OU6A 3WKCA 4CQLB 4EYOA 1NIPA 1Q7CA 4ESOA 4FUTA 1GT6A 1KP3A 1TXGA 4GPAA 5EQTA 2D59A 1XJCA 2WEKA 1XWFA 2DFVA 3ELYA 3HB1A 4M46A 5I51A 1LBHA 1M2VB 3OT5A 5D7NA 3A1WA 2AE1A 3OF2A 4LHEA 4U7DA 4B6EA 4ABTA 2VHXA 3VC3A 1MH9A 3DT8A 5CAEB 3KL4A 2ZYGA 3QPDA 3BGVA 2JJQA 1P6XA 2WD7A 1YI0A 3E2IA 1JYEA 1CEXA 4IJKA 521PA 1RQGA 2IL1A 3UJAA 2G28A 9GPBA 2CMHA 3DDCA 3VJMA 2I62A 4X9XA 1P3Y1 4L16A 4UDNA 4ENVA 1NXSA 3MUOA 3VR0A 2NAPA 2O7NA 2Z56A 1J8YF 5DHQA 3WQBA 3HHPA 2L82A 4CEHA 1NUUA 1WA5A 2X0KA 3LUPA 2RH4A 2I4RA 3CUVA 3EVEA 3MTAA 4G5RA 5B6JA 3MOSA 2Z1NA 3ZUGA 2GN0A 5FUQA 5TGZA 3WJ2A 1N78A 1OLUA 2GXSA 2GAAA 1S8NA 2J0EA 3PQDA 1MOPA 4I4TF 3Q3VA 4EEKA 3DCJA 4XFJA 3RPEA 3ZVMA 5M04A 1P5RA 1XA0A 1R4AA 5KJEA 1H3EA 1A9PA 2OWDA 4M9RA 2LRHA 4ZRNA 2VSYA 4IINA 3RYIA 3HP7A 4P7KA 4X5OA 4DJAA 4RMIA 3KSZO 3L4JA 5G4KA 5I47A 1IHYA 1WG8A 4B4VA 5KNBD 1ZW1A 2ZT7A 1JLRA 3DOEA 1KFEB 4K1LA 3T4UA 1XFAA 3H84A 4IMIB 2AZXA 1LLDA 5KUTA 4KLRA 2QTMA 1ORVA 3GVIA 4LJ7A 3NM6B 4GC9A 5K2OA 1SGWA 3IP3A 4GR4A 5TPWA 4F5WA 5B7NA 3QFFA 1R1DA 5EHXA 2FWBA 1JKXA 2E0IA 1E5DA 1KJWA 2HGSA 2N75A 2P9EA 3C8UA 3OZWA 4I8XA 4BVGA 5EKDA 3UBTA 4TYMA 4RADA 1BMTA 3ZWKA 1JLSA 1Z7BA 3M8KA 3OF5A 2H5JA 1NL3A 1V96A 4J4BA 3N8HA 4EJ0A 4HBGA 2XT9A 1HE2A 3BSWA 4JXXA 1VL1A 5L40A 2X8AA 5A9RA 4ND6A 4UNNA 3B8EA 3E3MA 4RY9A 3VVCA 4YMUA 1M9NA 3I28A 1I2AA 1M34A 2CXQA 2FW6A 5JPCA 5HILA 1OYVA 2C9YA 4K0RA 5KQSA 4FR5A 5F2EA 3I52A 3CO0S 4JLOA 3RBZA 4JK3A 3C3KA 3GLTA 2YHIA 2JHPA 4AP5A 2AE2A 3L1JA 4P7FA 4OBWA 4EGCB 1IATA 2INGX 3HFGA 4H60A 3WZLA 5KYTA 2WNSA 3GRRA 2BDEA 3X43A 1HOXA 1ICIA 4HRXA 3LW7A 2IPNA 2AL7A 8MHTA 3TTSA 4OX9B 3SIRA 1T9HA 4LHWA 3KU4A 4LXUA 3RSCA 5JW6A 1CS4C 2C0QA 3OZIA 3OE7D 2EQBA 4UCXA 1F2DA 1LPPA 4ZVSA 3PKJA 4TVBA 1OTHA 2C59A 2HTEA 4M2LA 3RK1A 4HDSA 5BO5A 3H5OA 4QU8A 3G1WA 1XAJA 1K89A 2IBMA 3ZWMA 4TVKA 3EDYA 4HUJA 2II6A 4A1FA 2JFWA 5EUQB 3HCPA 1VGQA 4FS3A 2FPGA 3VZRA 4QXPA 1Q19A 3ET4A 4BV9A 3QXCA 4IEEA 1Y0BA 2HRZA 2DY0A 3B52X 4DLYA 1TUBB 1RI5A 1WABA 5A0VA 2ODNA 2I3AA 5ER9A 1R16A 1W9HA 3VHXB 3E4CA 5EEGA 5JXHA 4R51A 1AT1A 2HTFA 2QMZA 4P4TA 1GNQA 3OTWA 5IYZA 2ERYA 4ZO7A 3HY3A 4QUAA 2Z9CA 1QCCA 4BBAA 2EC5A 3N6RA 3CX6A 2WE7A 2CDBA 3QMWA 5LB4A 3UG6A 4LWQA 4ZICA 5A4JA 5JO0A 3ONWA 3NPMA 4IPTA 3O8BA 3WLHA 2AT1A 4PSDA 2FF5A 2RGNA 3BXZA 4K40A 1B00A 1IUOA 2ZBRA 3LZ6A 4RIGA 2A33A 1KDZA 3WSWA 1UMCA 2JIBA 3KNZA 4D81A 5EXDA 1UBSB 3C3CA 5E4TA 3ZHRA 1KI1A 1G5FA 5KDOA 2W43A 1TPYA 1B2LA 1W94A 1FFCA 1FDOA 2PSEA 2SICE 4HYEA 1ZL0A 4ZAZA 1QTQA 1SBNE 3JQ9C 5K45A 5HIJA 2CE2X 2R2AA 4CQNA 4XTRA 3T8YA 1GG9A 3BF7A 3AVTA 2NQTA 4J2TA 1H69A 1HRKA 4N65A 4OHYA 3G89A 2O0KA 3D31A 1MTZA 2HV9A 3DC2A 3WJAA 1JSXA 3ASUA 3UGQA 3B53X 3MPOA 1QVRA 3WYNA 1C1XB 2KMLA 4YT4A 5KNCH 3TSOA 5ALHA 1JSCA 2IVZA 2D00A 3ULKA 2HBZA 3U19A 4S3MA 4L95C 1N2GA 1U7PA 2ORYA 1TTPB 2W6CX 4DCNA 4ZV7A 5SICE 1MABB 3F8WA 3OM9A 4P1ZA 2OD7A 1O94C 1YI8A 4JU9A 4LDZA 5GIOE 4YAOA 1E4EA 1GOTA 1XNHA 4HNRA 1GCIA 4U00A 1ISHA 1JU9A 3TDMA 2XUDA 3TBFA 5H9WA 1ZH2A 4RD4A 2VNJA 1VPEA 5AW9A 4ZAGA 1E69A 2Q3MA 4X24A 5FQNA 2E4VA 5JZMA 4OU5A 1TC1A 4DRYA 3AKZA 1Z7YA 1ZKDA 1GTRA 3SU8A 4OH1A 2WHPB 3BE4A 1U1FA 5EZSA 1RQXA 4TTJA 1F8GA 4D4HA 4TS3A 3DV2A 4GOKA 1BGXT 1P72A 4I3HA 1XQXA 4TQAA 3HLYA 1A96A 3P1JA 1G0NA 2X1HA 3T38A 4XCQA 1YB5A 2E4WA 1QGDA 5LQUA 3MINA 5HJ7A 3DXXA 1XU7A 1P1IA 5I8ZA 2O7VA 3C5CA 1YUBA 4PM4A 1SU4A 1BMFD 2P9TA 1VMIA 2C2BA 3IDSA 4P4NA 2XNSA 4ZGGA 3A9WA 3CCCA 4EJSB 1FDWA 3CN9A 3G3EA 2E1PA 4P9NA 1RQNA 4DV6B 4BX3A 4XI9A 3E9QA 2ZUBA 3K0BA 1GN9A 2K6GA 4Q66C 5MF6A 1QP4A 3ZHOA 2CXTA 4HAOA 4L5AA 4DV5B 2ANCA 2HFKA 3X44A 2PKEA 4GPD1 1LPNA 3FFWA 4YCCA 3GGOA 3ODPA 4G07A 4KQ2A 4BMCA 3I6IA 5AK5A 4NMWA 1Y82A 4UAJA 4B34A 3WO0A 2FUNB 2PZAA 1YK0A 3DEJA 2XSZA 3GLHE 1RP7A 3A6FA 5HHTA 2C96A 4GRAA 4MA5A 2QMOA 4R31A 5DI3B 3ZD7A 3DPIA 3HA5A 1M73E 2QB5A 7ABPA 4LFAB 4LHYA 4AY3A 5C1PA 3L0OA 1BVYF 3L18A 4URVR 1Q3HA 1U9IA 4OGWA 5LMNB 5IDXA 1ZJ5A 1E6UA 3IT1A 1RC0A 2AFIE 1FXWF 1MMFB 1GDHA 1NJ2A 2QG6A 3ANNA 3K1YA 1OAOA 1LV7A 5FADA 4A0FA 3COSA 4FDLA 1ELOA 2JA2A 1BNCA 3N87A 4TWZA 1ADCA 2FXVA 5C5IA 3KPYA 1FMTA 1E2GA 4Q6BA 3HCCA 1MO2A 2P4HX 4EY6A 3A1EA 3KPUA 2O2XA 3GFFA 2WSYB 3ZLVA 3CPHA 3C41J 4YP5A 2P1RA 2VK1A 4WKPA 4LJ6A 1SZJG 4FYPA 4PPGA 5L3QA 2ZJYA 4Z2AA 1OKKA 1OHHD 3SJUA 2IYVA 4RPKA 1CQPA 2JFYA 4YCBA 4AI6A 2H06A 3QLUA 3D4BA 3P9IA 1YD7A 2R6HA 2PUBA 4QOHA 5EPOA 1ZVVA 1RM0A 3GRFA 4ND4A 5BN5B 5ICSA 4GKKB 3GP3A 3I9MA 3DMHA 3ER8A 3TFWA 1U2TA 2AZDA 2RC5A 2WY2D 3ZYZA 1OROA 1XQ1A 1PWZA 1FMJA 3UMVA 5BWOA 3LOUA 4FHEA 1TZMA 1YIAA 5CH8A 2FVYA 1ZLYA 3L8CA 2F64A 4B17A 3QU5A 2CK3D 3OX1A 4J9VA 4BYMA 5TS2A 2BM1A 3M9LA 1TPZA 2EKBA 4H3VA 5CVJA 3PWTA 1KE1A 5KVVA 4FGKA 1U28C 3DZJA 3QPUA 3F7TA 3JWPA 1F2UA 4XXHA 4ZREA 2P4EA 1YC5A 4FDMA 4FGWA 4ZDJA 2CL6X 1ZUWA 1LVUA 4N39A 3AVPA 3UEOA 2GD2A 1SKMA 4B84A 1NBMD 1W9MA 3SZLA 1NC1A 1F8YA 1MQ8B 2V7WA 2X9GA 3OJWA 1ORWA 3C24A 4O6VA 2VJKA 3EGXA 4FOOA 5GGXA 4DGSA 4K86A 1F2TA 4RVFA 4ZPXA 5ANRB 4PTYA 5EIEA 1GSHA 2GJ8A 4L27A 3N58A 1IONA 3NEYA 4Q3LA 3EWAA 2V4UA 1HMPA 4G5QA 1PJ3A 1FU4A 3DGEC 3A05A 3I5UA 3Q9LA 4BVEA 5GZ3A 4C0HA 4YP6A 4OHZA 3FYUA 1Z7GA 2D62A 2WAXA 4TWRA 3RB8A 4BMZA 3NHLA 1P2BA 4AXBA 4B45A 4B87A 1YDMA 5DLYA 1X1RA 1LS1A 3BD6A 3II6X 3U49A 1F0KA 1GYRA 1KYQA 2JCBA 5GVSA 1G38A 1H2EA 1NF9A 2OK8A 3CNOA 5AK3A 4ZXFA 2CT8A 2COUA 3AF5A 4KPFC 1CUVA 3DKRA 5IABA 1IY2A 1THTA 4RXTA 5ALOA 2C3OA 5DTEA 1C7ZA 2X2OA 5F4BA 4HLUC 2GQ0A 5K0NA 3RDPA 2O0HA 2PZ8A 2WU4A 2YR0A 1BWPA 5EWJA 4HDNA 3KSMA 4MARA 4NU8X 3BD9A 4YAWA 4CG1A 5CFLA 3U7HB 3ORYA 1J5PA 1GQSA 5FP0A 1K06A 4CUKA 5KNLA 3ZV5A 1YOBA 1M1YB 2AC2A 2C5EA 3BDIA 3CNBA 3FMPB 3G85A 3MCTA 5E7MA 4AN0A 3O4FA 4LNAA 5ERGB 5LLSA 1SKAA 1WUJS 3REOA 4B7ZA 5ELXA 1PFGA 2CJWB 1RWWA 4K8RB 2JKZA 3KZ1E 1FLNA 1NWHA 1VHQA 1JNXX 1T10A 4RD1A 4Y7DA 5TT0A 3RFCA 3ESCA 4LJRA 1W4ZA 3P9NA 1C8BA 3VTZA 3PLAE 2DBQA 3UFXB 1VMKA 3AHGA 3QMVA 1QRAA 2J45A 1V16A 2J85A 3F6YA 5AFSA 3NHYA 5M2QA 3PKZA 1UODA 5DSXA 4EJ6A 3VHQA 3D8SA 4ARIA 3GROA 4GAEA 5J1SB 2VQSA 3F4BA 4J29A 4WZZA 1AG9A 5DEOA 3WGQA 2AEJA 2FCAA 2PZEA 4BLVA 3OSUA 4PYQA 1KK0A 5K99A 1Q15A 1M6VA 2DKFA 1W36B 4I2VA 1SG9A 3K5PA 1NW4A 4ZK6A 1JWAB 4RLHA 3QG1A 1JT9A 2H1FA 4UZEA 4B32A 1XR3A 1YKSA 2Z8YA 2F7SA 1O6CA 3IOEA 1UDBA 4R9UC 5F78A 3W2IA 3S2SA 3PUZA 4QLBA 1NVEA 4NZZA 2HT1A 2E2WA 4V0QA 4X95A 5A71A 3LUFA 1U9ZA 3KJZA 4JQZA 4KXUA 4PLVA 3JCZA 5AK4A 4CBVA 2BSAA 2DPLA 3FUVA 1U0GA 2H1IA 4R3NA 1CY1A 1T0BA 2ASVA 4EK9A 1IVSA 3T1QA 3NORA 1AQNA 2Y1KA 2G80A 5DNEA 2WI8A 5L3VA 4NBRA 1AKVA 4Z4EA 4N7MA 1XVLA 3OG9A 3M0EA 5FNVA 4CKEB 4OLJA 5KTKA 2C5FA 2A92A 1PFYA 2PMBA 2BF7A 2D0PB 1N9GB 1CY6A 2BR3A 1PIWA 2DU8A 2QX9A 4OXYA 3KDPA 3OCXA 1IK6A 2HMTA 3DLCA 4UHJA 5IUNC 1J8FA 2Y1DA 1IN5A 2B61A 1NVFA 3G2KA 3B6KA 2AMFA 5DCYA 5KNCA 1XYVA 2QS9A 1SUBA 2AR7A 1U7TA 1GKUB 1ZIYA 3C6MA 4M8SA 1RCFA 1VYVA 1UEIA 5EIFA 2VJAA 2VP2A 1SC3A 5AW6A 3RRFA 1ECFA 1WPRA 3V1KA 3T7DA 4A2PA 4MI3A 4F56A 4M54A 2J4FA 4OEHA 3VM6A 4YJGA 1HG0A 1DE0A 1WVGA 2XTNA 4JL6A 1N7JA 4WNAB 5NULA 4LPSA 1DO8A 2PZKA 4B0PA 3M1IA 4O4IB 2QRHA 4EFLA 5I7RA 4O2BB 4U8GA 2Z08A 1ZQ9A 3PNOA 5AOCA 3RM3A 4W82A 3MTJA 3F6RA 1HLGA 1VBKA 3NFYA 3ZK9A 4FM9A 3GRYA 4G1MB 4NQRA 3TCKA 2JFVA 1QYRA 4EUEA 4KCGA 4DUGD 2W2QA 1J8QA 1WHTB 2CCGA 3OHMA 2FSSA 1E66A 1X94A 3CH7A 3OZDA 4BVAA 1JHDA 3KQHA 1PYOA 2OFFA 1O87A 3EH2A 4QUDA 4Q1DA 3RRBA 2UVPB 4FOLA 1DIBA 2QLBA 3I1JA 1U2SA 4I3GA 3BGSA 1NRJB 4JSTA 1R88A 3LVFO 4GXNA 1TJ5A 4UFOA 1N2CE 2GBFA 3R6WA 3SX0A 3AKDA 2BMAA 3MJVA 4HDMA 2CUNA 1B8PA 4GPTA 1RPTA 4I5IA 2EP7A 2J59A 4Z8YA 1U5CA 1E77A 1GQQA 4LS3A 3SS7X 1O6BA 1XQVA 4K26A 3O1JC 5JE8A 3WE7A 3PDHA 2AN9A 5KYYB 1TECE 1YBVA 2WZBA 2R8BA 2E85A 1YWGO 4UFNA 2RGGA 4Q7KA 3C16C 3O4HA 4B43A 3LHDA 1DIOB 4DMCA 1U5BB 2B9VA 1FYFA 4KVAA 4EFKA 1N0WA 4XD2A 3K1JA 4BVLA 3TXYA 1G3RA 3ZGZA 4I6EA 2G63A 4GOJA 1HF3A 4OQDA 4JKOA 3W8DA 4DMLA 4FZ5A 4EY4A 3EF1A 4ZJYA 4F12A 3U1VA 1OV4A 3AHFA 2UV8A 2OHOA 3F71A 3WBBA 5ADVA 2J48A 2BELA 2NNWB 4LRSB 3UHJA 4JT8A 1S4QA 3TX6A 1KWGA 3CLSC 3JZDA 1J4AA 2WPDA 3AB7A 3PXUA 4JUDX 2F3TA 4Q0MA 5FEMA 3VR5A 4KXVA 2JLZA 3GDFA 1HI9A 3F97A 3B60A 2BBTA 4TV8A 2EGUA 4M1YA 1OH5A 3B1FA 1LUAA 4L5YA 1NAHA 2F43B 4TUYB 5ALFA 3OLXA 5EGSA 4DWVA 721PA 2BEVB 4GUDA 1TDJA 1MOZA 1YB7A 3RR2A 1NDHA 2GX6A 1RKVA 5K3OA 1ETUA 1YRYE 2CE7A 2BBSA 2FHSA 4MJ3A 1K5PA 1THMA 4NENA 2HDOA 3BRWD 3C8ZA 4KSCA 3EDQA 5CXSA 5IEBA 1KQPA 1MENA 3DE4X 2YWRA 2PH7A 2V3VA 4EVRA 4HYYA 4TWAA 2CHUA 3RRNA 4HEHA 5FT9A 1MB9A 3AFHA 1XNGA 3CG0A 1FFXA 4L7VA 2SKCA 1PJRA 5JSZB 5JCZA 3T1YB 2QN6A 1CJVC 5LCXA 3F4LA 1DX6A 3H2IA 3V2HA 1HR0B 3BIXA 1RCTE 1MJHA 3UAXA 3LSYA 3EHDA 3DOUA 1UBNA 4XWTA 3B6ZA 2PKQO 5AVRA 3EWNA 3LF1A 2CUTA 2CNWA 3EFHA 1G1AA 3LH5A 3V2UA 1Z15A 3LCVB 1ZISA 5JAMA 3P9RA 3R0QA 2HHCA 3OMWA 5C5CA 3GRPA 1SQSA 1K8QA 2FMIA 2WG2A 2G70A 5AXBA 5COBA 5K3SA 1NY6A 2W8ZA 1FQJA 4O4IF 1YRHA 4HVTA 5DHSA 3FBGA 3ZCTA 3T5TA 4O2BF 5F35A 4DYVA 1P73A 2QUHA 3S2IA 5EYPA 1MA0A 1IBSA 5E4JA 3V7UA 5K0TA 4Z4GA 5CYOA 4NESA 1B73A 1CUFA 3R4CA 1VG9B 3OE5A 3OQBA 3PPWA 4LY9A 3G5UA 4M7WA 4TLDA 2R96A 2PWBA 4HV4A 1A5TA 2EDCA 3GRZA 2XRFA 2NO5A 3ENVA 4TLBA 4WZBA 3GVPA 4F2GA 3I2HA 1XL1A 4EKYA 1LRLA 1IOLA 1CF9A 1QRTA 1GLNA 1KOFA 3FTNA 3N2NA 4MQ6A 1W1IA 3SE0A 1E3QA 3VPHA 2H63A 3RC9A 4EBBA 4YRAA 3L7BA 1V9SA 3OQMA 3PYLA 3TSYA 3DXZA 3M2TA 4RAQA 1S01A 4QJ3A 5BSEA 2D3WA 4IYJA 1L5MA 5ILGA 4ASUD 2NXWA 2RONA 2ZULA 2QL5A 1DAPA 3A58B 3GZNA 3NNSA 4CQMA 1Z33A 2OBXA 4CTMA 1SUEA 2BZ1A 4QHSA 3UKOA 2Z0MA 1AF7A 2BHTA 2FB9A 3UKJA 5BN1A 3LQ2A 4U2FA 4A36A 1RWKA 1YE5A 2BBOA 2BGLA 3BWXA 4BBPA 4XSGA 4DE5A 1I1QB 1YNOA 3KTDA 1S8AA 4DCVA 4ILKA 1CQJB 1DNPA 3L92A 1ZH6A 2NVUA 4N5NA 3ZNQA 1VMAA 2HF7A 1CRLA 2HQRA 3C7AA 2PL5A 1DUVG 3ACBA 3CEHA 3K0CA 2BTQA 3T3HA 3C7TA 3AOEC 1MPXA 4RK6A 5KPJA 4RIIA 3FDXA 2G17A 4OMFG 1TGVA 5MN4A 4DEXA 3FLAA 3TE7A 3N0VA 2GUGA 3HJFA 4KQMA 3ZDXB 2FVXA 4EMBA 2WYVA 1NNUA 3B3QA 3RSHA 4FDTA 2NU9A 4GGMX 5CB4B 2Q8NA 2C1EA 1B6SA 3DNMA 3MPUA 3OECA 1FTNA 1KBOA 1ZKMA 5HZMA 4HXFB 1IQUA 1I7PA 2VL7A 4YMIA 1DI0A 1CZKA 1DRUA 5JJLA 3ROZA 1G4HA 4TUYF 4BATA 4BE9A 3TLXA 1SQ6A 3OCCA 5IZ4A 3JQBA 1B41A 5H70A 4EW6A 1TRHA 1JDZA 1P80A 1U1CA 4DR5B 1R15A 2Z6VA 2C03A 3W78A 1IJFA 4JJGA 3HMKA 1A9RA 5AJZA 5ALTA 5TVGA 4H7FA 3E0QA 3QV1A 1O03A 2YWGA 2JKVA 3NKLA 4WXRA 1PJ4A 4BO9A 1PEDA 2UYQA 1QO9A 4E13A 4IQGA 3BULA 5AP9A 1EXNA 4TXMA 4ZU6X 3RFXA 4C7JA 1GYQA 3FCOA 3L6DA 4RSMA 1VLZA 1EWQA 4RHYA 3Q1LA 4FFRA 1EP9A 2DPMA 3VR6D 5L4LA 3HC7A 1YRQA 4MPPA 1DBWA 1E2LA 1P39A 1ZUNB 2D5AA 1Y9EA 3QTLA 1A7UA 4XX0B 3HB0A 5ARBA 3MWEB 1IHUA 4CFZA 1ESMA 1CKEA 1RJEA 3ZJ5A 3D4IA 2WIDA 4BMPB 4RMNA 4XD7A 1B1AA 2WIFA 3D6VA 4LV8B 4KAXA 4PG5A 3E35A 3ZE0B 4R9NA 3ER6A 5DHFA 2QBYB 2X14A 1H2HA 3CWZA 3DDWA 4FNAA 3U3DA 3U31A 3HWWA 3PYMA 4XYEA 5ALMA 1P44A 4DDUA 5A7GA 4WA7A 5FFMA 2RGWA 4PAMA 1MZPA 5LP6A 1ZJZA 3I12A 2Q0HA 4MV6A 2IIBA 2XECA 2QAIA 2VQFB 3M4NA 4OL0A 1KEPA 2GNOA 1RMQA 2CXNA 4GBGA 2Z5VA 3PIDA 3AVQA 1PE0A 5LWQA 1KYTA 5JJ5A 3WLQA 1N7HA 4QYWA 1K7EB 3FGOA 5BSMA 1Q0HA 2O2YA 2WUDA 3KEFA 3QF4B 3UTCA 3DZIA 7MHTA 3U4DA 4CV1A 2OWEA 5C5EA 2F1RA 3NC0C 3WBKA 3KYDB 3TB4A 3DB1A 2D1QA 1UP4A 4PGGA 3RUAA 5GJWC 1G7RA 2ZRIA 5HJ2A 4DN6A 4KRGA 2DBZA 4LRYA 2VJLA 2OXTA 2ZJOA 3Q7TA 3S1SA 1U1EA 1WZNA 4DDWA 1WAMA 3MTEA 3PZBA 3I01A 4NOJA 2Z2KA 2AOVA 4NY1A 1UPBA 2XHEA 2ID4A 3BJZA 3TYXA 5E6UB 4NZNA 2ZBPA 4II3A 3Q8LA 4ZPJA 3TFOA 3E0XA 4PICA 2O7QA 4JAVC 1W4CA 2IYWA 5J4HA 1QRRA 4C87A 3E48A 2VHYA 3HCRA 3OLQA 4OJKA 1CQXA 1TJYA 2PSSA 4I5DA 1IWPB 1WRBA 4GXRA 3FLBA 3HGTA 4UUAA 3ZCXA 5DCWA 4ARZA 4ZAXA 1JF8A 2F9MA 4JC5A 4WFIA 3EY4A 2C58A 3EXEA 2ZVPX 1RQPA 3FUCA 3KJFA 1KJNA 3EEFA 2QUAA 1GGFA 4DCGA 5BN3B 1KP9A 1JKFA 4RWEA 4M98A 4LWZA 2EBHX 2HO4A 1OY1A 3LNTA 2QQGA 5CXXA 2JFOA 4Y2JA 4HLNA 5CB4F 1KF0A 4JDPA 1IM8A 2IYLD 3ZDYB 1KNXA 3RUCA 1JFFA 2J3DA 3PWSA 4XOUA 1JLKA 3PUYA 4RDCA 4OLAA 1U8TA 3T06B 1IUNA 1IK4A 3C85A 1A9SA 4QYXA 3SN6A 3STWA 1Z5VA 2WWIA 1YONA 1RAGA 2AFVA 4EUHA 2JFBA 1ECBA 4R4JA 1G8AA 1GVNB 2AOUB 5BORA 1T2NA 4BJ5A 4DNQA 1PD1A 1CF2O 2GGSA 2C83A 2VJQA 4ROSA 4A4DA 4C2UA 3QA3E 3I4LA 1DC8A 1JFSA 1GZHB 3LA6A 1VYTA 3CSUA 2G36A 3JWHA 3BD7A 5BR4A 1UP6A 2QTGA 4W7SA 3I62A 4X1YA 1U2QA 3AZQA 2F3UA 4QSMA 2E4AA 4YH1A 4Y0VA 3WGJA 5LMCA 3ETLA 1O94D 2BR5A 4ZFNA 3Q7RA 4NYMR 1VG1A 3UUGA 1E1NA 5CYPA 1V1MB 3H9CA 4YRBA 1GPYA 1V39A 3K70B 2NX2A 2GPNA 1KI9A 2RKWA 3BQNB 3JX9A 3OOJA 4DMFA 1MAUA 2ZEJA 3QVGA 1ILEA 5EE3A 2O2IA 2HQSA 3SC3A 4YJ3A 2J9ZB 3HWSA 5KKAA 1ATIA 4AJKA 4B4WA 4MNTA 3NHKA 1EQ2A 1VCHA 3MF4A 4Q4JA 2EFHB 5EHGA 2FW9A 4PXYA 5IAAA 4KITB 4JYAB 1HOTA 4QL3A 2UU9B 5MN5A 4Q01A 2Y27A 1FFYA 4MJLA 4CM8A 2A2ZA 4IGAA 2PVCA 4G89A 3E1GA 1U8FO 3TRDA 3UB4A 3ZV6A 1QIMA 4URXR 3M6VA 3D64A 2XLCA 3O8LA 5EWMB 4ALMA 3O95A 1FK8A 1RC1A 3ZE9A 3VPFA 1VJ5A 3VU8A 4D9KA 1JEDA 5T57A 2H2FA 2Z2ZA 3JQ6A 4HYTA 4DFDA 1XYGA 1DEAA 1AKEA 5HRCA 1Q1AA 3PR3A 2QTWB 4Z0PA 1I6KA 4TTSA 3NOOA 1V3TA 4QASA 4QE3A 2LCIA 1R6TA 2ZU6A 4YT2A 3V7FA 4D8YA 5SYMA 3WYDA 4AROA 4HQ6A 3RYCA 3R6DA 4G0YA 2BDTA 3V7WA 3O6VA 3TQFA 5A7HA 3W6OA 6Q21A 2C31A 2POQX 5IZCA 5LMUB 2ZB3A 4JCOA 4K9DA 1KY4A 3MWYW 2CDNA 3NP9A 3AL3A 2O8DB 2OZKA 3SNHA 5LQAA 3DFKA 3CISA 2ZJ0A 2BFCA 3WKDA 3CVXA 3N86A 2CKMA 1EG2A 2I6UA 1E1MA 4D9MA 3QX7A 2O0MA 1SVNA 2CBGA 2PT6A 1JG6A 3VR2A 3ESAA 5C7LO 2QT9A 4R6WA 3CLHA 4NE2A 4UHEA 2VIIA 1E9CA 1E3WA 1LU9A 1X9HA 3H9EO 2XVMA 3FPCA 4D80A 3BHNA 4MUAA 1DAFA 1NFRA 2BKLA 3BIFA 2J32A 3GDOA 4Q9HA 3QVJA 1KQNA 1K66A 5CEFA 2F55A 1QF9A 1QHEA 2Q5HA 3V32A 3OZCA 4RA9B 1W19A 4DIDA 4UTZA 4MX8A 1H5QA 1QS0B 3FNHA 3ZVRA 2ES4A 5DP2A 2F59A 4F3YA 1FJ2A 4FLFA 3NH6A 3DVQX 3UNXA 4AJ9A 4DLSA 1ULTA 2C1XA 2W2VA 1RYYA 1H2FA 1V5FA 3NEPX 4PAGA 5BPFA 1OUMA 1QOPB 5JXJA 4HFRA 4MHTA 1FSFA 5C1BA 2ZR8A 3TZLA 1ZM3A 3TEMA 4BGEA 4R0VA 4B7AA 1SCKA 3HFRA 2WE8A 3DEYX 3KXPA 4YVFA 4ZEMA 1XQ6A 1IN6A 1GGHA 1ZK1A 2NTNA 1Z4KA 1U8EA 3B6EA 1EE1A 1H0HA 4Y18A 5BYJA 4PG8A 4NYIQ 4BY9E 5CB6A 4MW9A 1ZG3A 5FI0B 4H6PA 5JU6A 5BMVB 2FWMX 1E5QA 4CMCA 3VSEA 3KG2A 1BMQA 2GWHA 4L85A 1X14A 4PR3A 1SIBE 4POAA 3WMRA 3KBBA 4BNYA 1XJWA 1T4CB 4OJQA 1RKQA 4FMDB 4N3CA 4U0JA 5CDFE 4GI1A 1UXOA 1THGA 1U1IA 3ORRA 2G9ZA 3Q5GA 2O8FB 2HEGA 4MEAA 3V1NA 3Q7PA 4EA8A 2IFTA 3UC5A 2ADOA 2I1QA 1WF3A 1M6EX 2QD3A 3NAZA 3QLVC 2PGIA 5FYDA 3GLGA 2H1LA 3HACA 4V24A 1QK3A 4FGLA 4V1CI 1AS3A 2OZVA 3I8XA 1YA4A 2O8BA 1RRMA 5FLEX 3VPBA 1COZA 1VG8A 4ZI5A 4ZVNA 5AW5A 1Z38A 2YOGA 4B47A 4CV0A 1IB6A 3ILYA 5JBQA 1XMVA 1Z4PX 1XT6A 5C7IO 3K6KA 1ABFA 4G23A 3I83A 5TQ2A 1RKBA 5D8DA 4RFVA 2Z58A 4OMUA 2GEJA 3ZCUA 1Q92A 2NU7B 5HF8A 3EH1A 1T25A 4X54A 3RAPR 5CLJA 1P1CA 5K8IA 4TXLA 1DKRA 2NPFA 2G76A 1ZOIA 2G5PA 3OD5A 5A4IS 3IAM1 4OFXA 2MT9A 2XYVA 5CT4A 1YA6A 3U9LA 2F3SA 1GPBA 1IXKA 5TDHA 2V7XA 4WKGA 4D02A 1QP8A 2G8LA 2P40A 1H5UA 4XYGA 2RHCA 3PNBA 4HGZA 4AJOA 3P2OA 1UBLS 2YHBA 3Q9SA 4FPXA 1JILA 2FSUA 2HCTA 2J3JA 4YP0A 5IVDA 2JJ2D 4P84A 1E3EA 3DDNA 4K81B 5A4KA 2P9BA 3ZGNA 5JEDA 1C7RA 3AJDA 1SVUA 1W5FA 4ZVLA 3QNMA 1PL6A 3NANA 4M99A 4A92A 1EUCA 4DYDA 2PS9A 1KIFA 3PT9A 4IXMA 2J0SA 4OAQA 2PR7A 1P2SA 3CB4A 4I50B 1E1YA 2R8YA 2RHDA 3NTVA 5EOVA 5EVCA 4G86A 4I5GA 3OZBA 3VU3A 1FJHA 2QW0X 1AURA 2I71A 2BI7A 1I8TA 1N2SA 2PUJA 3EQ2A 2VPZA 1T2VA 3CX8A 4HP8A 4HXYA 2PX4A 2C3UA 4REMA 3H3FA 3SDBA 3TZBA 2JCSA 2X9VA 5DP1A 1NVBA 5L53A 1KZHA 2OXEA 2XGGA 1JQJC 2VHEA 4B3HA 4EL5A 3VHRA 4ZC1A 4FGZA 5AYVA 3UJDA 3ZHBA 4U6QA 3GGSA 3MMZA 4QSHA 5ENDA 3AJ8A 2EWVA 3N0TA 4XWGA 1I6WA 2WTXA 2A1TR 5JHHB 4V1CA 5K0EA 1F7VA 3LKDA 2WB2A 1C4WA 2QU7A 4DZRA 3H4IA 1A1SA 3GH3A 5KQRA 4JBHA 1WMEA 4MGKR 4TKLA 5A4MS 1H1LB 1CS0B 3WV4A 1IEXA 3VSDA 1OI4A 4W9MC 4DLTA 1JHZA 4CT4B 3R8XA 3MT0A 2AMYA 1SB8A 2O06A 2WF5A 2G9RA 3HBJA 3ENWA 3PJFA 4IVRA 1NASA 1JG4A 3DV0B 1U3UA 2PTHA 2QTAA 1JE0A 3I6YA 3HUFA 4KVGA 4QREA 4Z0HO 3R74A 4HNTA 4M0LA 4AQYB 5A9SA 1FTGA 3A06A 1NVXQ 1WP9A 4IR7A 5BMVF 2FQWA 2CVFA 3DFUA 4FT4A 5H5JA 4ZMBA 2PIDA 4LGMA 1J9ZA 4R2IA 3TLGA 5L4SA 3R9IA 2ZGVA 1XF1A 1DDOA 1Y98A 4PIPA 4Q1VA 5CX1B 4FMDF 4D3DA 4ZZ3A 1XMQB 4P32A 5EL0A 2FPPB 2ECPA 2HA3A 1DZ3A 4A03A 1OX4B 4K1XA 2X1VA 4UUPA 1T6BY 3UWDA 1TZKA 4U7JA 1T6XA 3T1VA 1KOJA 1G8GA 1DBQA 2WTBA 4I1RA 2GCOB 4J1TA 4QFBA 4RUKA 1IEQA 2HZ7A 2BLLA 3E9CA 4M6WB 3H05A 3WNQA 4BTVA 3MAGA 5L95A 1JIKA 1H8HA 2QMEA 4C4OA 4IJMA 1T13A 1SXJE 4JGIA 3U3MA 2VDMB 3I2YX 1RVDA 3UJPA 3LHSA 2LDBA 3TSWA 1I6LA 1N1DA 1OAKA 2BHSA 2HA4A 1XVUA 2Q62A 3ZTWA 3OF3A 5AVTA 3I2JA 1LDYA 1JEYB 2FQXA 1C0PA 3HV2A 1UIRA 2H8GA 1EBUA 1L6RA 1X70A 3AI7A 2R48A 3GLHB 5ALPA 1SUWA 4PEVA 5AQEA 1GILA 3S55A 5JLJA 4DTIA 2CNDA 4N6OA 3LUDA 3TD2A 1QUEA 4TYWA 2XUKA 3OIYA 4QU9A 1Q7BA 2XMSA 3K72B 3PB3A 4NU0A 1I32A 5FFNA 4GWLA 3PNSA 5CM9C 1QSGA 4P2BA 1FLVA 4V39A 2X0EA 3ABIA 1U0SY 4K6MA 4OMDA 3EXFB 3PZRA 4EO4A 1CJMA 1GNTA 1QIFA 2AFIB 2RHGB 1UJCA 2ZSFA 3FETA 3IA7A 1BXGA 4G5XA 4WE3A 5DHTA 1AHIA 4HN4B 3WHKA 4DCTA 5FOXA 4CODB 1MJGA 2YWFA 4HG2A 1WHSA 4X92A 3UMSA 2YY5A 1IZ0A 5J2TF 4CLOA 1QNLA